BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19982_g2_i1 len=437 path=[415:0-69 485:70-114 530:115-436]

Length=437
                                                                      Score     E

ref|XP_008798890.1|  PREDICTED: pathogenesis-related protein PR-1...    135   7e-37   
ref|XP_010943450.1|  PREDICTED: pathogenesis-related protein PR-1...    129   2e-34   
ref|XP_011002601.1|  PREDICTED: pathogenesis-related protein 1-like     120   3e-31   
gb|AEM36335.1|  pathogenesis-related protein                            119   2e-30   
ref|XP_004955414.1|  PREDICTED: pathogenesis-related protein 1-like     119   2e-30   
gb|ABK94784.1|  unknown                                                 118   2e-30   Populus trichocarpa [western balsam poplar]
gb|AEH25622.1|  pathogenesis-related protein 1-7                        118   3e-30   
emb|CDO97325.1|  unnamed protein product                                118   3e-30   
ref|XP_002273788.2|  PREDICTED: pathogenesis-related protein 1          119   3e-30   Vitis vinifera
gb|EAZ02649.1|  hypothetical protein OsI_24760                          117   5e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_006379156.1|  pathogenesis-related family protein                117   6e-30   
gb|EAY95187.1|  hypothetical protein OsI_17005                          116   6e-30   Oryza sativa Indica Group [Indian rice]
dbj|BAF95881.1|  putative pathogenesis-related protein 1                117   6e-30   Vitis hybrid cultivar
gb|AAQ19681.1|  cytoplasmic small heat shock protein class I            116   8e-30   Capsicum frutescens [bird pepper]
emb|CAN77102.1|  hypothetical protein VITISV_021166                     116   2e-29   Vitis vinifera
ref|NP_001058816.1|  Os07g0129300                                       115   2e-29   Oryza sativa Japonica Group [Japonica rice]
gb|AAX20041.1|  cytoplasmic small heat shock protein class I            115   2e-29   Capsicum annuum
gb|EEC81457.1|  hypothetical protein OsI_24759                          115   3e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_006657422.1|  PREDICTED: pathogenesis-related protein 1-like     116   3e-29   
emb|CAA70070.1|  PR protein                                             115   3e-29   Solanum lycopersicum
ref|XP_004246724.1|  PREDICTED: pathogenesis-related leaf protein 4     115   4e-29   
gb|EMT11012.1|  Pathogenesis-related protein PRMS                       115   5e-29   
ref|XP_004955413.1|  PREDICTED: pathogenesis-related protein 1-like     114   1e-28   
gb|AGK89727.1|  pathogenesis-related 1 protein                          114   1e-28   
emb|CDP12737.1|  unnamed protein product                                114   1e-28   
ref|XP_002313935.2|  hypothetical protein POPTR_0009s08660g             113   2e-28   Populus trichocarpa [western balsam poplar]
ref|NP_001058815.1|  Os07g0129200                                       113   2e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AAG44566.1|AF251277_1  acidic PR-1 type pathogenesis-related p...    113   2e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AFR90191.1|  pathogenesis-related protein 1a                         112   4e-28   
ref|NP_001234523.1|  pathogenesis-related leaf protein 4 precursor      112   4e-28   
emb|CAB58263.1|  pathogenesis related protein PR-1                      112   6e-28   Solanum tuberosum [potatoes]
gb|KDP37606.1|  hypothetical protein JCGZ_06949                         112   6e-28   
emb|CAD38276.1|  pathogenesis related protein isoform b1                112   7e-28   Solanum phureja [chaucha]
ref|NP_001275095.1|  pathogenesis-related protein 1b precursor          111   8e-28   
ref|NP_001234128.1|  pathogenesis-related protein 1A1 precursor         111   1e-27   
dbj|BAD11072.1|  pathogenesis-related protein 1                         111   1e-27   Capsicum chinense [bonnet pepper]
emb|CAD60273.1|  putative pathogenesis related protein 1 precursor      111   1e-27   Vitis vinifera
gb|ADN43433.1|  pathogenesis-related protein 1                          110   2e-27   
gb|AEH25624.1|  pathogenesis-related protein 1-9                        110   2e-27   
ref|XP_006345692.1|  PREDICTED: pathogenesis-related leaf protein...    110   2e-27   
gb|AHE81273.1|  pathogenesis-related protein 1-9                        110   2e-27   
gb|AHE81252.1|  pathogenesis-related protein 1-9                        110   2e-27   
ref|NP_001234314.1|  pathogenesis-related leaf protein 6 precursor      110   2e-27   
gb|AEH25634.1|  pathogenesis-related protein 1-19                       110   2e-27   
gb|KDP37604.1|  hypothetical protein JCGZ_06947                         110   2e-27   
gb|KDP37611.1|  hypothetical protein JCGZ_06954                         110   2e-27   
ref|XP_009769213.1|  PREDICTED: pathogenesis-related protein 1C         110   3e-27   
emb|CAD38277.1|  pathogenesis related protein isoform b2                110   3e-27   Solanum phureja [chaucha]
gb|AAZ94265.1|  pathogenesis-related 1a                                 110   3e-27   Triticum monococcum [einkorn wheat]
emb|CAA29023.1|  PR-1c protein                                          110   3e-27   Nicotiana tabacum [American tobacco]
ref|XP_009378591.1|  PREDICTED: pathogenesis-related leaf protein...    110   3e-27   
emb|CAA31010.1|  PR1c preprotein                                        110   3e-27   Nicotiana tabacum [American tobacco]
gb|ADN43432.1|  pathogenesis-related protein 1                          109   5e-27   
ref|XP_009787159.1|  PREDICTED: basic form of pathogenesis-relate...    110   5e-27   
ref|XP_002274371.1|  PREDICTED: basic form of pathogenesis-relate...    109   5e-27   Vitis vinifera
gb|ADN43431.1|  pathogenesis-related protein 1                          109   6e-27   
ref|XP_006368144.1|  PREDICTED: pathogenesis-related protein 1C-like    109   6e-27   
gb|AHE81259.1|  pathogenesis-related protein 1-16                       109   6e-27   
gb|AEH25631.1|  pathogenesis-related protein 1-16                       109   6e-27   
gb|AHE81280.1|  pathogenesis-related protein 1-16                       109   6e-27   
gb|EMT32398.1|  Pathogenesis-related protein PRMS                       109   8e-27   
ref|NP_001234358.1|  PR1 protein precursor                              109   8e-27   
ref|XP_010941969.1|  PREDICTED: pathogenesis-related protein PRB1...    108   9e-27   
gb|ADN43435.1|  pathogenesis-related protein 1                          108   9e-27   
ref|XP_004246723.1|  PREDICTED: pathogenesis-related leaf protein...    108   9e-27   
dbj|BAA14220.1|  PR1a protein precursor                                 108   1e-26   Nicotiana tabacum [American tobacco]
ref|XP_006367091.1|  PREDICTED: basic form of pathogenesis-relate...    109   1e-26   
ref|XP_002522065.1|  STS14 protein precursor, putative                  108   1e-26   Ricinus communis
gb|ADN43428.1|  pathogenesis-related protein 1                          108   1e-26   
gb|EMS62872.1|  Pathogenesis-related protein PRMS                       108   1e-26   
gb|KDP37607.1|  hypothetical protein JCGZ_06950                         108   1e-26   
gb|ADN43427.1|  pathogenesis-related protein 1                          108   1e-26   
gb|KDP37612.1|  hypothetical protein JCGZ_06955                         108   1e-26   
gb|AGS80328.1|  pathogenesis-related protein 1                          108   1e-26   
gb|ADN43417.1|  pathogenesis-related protein 1                          108   2e-26   
gb|ADN43436.1|  pathogenesis-related protein 1                          108   2e-26   
gb|ADN43437.1|  pathogenesis-related protein 1                          108   2e-26   
gb|ADN43419.1|  pathogenesis-related protein 1                          108   2e-26   
gb|ADN43416.1|  pathogenesis-related protein 1                          108   2e-26   
gb|ADN43415.1|  pathogenesis-related protein 1                          108   2e-26   
gb|AAK30143.1|AF348141_1  pathogenesis-related protein PR-1 precu...    108   2e-26   Capsicum annuum
ref|XP_006486820.1|  PREDICTED: pathogenesis-related protein 1-like     108   2e-26   
gb|KDP35900.1|  hypothetical protein JCGZ_09872                         107   2e-26   
gb|KDP37603.1|  hypothetical protein JCGZ_06946                         107   2e-26   
ref|XP_009610821.1|  PREDICTED: pathogenesis-related protein 1B         108   2e-26   
ref|XP_008798895.1|  PREDICTED: pathogenesis-related protein 1-like     107   3e-26   
emb|CAA29022.1|  PR-1b protein                                          107   3e-26   Nicotiana tabacum [American tobacco]
gb|ADN43434.1|  pathogenesis-related protein 1                          107   3e-26   
emb|CAA31008.1|  PR1a preprotein                                        107   3e-26   Nicotiana tabacum [American tobacco]
emb|CAA30017.1|  unnamed protein product                                107   3e-26   Nicotiana tabacum [American tobacco]
sp|P08299.1|PR1A_TOBAC  RecName: Full=Pathogenesis-related protei...    107   3e-26   Nicotiana tabacum [American tobacco]
ref|XP_002273416.1|  PREDICTED: basic form of pathogenesis-relate...    107   4e-26   Vitis vinifera
gb|AHA43767.1|  pathogenesis related protein 1 isoform 4                107   4e-26   
ref|XP_009798466.1|  PREDICTED: pathogenesis-related protein 1A         107   4e-26   
gb|ADN43418.1|  pathogenesis-related protein 1                          107   4e-26   
gb|AEL99925.1|  pathogenesis-related protein 1                          107   4e-26   
gb|AHW81904.1|  pathogenesis-related protein                            107   4e-26   
ref|XP_010245650.1|  PREDICTED: basic form of pathogenesis-relate...    107   4e-26   
ref|XP_004230669.1|  PREDICTED: pathogenesis-related leaf protein 6     107   5e-26   
ref|XP_010904557.1|  PREDICTED: pathogenesis-related protein 1-like     107   5e-26   
ref|XP_010904546.1|  PREDICTED: pathogenesis-related protein PRB1...    107   5e-26   
ref|XP_010500562.1|  PREDICTED: pathogenesis-related leaf protein...    107   6e-26   
ref|XP_002522071.1|  STS14 protein precursor, putative                  107   6e-26   Ricinus communis
gb|AHE81254.1|  pathogenesis-related protein 1-11                       107   7e-26   
ref|XP_008798894.1|  PREDICTED: pathogenesis-related protein PRB1...    106   7e-26   
ref|XP_010941968.1|  PREDICTED: pathogenesis-related protein PRB1...    106   8e-26   
ref|XP_010530686.1|  PREDICTED: pathogenesis-related protein 1-like     106   8e-26   
ref|XP_002459696.1|  hypothetical protein SORBIDRAFT_02g008970          106   8e-26   Sorghum bicolor [broomcorn]
emb|CAA31009.1|  PR1b preprotein                                        106   9e-26   Nicotiana tabacum [American tobacco]
ref|XP_007041421.1|  CAP (Cysteine-rich secretory proteins, Antig...    106   1e-25   
gb|AHE81275.1|  pathogenesis-related protein 1-11                       106   1e-25   
ref|XP_006658251.1|  PREDICTED: uncharacterized protein LOC102701282    109   1e-25   
ref|XP_007148301.1|  hypothetical protein PHAVU_006G196900g             106   1e-25   
gb|EMS35766.1|  Pathogenesis-related protein PRMS                       105   2e-25   
sp|P11670.1|PRB1_TOBAC  RecName: Full=Basic form of pathogenesis-...    106   2e-25   Nicotiana tabacum [American tobacco]
ref|XP_009605696.1|  PREDICTED: basic form of pathogenesis-relate...    106   2e-25   
ref|XP_010941967.1|  PREDICTED: pathogenesis-related protein PRB1...    105   2e-25   
gb|AEH25623.1|  pathogenesis-related protein 1-8                        105   2e-25   
ref|XP_008455064.1|  PREDICTED: pathogenesis-related protein PRB1...    105   2e-25   
ref|XP_010478439.1|  PREDICTED: pathogenesis-related leaf protein...    105   2e-25   
gb|ABA34060.1|  pathogenesis-related protein 1                          105   2e-25   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAB05225.1|  pathogenesis-related protein-1                          105   2e-25   Nicotiana glutinosa
ref|XP_009788195.1|  PREDICTED: basic form of pathogenesis-relate...    105   2e-25   
ref|XP_002274275.1|  PREDICTED: basic form of pathogenesis-relate...    105   2e-25   Vitis vinifera
ref|XP_002522070.1|  STS14 protein precursor, putative                  105   2e-25   Ricinus communis
ref|NP_001043091.1|  Os01g0382400                                       105   2e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EMT02515.1|  Pathogenesis-related protein 1                          104   2e-25   
gb|AHA56682.1|  pathogenesis related protein                            105   2e-25   
ref|XP_008651988.1|  PREDICTED: pathogenesis-related protein PRB1...    105   2e-25   
gb|AEH25626.1|  pathogenesis-related protein 1-11                       105   3e-25   
ref|XP_009388942.1|  PREDICTED: pathogenesis-related protein 1-like     105   3e-25   
ref|XP_008652242.1|  PREDICTED: pathogenesis-related protein 1-like     105   3e-25   
gb|ADN43429.1|  pathogenesis-related protein 1                          105   3e-25   
gb|AHE81270.1|  pathogenesis-related protein 1-6                        105   3e-25   
emb|CAA47374.1|  prb-1b                                                 105   3e-25   Nicotiana tabacum [American tobacco]
gb|AEH25621.1|  pathogenesis-related protein 1-6                        105   3e-25   
ref|XP_010270273.1|  PREDICTED: pathogenesis-related leaf protein...    105   3e-25   
ref|XP_010088980.1|  hypothetical protein L484_013560                   105   3e-25   
gb|ACJ62489.1|  pathogenesis-related protein class I                    104   4e-25   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62461.1|  pathogenesis-related protein class I                    104   4e-25   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ADN43439.1|  pathogenesis-related protein 1                          104   4e-25   
gb|ACJ62530.1|  pathogenesis-related protein class I                    104   4e-25   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AFK93503.1|  pathogenesis related protein 1 isoform 4                105   4e-25   
ref|XP_010461858.1|  PREDICTED: pathogenesis-related leaf protein...    104   4e-25   
gb|ACJ62486.1|  pathogenesis-related protein class I                    104   4e-25   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62462.1|  pathogenesis-related protein class I                    104   4e-25   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_009605825.1|  PREDICTED: pathogenesis-related protein 1B-like    105   4e-25   
gb|ACJ62513.1|  pathogenesis-related protein class I                    104   5e-25   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_006486822.1|  PREDICTED: pathogenesis-related protein 1-like     104   5e-25   
emb|CAA36790.1|  unnamed protein product                                105   5e-25   Nicotiana tabacum [American tobacco]
gb|ADN43438.1|  pathogenesis-related protein 1                          104   5e-25   
ref|XP_009803803.1|  PREDICTED: pathogenesis-related protein 1C-like    105   5e-25   
ref|XP_004136927.1|  PREDICTED: basic form of pathogenesis-relate...    104   6e-25   
gb|ADN43430.1|  pathogenesis-related protein 1                          104   6e-25   
emb|CDY46097.1|  BnaA03g52710D                                          103   7e-25   
gb|ADB54823.1|  pathogenesis-related protein 1                          103   7e-25   Vitis pseudoreticulata
ref|XP_010252394.1|  PREDICTED: basic form of pathogenesis-relate...    103   7e-25   
dbj|BAO09561.1|  pathogenesis-related protein 1                         103   8e-25   
ref|XP_002265050.1|  PREDICTED: basic form of pathogenesis-relate...    103   8e-25   Vitis vinifera
ref|XP_008796970.1|  PREDICTED: pathogenesis-related protein PRB1...    103   8e-25   
ref|XP_002273546.1|  PREDICTED: basic form of pathogenesis-relate...    103   1e-24   Vitis vinifera
gb|EEC81456.1|  hypothetical protein OsI_24758                          103   1e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_010088981.1|  hypothetical protein L484_013561                   103   1e-24   
ref|XP_010530685.1|  PREDICTED: pathogenesis-related protein 1-like     103   1e-24   
ref|XP_008370577.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    103   1e-24   
ref|XP_006368156.1|  PREDICTED: basic form of pathogenesis-relate...    102   1e-24   
dbj|BAB78476.1|  PR-1                                                   103   1e-24   Solanum torvum [berenjena cimarrona]
ref|XP_006306376.1|  hypothetical protein CARUB_v10012281mg             103   1e-24   
emb|CDO97323.1|  unnamed protein product                                103   2e-24   
ref|XP_009135645.1|  PREDICTED: pathogenesis-related protein 1          103   2e-24   
ref|XP_006367092.1|  PREDICTED: basic form of pathogenesis-relate...    103   2e-24   
ref|XP_009388943.1|  PREDICTED: pathogenesis-related protein 1-like     103   2e-24   
ref|XP_008455066.1|  PREDICTED: basic form of pathogenesis-relate...    103   2e-24   
gb|KDP37600.1|  hypothetical protein JCGZ_06943                         102   2e-24   
ref|XP_009138233.1|  PREDICTED: pathogenesis-related protein 1-like     103   2e-24   
ref|XP_006422714.1|  hypothetical protein CICLE_v10029431mg             102   2e-24   
ref|XP_010691525.1|  PREDICTED: pathogenesis-related protein 1A-like    102   2e-24   
ref|XP_010530683.1|  PREDICTED: pathogenesis-related protein 1-like     102   3e-24   
ref|XP_006387932.1|  hypothetical protein POPTR_0473s00220g             102   3e-24   
ref|XP_006367104.1|  PREDICTED: basic form of pathogenesis-relate...    103   3e-24   
ref|XP_003557605.1|  PREDICTED: pathogenesis-related protein 1-like     102   3e-24   
ref|XP_006367095.1|  PREDICTED: basic form of pathogenesis-relate...    103   3e-24   
ref|XP_010266628.1|  PREDICTED: pathogenesis-related protein 1A-like    102   3e-24   
ref|XP_010691522.1|  PREDICTED: pathogenesis-related protein PR-1...    102   3e-24   
ref|XP_002274307.1|  PREDICTED: pathogenesis-related leaf protein 6     102   3e-24   Vitis vinifera
emb|CAE51954.1|  putative basic PR1                                     102   3e-24   Pisum sativum [garden pea]
ref|XP_004289699.1|  PREDICTED: pathogenesis-related protein 1B-like    102   3e-24   
gb|ACJ62499.1|  pathogenesis-related protein class I                    102   4e-24   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_011002613.1|  PREDICTED: basic form of pathogenesis-relate...    102   4e-24   
ref|XP_010095625.1|  hypothetical protein L484_003726                   102   4e-24   
ref|XP_004289697.1|  PREDICTED: pathogenesis-related protein 1C-like    102   4e-24   
ref|XP_008796972.1|  PREDICTED: pathogenesis-related protein PRB1...    102   4e-24   
gb|KGN43833.1|  hypothetical protein Csa_7G070255                       102   4e-24   
ref|XP_006367094.1|  PREDICTED: pathogenesis-related leaf protein...    102   4e-24   
ref|XP_002274105.1|  PREDICTED: pathogenesis-related leaf protein 6     102   5e-24   Vitis vinifera
ref|XP_008346349.1|  PREDICTED: pathogenesis-related protein 1-like     102   5e-24   
ref|XP_010527028.1|  PREDICTED: pathogenesis-related protein PR-1...    102   5e-24   
ref|XP_006657421.1|  PREDICTED: pathogenesis-related protein PRB1...    102   5e-24   
ref|XP_004955412.1|  PREDICTED: pathogenesis-related protein PRB1...    102   5e-24   
ref|XP_006379155.1|  hypothetical protein POPTR_0009s08640g             100   6e-24   
ref|XP_006367089.1|  PREDICTED: pathogenesis-related protein 1A1-...    102   6e-24   
ref|NP_197985.2|  Cysteine-rich secretory proteins, Antigen 5, an...    101   6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011016555.1|  PREDICTED: basic form of pathogenesis-relate...    101   6e-24   
ref|XP_008236223.1|  PREDICTED: pathogenesis-related protein 1-like     101   6e-24   
ref|XP_010478440.1|  PREDICTED: pathogenesis-related protein 1A-like    101   7e-24   
gb|EEE54618.1|  hypothetical protein OsJ_01863                          101   7e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010942046.1|  PREDICTED: uncharacterized protein LOC105060136    104   7e-24   
gb|ABA34062.1|  pathogenesis-related protein 1                          101   7e-24   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001105399.1|  pathogenesis related protein4 precursor            101   7e-24   Zea mays [maize]
gb|ABA34056.1|  pathogenesis-related protein 1                          101   8e-24   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA34079.1|  pathogenesis-related protein 1                          101   8e-24   Zea diploperennis [chapule]
gb|ABA34063.1|  pathogenesis-related protein 1                          101   8e-24   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA34055.1|  pathogenesis-related protein 1                          101   8e-24   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62494.1|  pathogenesis-related protein class I                    101   8e-24   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA34077.1|  pathogenesis-related protein 1                          101   9e-24   Zea diploperennis [chapule]
gb|ADN43442.1|  pathogenesis-related protein 1                          101   9e-24   
gb|EMT26678.1|  Pathogenesis-related protein 1                          100   9e-24   
gb|ABK55610.1|  pathogenesis-related protein PR1c                       101   1e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_007201612.1|  hypothetical protein PRUPE_ppa019807mg             100   1e-23   
sp|Q41359.1|PR1_SAMNI  RecName: Full=Pathogenesis-related protein...    100   1e-23   Sambucus nigra
ref|XP_011092473.1|  PREDICTED: pathogenesis-related leaf protein...    100   1e-23   
emb|CDY22960.1|  BnaC03g41090D                                          100   1e-23   
ref|XP_006406470.1|  hypothetical protein EUTSA_v10022205mg             100   1e-23   
ref|NP_001043089.1|  Os01g0382000                                       100   2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009397726.1|  PREDICTED: pathogenesis-related protein PRB1...    102   2e-23   
gb|AFK64734.1|  pathogenesis related protein 1a                         100   2e-23   
ref|XP_010517589.1|  PREDICTED: pathogenesis-related protein 1-like     100   2e-23   
ref|XP_010488899.1|  PREDICTED: pathogenesis-related protein 1          100   2e-23   
gb|KDP37598.1|  hypothetical protein JCGZ_06941                         100   2e-23   
ref|NP_179068.1|  pathogenesis-related protein 1                        100   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28181.1|  unknown                                                 100   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004168739.1|  PREDICTED: basic form of pathogenesis-relate...    100   2e-23   
emb|CDX72421.1|  BnaC07g44430D                                          100   2e-23   
gb|ACN52596.1|  pathogenesis-related protein                          99.4    3e-23   Pyrus x bretschneideri [bai li]
gb|ABA34066.1|  pathogenesis-related protein 1                          100   3e-23   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_004487816.1|  PREDICTED: pathogenesis-related protein 1-like     100   3e-23   
gb|AFM77011.1|  pathogenesis related protein 1a                       99.8    3e-23   
ref|XP_008236237.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...  99.8    3e-23   
ref|XP_009787160.1|  PREDICTED: pathogenesis-related leaf protein...    100   3e-23   
gb|AAD40121.1|AF149413_2  contains similarity to SCP-like extrace...    100   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004486257.1|  PREDICTED: basic form of pathogenesis-relate...  99.8    3e-23   
gb|ABK41053.2|  pathogenesis-related protein 1                        99.8    3e-23   Musa acuminata [banana]
gb|AFD29286.1|  pathogenesis-related protein 1                        99.8    3e-23   
ref|XP_010500560.1|  PREDICTED: pathogenesis-related protein 1B-like  99.8    3e-23   
ref|XP_004170276.1|  PREDICTED: basic form of pathogenesis-relate...  99.8    3e-23   
ref|XP_009605697.1|  PREDICTED: pathogenesis-related leaf protein...  99.8    3e-23   
ref|XP_002459310.1|  hypothetical protein SORBIDRAFT_02g002150          100   3e-23   Sorghum bicolor [broomcorn]
ref|XP_004136921.1|  PREDICTED: basic form of pathogenesis-relate...  99.8    3e-23   
gb|AAL84768.1|AF475286_1  pathogenesis-related protein 1-1a           99.0    4e-23   Cucumis sativus [cucumbers]
ref|XP_006486832.1|  PREDICTED: pathogenesis-related protein PR-1...  99.8    4e-23   
ref|XP_006367096.1|  PREDICTED: pathogenesis-related leaf protein...  99.8    4e-23   
gb|ADB54822.1|  pathogenesis-related protein 1                        99.8    4e-23   Vitis pseudoreticulata
ref|XP_004289701.1|  PREDICTED: pathogenesis-related protein 1B-like  99.4    4e-23   
ref|XP_009398311.1|  PREDICTED: pathogenesis-related protein PRB1...  99.4    4e-23   
ref|XP_006412319.1|  hypothetical protein EUTSA_v10026438mg           99.4    4e-23   
gb|AFK37568.1|  unknown                                               99.8    5e-23   
ref|XP_006644187.1|  PREDICTED: pathogenesis-related protein PRB1...  99.4    5e-23   
dbj|BAF03626.1|  pathogenesis related protein 1                       99.4    5e-23   Eutrema japonicum [wasabe]
dbj|BAK01044.1|  predicted protein                                    99.4    5e-23   
dbj|BAC84725.1|  putative pathogenesis-related protein 1              99.0    5e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004138862.1|  PREDICTED: basic form of pathogenesis-relate...  99.0    5e-23   
gb|AAF78528.1|AF195237_1  pathogenesis-related protein                98.6    5e-23   Pyrus pyrifolia [sha li]
ref|XP_010547940.1|  PREDICTED: pathogenesis-related protein 1-like   99.0    6e-23   
ref|XP_007148303.1|  hypothetical protein PHAVU_006G197100g           99.4    6e-23   
ref|XP_006412320.1|  hypothetical protein EUTSA_v10027447mg           99.4    6e-23   
emb|CAN68901.1|  hypothetical protein VITISV_019988                   98.6    6e-23   Vitis vinifera
emb|CDY46098.1|  BnaA03g52700D                                        99.0    6e-23   
gb|KFK39972.1|  hypothetical protein AALP_AA3G313200                  98.6    8e-23   
ref|XP_010691524.1|  PREDICTED: pathogenesis-related protein PR-1...  99.0    8e-23   
ref|XP_009138212.1|  PREDICTED: pathogenesis-related protein 1-like   99.0    8e-23   
gb|KCW56841.1|  hypothetical protein EUGRSUZ_I02509                   99.0    8e-23   
gb|ADN43443.1|  pathogenesis-related protein 1                        98.6    8e-23   
ref|XP_002522066.1|  STS14 protein precursor, putative                99.0    8e-23   Ricinus communis
gb|KGN48339.1|  hypothetical protein Csa_6G483242                     98.2    9e-23   
gb|AFM76999.1|  pathogenesis related protein 1a                       98.6    9e-23   
ref|XP_002313932.2|  pathogenesis-related family protein              98.6    9e-23   Populus trichocarpa [western balsam poplar]
ref|XP_008454501.1|  PREDICTED: basic form of pathogenesis-relate...  98.6    9e-23   
dbj|BAL63012.1|  pathogenesis-related protein 1-1a                    97.8    9e-23   
ref|XP_010029887.1|  PREDICTED: pathogenesis-related protein PR-1...  99.0    9e-23   
ref|XP_006299640.1|  hypothetical protein CARUB_v10015827mg           98.6    9e-23   
ref|XP_009342365.1|  PREDICTED: pathogenesis-related protein 1-like   98.6    1e-22   
ref|XP_004152970.1|  PREDICTED: basic form of pathogenesis-relate...  98.6    1e-22   
emb|CDX82282.1|  BnaA03g35390D                                        98.6    1e-22   
ref|XP_006422718.1|  hypothetical protein CICLE_v10029873mg           98.6    1e-22   
ref|XP_009138206.1|  PREDICTED: pathogenesis-related protein 1-like   98.6    1e-22   
ref|XP_009138205.1|  PREDICTED: pathogenesis-related protein 1-like   98.6    1e-22   
ref|XP_009605695.1|  PREDICTED: basic form of pathogenesis-relate...  99.0    1e-22   
gb|AAF62171.1|  pathogenesis-related protein 1                        96.7    1e-22   
ref|XP_003557607.1|  PREDICTED: pathogenesis-related protein PRB1...  98.2    1e-22   
ref|XP_010691521.1|  PREDICTED: pathogenesis-related protein PR-1...  98.2    1e-22   
gb|AEH25625.1|  pathogenesis-related protein 1-10                     98.6    1e-22   
gb|ADP69172.1|  pathogenesis related protein-1                        98.2    1e-22   
dbj|BAL63013.1|  pathogenesis-related protein 1-1a                    97.4    1e-22   
ref|XP_009378592.1|  PREDICTED: pathogenesis-related protein PR-1...  98.2    1e-22   
ref|XP_004136929.1|  PREDICTED: pathogenesis-related protein 1-like   97.8    1e-22   
ref|XP_007201285.1|  hypothetical protein PRUPE_ppa012617mg           98.2    1e-22   
ref|XP_006658252.1|  PREDICTED: pathogenesis-related protein PRB1...  98.6    1e-22   
gb|ACB45874.1|  pathogen-related protein 1                            97.8    1e-22   
ref|XP_002313936.2|  pathogenesis-related family protein              98.2    1e-22   
ref|NP_188603.1|  putative pathogenesis-related protein               98.2    1e-22   
ref|XP_007199955.1|  hypothetical protein PRUPE_ppa1027191mg          97.8    2e-22   
ref|XP_008455068.1|  PREDICTED: basic form of pathogenesis-relate...  97.8    2e-22   
ref|XP_004136928.1|  PREDICTED: pathogenesis-related protein 1C-like  98.2    2e-22   
ref|XP_004968783.1|  PREDICTED: pathogenesis-related protein PRMS...  97.8    2e-22   
ref|XP_006422719.1|  hypothetical protein CICLE_v10029950mg           97.8    2e-22   
ref|XP_008372941.1|  PREDICTED: pathogenesis-related leaf protein...  98.2    2e-22   
ref|XP_009342367.1|  PREDICTED: pathogenesis-related protein PR-1...  97.8    2e-22   
prf||1803521A  pathogenesis-related protein 1                         97.1    2e-22
ref|XP_009388944.1|  PREDICTED: pathogenesis-related protein 1C-like  97.8    2e-22   
ref|XP_006304441.1|  hypothetical protein CARUB_v10011055mg           97.8    2e-22   
ref|XP_006486819.1|  PREDICTED: pathogenesis-related protein 1-like   97.4    2e-22   
gb|ADD97801.1|  pathogenesis-related protein 1                        97.8    2e-22   
ref|XP_004136922.1|  PREDICTED: basic form of pathogenesis-relate...  97.8    2e-22   
ref|XP_006299028.1|  hypothetical protein CARUB_v10015165mg           97.4    2e-22   
ref|XP_006367102.1|  PREDICTED: basic form of pathogenesis-relate...  97.8    2e-22   
ref|XP_009138211.1|  PREDICTED: pathogenesis-related protein 1-like   97.4    2e-22   
ref|XP_008372945.1|  PREDICTED: pathogenesis-related protein 1-like   97.4    3e-22   
dbj|BAN09077.1|  pathogenesis related protein-1.2                     97.8    3e-22   
ref|XP_010489949.1|  PREDICTED: pathogenesis-related protein 1A-like  97.4    3e-22   
emb|CDY49367.1|  BnaA03g50560D                                        97.4    3e-22   
ref|XP_010270442.1|  PREDICTED: basic form of pathogenesis-relate...  97.4    3e-22   
ref|XP_006422707.1|  hypothetical protein CICLE_v10030029mg           97.4    3e-22   
gb|KDP36353.1|  hypothetical protein JCGZ_09850                       97.8    3e-22   
ref|XP_010507919.1|  PREDICTED: pathogenesis-related protein 1A-like  97.1    3e-22   
gb|ADN43441.1|  pathogenesis-related protein 1                        97.1    4e-22   
ref|XP_007041425.1|  Pathogenesis-related protein 1                   97.1    4e-22   
ref|XP_008455071.1|  PREDICTED: basic form of pathogenesis-relate...  97.1    4e-22   
ref|XP_009398310.1|  PREDICTED: pathogenesis-related protein 1-like   97.1    4e-22   
gb|AFM77000.1|  pathogenesis related protein 1a                       97.1    4e-22   
gb|KDP25905.1|  hypothetical protein JCGZ_22976                       95.9    4e-22   
ref|XP_006369711.1|  Pathogenesis-related family protein              96.7    4e-22   
ref|XP_010943479.1|  PREDICTED: pathogenesis-related protein PRB1...  96.7    5e-22   
ref|XP_010467245.1|  PREDICTED: pathogenesis-related protein 1-like   96.7    5e-22   
ref|XP_010252393.1|  PREDICTED: basic form of pathogenesis-relate...  96.7    5e-22   
ref|XP_011002583.1|  PREDICTED: pathogenesis-related leaf protein...  96.7    5e-22   
gb|EMS56527.1|  Pathogenesis-related protein PRMS                     96.7    5e-22   
gb|AEQ33601.1|  pathogenesis-related protein 1a                       95.9    6e-22   
ref|XP_010252392.1|  PREDICTED: basic form of pathogenesis-relate...  96.3    7e-22   
ref|XP_010461857.1|  PREDICTED: pathogenesis-related protein 1B-like  96.3    7e-22   
ref|XP_006486821.1|  PREDICTED: basic form of pathogenesis-relate...  96.3    8e-22   
gb|KCW63548.1|  hypothetical protein EUGRSUZ_G01181                   95.9    8e-22   
gb|AFK93500.1|  pathogenesis related protein 1 isoform 1              96.3    8e-22   
ref|XP_011091978.1|  PREDICTED: basic form of pathogenesis-relate...  95.9    8e-22   
ref|XP_010065853.1|  PREDICTED: basic form of pathogenesis-relate...  95.9    9e-22   
ref|XP_009138209.1|  PREDICTED: pathogenesis-related protein 1-like   95.9    1e-21   
gb|AAF76440.1|AC015445_7  Contains similarity to PR1a protein pre...  95.9    1e-21   
ref|XP_010691520.1|  PREDICTED: pathogenesis-related protein 1C-like  95.9    1e-21   
ref|XP_004504945.1|  PREDICTED: basic form of pathogenesis-relate...  95.9    1e-21   
ref|XP_006367093.1|  PREDICTED: basic form of pathogenesis-relate...  96.3    1e-21   
ref|XP_004168740.1|  PREDICTED: basic form of pathogenesis-relate...  95.5    1e-21   
ref|NP_179064.1|  pathogenesis-related protein 1                      95.5    1e-21   
gb|EMT00919.1|  Pathogenesis-related protein PRB1-2                   97.4    1e-21   
gb|AEH25633.1|  pathogenesis-related protein 1-18                     95.9    1e-21   
gb|AEH25629.1|  pathogenesis-related protein 1-14                     95.9    1e-21   
gb|ACT99721.1|  pathogen-related protein 1                            95.5    1e-21   
ref|XP_011092471.1|  PREDICTED: basic form of pathogenesis-relate...  95.5    1e-21   
gb|KFK39965.1|  hypothetical protein AALP_AA3G312200                  95.5    1e-21   
ref|XP_007148307.1|  hypothetical protein PHAVU_006G197500g           95.1    1e-21   
ref|XP_006422713.1|  hypothetical protein CICLE_v10029459mg           95.1    2e-21   
ref|XP_008360375.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...  95.9    2e-21   
gb|ABA41593.1|  pathogenesis-related protein                          94.4    2e-21   
pdb|1CFE|A  Chain A, P14a, Nmr, 20 Structures                         94.4    2e-21   
ref|XP_003561249.1|  PREDICTED: pathogenesis-related protein 1-like   95.1    2e-21   
gb|KHN33603.1|  Basic form of pathogenesis-related protein 1          95.1    2e-21   
ref|NP_001237253.1|  uncharacterized protein LOC100527778 precursor   94.7    2e-21   
ref|XP_010943437.1|  PREDICTED: pathogenesis-related protein 1B-like  95.5    2e-21   
ref|XP_010687897.1|  PREDICTED: pathogenesis-related protein PR-1...  94.7    2e-21   
ref|NP_175427.1|  putative pathogenesis-related protein               96.3    3e-21   
ref|XP_010525646.1|  PREDICTED: pathogenesis-related leaf protein...  94.7    3e-21   
gb|EMS45142.1|  Pathogenesis-related protein 1                        94.7    3e-21   
gb|KFK39973.1|  hypothetical protein AALP_AA3G313300                  94.4    3e-21   
ref|XP_010052995.1|  PREDICTED: basic form of pathogenesis-relate...  94.4    3e-21   
ref|XP_011092436.1|  PREDICTED: basic form of pathogenesis-relate...  94.4    3e-21   
ref|XP_002465112.1|  hypothetical protein SORBIDRAFT_01g032200        94.7    3e-21   
ref|XP_006848057.1|  hypothetical protein AMTR_s00029p00197310        94.4    4e-21   
ref|XP_010943469.1|  PREDICTED: pathogenesis-related protein PRB1...  94.4    4e-21   
ref|XP_003608310.1|  F-box/FBD/LRR-repeat protein                     99.8    4e-21   
gb|KGN62935.1|  hypothetical protein Csa_2G381130                     96.7    4e-21   
ref|XP_010053002.1|  PREDICTED: basic form of pathogenesis-relate...  94.0    4e-21   
ref|XP_006486833.1|  PREDICTED: pathogenesis-related leaf protein...  94.0    4e-21   
ref|XP_004292053.1|  PREDICTED: basic form of pathogenesis-relate...  94.4    5e-21   
gb|KCW44084.1|  hypothetical protein EUGRSUZ_L02505                   94.0    5e-21   
ref|XP_004955945.1|  PREDICTED: pathogenesis-related protein PRMS...  94.4    5e-21   
prf||1202235B  protein p14,pathogenesis related                       93.2    5e-21
ref|XP_010065836.1|  PREDICTED: pathogenesis-related protein 1-like   94.0    5e-21   
ref|XP_011092435.1|  PREDICTED: basic form of pathogenesis-relate...  93.6    6e-21   
gb|AEX55228.1|  pathogenesis-related protein 1                        94.0    6e-21   
ref|XP_002869194.1|  hypothetical protein ARALYDRAFT_491308           93.6    6e-21   
gb|ADN43440.1|  pathogenesis-related protein 1                        93.6    7e-21   
ref|XP_004137081.1|  PREDICTED: basic form of pathogenesis-relate...  93.6    7e-21   
ref|XP_002270281.2|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...  93.6    7e-21   
ref|XP_002885324.1|  hypothetical protein ARALYDRAFT_898358           93.6    8e-21   
emb|CDO97324.1|  unnamed protein product                              93.6    8e-21   
gb|KCW63509.1|  hypothetical protein EUGRSUZ_G01140                   93.6    8e-21   
ref|XP_008798893.1|  PREDICTED: pathogenesis-related protein 1B-like  94.0    8e-21   
ref|XP_008455062.1|  PREDICTED: pathogenesis-related protein 1-like   93.6    8e-21   
ref|XP_010065838.1|  PREDICTED: pathogenesis-related protein 1-like   93.6    8e-21   
ref|XP_010467244.1|  PREDICTED: pathogenesis-related protein 1-like   93.2    9e-21   
ref|XP_010095627.1|  hypothetical protein L484_003728                 93.2    9e-21   
gb|AEI28607.1|  pathogenesis-related protein 1                        93.2    9e-21   
ref|XP_010065842.1|  PREDICTED: pathogenesis-related protein 1-like   93.2    1e-20   
gb|AEH25627.1|  pathogenesis-related protein 1-12                     93.2    1e-20   
emb|CAA65420.1|  pathogenesis-related protein 1                       93.2    1e-20   
ref|XP_003606006.1|  Maturase K                                       98.6    1e-20   
gb|KCW63515.1|  hypothetical protein EUGRSUZ_G01148                   93.2    1e-20   
gb|KHN19052.1|  Basic form of pathogenesis-related protein 1          93.2    1e-20   
ref|XP_010052996.1|  PREDICTED: pathogenesis-related protein 1-like   93.2    1e-20   
ref|XP_002891554.1|  hypothetical protein ARALYDRAFT_474142           92.8    1e-20   
ref|XP_004952487.1|  PREDICTED: cysteine-rich receptor-like prote...  97.8    1e-20   
ref|XP_009335372.1|  PREDICTED: pathogenesis-related leaf protein...  92.8    1e-20   
ref|XP_004155485.1|  PREDICTED: basic form of pathogenesis-relate...  93.6    1e-20   
ref|XP_004289700.1|  PREDICTED: basic form of pathogenesis-relate...  92.8    1e-20   
ref|XP_004136924.1|  PREDICTED: basic form of pathogenesis-relate...  92.8    1e-20   
gb|KGN43831.1|  hypothetical protein Csa_7G070254                     92.8    1e-20   
gb|AAM33434.1|AF507974_1  pathogenesis-related protein 1              91.3    1e-20   
ref|XP_002436405.1|  hypothetical protein SORBIDRAFT_10g001940        92.8    1e-20   
ref|XP_010095626.1|  hypothetical protein L484_003727                 92.4    1e-20   
ref|XP_003631695.1|  PREDICTED: basic form of pathogenesis-relate...  93.2    2e-20   
ref|XP_010447203.1|  PREDICTED: pathogenesis-related protein 1-like   92.8    2e-20   
ref|XP_010041779.1|  PREDICTED: pathogenesis-related protein 1A-like  91.7    2e-20   
ref|XP_010437726.1|  PREDICTED: pathogenesis-related protein 1-like   92.4    2e-20   
ref|XP_010042397.1|  PREDICTED: basic form of pathogenesis-relate...  92.4    2e-20   
ref|XP_010691519.1|  PREDICTED: pathogenesis-related protein 1A-like  92.8    2e-20   
gb|AEH25638.1|  pathogenesis-related protein 1-23                     92.4    2e-20   
gb|AHE81264.1|  pathogenesis-related protein 1-21                     92.8    2e-20   
ref|XP_011030276.1|  PREDICTED: basic form of pathogenesis-relate...  92.4    2e-20   
gb|AAT46023.1|  pathogenesis-related protein 1                        92.4    2e-20   
ref|XP_011030266.1|  PREDICTED: basic form of pathogenesis-relate...  92.4    2e-20   
ref|XP_006409652.1|  hypothetical protein EUTSA_v10022888mg           92.4    2e-20   
ref|XP_010065843.1|  PREDICTED: pathogenesis-related protein 1-like   92.4    2e-20   
ref|XP_002273355.1|  PREDICTED: basic form of pathogenesis-relate...  92.4    2e-20   
gb|AEH25628.1|  pathogenesis-related protein 1-13                     92.4    2e-20   
gb|AFK35640.1|  unknown                                               92.8    2e-20   
emb|CAA88618.1|  type-1 pathogenesis-related protein                  92.8    2e-20   
ref|XP_011088028.1|  PREDICTED: pathogenesis-related protein 1A-like  92.8    2e-20   
ref|XP_010065837.1|  PREDICTED: pathogenesis-related protein 1A-like  92.4    2e-20   
ref|XP_006368158.1|  PREDICTED: pathogenesis-related protein 1A-like  91.7    2e-20   
gb|KCW63519.1|  hypothetical protein EUGRSUZ_G01152                   92.0    2e-20   
ref|XP_006282972.1|  hypothetical protein CARUB_v10007846mg           92.0    2e-20   
ref|XP_009342363.1|  PREDICTED: pathogenesis-related leaf protein...  92.4    3e-20   
ref|XP_008372933.1|  PREDICTED: basic form of pathogenesis-relate...  92.4    3e-20   
ref|XP_010488898.1|  PREDICTED: pathogenesis-related protein 1-like   92.0    3e-20   
ref|NP_001238109.1|  uncharacterized protein LOC100499927 precursor   92.0    3e-20   
gb|AEH25636.1|  pathogenesis-related protein 1-21                     92.4    3e-20   
ref|NP_195098.1|  putative pathogenesis-related protein               92.0    3e-20   
ref|XP_010468301.1|  PREDICTED: pathogenesis-related protein 1A-like  92.0    3e-20   
ref|XP_010065833.1|  PREDICTED: pathogenesis-related protein 1-like   92.0    3e-20   
ref|XP_008236150.1|  PREDICTED: basic form of pathogenesis-relate...  92.0    3e-20   
ref|XP_004983398.1|  PREDICTED: pathogenesis-related protein PRMS...  92.0    3e-20   
ref|XP_010939329.1|  PREDICTED: pathogenesis-related protein PRB1...  92.0    3e-20   
ref|XP_010054710.1|  PREDICTED: pathogenesis-related leaf protein...  92.8    3e-20   
ref|XP_010065834.1|  PREDICTED: pathogenesis-related protein 1-like   92.0    3e-20   
ref|XP_010068342.1|  PREDICTED: basic form of pathogenesis-relate...  91.7    4e-20   
emb|CDO97326.1|  unnamed protein product                              91.7    4e-20   
gb|KCW77203.1|  hypothetical protein EUGRSUZ_D01554                   91.7    4e-20   
ref|XP_004138861.1|  PREDICTED: basic form of pathogenesis-relate...  91.7    4e-20   
gb|EMT01155.1|  Pathogenesis-related protein PRMS                     90.5    4e-20   
gb|AFK36478.1|  unknown                                               91.7    4e-20   
emb|CBI25093.3|  unnamed protein product                              91.7    4e-20   
emb|CAA07474.1|  pathogenisis-related protein 1.2                     91.7    4e-20   
ref|XP_010052997.1|  PREDICTED: pathogenesis-related protein 1-like   91.7    4e-20   
gb|AEH25632.1|  pathogenesis-related protein 1-17                     92.0    4e-20   
gb|AES63607.2|  CAP, cysteine-rich secretory protein, antigen 5       91.7    4e-20   
ref|XP_010052998.1|  PREDICTED: basic form of pathogenesis-relate...  91.3    4e-20   
gb|KCW63511.1|  hypothetical protein EUGRSUZ_G01142                   91.3    5e-20   
ref|XP_003593453.1|  Pathogenesis-related protein 1a                  91.7    5e-20   
ref|XP_009378590.1|  PREDICTED: pathogenesis-related leaf protein...  91.7    5e-20   
ref|XP_010040969.1|  PREDICTED: pathogenesis-related protein 1-like   91.3    5e-20   
ref|XP_003593356.1|  Pathogenesis-related protein                     91.3    5e-20   
gb|KDP37597.1|  hypothetical protein JCGZ_06940                       94.4    6e-20   
ref|XP_009346545.1|  PREDICTED: pathogenesis-related protein 1A-like  91.3    6e-20   
gb|KCW78615.1|  hypothetical protein EUGRSUZ_C00080                   90.5    6e-20   
ref|XP_010041202.1|  PREDICTED: basic form of pathogenesis-relate...  91.3    7e-20   
gb|AFK93502.1|  pathogenesis related protein 1 isoform 3              90.9    7e-20   
ref|XP_009402037.1|  PREDICTED: pathogenesis-related protein PR-1...  91.3    7e-20   
ref|XP_010065847.1|  PREDICTED: basic form of pathogenesis-relate...  90.9    7e-20   
gb|KGN62936.1|  hypothetical protein Csa_2G381380                     90.9    7e-20   
ref|XP_002270128.1|  PREDICTED: pathogenesis-related leaf protein 4   90.9    8e-20   
ref|XP_006393183.1|  hypothetical protein EUTSA_v10011955mg           90.9    8e-20   
ref|XP_010046906.1|  PREDICTED: pathogenesis-related protein 1C-like  91.3    8e-20   
ref|XP_007200682.1|  hypothetical protein PRUPE_ppa016942mg           90.5    9e-20   
ref|XP_008236224.1|  PREDICTED: pathogenesis-related leaf protein...  90.5    9e-20   
ref|XP_007041422.1|  Pathogenesis-related protein 1                   90.5    9e-20   
ref|XP_011092472.1|  PREDICTED: basic form of pathogenesis-relate...  90.5    1e-19   
ref|XP_010467241.1|  PREDICTED: pathogenesis-related protein 1-like   90.5    1e-19   
ref|XP_002300292.2|  Pathogenesis-related family protein              90.5    1e-19   
ref|XP_010517582.1|  PREDICTED: pathogenesis-related protein 1-like   90.5    1e-19   
gb|ABA34024.1|  pathogenesis-related maize seed protein               90.5    1e-19   
ref|XP_010053000.1|  PREDICTED: pathogenesis-related protein 1-like   90.5    1e-19   
gb|KCW77208.1|  hypothetical protein EUGRSUZ_D01560                   90.5    1e-19   
ref|XP_006298656.1|  hypothetical protein CARUB_v10014746mg           90.9    1e-19   
gb|ACJ62597.1|  pathogenesis-related maize seed protein               90.5    1e-19   
ref|XP_010052994.1|  PREDICTED: basic form of pathogenesis-relate...  90.1    1e-19   
sp|Q00008.1|PRMS_MAIZE  RecName: Full=Pathogenesis-related protei...  90.1    1e-19   
gb|AEZ52390.1|  pathogenesis-related protein 1                        90.5    1e-19   
gb|ACJ62603.1|  pathogenesis-related maize seed protein               90.1    1e-19   
ref|XP_010065841.1|  PREDICTED: basic form of pathogenesis-relate...  90.1    1e-19   
ref|XP_010068331.1|  PREDICTED: protein PRY2-like                     93.2    2e-19   
gb|ACJ62575.1|  pathogenesis-related maize seed protein               90.1    2e-19   
gb|AGO62049.1|  pathogenesis-related protein 1                        89.4    2e-19   



>ref|XP_008798890.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Phoenix 
dactylifera]
Length=166

 Score =   135 bits (339),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +3

Query  87   CMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLT  266
            C  V  MA    AQNS  DF++AHNAAR AVGVGP++W+TTV +YA++YAN+R  DC L 
Sbjct  11   CATVLVMAHATLAQNSPDDFVNAHNAAREAVGVGPVSWNTTVASYAKDYANQRKGDCQLI  70

Query  267  HSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            HS S  +GYGEN+  GGGP  TAK AV +W  EK+YY + SNSCSAP GQSCGHYTQV
Sbjct  71   HSDSISYGYGENLFIGGGPDFTAKDAVDLWVGEKQYYDYDSNSCSAPPGQSCGHYTQV  128



>ref|XP_010943450.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Elaeis 
guineensis]
Length=166

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +3

Query  87   CMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLT  266
            C +   MA    AQNS  DF++AHNAAR AVGVGP++WDTTV +YA++YAN+R  DC L 
Sbjct  11   CTMALVMAHATLAQNSPDDFVNAHNAAREAVGVGPVSWDTTVASYAEDYANQRKGDCQLI  70

Query  267  HSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            HS +   GYGEN+  GGGP  TAK+AV +W  E++YY + SNSCSAP GQSCGHYTQV
Sbjct  71   HSDASSHGYGENLFWGGGPDHTAKNAVDLWVGEQQYYDYGSNSCSAPQGQSCGHYTQV  128



>ref|XP_011002601.1| PREDICTED: pathogenesis-related protein 1-like [Populus euphratica]
Length=162

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 88/123 (72%), Gaps = 5/123 (4%)
 Frame = +3

Query  69   SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrra  248
            S  F   ++  S+ L   AQ++ QD+LDAHNAARAAVGVGP+TWDTTV+AYAQNYAN+RA
Sbjct  7    SLAFFTLIITLSLILPSRAQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQRA  66

Query  249  aDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHY  428
             DC+L HSG     YGEN+A     L+   AV MW  EK YY ++SNSC+  AGQ CGHY
Sbjct  67   GDCNLVHSGG---PYGENLAWSSADLSGTDAVKMWVDEKAYYDYSSNSCA--AGQQCGHY  121

Query  429  TQV  437
            TQV
Sbjct  122  TQV  124



>gb|AEM36335.1| pathogenesis-related protein [Vitis quinquangularis]
Length=160

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 84/128 (66%), Gaps = 6/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  +SP+ + C +  ++A  C AQNS QD+L+AHN ARA VGVGPM+WD TV AYAQNY
Sbjct  1    MGLCRSPLALLCFMGLALAHICCAQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            A +R  DC+L HSG     YGEN+A G   LT   AV +W  EK  Y H SNSC    G 
Sbjct  61   AKQRIGDCNLVHSGG---PYGENLARGSPSLTGTDAVNLWVGEKSNYDHNSNSC---VGG  114

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  115  QCGHYTQV  122



>ref|XP_004955414.1| PREDICTED: pathogenesis-related protein 1-like [Setaria italica]
Length=168

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 82/109 (75%), Gaps = 4/109 (4%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS+QDF+D HNAAR+ VGVGP++WD  V A+A++YA +RA DC+L HS     GYG
Sbjct  24   CAAQNSQQDFVDLHNAARSDVGVGPVSWDDNVAAFARSYAAQRAGDCALQHSSGS--GYG  81

Query  297  ENIAAGGG--PLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            ENI  GG     +A  AV +W AEK++Y H SNSCSAPAGQSCGHYTQV
Sbjct  82   ENIFVGGAGADWSASDAVGLWVAEKQWYDHGSNSCSAPAGQSCGHYTQV  130



>gb|ABK94784.1| unknown [Populus trichocarpa]
 gb|ABK96093.1| unknown [Populus trichocarpa]
Length=161

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 85/116 (73%), Gaps = 5/116 (4%)
 Frame = +3

Query  90   MLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTH  269
            ++  S+ L   AQ++ QD+LDAHNAARAAVGVGP+TWDTTV+AYAQNYAN+RA DC+L H
Sbjct  13   LITLSLILPSRAQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLVH  72

Query  270  SGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            SG     YGENIA     L+   AV MW  EK YY + SNSC+  AGQ CGHYTQV
Sbjct  73   SGG---PYGENIAWSSADLSGTDAVKMWVDEKAYYDYNSNSCA--AGQQCGHYTQV  123



>gb|AEH25622.1| pathogenesis-related protein 1-7 [Triticum aestivum]
 gb|AHE81250.1| pathogenesis-related protein 1-7 [Triticum aestivum]
 gb|AHE81271.1| pathogenesis-related protein 1-7 [Triticum aestivum]
Length=165

 Score =   118 bits (295),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 85/124 (69%), Gaps = 2/124 (2%)
 Frame = +3

Query  69   SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrra  248
            S   +  ++    A+   AQNS QDF+DAHNAARA VG+G +TWD TV A+AQ+YA++R 
Sbjct  4    STKLVVLLVALMSAMAVTAQNSEQDFVDAHNAARADVGLGEVTWDATVAAFAQDYADQRR  63

Query  249  aDCSLTHSGSFRFGYGENIAAGGG-PLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGH  425
             DC L H+   R  YGEN+  GGG   TA  AV  W +EK+YY H SN+CSAP G+SCGH
Sbjct  64   GDCQLIHTPDGR-PYGENLYGGGGTEWTATDAVNSWVSEKQYYDHDSNTCSAPEGESCGH  122

Query  426  YTQV  437
            YTQV
Sbjct  123  YTQV  126



>emb|CDO97325.1| unnamed protein product [Coffea canephora]
Length=162

 Score =   118 bits (295),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 89/128 (70%), Gaps = 5/128 (4%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  K  + +   ++ ++     AQNS+QD++DAHNAARA VGVGP+ WD TV AYAQNY
Sbjct  1    MGSPKISLALVSFILLAIFWPSRAQNSQQDYVDAHNAARAQVGVGPIAWDDTVAAYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN+R  DC+L HSG     YGEN+A G G LT + AV +W +EK+YY + SN+C+   GQ
Sbjct  61   ANQRINDCNLVHSGGR---YGENLAEGSGDLTGRDAVNLWVSEKQYYDYNSNTCA--QGQ  115

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  116  QCGHYTQV  123



>ref|XP_002273788.2| PREDICTED: pathogenesis-related protein 1 [Vitis vinifera]
Length=197

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 86/129 (67%), Gaps = 6/129 (5%)
 Frame = +3

Query  51   KMGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            KMG  +SP+ + C +  ++A  C AQNS QD+L+AHN ARA VGVGPM+WD TV AYAQN
Sbjct  37   KMGLCRSPLALLCFMGLALAHICCAQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYAQN  96

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R  DC+L HSG     YGEN+A G   LT   AV +W  EK  Y + SNSC    G
Sbjct  97   YANQRIGDCNLVHSGG---PYGENLAWGSPSLTGTDAVNLWVGEKSNYDYNSNSC---VG  150

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  151  GQCGHYTQV  159



>gb|EAZ02649.1| hypothetical protein OsI_24760 [Oryza sativa Indica Group]
 gb|EAZ38569.1| hypothetical protein OsJ_22958 [Oryza sativa Japonica Group]
Length=149

 Score =   117 bits (292),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 83/111 (75%), Gaps = 3/111 (3%)
 Frame = +3

Query  111  LCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFG  290
            +   AQNS QD++DAHNAAR+ VGVGP++WD TV AYA++YA +R  DC+L HS S    
Sbjct  1    MAATAQNSAQDYVDAHNAARSDVGVGPVSWDDTVAAYAESYAAQRQGDCALEHSDSGG-K  59

Query  291  YGENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            YGENI  G  GG  TA SAV+ W AEK++Y H SNSCSAPAG SCGHYTQV
Sbjct  60   YGENIFWGSAGGDWTAASAVSSWVAEKQWYDHDSNSCSAPAGSSCGHYTQV  110



>ref|XP_006379156.1| pathogenesis-related family protein [Populus trichocarpa]
 gb|ERP56953.1| pathogenesis-related family protein [Populus trichocarpa]
Length=161

 Score =   117 bits (293),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 85/116 (73%), Gaps = 5/116 (4%)
 Frame = +3

Query  90   MLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTH  269
            ++  S+ L   AQ++ QD+LDAHNAARAAVGVGP+TWDTTV+AYAQNYAN+RA DC+L H
Sbjct  13   LITLSLILPSRAQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLIH  72

Query  270  SGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            SG     YGEN+A     L+   AV MW  EK YY + SNSC+  AGQ CGHYTQV
Sbjct  73   SGG---PYGENLAWSSADLSGTDAVKMWVDEKAYYDYNSNSCA--AGQQCGHYTQV  123



>gb|EAY95187.1| hypothetical protein OsI_17005 [Oryza sativa Indica Group]
Length=122

 Score =   116 bits (290),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 81/107 (76%), Gaps = 3/107 (3%)
 Frame = +3

Query  123  AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGEN  302
            AQNS +D++D HNAARA VGVGP+ WD TV AYAQ YAN+R  DC L HS S  + YGEN
Sbjct  2    AQNSAKDYVDPHNAARAEVGVGPVHWDDTVAAYAQGYANQRRGDCKLQHSDS-GWKYGEN  60

Query  303  IAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            I  G  GG  TA SAV++W  EK++Y+H SNSCSAPAG+ CGHYTQV
Sbjct  61   IFWGPAGGDWTAASAVSLWVKEKQWYNHGSNSCSAPAGKECGHYTQV  107



>dbj|BAF95881.1| putative pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   117 bits (292),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 85/128 (66%), Gaps = 6/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  +SP+ + C +  ++A  C AQNS QD+L+AHN ARA VGVGPM+WD TV AYAQNY
Sbjct  1    MGLCRSPLALLCFMGLALAHICCAQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN+R  DC+L HSG     YGEN+A G   LT   AV MW  EK  Y + SNSC    G 
Sbjct  61   ANQRIGDCNLVHSGG---PYGENLAWGSPSLTGTDAVNMWVGEKSNYDYNSNSC---VGG  114

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  115  QCGHYTQV  122



>gb|AAQ19681.1| cytoplasmic small heat shock protein class I [Capsicum frutescens]
Length=158

 Score =   116 bits (291),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 84/128 (66%), Gaps = 8/128 (6%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG    P+ + C++V ++   C+AQNS QD+L  HN ARA VGVGPM+WD  + + AQNY
Sbjct  1    MGLFNIPLLLVCLIVLAIFHSCHAQNSPQDYLAVHNNARAQVGVGPMSWDAGLASRAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN R  DCSL HSG+     GEN+A GGG  T + AV +W +EK  Y+HA+N C   AG 
Sbjct  61   ANSRTGDCSLIHSGA-----GENLAKGGGDYTGRRAVELWVSEKPNYNHATNQC---AGG  112

Query  414  SCGHYTQV  437
             C HYTQV
Sbjct  113  ECRHYTQV  120



>emb|CAN77102.1| hypothetical protein VITISV_021166 [Vitis vinifera]
 emb|CBI25100.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 85/128 (66%), Gaps = 6/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  +SP+ + C +  ++A  C AQNS QD+L+AHN ARA VGVGPM+WD TV AYAQNY
Sbjct  1    MGLCRSPLALLCFMGLALAHICCAQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN+R  DC+L HSG     YGEN+A G   LT   AV +W  EK  Y + SNSC    G 
Sbjct  61   ANQRIGDCNLVHSGG---PYGENLAWGSPSLTGTDAVNLWVGEKSNYDYNSNSC---VGG  114

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  115  QCGHYTQV  122



>ref|NP_001058816.1| Os07g0129300 [Oryza sativa Japonica Group]
 gb|AAM45439.1|AF306651_1 pathogenesis-related protein 1 [Oryza sativa]
 dbj|BAC84723.1| pathogenesis-related protein 1 [Oryza sativa Japonica Group]
 dbj|BAF20730.1| Os07g0129300 [Oryza sativa Japonica Group]
Length=165

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = +3

Query  126  QNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGENI  305
            QNS QD++DAHNAAR+ VGVGP++WD TV AYA++YA +R  DC+L HS S    YGENI
Sbjct  22   QNSAQDYVDAHNAARSDVGVGPVSWDDTVAAYAESYAAQRQGDCALEHSDSGG-KYGENI  80

Query  306  AAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
              G  GG  TA SAV+ W AEK++Y H SNSCSAPAG SCGHYTQV
Sbjct  81   FWGSAGGDWTAASAVSSWVAEKQWYDHDSNSCSAPAGSSCGHYTQV  126



>gb|AAX20041.1| cytoplasmic small heat shock protein class I [Capsicum annuum]
 gb|AHZ65519.1| cytoplasmic small heat shock protein class I [Capsicum annuum 
Conoides Group]
Length=158

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 84/128 (66%), Gaps = 8/128 (6%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG    P+ + C++V ++   C+AQNS QD+L  HN ARA VGVGPM+WD  + + AQNY
Sbjct  1    MGLFNIPLLLVCLIVLAIFHSCHAQNSPQDYLAVHNNARAQVGVGPMSWDAGLASRAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN R  DC+L HSG+     GEN+A GGG  T + AV +W +EK  Y+HA+N C   AG 
Sbjct  61   ANSRTGDCNLIHSGA-----GENLAKGGGDYTGRRAVELWVSEKPNYNHATNQC---AGG  112

Query  414  SCGHYTQV  437
             C HYTQV
Sbjct  113  ECRHYTQV  120



>gb|EEC81457.1| hypothetical protein OsI_24759 [Oryza sativa Indica Group]
 gb|EEE66502.1| hypothetical protein OsJ_22957 [Oryza sativa Japonica Group]
Length=149

 Score =   115 bits (288),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 80/111 (72%), Gaps = 3/111 (3%)
 Frame = +3

Query  111  LCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFG  290
            +   AQNS QDF+D HNAARA VGVGP++WD TV AYA++YA +R  DC L HS S    
Sbjct  1    MAATAQNSAQDFVDPHNAARADVGVGPVSWDDTVAAYAESYAAQRQGDCKLEHSDSGG-K  59

Query  291  YGENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            YGENI  G  GG  TA SAV+ W +EK++Y H SNSCSAP G SCGHYTQV
Sbjct  60   YGENIFWGSAGGDWTAASAVSAWVSEKQWYDHGSNSCSAPEGSSCGHYTQV  110



>ref|XP_006657422.1| PREDICTED: pathogenesis-related protein 1-like [Oryza brachyantha]
Length=177

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 80/109 (73%), Gaps = 3/109 (3%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQN++QD +D HNAAR+ VGVGP+TW+ TV AYA+ YA +R  DC L HS S    YG
Sbjct  31   CMAQNTQQDVVDLHNAARSDVGVGPVTWNDTVAAYAEAYAEKRRGDCLLQHSDSSGL-YG  89

Query  297  ENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+  G  GG  T   AVA+W AEK++Y HASNSCSAPAG SCGHYTQV
Sbjct  90   ENLFLGSAGGNWTGSDAVALWVAEKQWYDHASNSCSAPAGSSCGHYTQV  138



>emb|CAA70070.1| PR protein [Solanum lycopersicum]
Length=168

 Score =   115 bits (288),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 88/126 (70%), Gaps = 7/126 (6%)
 Frame = +3

Query  60   FLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyan  239
            F  S + + C++V ++   C+AQNS QD+L+ HN ARA VGVGPM+WD  +E+ AQ+YAN
Sbjct  4    FNMSLLLMTCLMVLAIFHSCDAQNSPQDYLEVHNDARAQVGVGPMSWDADLESRAQSYAN  63

Query  240  rraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSC  419
             RA DC+L HSGS     GEN+A GGG  T ++AV +W +EK  Y++ +N C   +G+ C
Sbjct  64   SRAGDCNLIHSGS-----GENLAKGGGDFTGRAAVELWVSEKPNYNYDTNEC--VSGKMC  116

Query  420  GHYTQV  437
            GHYTQV
Sbjct  117  GHYTQV  122



>ref|XP_004246724.1| PREDICTED: pathogenesis-related leaf protein 4 [Solanum lycopersicum]
 emb|CAA04881.1| pathogenesis-related protein [Solanum lycopersicum]
Length=160

 Score =   115 bits (287),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 88/126 (70%), Gaps = 7/126 (6%)
 Frame = +3

Query  60   FLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyan  239
            F  S + + C++V ++   C+AQNS QD+L+ HN ARA VGVGPM+WD  +E+ AQ+YAN
Sbjct  4    FNMSLLLMTCLMVLAIFHSCDAQNSPQDYLEVHNDARAQVGVGPMSWDADLESRAQSYAN  63

Query  240  rraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSC  419
             RA DC+L HSGS     GEN+A GGG  T ++AV +W +EK  Y++ +N C   +G+ C
Sbjct  64   SRAGDCNLIHSGS-----GENLAKGGGDFTGRAAVELWVSEKPNYNYDTNECV--SGKMC  116

Query  420  GHYTQV  437
            GHYTQV
Sbjct  117  GHYTQV  122



>gb|EMT11012.1| Pathogenesis-related protein PRMS [Aegilops tauschii]
Length=166

 Score =   115 bits (287),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 77/106 (73%), Gaps = 2/106 (2%)
 Frame = +3

Query  123  AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGEN  302
            AQNS QDF+D HNAARA VGVGP+TWD  V AYAQNYA +R  DC L H+   R  YGEN
Sbjct  23   AQNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLIHTPDGR-PYGEN  81

Query  303  IAAGGG-PLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            +  GGG   TA  AV+ W +EK+YY H SNSCSAP G SCGHYTQV
Sbjct  82   LFGGGGTQWTAADAVSSWVSEKQYYDHGSNSCSAPEGDSCGHYTQV  127



>ref|XP_004955413.1| PREDICTED: pathogenesis-related protein 1-like [Setaria italica]
Length=170

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 79/109 (72%), Gaps = 5/109 (5%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS QD++D HNAAR+ VGVGP+TWD TV AYAQ+YA +R  DC+L HSG     YG
Sbjct  26   CAAQNSPQDYVDPHNAARSDVGVGPVTWDDTVAAYAQSYAAQRQGDCALVHSGGP---YG  82

Query  297  ENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            ENI  G  G   +A  AV  W +EK++Y H SNSCSAP GQSCGHYTQV
Sbjct  83   ENIFWGSAGADWSAADAVGSWVSEKQWYDHGSNSCSAPEGQSCGHYTQV  131



>gb|AGK89727.1| pathogenesis-related 1 protein [Coffea canephora]
Length=162

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 87/128 (68%), Gaps = 5/128 (4%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  K  + +   ++ ++      QNS+QD++DAHNAARA VGVGP+ WD TV AYAQNY
Sbjct  1    MGSPKISLALFSFILLAIFWPSRTQNSQQDYVDAHNAARAQVGVGPIAWDDTVAAYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN+R  DC+L HS      YGEN+A GGG  T + AV +W +EK+YY + SN+C+   GQ
Sbjct  61   ANQRINDCNLEHSDG---RYGENLAEGGGDFTGRDAVNLWVSEKQYYDYNSNTCA--QGQ  115

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  116  QCGHYTQV  123



>emb|CDP12737.1| unnamed protein product [Coffea canephora]
Length=162

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 84/128 (66%), Gaps = 5/128 (4%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  K    I C ++ +M     AQNS+QD+LD HNAARA V VGP+ WD  + AYAQNY
Sbjct  1    MGSFKISSAIFCFVLLAMFWPSRAQNSQQDYLDVHNAARAQVNVGPIAWDDRLAAYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            A +R  DC L HSG     YGEN+AAG G  TA++AV +W  E++YY + SNSC+   G+
Sbjct  61   ATQRMNDCQLMHSGG---PYGENLAAGSGDFTARAAVNLWVNERQYYDYGSNSCT--QGK  115

Query  414  SCGHYTQV  437
             C HYTQV
Sbjct  116  ECRHYTQV  123



>ref|XP_002313935.2| hypothetical protein POPTR_0009s08660g [Populus trichocarpa]
 gb|EEE87890.2| hypothetical protein POPTR_0009s08660g [Populus trichocarpa]
Length=160

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = +3

Query  90   MLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTH  269
            ++  S+ L   AQ++ QD+LDAHN ARAAVGVGP+TWDTTV+AYAQNYAN+RA DC+L H
Sbjct  12   LITLSLILPSRAQDNPQDYLDAHNTARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLVH  71

Query  270  SGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            SG     YGENIA     L+   AV MW  E  YY + SNSC+  +GQ CGHYTQV
Sbjct  72   SGG---PYGENIAWSSADLSGTDAVKMWVDEMAYYDYNSNSCA--SGQQCGHYTQV  122



>ref|NP_001058815.1| Os07g0129200 [Oryza sativa Japonica Group]
 dbj|BAC84842.1| PR-1 type pathogenesis-related protein PR-1a [Oryza sativa Japonica 
Group]
 dbj|BAD31924.1| PR-1 type pathogenesis-related protein PR-1a [Oryza sativa Japonica 
Group]
 dbj|BAF20729.1| Os07g0129200 [Oryza sativa Japonica Group]
 gb|ABK55608.1| pathogenesis-related protein PR1a [Oryza sativa Indica Group]
Length=168

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 78/106 (74%), Gaps = 3/106 (3%)
 Frame = +3

Query  126  QNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGENI  305
            QNS QDF+D HNAARA VGVGP++WD TV AYA++YA +R  DC L HS S    YGENI
Sbjct  25   QNSAQDFVDPHNAARADVGVGPVSWDDTVAAYAESYAAQRQGDCKLEHSDSGG-KYGENI  83

Query  306  AAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
              G  GG  TA SAV+ W +EK++Y H SNSCSAP G SCGHYTQV
Sbjct  84   FWGSAGGDWTAASAVSAWVSEKQWYDHGSNSCSAPEGSSCGHYTQV  129



>gb|AAG44566.1|AF251277_1 acidic PR-1 type pathogenesis-related protein PR-1a [Oryza sativa 
Japonica Group]
 emb|CAC03571.1| PR1a protein [Oryza sativa Japonica Group]
Length=168

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 78/106 (74%), Gaps = 3/106 (3%)
 Frame = +3

Query  126  QNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGENI  305
            QNS QDF+D HNAARA VGVGP++WD TV AYA++YA +R  DC L HS S    YGENI
Sbjct  25   QNSAQDFVDPHNAARADVGVGPVSWDDTVAAYAESYAAQRQGDCKLEHSDSGG-KYGENI  83

Query  306  AAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
              G  GG  TA SAV+ W +EK++Y H SNSCSAP G SCGHYTQV
Sbjct  84   FWGSPGGDWTAASAVSAWVSEKQWYDHGSNSCSAPEGSSCGHYTQV  129



>gb|AFR90191.1| pathogenesis-related protein 1a [Salsola ferganica]
Length=166

 Score =   112 bits (281),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = +3

Query  90   MLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTH  269
            +   ++A  C+AQNS QD+++AHNAARAAVGVG + WD  + AYAQ YAN+R  DC+L H
Sbjct  16   LATVTLAQMCHAQNSPQDYVNAHNAARAAVGVGKIQWDGKLAAYAQQYANQRKGDCALKH  75

Query  270  SGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            SG     YGENIA GGGP T + AV MW AEK  Y++ SN+C+  A + CGHYTQV
Sbjct  76   SGG---PYGENIAVGGGPFTGRDAVKMWVAEKANYNYNSNTCA--ANKVCGHYTQV  126



>ref|NP_001234523.1| pathogenesis-related leaf protein 4 precursor [Solanum lycopersicum]
 sp|Q04108.1|PR04_SOLLC RecName: Full=Pathogenesis-related leaf protein 4; Short=P4; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAA03615.1| pathogenesis-related protein P4 [Solanum lycopersicum]
 emb|CAA09671.1| pathogenesis-related protein PR1a (P4) [Solanum lycopersicum]
Length=159

 Score =   112 bits (280),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 85/128 (66%), Gaps = 7/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG     + + C++V ++   C AQNS QD+L  HN ARA VGVGPM+WD  + + AQNY
Sbjct  1    MGLFNISLLLTCLMVLAIFHSCEAQNSPQDYLAVHNDARAQVGVGPMSWDANLASRAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN RA DC+L HSG+     GEN+A GGG  T ++AV +W +E+  Y++A+N C    G+
Sbjct  61   ANSRAGDCNLIHSGA-----GENLAKGGGDFTGRAAVQLWVSERPDYNYATNQCV--GGK  113

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  114  MCGHYTQV  121



>emb|CAB58263.1| pathogenesis related protein PR-1 [Solanum tuberosum]
Length=159

 Score =   112 bits (279),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 84/128 (66%), Gaps = 7/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG     + + C++V ++   C+AQNS QD+L  HN ARA VGVGPM+WD  + + AQNY
Sbjct  1    MGLFNISLLLTCLMVLAIFHSCDAQNSPQDYLAVHNDARAQVGVGPMSWDAGLASRAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN R  DC+L HSG+     GEN+A G G  T ++AV +W  EK  Y++ +N C+  +GQ
Sbjct  61   ANSRTGDCNLIHSGA-----GENLAKGSGDFTGRAAVQLWVGEKPNYNYGTNQCA--SGQ  113

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  114  VCGHYTQV  121



>gb|KDP37606.1| hypothetical protein JCGZ_06949 [Jatropha curcas]
Length=163

 Score =   112 bits (279),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 86/129 (67%), Gaps = 5/129 (4%)
 Frame = +3

Query  51   KMGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            K+ F  S   +  ++  ++ L   +Q+ +QD+LDAHN ARAAVGVGP++WD TV AYAQN
Sbjct  2    KLSFKNSLFPLFALINLALILPIQSQDQQQDYLDAHNQARAAVGVGPLSWDDTVAAYAQN  61

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YA++RA DC+L HSG     YGEN+A     L+   AV MW  EK YY + SNSCS   G
Sbjct  62   YASQRAGDCNLVHSGG---PYGENLAWSSAELSGTDAVKMWVDEKAYYDYDSNSCS--PG  116

Query  411  QSCGHYTQV  437
            Q CGHYTQV
Sbjct  117  QMCGHYTQV  125



>emb|CAD38276.1| pathogenesis related protein isoform b1 [Solanum phureja]
Length=159

 Score =   112 bits (279),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 84/128 (66%), Gaps = 7/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG     + + C+++ ++   C+AQNS QD+L  HN ARA VGVGPM+WD  + + AQNY
Sbjct  1    MGLFNISLLLTCLMILAIFHSCDAQNSPQDYLAVHNDARAQVGVGPMSWDAGLASRAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN R  DC+L HSG+     GEN+A G G  T ++AV +W  EK  Y++ +N C+  +GQ
Sbjct  61   ANSRTGDCNLIHSGA-----GENLAKGSGDFTGRAAVQLWVGEKPNYNYGTNQCA--SGQ  113

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  114  VCGHYTQV  121



>ref|NP_001275095.1| pathogenesis-related protein 1b precursor [Solanum tuberosum]
 ref|XP_006345693.1| PREDICTED: pathogenesis-related leaf protein 4-like [Solanum 
tuberosum]
 ref|XP_006345695.1| PREDICTED: pathogenesis-related leaf protein 4-like [Solanum 
tuberosum]
 gb|AAL01594.1| pathogenesis-related protein 1b precursor [Solanum tuberosum]
Length=159

 Score =   111 bits (278),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 84/128 (66%), Gaps = 7/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG     + + C++V ++   C+AQNS QD+L  HN ARA VGVGPM+WD  + + AQNY
Sbjct  1    MGLFNISLLLTCLMVLAIFHSCDAQNSPQDYLAVHNDARAQVGVGPMSWDAGLASRAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN R  DC+L HSG+     GEN+A G G  T ++AV +W  EK  Y++ +N C+  +GQ
Sbjct  61   ANSRTGDCNLIHSGA-----GENLAKGTGDFTGRAAVQLWVGEKPNYNYGTNQCA--SGQ  113

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  114  VCGHYTQV  121



>ref|NP_001234128.1| pathogenesis-related protein 1A1 precursor [Solanum lycopersicum]
 sp|Q08697.1|PR1A_SOLLC RecName: Full=Pathogenesis-related protein 1A1; Short=PR-1A1; 
Flags: Precursor [Solanum lycopersicum]
 emb|CAA50596.1| PR-1a1 [Solanum lycopersicum]
Length=175

 Score =   111 bits (278),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 85/125 (68%), Gaps = 5/125 (4%)
 Frame = +3

Query  63   LKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanr  242
            +KS +F+AC + F +     AQ  R++FL+AHNAAR  VGVGPMTWD  + AYAQNYAN+
Sbjct  1    MKSSIFVACFITFIIFHSSQAQTPRENFLNAHNAARRRVGVGPMTWDDGLAAYAQNYANQ  60

Query  243  raaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCG  422
            RA DC + HS      YGEN+AA    L A  AV MWD EK++Y + SN+C+   G+ CG
Sbjct  61   RADDCGMIHSDG---PYGENLAAAFPQLNAAGAVKMWDDEKQWYDYNSNTCA--PGKVCG  115

Query  423  HYTQV  437
            HYTQV
Sbjct  116  HYTQV  120



>dbj|BAD11072.1| pathogenesis-related protein 1 [Capsicum chinense]
Length=161

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 83/127 (65%), Gaps = 7/127 (6%)
 Frame = +3

Query  57   GFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnya  236
            G     + +  +++ ++   C+AQNS QD+L+ HN ARA VGVGPMTWD  + + AQNYA
Sbjct  2    GLFNISLLLVSLMILAIFHSCDAQNSPQDYLEVHNNARAQVGVGPMTWDAGLASRAQNYA  61

Query  237  nrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQS  416
            N R  DC+L HSG      GEN+A GGG  T ++AV +W  EK  Y+H +N C+  +G+ 
Sbjct  62   NSRTGDCNLIHSGP-----GENLAKGGGDFTGRAAVELWVFEKPNYNHGTNQCA--SGKV  114

Query  417  CGHYTQV  437
            CGHYTQV
Sbjct  115  CGHYTQV  121



>emb|CAD60273.1| putative pathogenesis related protein 1 precursor [Vitis vinifera]
Length=161

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 86/128 (67%), Gaps = 6/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  +SP+ + C +  ++A  C AQNS QD+++AHNAARA VGVG +TW+ TV AYAQNY
Sbjct  1    MGLCRSPLALLCFMWLALAHICCAQNSPQDYVNAHNAARAQVGVGSITWNDTVAAYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN+R +DC+L HSG     YGEN+A G G LT   AV +W  EK  Y + SNSC    G 
Sbjct  61   ANKRISDCNLVHSGG---PYGENLAKGSGSLTGTDAVNLWVGEKPNYDYNSNSC---VGG  114

Query  414  SCGHYTQV  437
             C HYTQV
Sbjct  115  ECLHYTQV  122



>gb|ADN43433.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 85/129 (66%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLV-FSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  K  + +   L+  ++A  C AQNS QD++DAHNAARA VGVGPMTW+ TV AYAQN
Sbjct  1    MGLFKISLALXVGLMGLALAHTCCAQNSLQDYVDAHNAARAQVGVGPMTWNNTVAAYAQN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R  DCSL HSG     YGENIA G   LT+  AV MW  EK  Y + SNSC    G
Sbjct  61   YANQRIGDCSLVHSGG---PYGENIAWGSPSLTSTDAVNMWVGEKPNYDYNSNSC---VG  114

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  115  GECGHYTQV  123



>gb|AEH25624.1| pathogenesis-related protein 1-9 [Triticum aestivum]
Length=166

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = +3

Query  126  QNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGENI  305
            QNS QDF+D HNAARA VGVGP+TWD  V AYAQNYA +R  DC L H+   R  YGEN+
Sbjct  24   QNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLIHTPDGR-PYGENL  82

Query  306  AAGGG-PLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
              G G   TA  AV  W +EK+YY H SNSCSAP G SCGHYTQV
Sbjct  83   FGGSGTQWTAADAVNSWVSEKQYYDHGSNSCSAPEGDSCGHYTQV  127



>ref|XP_006345692.1| PREDICTED: pathogenesis-related leaf protein 4-like [Solanum 
tuberosum]
Length=159

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 83/128 (65%), Gaps = 7/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  ++ +F+ C ++ ++   C+AQNS QD+L  HN ARA V VGPM+WD  +   AQ Y
Sbjct  1    MGLFENTLFLICFMILAIFHSCDAQNSPQDYLAVHNNARAQVRVGPMSWDGALATKAQKY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            A+ R  DC+L HSGS     GEN+A G G  T +SA  +W AEK  Y++ +N C+  +G+
Sbjct  61   ADSRRGDCNLIHSGS-----GENLAKGSGDFTGRSASELWVAEKPNYNYDTNKCA--SGK  113

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  114  VCGHYTQV  121



>gb|AHE81273.1| pathogenesis-related protein 1-9, partial [Triticum aestivum]
Length=162

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = +3

Query  126  QNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGENI  305
            QNS QDF+D HNAARA VGVGP+TWD  V AYAQNYA +R  DC L H+   R  YGEN+
Sbjct  20   QNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLIHTPDGR-PYGENL  78

Query  306  AAGGG-PLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
              G G   TA  AV  W +EK+YY H SNSCSAP G SCGHYTQV
Sbjct  79   FGGSGTQWTAADAVNSWVSEKQYYDHGSNSCSAPEGDSCGHYTQV  123



>gb|AHE81252.1| pathogenesis-related protein 1-9 [Triticum aestivum]
Length=166

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = +3

Query  126  QNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGENI  305
            QNS QDF+D HNAARA VGVGP+TWD  V AYAQNYA +R  DC L H+   R  YGEN+
Sbjct  24   QNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLIHTPDGR-PYGENL  82

Query  306  AAGGG-PLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
              G G   TA  AV  W +EK+YY H SNSCSAP G SCGHYTQV
Sbjct  83   FGGSGTQWTAADAVNSWVSEKQYYDHGSNSCSAPEGDSCGHYTQV  127



>ref|NP_001234314.1| pathogenesis-related leaf protein 6 precursor [Solanum lycopersicum]
 sp|P04284.2|PR06_SOLLC RecName: Full=Pathogenesis-related leaf protein 6; Short=P6; 
AltName: Full=Ethylene-induced protein P1; AltName: Full=P14; 
AltName: Full=P14A; AltName: Full=PR protein; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA48672.1| P1(p14) protein [Solanum lycopersicum]
 gb|AAA03616.1| pathogenesis-related protein P6 [Solanum lycopersicum]
 emb|CAA70042.1| PR protein [Solanum lycopersicum]
Length=159

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 84/128 (66%), Gaps = 7/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG     + + C++V ++   C AQNS QD+L  HN ARA VGVGPM+WD  + + AQNY
Sbjct  1    MGLFNISLLLTCLMVLAIFHSCEAQNSPQDYLAVHNDARAQVGVGPMSWDANLASRAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN RA DC+L HSG+     GEN+A GGG  T ++AV +W +E+  Y++A+N C    G+
Sbjct  61   ANSRAGDCNLIHSGA-----GENLAKGGGDFTGRAAVQLWVSERPSYNYATNQCV--GGK  113

Query  414  SCGHYTQV  437
             C HYTQV
Sbjct  114  KCRHYTQV  121



>gb|AEH25634.1| pathogenesis-related protein 1-19 [Triticum aestivum]
 gb|AHE81262.1| pathogenesis-related protein 1-19 [Triticum aestivum]
 gb|AHE81283.1| pathogenesis-related protein 1-19 [Triticum aestivum]
Length=167

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 74/108 (69%), Gaps = 6/108 (6%)
 Frame = +3

Query  123  AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGEN  302
            AQNS QDF+D HNAARA VGVGP+TWD  V AYAQ YA +R  DC L HSG     YGEN
Sbjct  24   AQNSPQDFVDPHNAARANVGVGPVTWDDNVAAYAQKYAEQRRGDCQLVHSGGQ---YGEN  80

Query  303  I---AAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            I     GG   TA  AV  W +EK+YY H SNSCSAPA +SC HYTQV
Sbjct  81   IYGGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSCLHYTQV  128



>gb|KDP37604.1| hypothetical protein JCGZ_06947 [Jatropha curcas]
Length=162

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 85/126 (67%), Gaps = 7/126 (6%)
 Frame = +3

Query  60   FLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyan  239
             L  P+FIA +L+  +    NAQ + +D+L+AHN ARA VG+GPM+WD  V AYAQNYAN
Sbjct  6    LLALPLFIATVLLLPVPF--NAQQTPEDYLNAHNQARAVVGLGPMSWDKKVAAYAQNYAN  63

Query  240  rraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSC  419
            +  ++C+L HS      YGEN+A G G L+ + AV MW  EK YY + SNSC+   GQ C
Sbjct  64   QHVSECNLVHSEG---PYGENLAWGSGDLSVEEAVKMWVDEKTYYDYNSNSCA--PGQVC  118

Query  420  GHYTQV  437
            GHYTQV
Sbjct  119  GHYTQV  124



>gb|KDP37611.1| hypothetical protein JCGZ_06954 [Jatropha curcas]
Length=163

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 85/129 (66%), Gaps = 5/129 (4%)
 Frame = +3

Query  51   KMGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            K+ F  S   +  ++  ++ L   +Q+ +QD+LDAHN AR AVGVGP++WD TV AYAQN
Sbjct  2    KLSFKNSLFPLFALINLALILPIQSQDQQQDYLDAHNQARTAVGVGPLSWDDTVAAYAQN  61

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+RA DC+L HSG     YGEN+A     L+   AV MW  EK YY + SNSCS   G
Sbjct  62   YANQRAGDCNLVHSGG---PYGENLAWSSAELSGTDAVKMWVDEKAYYDYDSNSCS--PG  116

Query  411  QSCGHYTQV  437
            Q CGHYTQV
Sbjct  117  QMCGHYTQV  125



>ref|XP_009769213.1| PREDICTED: pathogenesis-related protein 1C [Nicotiana sylvestris]
 sp|P09042.3|PR1C_TOBAC RecName: Full=Pathogenesis-related protein 1C; Short=PR-1C; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA35666.1| unnamed protein product [Nicotiana tabacum]
Length=168

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 89/127 (70%), Gaps = 7/127 (6%)
 Frame = +3

Query  63   LKSPVFIACMLVF-SMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyan  239
            + S   ++ +L+F  ++  C+AQNS+QD+LDAHN ARA VGV P+TWD  V AYAQNYA+
Sbjct  9    MSSFFLVSTLLLFLIISHSCHAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYAS  68

Query  240  rraaDCSLTHSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQS  416
            + AADC+L HS      YGEN+A G G  LTA  AV MW  EK+YY H SN+C+   GQ 
Sbjct  69   QLAADCNLVHSHG---QYGENLAWGSGDFLTAAKAVEMWVNEKQYYAHDSNTCA--QGQV  123

Query  417  CGHYTQV  437
            CGHYTQV
Sbjct  124  CGHYTQV  130



>emb|CAD38277.1| pathogenesis related protein isoform b2 [Solanum phureja]
Length=159

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 83/128 (65%), Gaps = 7/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG         C++V S+   C+AQNS QD+L  HN ARA VGVGPM+WD  + A AQNY
Sbjct  1    MGLFNISWLFICLMVLSIFHSCDAQNSPQDYLAVHNDARAQVGVGPMSWDAGLAARAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN R  DC+L HSG+     GEN+A GGG  T + AV +W +EK  Y++ +N C+  +G+
Sbjct  61   ANSRIGDCNLIHSGA-----GENLAKGGGDYTGRRAVQLWVSEKPNYNYDTNQCA--SGK  113

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  114  MCGHYTQV  121



>gb|AAZ94265.1| pathogenesis-related 1a [Triticum monococcum]
Length=167

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 75/108 (69%), Gaps = 6/108 (6%)
 Frame = +3

Query  123  AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGEN  302
            AQNS QDF+D HNAARA VGVGP+TWD  V AYAQNYA +R  DC L HSG     YGEN
Sbjct  24   AQNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLVHSGGQ---YGEN  80

Query  303  I---AAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            I     GG   TA  AV  W +EK+YY H SNSCSAPA +SC HYTQV
Sbjct  81   IYGGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSCLHYTQV  128



>emb|CAA29023.1| PR-1c protein [Nicotiana tabacum]
Length=161

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 89/127 (70%), Gaps = 7/127 (6%)
 Frame = +3

Query  63   LKSPVFIACMLVF-SMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyan  239
            + S   ++ +L+F  ++  C+AQNS+QD+LDAHN ARA VGV P+TWD  V AYAQNYA+
Sbjct  2    MSSFFLVSTLLLFLIISHSCHAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYAS  61

Query  240  rraaDCSLTHSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQS  416
            + AADC+L HS      YGEN+A G G  LTA  AV MW  EK+YY H SN+C+   GQ 
Sbjct  62   QLAADCNLVHSHG---QYGENLAWGSGDFLTAAKAVEMWVNEKQYYAHDSNTCA--QGQV  116

Query  417  CGHYTQV  437
            CGHYTQV
Sbjct  117  CGHYTQV  123



>ref|XP_009378591.1| PREDICTED: pathogenesis-related leaf protein 4-like [Pyrus x 
bretschneideri]
Length=161

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 88/128 (69%), Gaps = 5/128 (4%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  K+   + C++  ++    +AQNS QD+L+AHNAARA VGV P++WDT +  YAQ Y
Sbjct  1    MGLWKTSFALVCLISLTLLPSSHAQNSPQDYLNAHNAARAQVGVAPLSWDTNLVNYAQRY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN R  DC+L HSG     YGENIA+ GG L+  +AV ++ +EK  Y++ SN+C+  AG+
Sbjct  61   ANSRIGDCNLVHSGG---PYGENIASSGGDLSGTAAVNLFVSEKANYNYYSNTCA--AGK  115

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  116  MCGHYTQV  123



>emb|CAA31010.1| PR1c preprotein [Nicotiana tabacum]
Length=163

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 89/127 (70%), Gaps = 7/127 (6%)
 Frame = +3

Query  63   LKSPVFIACMLVF-SMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyan  239
            + S   ++ +L+F  ++  C+AQNS+QD+LDAHN ARA VGV P+TWD  V AYAQNYA+
Sbjct  4    MSSFFLVSTLLLFLIISHSCHAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYAS  63

Query  240  rraaDCSLTHSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQS  416
            + AADC+L HS      YGEN+A G G  LTA  AV MW  EK+YY H SN+C+   GQ 
Sbjct  64   QLAADCNLVHSHG---QYGENLAWGSGDFLTAAKAVEMWVNEKQYYAHDSNTCA--QGQV  118

Query  417  CGHYTQV  437
            CGHYTQV
Sbjct  119  CGHYTQV  125



>gb|ADN43432.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   109 bits (273),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 85/129 (66%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  K S   +  ++ F++A  C AQNS QD++D+HNAARA VGVGP+TW+ TV AYAQN
Sbjct  1    MGLFKISLALLVGLMGFALAHTCCAQNSPQDYVDSHNAARAQVGVGPITWNDTVAAYAQN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R  DC+L HSG     YGENIA G   LT   AV MW  EK  Y + SNSC    G
Sbjct  61   YANQRIGDCNLVHSGG---PYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSC---VG  114

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  115  GECGHYTQV  123



>ref|XP_009787159.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nicotiana sylvestris]
Length=179

 Score =   110 bits (274),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 87/129 (67%), Gaps = 8/129 (6%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMAL-CCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG+  S   +AC + F++      AQNS QD+L+AHNAAR  VGVGPMTWD  V A+AQN
Sbjct  1    MGY--STTLVACFITFAILFPSSQAQNSPQDYLNAHNAARRRVGVGPMTWDNRVAAFAQN  58

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+RA DC + HSG     YGEN+AA    L A  AV MW  EK++Y + SNSC+  AG
Sbjct  59   YANQRAGDCRMQHSGG---PYGENLAAAFPQLNAAGAVKMWVDEKQFYDYNSNSCA--AG  113

Query  411  QSCGHYTQV  437
            + CGHYTQV
Sbjct  114  KVCGHYTQV  122



>ref|XP_002274371.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CAN80994.1| hypothetical protein VITISV_042545 [Vitis vinifera]
Length=161

 Score =   109 bits (273),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  K S   +  ++  ++A  C AQNS QD++DAHNAARA VGVG +TW+ TV AYAQN
Sbjct  1    MGLCKISMALLVGLMGLALAHTCCAQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R +DC+L HSG     YGEN+A G G LT   AV +W  EK YY + SNSC    G
Sbjct  61   YANQRISDCNLVHSGG---PYGENLAKGSGSLTGTDAVNLWVGEKPYYDYNSNSC---VG  114

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  115  GECGHYTQV  123



>gb|ADN43431.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   109 bits (272),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 84/129 (65%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  K S   +  ++ F++A  C AQNS QD++D HNAARA VGVGP+TW+ TV AYAQN
Sbjct  1    MGLFKISLALLVGLMGFALAHTCCAQNSPQDYVDPHNAARAQVGVGPITWNDTVAAYAQN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R  DC+L HSG     YGENIA G   LT   AV MW  EK  Y + SNSC    G
Sbjct  61   YANQRIGDCNLVHSGG---PYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSC---VG  114

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  115  GECGHYTQV  123



>ref|XP_006368144.1| PREDICTED: pathogenesis-related protein 1C-like, partial [Solanum 
tuberosum]
Length=153

 Score =   109 bits (272),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 87/131 (66%), Gaps = 13/131 (10%)
 Frame = +3

Query  60   FLKSPVF--IACMLVFSMALC--CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaq  227
            F + P F  +A +LVF + +   C+AQ   QD+LDAHN ARA+VGV P TWD  V AYAQ
Sbjct  6    FSQMPSFFHLASVLVFILIVSHSCHAQ---QDYLDAHNTARASVGVEPFTWDDQVAAYAQ  62

Query  228  nyanrraaDCSLTHSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAP  404
             YA++ A DC+L HS      YGEN+AAG G  +TA  AV MW  EK+YYHH SN+C   
Sbjct  63   QYASQLATDCNLVHSHG---QYGENLAAGSGDFMTATKAVEMWVDEKQYYHHDSNTCD--  117

Query  405  AGQSCGHYTQV  437
             GQ CGHYTQV
Sbjct  118  EGQVCGHYTQV  128



>gb|AHE81259.1| pathogenesis-related protein 1-16 [Triticum aestivum]
Length=167

 Score =   109 bits (273),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 76/112 (68%), Gaps = 6/112 (5%)
 Frame = +3

Query  111  LCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFG  290
            +   AQNS QDF+D HNAARA +GVGP+TWD  V AYAQNYA +R  DC L HSG     
Sbjct  20   VVVTAQNSPQDFVDPHNAARADMGVGPVTWDDNVAAYAQNYAEQRRGDCQLVHSGG---Q  76

Query  291  YGENI---AAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            YGENI     GG   TA  AV  W +EK+YY H SNSCSAPA +SC HYTQV
Sbjct  77   YGENIYGGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSCLHYTQV  128



>gb|AEH25631.1| pathogenesis-related protein 1-16 [Triticum aestivum]
Length=167

 Score =   109 bits (273),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 76/112 (68%), Gaps = 6/112 (5%)
 Frame = +3

Query  111  LCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFG  290
            +   AQNS QDF+D HNAARA +GVGP+TWD  V AYAQNYA +R  DC L HSG     
Sbjct  20   VVVTAQNSPQDFVDPHNAARADMGVGPVTWDDNVAAYAQNYAEQRRGDCQLVHSGG---Q  76

Query  291  YGENI---AAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            YGENI     GG   TA  AV  W +EK+YY H SNSCSAPA +SC HYTQV
Sbjct  77   YGENIYGGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSCLHYTQV  128



>gb|AHE81280.1| pathogenesis-related protein 1-16 [Triticum aestivum]
Length=167

 Score =   109 bits (273),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 76/112 (68%), Gaps = 6/112 (5%)
 Frame = +3

Query  111  LCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFG  290
            +   AQNS QDF+D HNAARA +GVGP+TWD  V AYAQNYA +R  DC L HSG     
Sbjct  20   VVVTAQNSPQDFVDPHNAARADMGVGPVTWDDNVAAYAQNYAEQRRGDCQLVHSGG---Q  76

Query  291  YGENI---AAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            YGENI     GG   TA  AV  W +EK+YY H SNSCSAPA +SC HYTQV
Sbjct  77   YGENIYGGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSCLHYTQV  128



>gb|EMT32398.1| Pathogenesis-related protein PRMS [Aegilops tauschii]
Length=180

 Score =   109 bits (273),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 75/111 (68%), Gaps = 6/111 (5%)
 Frame = +3

Query  111  LCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFG  290
            +   AQNS QDF+D HNAARA VGVGP+TWD  V AYAQNYA +R  DC L HSG     
Sbjct  20   VVVTAQNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLVHSGG---Q  76

Query  291  YGENI---AAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
            YGENI     GG   TA  AV  W +EK+YY H SNSCSAPA +SC HYTQ
Sbjct  77   YGENIYGGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSCLHYTQ  127



>ref|NP_001234358.1| PR1 protein precursor [Solanum lycopersicum]
 gb|ACB88202.1| PR1 protein [Solanum lycopersicum]
Length=179

 Score =   109 bits (273),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 82/120 (68%), Gaps = 5/120 (4%)
 Frame = +3

Query  78   FIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDC  257
             I C L F++     AQNS QD+L+AHNAAR  VGVGPMTWD  + A+AQNYAN+RA DC
Sbjct  8    LIICFLTFAIFHSSQAQNSPQDYLNAHNAARRQVGVGPMTWDNRLAAFAQNYANQRAGDC  67

Query  258  SLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
             + HSG     YGEN+AA    L A  AV MW  EK++Y++ SN+C   AG+ CGHYTQV
Sbjct  68   RMQHSGG---PYGENLAAAFPQLNAAGAVKMWVDEKQWYNYNSNTCQ--AGKVCGHYTQV  122



>ref|XP_010941969.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score =   108 bits (271),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 88/129 (68%), Gaps = 6/129 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            M F      +AC +  +MA    AQNS QDF+ AHNAARAAVGVGP++WD TV AYAQNY
Sbjct  1    MKFSNLTFALACAMFLAMAHTTIAQNSPQDFVSAHNAARAAVGVGPVSWDNTVAAYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGG-PLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            AN+R  DC L HSG     YGEN+  G G   TA  AV +W +EK++Y +++N+C+  AG
Sbjct  61   ANQRIGDCQLVHSGG---PYGENLFWGSGREYTAADAVNLWVSEKQWYDYSTNTCA--AG  115

Query  411  QSCGHYTQV  437
            + CGHYTQV
Sbjct  116  KVCGHYTQV  124



>gb|ADN43435.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   108 bits (271),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 83/129 (64%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  K S   +   +  ++A  C AQNS QD++DAHNAARA VGVGPMTW+ TV AYAQN
Sbjct  1    MGLFKISLALLVGPMGLALAHTCCAQNSPQDYVDAHNAARAQVGVGPMTWNNTVAAYAQN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R  DC+L HSG     YGENIA G   LT   AV MW  EK  Y + SNSC    G
Sbjct  61   YANQRIGDCNLVHSGG---PYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSC---VG  114

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  115  GKCGHYTQV  123



>ref|XP_004246723.1| PREDICTED: pathogenesis-related leaf protein 4-like [Solanum 
lycopersicum]
Length=159

 Score =   108 bits (271),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 81/128 (63%), Gaps = 7/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  ++ +F+ C ++ ++   C+AQNS QD+L  HN AR  VGVGPM+WD  +   AQ Y
Sbjct  1    MGLFENTLFLFCFMILAIFHSCDAQNSPQDYLVVHNNARGQVGVGPMSWDDALATKAQRY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            A+ R  DC+L HSG      GEN+A G G  T + A  +W AEK  Y++ +N C+  +G+
Sbjct  61   ADSRRGDCNLIHSGP-----GENLAKGSGDFTGRRASELWVAEKPNYNYGTNQCA--SGK  113

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  114  VCGHYTQV  121



>dbj|BAA14220.1| PR1a protein precursor [Nicotiana tabacum]
 prf||1501385A pathogenesis related protein PR1a
Length=168

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 78/108 (72%), Gaps = 6/108 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS+QD+LDAHN ARA VGV P+TWD  V AYAQNYA++ AADC+L HS      YG
Sbjct  28   CRAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHSHG---QYG  84

Query  297  ENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+A G G  +TA  AV MW  EK+YY H SN+CS   GQ CGHYTQV
Sbjct  85   ENLAEGSGDFMTAAKAVEMWVDEKQYYDHDSNTCS--QGQVCGHYTQV  130



>ref|XP_006367091.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=179

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 82/120 (68%), Gaps = 5/120 (4%)
 Frame = +3

Query  78   FIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDC  257
             I C L+F++     AQNS QD+L+ HNAAR  VGVGPMTWD  + A+AQNYAN+RA DC
Sbjct  8    LIICFLIFAIFHSSQAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAFAQNYANQRAGDC  67

Query  258  SLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
             + HSG     YGEN+AA    L A  AV MW  EK++Y++ SN+C   AG+ CGHYTQV
Sbjct  68   RMQHSGG---PYGENLAAAFPQLNAAGAVKMWFDEKQWYNYNSNTCQ--AGKVCGHYTQV  122



>ref|XP_002522065.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40265.1| STS14 protein precursor, putative [Ricinus communis]
Length=161

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 78/105 (74%), Gaps = 5/105 (5%)
 Frame = +3

Query  123  AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGEN  302
            AQN  QD+++AHNAARAAVGVGPMTWD TV AYAQNYAN+R  DC L HSG     YGEN
Sbjct  24   AQNLPQDYINAHNAARAAVGVGPMTWDNTVAAYAQNYANQRINDCRLVHSGGR---YGEN  80

Query  303  IAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            IA   G L+  +AV +W  EK +Y++ SN+C+  AGQ CGHYTQV
Sbjct  81   IAWSSGDLSGTAAVKLWVDEKAFYNYNSNTCA--AGQQCGHYTQV  123



>gb|ADN43428.1| pathogenesis-related protein 1 [Vitis shuttleworthii]
Length=160

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 81/128 (63%), Gaps = 6/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  K  +   C++  S+     AQNS+QD+L+AHN ARA VGVG MTW+ TV +YAQNY
Sbjct  1    MGLFKISLVFICLVGLSLVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN+R  DC+L HS      YGENIA G G LT   AV +W  EK  Y + SNSC    G 
Sbjct  61   ANQRIGDCNLVHSNG---PYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSC---VGG  114

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  115  KCGHYTQV  122



>gb|EMS62872.1| Pathogenesis-related protein PRMS [Triticum urartu]
Length=166

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 73/105 (70%), Gaps = 2/105 (2%)
 Frame = +3

Query  126  QNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGENI  305
            QNS QDF+D HNAARA  GVGP+TWD  V AYAQNYA +R  DC L H+   R  YGEN+
Sbjct  24   QNSPQDFVDPHNAARADAGVGPVTWDDNVAAYAQNYAEQRRGDCQLIHTPDGR-PYGENL  82

Query  306  AAGGG-PLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
              G G   TA  AV  W +EK+YY H SNSCSAP G SCGHYTQV
Sbjct  83   FGGSGTQWTAADAVNSWVSEKQYYDHGSNSCSAPEGDSCGHYTQV  127



>gb|KDP37607.1| hypothetical protein JCGZ_06950 [Jatropha curcas]
Length=162

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 85/126 (67%), Gaps = 7/126 (6%)
 Frame = +3

Query  60   FLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyan  239
             L  P+FIA +L+  +    NAQ + +D+L+AHN ARA VG+GPM+WD  V AYAQNYAN
Sbjct  6    LLALPLFIATVLLLPVPF--NAQQTPEDYLNAHNQARAVVGLGPMSWDKKVAAYAQNYAN  63

Query  240  rraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSC  419
            +  ++C+L HS      YGEN+A G G L+ + AV MW  EK YY + SNSC+   G+ C
Sbjct  64   QHVSECNLVHS---EGPYGENLAWGSGDLSGEEAVKMWVDEKTYYDYNSNSCA--PGRVC  118

Query  420  GHYTQV  437
            GHYTQV
Sbjct  119  GHYTQV  124



>gb|ADN43427.1| pathogenesis-related protein 1 [Vitis vinifera]
Length=159

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 84/128 (66%), Gaps = 7/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MGF  S VFI C++  ++     AQNS+QD+L+AHN ARA VGVG MTW+ TV +YAQNY
Sbjct  1    MGFKISLVFI-CLVGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNY  59

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN+R  DC+L HS      YGENIA G G LT   AV +W  EK  Y + SNSC    G 
Sbjct  60   ANQRIGDCNLVHSNG---PYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSC---VGG  113

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  114  KCGHYTQV  121



>gb|KDP37612.1| hypothetical protein JCGZ_06955 [Jatropha curcas]
Length=147

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 84/126 (67%), Gaps = 7/126 (6%)
 Frame = +3

Query  60   FLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyan  239
             L  P+FIA +L+  +    NAQ + +D+L+AHN ARA VG+GPM+WD  V AYAQNYAN
Sbjct  6    LLALPLFIATVLLLPVPF--NAQQTPEDYLNAHNQARAVVGLGPMSWDKKVAAYAQNYAN  63

Query  240  rraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSC  419
            +  ++C+L HS      YGEN+A G G L+ + AV MW  EK YY + SNSC    G+ C
Sbjct  64   QHVSECNLVHSEG---PYGENLAWGSGDLSGEEAVKMWVDEKTYYDYNSNSCV--PGEVC  118

Query  420  GHYTQV  437
            GHYTQV
Sbjct  119  GHYTQV  124



>gb|AGS80328.1| pathogenesis-related protein 1 [Actinidia eriantha]
Length=173

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 86/130 (66%), Gaps = 8/130 (6%)
 Frame = +3

Query  54   MGFL--KSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaq  227
            MG+L   S + +A ++V +M     AQNS QD+L+AHNAARAAVGVGP+ WD  +  YA+
Sbjct  1    MGWLCRMSSLALASLMVLAMVHSSLAQNSPQDYLNAHNAARAAVGVGPIRWDNNLANYAR  60

Query  228  nyanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPA  407
            +YAN R  DC+L HS   +  YGEN+A G   LT + +V MW  EK+YY + SNSC    
Sbjct  61   DYANSRIKDCNLVHS---KGPYGENLAKGFPGLTGRDSVKMWVDEKKYYDYNSNSC---I  114

Query  408  GQSCGHYTQV  437
            G  CGHYTQV
Sbjct  115  GGVCGHYTQV  124



>gb|ADN43417.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 82/128 (64%), Gaps = 6/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  K  +   C++  ++     AQNS+QD+L+AHN ARA VGVG MTW+ TV +YAQNY
Sbjct  1    MGLFKISLVFICLVGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN+R  DC+L HS      YGENIA G G LT   AV +W  EK  Y ++SNSC    G 
Sbjct  61   ANQRIGDCNLVHSNG---PYGENIAWGSGSLTGTDAVNLWVGEKPNYDYSSNSC---VGG  114

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  115  KCGHYTQV  122



>gb|ADN43436.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 84/129 (65%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  K S   +  ++ F++A  C AQNS QD++D HNAARA VGVGP+TW+ TV AYAQN
Sbjct  1    MGLFKISLALLVGLMGFALAHTCCAQNSPQDYVDPHNAARAQVGVGPITWNDTVAAYAQN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R  DC+L HSG     YGENIA G   LT   AV +W  EK  Y + SNSC    G
Sbjct  61   YANQRIGDCNLVHSGG---PYGENIAWGSPSLTGTDAVNLWVGEKPNYDYNSNSC---VG  114

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  115  GKCGHYTQV  123



>gb|ADN43437.1| pathogenesis-related protein 1 [Vitis shuttleworthii]
Length=161

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 84/129 (65%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  K S   +  ++ F++A  C AQNS QD++D HNAARA VGVGP+TW+ TV AYAQN
Sbjct  1    MGLFKISLALLVGLMGFALAHTCCAQNSPQDYVDPHNAARAQVGVGPITWNDTVAAYAQN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R  DC+L HSG     YGENIA G   LT   AV MW  EK  Y + SNSC    G
Sbjct  61   YANQRIGDCNLVHSGG---PYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSC---FG  114

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  115  GECGHYTQV  123



>gb|ADN43419.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 81/128 (63%), Gaps = 6/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  K  +   C+L  ++     AQNS+QD+L+AHN ARA VGVG MTW+ TV +YAQNY
Sbjct  1    MGLFKISLVFICVLGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN+R  DC+L HS      YGENIA G G LT   AV +W  EK  Y + SNSC    G 
Sbjct  61   ANQRIGDCNLVHSNG---PYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSC---VGG  114

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  115  KCGHYTQV  122



>gb|ADN43416.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 81/128 (63%), Gaps = 6/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  K  +   C+L  ++     AQNS+QD+L+AHN ARA VGVG MTW+ TV +YAQNY
Sbjct  1    MGLFKISLVFICVLGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN+R  DC+L HS      YGENIA G G LT   AV +W  EK  Y + SNSC    G 
Sbjct  61   ANQRIGDCNLVHSNG---PYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSC---VGG  114

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  115  KCGHYTQV  122



>gb|ADN43415.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 81/128 (63%), Gaps = 6/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  K  +   C+L  ++     AQNS+QD+L+AHN ARA VGVG MTW+ TV +YAQNY
Sbjct  1    MGLFKISLVFICVLGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN+R  DC+L HS      YGENIA G G LT   AV +W  EK  Y + SNSC    G 
Sbjct  61   ANQRIGDCNLVHSNG---PYGENIAWGSGSLTGTDAVDLWVGEKPNYDYNSNSC---VGG  114

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  115  KCGHYTQV  122



>gb|AAK30143.1|AF348141_1 pathogenesis-related protein PR-1 precursor [Capsicum annuum]
 gb|AAC06244.2| basic PR-1 protein precursor [Capsicum annuum]
 gb|AAU20808.1| basic PR-1 protein precursor [Capsicum annuum]
Length=179

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 81/120 (68%), Gaps = 5/120 (4%)
 Frame = +3

Query  78   FIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDC  257
             I C + F++     AQNS QD+L+AHNAAR  VGVGPMTWD  + A+AQNYAN+R  DC
Sbjct  8    LIVCFITFAIFHSTQAQNSPQDYLNAHNAARRQVGVGPMTWDNRLAAFAQNYANQRIGDC  67

Query  258  SLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
             + HSG     YGEN+AA    L A  AV MW  EK++Y++ SNSC+   G+ CGHYTQV
Sbjct  68   RMQHSGG---PYGENLAAAFPQLNAAGAVKMWVNEKQWYNYNSNSCA--PGKVCGHYTQV  122



>ref|XP_006486820.1| PREDICTED: pathogenesis-related protein 1-like [Citrus sinensis]
Length=163

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 90/131 (69%), Gaps = 10/131 (8%)
 Frame = +3

Query  54   MGFLKS---PVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEaya  224
            MGF K+   P+F  C+L  ++ L  +AQ+S QD+++AHNAARA VGVGP+TWD  V +YA
Sbjct  1    MGFSKNSSLPLF--CILGLALILSSHAQDSPQDYVNAHNAARAQVGVGPVTWDDRVASYA  58

Query  225  qnyanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAP  404
            QNYAN+R  DC+L HSG     YGEN+A     L+   AV +W  EK  YH+ SN+C+  
Sbjct  59   QNYANQRKGDCNLVHSGG---PYGENLAWSSAGLSGTDAVKLWVNEKADYHYNSNTCA--  113

Query  405  AGQSCGHYTQV  437
            AG+ CGHYTQV
Sbjct  114  AGKVCGHYTQV  124



>gb|KDP35900.1| hypothetical protein JCGZ_09872 [Jatropha curcas]
Length=160

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 85/119 (71%), Gaps = 5/119 (4%)
 Frame = +3

Query  81   IACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCS  260
            + C++  ++ +  +AQ+S QD+++AHN ARAAVGVGP+TWD TV AYA+NYANR   DC 
Sbjct  9    LICLMSVTLIIPLHAQDSPQDYVNAHNTARAAVGVGPVTWDNTVAAYARNYANRHIGDCR  68

Query  261  LTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            L HSG     YGEN+A   G L+  +AV +W  EK +Y++ SN+C+  AG+ CGHYTQV
Sbjct  69   LVHSGG---PYGENLAGSSGYLSGTAAVKLWVDEKAFYNYNSNTCA--AGKVCGHYTQV  122



>gb|KDP37603.1| hypothetical protein JCGZ_06946 [Jatropha curcas]
Length=157

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 79/112 (71%), Gaps = 5/112 (4%)
 Frame = +3

Query  102  SMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSF  281
            S+ L   +Q+ +QD+LDAHN ARAAVGVGP++WD TV AYAQNYA++RA DC+L HSG  
Sbjct  13   SLILPIQSQDQQQDYLDAHNQARAAVGVGPLSWDDTVAAYAQNYASQRAGDCNLVHSGG-  71

Query  282  RFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
               YGEN+A     L+   AV MW  EK YY + SNSCS   GQ CGHYTQV
Sbjct  72   --PYGENLAWSSAELSGTDAVKMWVDEKAYYDYDSNSCS--PGQMCGHYTQV  119



>ref|XP_009610821.1| PREDICTED: pathogenesis-related protein 1B [Nicotiana tomentosiformis]
 sp|P07053.1|PR1B_TOBAC RecName: Full=Pathogenesis-related protein 1B; Short=PR-1B; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA35665.1| unnamed protein product [Nicotiana tabacum]
 dbj|BAA14221.1| PR1b protein precursor [Nicotiana tabacum]
 emb|CAA27183.1| PR-1b precursor; (aa -30-138) [Nicotiana tabacum]
 prf||1203245A protein 1b,pathogenesis related
Length=168

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 91/135 (67%), Gaps = 12/135 (9%)
 Frame = +3

Query  54   MGFL---KSPVF--IACMLVF-SMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVE  215
            MGF    + P F  ++ +L+F  ++   +AQNS+QD+LDAHN ARA VGV P+TWD  V 
Sbjct  1    MGFFLFSQMPSFFLVSTLLLFLIISHSSHAQNSQQDYLDAHNTARADVGVEPLTWDNGVA  60

Query  216  ayaqnyanrraaDCSLTHSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNS  392
            AYAQNY ++ AADC+L HS      YGEN+A G G  +TA  AV MW  EK+YY H SN+
Sbjct  61   AYAQNYVSQLAADCNLVHSHG---QYGENLAQGSGDFMTAAKAVEMWVDEKQYYDHDSNT  117

Query  393  CSAPAGQSCGHYTQV  437
            C+   GQ CGHYTQV
Sbjct  118  CA--QGQVCGHYTQV  130



>ref|XP_008798895.1| PREDICTED: pathogenesis-related protein 1-like [Phoenix dactylifera]
Length=162

 Score =   107 bits (268),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 88/128 (69%), Gaps = 6/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG     +F+   +  ++    +AQNS QDF++ HNAARAAVGVGP++W+ TV AYAQ+Y
Sbjct  1    MGMSSIALFMISAMALAIVPISHAQNSPQDFINPHNAARAAVGVGPVSWNATVAAYAQDY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            AN+R ADC L HS      YGENI  GGGP  TA  AV  W +EK+YY +ASNSC AP+ 
Sbjct  61   ANKRKADCELVHSNG---PYGENIFWGGGPGWTAADAVNDWVSEKQYYDYASNSC-APS-  115

Query  411  QSCGHYTQ  434
            Q CGHYTQ
Sbjct  116  QVCGHYTQ  123



>emb|CAA29022.1| PR-1b protein [Nicotiana tabacum]
Length=164

 Score =   107 bits (268),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 89/130 (68%), Gaps = 9/130 (7%)
 Frame = +3

Query  60   FLKSPVF--IACMLVF-SMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            F + P F  ++ +L+F  ++   +AQNS+QD+LDAHN ARA VGV P+TWD  V AYAQN
Sbjct  2    FSQMPSFFLVSTLLLFLIISHSSHAQNSQQDYLDAHNTARADVGVEPLTWDNGVAAYAQN  61

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPA  407
            Y ++ AADC+L HS      YGEN+A G G  +TA  AV MW  EK+YY H SN+C+   
Sbjct  62   YVSQLAADCNLVHSHG---QYGENLAQGSGDFMTAAKAVEMWVDEKQYYDHDSNTCA--Q  116

Query  408  GQSCGHYTQV  437
            GQ CGHYTQV
Sbjct  117  GQVCGHYTQV  126



>gb|ADN43434.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   107 bits (268),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 84/129 (65%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  K S   +  ++ F++A  C AQNS QD++D HNAA+A VGVGP+TW+ TV AYAQN
Sbjct  1    MGLFKISLALLVGLMGFALAHTCCAQNSPQDYVDPHNAAQAQVGVGPITWNDTVAAYAQN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R  DC+L HSG     YGENIA G   LT   AV MW  EK  Y + SNSC    G
Sbjct  61   YANQRIGDCNLVHSGG---PYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSC---VG  114

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  115  GKCGHYTQV  123



>emb|CAA31008.1| PR1a preprotein [Nicotiana tabacum]
Length=165

 Score =   107 bits (268),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 78/108 (72%), Gaps = 6/108 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS+QD+LDAHN ARA VGV P+TWD  V AYAQNYA++ AADC+L HS      YG
Sbjct  25   CRAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS---HGQYG  81

Query  297  ENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+A G G  +TA  AV MW  EK+YY H SN+C+   GQ CGHYTQV
Sbjct  82   ENLAEGSGDFMTAAKAVEMWVDEKQYYDHDSNTCA--QGQVCGHYTQV  127



>emb|CAA30017.1| unnamed protein product [Nicotiana tabacum]
Length=168

 Score =   107 bits (268),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 78/108 (72%), Gaps = 6/108 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS+QD+LDAHN ARA VGV P+TWD  V AYAQNYA++ AADC+L HS      YG
Sbjct  28   CRAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHSHG---QYG  84

Query  297  ENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+A G G  +TA  AV MW  EK+YY H SN+C+   GQ CGHYTQV
Sbjct  85   ENLAEGSGDFMTAAKAVEMWVNEKQYYDHDSNTCA--QGQVCGHYTQV  130



>sp|P08299.1|PR1A_TOBAC RecName: Full=Pathogenesis-related protein 1A; Short=PR-1A; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA31233.1| unnamed protein product [Nicotiana tabacum]
 emb|CAA29392.1| PR-1a precursor (AA -30 to 138) [Nicotiana tabacum]
 emb|CAA29660.1| PR1a precursor (AA -30 to -1) [Nicotiana tabacum]
Length=168

 Score =   107 bits (268),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 78/108 (72%), Gaps = 6/108 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS+QD+LDAHN ARA VGV P+TWD  V AYAQNYA++ AADC+L HS      YG
Sbjct  28   CRAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHSHG---QYG  84

Query  297  ENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+A G G  +TA  AV MW  EK+YY H SN+C+   GQ CGHYTQV
Sbjct  85   ENLAEGSGDFMTAAKAVEMWVDEKQYYDHDSNTCA--QGQVCGHYTQV  130



>ref|XP_002273416.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 gb|ADN43420.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43421.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43422.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43423.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43424.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43425.1| pathogenesis-related protein 1 [Vitis vinifera]
Length=160

 Score =   107 bits (267),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 81/128 (63%), Gaps = 6/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  K  +   C++  ++     AQNS+QD+L+AHN ARA VGVG MTW+ TV +YAQNY
Sbjct  1    MGLFKISLVFICLVGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN+R  DC+L HS      YGENIA G G LT   AV +W  EK  Y + SNSC    G 
Sbjct  61   ANQRIGDCNLVHSNG---PYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSC---VGG  114

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  115  KCGHYTQV  122



>gb|AHA43767.1| pathogenesis related protein 1 isoform 4 [Morus alba var. multicaulis]
 gb|AHW81905.1| pathogenesis-related protein [Morus alba var. atropurpurea]
Length=171

 Score =   107 bits (268),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 79/129 (61%), Gaps = 4/129 (3%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  + S   + C+L   +   C AQ + QDFLD HN ARA VGVGPMTWD +V AYA+N
Sbjct  1    MGLSRISLALVICILGLGVIELCYAQTTPQDFLDPHNRARAKVGVGPMTWDDSVAAYARN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R  DC L HSG     YGENIA   G L+A  AV MW AEK  Y + SN+C     
Sbjct  61   YANQRQGDCKLVHSGG---PYGENIAWSSGDLSAAGAVGMWVAEKSLYDYYSNTCVGQNP  117

Query  411  QSCGHYTQV  437
              C HYTQV
Sbjct  118  MGCLHYTQV  126



>ref|XP_009798466.1| PREDICTED: pathogenesis-related protein 1A [Nicotiana sylvestris]
Length=168

 Score =   107 bits (268),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 78/108 (72%), Gaps = 6/108 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS+QD+LDAHN ARA VGV P+TWD  V AYAQNYA++ AADC+L HS      YG
Sbjct  28   CRAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHSHG---QYG  84

Query  297  ENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+A G G  +TA  AV MW  EK+YY H SN+C+   GQ CGHYTQV
Sbjct  85   ENLAEGSGDFMTAAKAVEMWVDEKQYYDHDSNTCA--QGQVCGHYTQV  130



>gb|ADN43418.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43426.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   107 bits (267),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 81/128 (63%), Gaps = 6/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  K  +   C++  ++     AQNS+QD+L+AHN ARA VGVG MTW+ TV +YAQNY
Sbjct  1    MGLFKISLVFICLVGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN+R  DC+L HS      YGENIA G G LT   AV +W  EK  Y + SNSC    G 
Sbjct  61   ANQRIGDCNLVHSNG---PYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSC---VGG  114

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  115  KCGHYTQV  122



>gb|AEL99925.1| pathogenesis-related protein 1 [Nicotiana benthamiana]
Length=160

 Score =   107 bits (267),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 78/108 (72%), Gaps = 6/108 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS+QD+LDAHN ARA VGV P+TWD  V AYAQNYA++ AADC+L HS      YG
Sbjct  20   CRAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS---HGQYG  76

Query  297  ENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+A G G  +TA  AV MW  EK+YY H SN+C+   GQ CGHYTQV
Sbjct  77   ENLAEGSGDFMTAAKAVEMWVDEKQYYDHDSNTCA--QGQVCGHYTQV  122



>gb|AHW81904.1| pathogenesis-related protein [Morus alba var. atropurpurea]
Length=171

 Score =   107 bits (267),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 79/129 (61%), Gaps = 4/129 (3%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  + S   + C+L   +   C AQ + QDFLD HN ARA VGVGPMTWD +V AYA+N
Sbjct  1    MGLSRISLALVICILGLGVIELCYAQTTPQDFLDPHNRARAKVGVGPMTWDDSVAAYARN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R  DC L HSG     YGENIA   G L+A  AV MW AEK  Y + SN+C     
Sbjct  61   YANQRQGDCKLVHSGG---PYGENIAWSSGDLSAAGAVGMWVAEKSLYDYYSNTCVGRNP  117

Query  411  QSCGHYTQV  437
              C HYTQV
Sbjct  118  MGCLHYTQV  126



>ref|XP_010245650.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=163

 Score =   107 bits (267),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 80/121 (66%), Gaps = 8/121 (7%)
 Frame = +3

Query  75   VFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            +F+  + +F   + C+AQ+S +D+L AHN  R+ VGVGP+TWD+ V AYA NYA++R  D
Sbjct  13   LFLLVLTLFH--VLCHAQDSPEDYLHAHNIVRSEVGVGPLTWDSKVAAYAHNYASQRIGD  70

Query  255  CSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
            C L HS      YGENIA GG P     AV MW +EK+YY +ASNSC    G  CGHYTQ
Sbjct  71   CKLEHSDG---PYGENIAGGGDPFPGVDAVKMWASEKQYYDYASNSC---IGGECGHYTQ  124

Query  435  V  437
            V
Sbjct  125  V  125



>ref|XP_004230669.1| PREDICTED: pathogenesis-related leaf protein 6 [Solanum lycopersicum]
Length=164

 Score =   107 bits (267),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 87/131 (66%), Gaps = 8/131 (6%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMAL--CCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaq  227
            M   KS   + C ++ +  L   C+AQNS+ D+L+ HN+AR+ VGVG +TW+TT+E YAQ
Sbjct  1    MALFKSSNVLICFIILAFVLPYYCDAQNSQTDYLNTHNSARSQVGVGAITWNTTLENYAQ  60

Query  228  nyanrraaDCSLTHSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAP  404
            NYAN+R +DC+L HS      YGENIA G G  +T  +AV +W  EK YY + SNSC+  
Sbjct  61   NYANQRISDCNLVHSNG---PYGENIAKGSGSFMTGTAAVNLWVGEKPYYDYNSNSCT--  115

Query  405  AGQSCGHYTQV  437
             G+ C HYTQV
Sbjct  116  GGKECRHYTQV  126



>ref|XP_010904557.1| PREDICTED: pathogenesis-related protein 1-like [Elaeis guineensis]
Length=163

 Score =   107 bits (266),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 85/120 (71%), Gaps = 6/120 (5%)
 Frame = +3

Query  81   IACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCS  260
            + C +  +M    +AQNS +DF++ HNAARAAVGVGP++W+ TV AYAQ+YA++R ADC 
Sbjct  10   MICAMALAMVPISHAQNSPEDFINLHNAARAAVGVGPVSWNDTVAAYAQDYADKRKADCQ  69

Query  261  LTHSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            L HS      YGENI  GGGP  TA  AV  W +E++YY +ASNSC+   GQ CGHYTQV
Sbjct  70   LVHSDGT---YGENIFWGGGPGWTATVAVNDWVSERQYYDYASNSCA--VGQVCGHYTQV  124



>ref|XP_010904546.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=163

 Score =   107 bits (266),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 85/129 (66%), Gaps = 6/129 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG     +   C +  ++     AQNS QDF++ HNAARAAVGVGP++W+  V AYAQ+Y
Sbjct  1    MGISSLVLSTICAMALALVSISQAQNSPQDFINPHNAARAAVGVGPVSWNDAVAAYAQDY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            AN+R ADC L HS      YGENI  GGGP  TA  AV  W +E++YY +ASNSC+   G
Sbjct  61   ANKRKADCQLVHSNG---PYGENIFWGGGPGWTATVAVNDWVSERQYYDYASNSCA--VG  115

Query  411  QSCGHYTQV  437
            Q CGHYTQV
Sbjct  116  QVCGHYTQV  124



>ref|XP_010500562.1| PREDICTED: pathogenesis-related leaf protein 6-like [Camelina 
sativa]
Length=160

 Score =   107 bits (266),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 81/128 (63%), Gaps = 6/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            M   K+P  +   + F + +  NAQNS+QD+L AHN ARA VGV  + WDTTV  YA NY
Sbjct  1    MNTFKTPSLLIVAISF-LVIATNAQNSQQDYLTAHNNARAQVGVANLVWDTTVATYALNY  59

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN R A+CSL HS      YGEN+A G G  TA +AV +W  EK YY + +N+C+   GQ
Sbjct  60   ANTRKANCSLIHSNG---PYGENLAKGSGNFTAIAAVKLWVDEKPYYSYTTNACT--GGQ  114

Query  414  SCGHYTQV  437
             C HYTQV
Sbjct  115  QCLHYTQV  122



>ref|XP_002522071.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40271.1| STS14 protein precursor, putative [Ricinus communis]
Length=164

 Score =   107 bits (266),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 88/131 (67%), Gaps = 8/131 (6%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMAL-CCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaq  227
            MG LK S V ++ ++  ++ +  C+AQNS+QD+LDAHNAARA VGV  + WD TV  YAQ
Sbjct  1    MGSLKISQVLVSLLMGLALVVHPCHAQNSQQDYLDAHNAARAQVGVANIVWDNTVATYAQ  60

Query  228  nyanrraaDCSLTHSGSFRFGYGENIAAG-GGPLTAKSAVAMWDAEKRYYHHASNSCSAP  404
            NYAN R  DC+L HS      YGEN+A G    LT  +AV +W AEK YY++ SNSC+  
Sbjct  61   NYANSRIGDCNLVHSSG---SYGENLAKGSSSSLTGTAAVNLWVAEKPYYNYTSNSCT--  115

Query  405  AGQSCGHYTQV  437
             GQ C HYTQV
Sbjct  116  GGQQCLHYTQV  126



>gb|AHE81254.1| pathogenesis-related protein 1-11 [Triticum aestivum]
Length=169

 Score =   107 bits (266),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 87/132 (66%), Gaps = 11/132 (8%)
 Frame = +3

Query  60   FLKSPVFIACMLVFSMALC----CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaq  227
            +  S +  + +L F+MA      C AQN+  DF+  HN++RA VGVGP+TWDTTV  YA 
Sbjct  4    YYSSKLAWSLVLAFAMAAAITSPCAAQNAPADFVSLHNSSRALVGVGPVTWDTTVANYAL  63

Query  228  nyanrraaDCSLTHSGSFRFGYGENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSA  401
            +YAN+R ADCSL HSG     YGENI  G  GG  TA SAV MW  EK++Y +A+N+C+ 
Sbjct  64   SYANQRKADCSLVHSGG---TYGENILWGSAGGTWTASSAVTMWTDEKQFYDYATNTCA-  119

Query  402  PAGQSCGHYTQV  437
               + CGHYTQV
Sbjct  120  -TNKVCGHYTQV  130



>ref|XP_008798894.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Phoenix 
dactylifera]
Length=162

 Score =   106 bits (265),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 84/120 (70%), Gaps = 6/120 (5%)
 Frame = +3

Query  81   IACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCS  260
            + C + F M     AQNS +DF+ AHNAARAAV VGP++WD+TV AYAQNYAN+R  DC 
Sbjct  10   LVCAMAFCMVGTTIAQNSPEDFVSAHNAARAAVNVGPVSWDSTVAAYAQNYANQRIGDCK  69

Query  261  LTHSGSFRFGYGENIAAG-GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            L HSG     YGEN+  G G  +TA  AV +W  EK++Y++ SN+C+  AG+ CGHYTQV
Sbjct  70   LVHSGG---PYGENLVGGPGAEVTAADAVKLWVGEKQWYNYNSNTCA--AGKVCGHYTQV  124



>ref|XP_010941968.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score =   106 bits (265),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 86/129 (67%), Gaps = 6/129 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            M F      +AC +  +MA    AQNS QDF+ AHNAARAAVGVGP++WD TV AYAQNY
Sbjct  1    MKFSNLTFALACAMFLAMAHTTIAQNSPQDFVSAHNAARAAVGVGPVSWDNTVAAYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGG-PLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            AN+R  DC L HSG     YGEN+  G G   TA  AV  W +EK++Y + +N+C+  AG
Sbjct  61   ANQRIGDCQLVHSGG---PYGENLFWGSGREYTAADAVNSWVSEKQWYDYNTNTCA--AG  115

Query  411  QSCGHYTQV  437
            + CGHYTQV
Sbjct  116  KVCGHYTQV  124



>ref|XP_010530686.1| PREDICTED: pathogenesis-related protein 1-like [Tarenaya hassleriana]
Length=157

 Score =   106 bits (264),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 81/121 (67%), Gaps = 5/121 (4%)
 Frame = +3

Query  75   VFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            + +   LV ++     AQ+  QD++DAHN ARA VGVGP+ WD TV AYA++YAN+R  D
Sbjct  4    LILVIALVLALVGPMRAQDQPQDYVDAHNQARAEVGVGPIEWDETVAAYARDYANQRRGD  63

Query  255  CSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
            CSLTHS      YGENIA GGG L+  +AV MW  EK  Y + +N+C   AG+ CGHYTQ
Sbjct  64   CSLTHSSG---PYGENIAWGGGDLSGTAAVKMWVDEKADYDYNTNTCR--AGKQCGHYTQ  118

Query  435  V  437
            +
Sbjct  119  I  119



>ref|XP_002459696.1| hypothetical protein SORBIDRAFT_02g008970 [Sorghum bicolor]
 gb|EER96217.1| hypothetical protein SORBIDRAFT_02g008970 [Sorghum bicolor]
Length=169

 Score =   106 bits (265),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 79/107 (74%), Gaps = 5/107 (5%)
 Frame = +3

Query  123  AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGEN  302
            AQN+ QDF++ HN+ RA VGVG +TW+TTV AYAQ+YAN+RA DC L HSG     YGEN
Sbjct  27   AQNTAQDFVNLHNSPRADVGVGSVTWNTTVAAYAQSYANQRAGDCRLVHSGG---PYGEN  83

Query  303  IAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            +  G  G    A  AV  W AEK+YY HA+N+CSAP+GQSCGHYTQV
Sbjct  84   LFWGSAGYAWAASDAVGSWVAEKQYYDHATNTCSAPSGQSCGHYTQV  130



>emb|CAA31009.1| PR1b preprotein [Nicotiana tabacum]
Length=153

 Score =   106 bits (264),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 81/117 (69%), Gaps = 6/117 (5%)
 Frame = +3

Query  90   MLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTH  269
            +L   ++   +AQNS+QD+LDAHN ARA VGV P+TWD  V AYAQNY ++ AADC+L H
Sbjct  4    LLFLIISHSSHAQNSQQDYLDAHNTARADVGVEPLTWDNGVAAYAQNYVSQLAADCNLVH  63

Query  270  SGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            S      YGEN+A G G  +TA  AV MW  EK+YY H SN+C+   GQ CGHYTQV
Sbjct  64   S---HGQYGENLAQGSGDFMTAAKAVEMWVDEKQYYDHDSNTCA--QGQVCGHYTQV  115



>ref|XP_007041421.1| CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 
1 protein) superfamily protein [Theobroma cacao]
 gb|EOX97252.1| CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 
1 protein) superfamily protein [Theobroma cacao]
Length=159

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 79/123 (64%), Gaps = 5/123 (4%)
 Frame = +3

Query  69   SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrra  248
            S + +AC+++ S AL   A+  +Q+FLDA N ARA V V PM WD  V AYAQ YAN+R 
Sbjct  4    SKLALACLIIVSFALPSLAKTLKQEFLDAQNEARAEVNVEPMAWDAQVAAYAQEYANQRI  63

Query  249  aDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHY  428
            ADC L HSG     YGENIA G   L+   AV MW  EK YY H SN+C+  +GQ C HY
Sbjct  64   ADCDLVHSGG---PYGENIAWGSDDLSVADAVKMWVDEKVYYDHGSNTCA--SGQVCAHY  118

Query  429  TQV  437
            TQV
Sbjct  119  TQV  121



>gb|AHE81275.1| pathogenesis-related protein 1-11 [Triticum aestivum]
Length=169

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 87/132 (66%), Gaps = 11/132 (8%)
 Frame = +3

Query  60   FLKSPVFIACMLVFSMALC----CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaq  227
            +  S +  + +L F+MA      C AQN+  DF+  HN++RA VGVGP+TWDTTV  YA 
Sbjct  4    YYSSKLAWSLVLAFAMAAAITSPCAAQNAPADFVSLHNSSRALVGVGPVTWDTTVANYAL  63

Query  228  nyanrraaDCSLTHSGSFRFGYGENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSA  401
            +YAN+R ADCSL HSG     YGENI  G  GG  TA SAV MW  EK++Y +A+N+C+ 
Sbjct  64   SYANQRKADCSLVHSGG---TYGENIFWGSAGGTWTASSAVTMWTDEKQFYDYATNTCA-  119

Query  402  PAGQSCGHYTQV  437
               + CGHYTQV
Sbjct  120  -TNKVCGHYTQV  130



>ref|XP_006658251.1| PREDICTED: uncharacterized protein LOC102701282 [Oryza brachyantha]
Length=376

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 81/127 (64%), Gaps = 7/127 (6%)
 Frame = +3

Query  78   FIACMLVFSMALCCN-AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
             +  M V +M +  + AQNS +DF+D HNAARAAVGVGP+TWD  V  YA  YA +RA D
Sbjct  211  MVMAMAVSAMMVTTSMAQNSAKDFVDLHNAARAAVGVGPVTWDAKVAEYAAGYARQRAGD  270

Query  255  CSLTHSGSFRFGYGENIAAG--GGPLTAKSAVAM----WDAEKRYYHHASNSCSAPAGQS  416
            C + HSG     YGEN+  G  G   TA  AV      W  EK++YHHA N CSAPAG++
Sbjct  271  CKMVHSGGKNGAYGENLWWGSAGRAWTAADAVTKSDFAWVKEKQWYHHAGNRCSAPAGKT  330

Query  417  CGHYTQV  437
            C HYTQV
Sbjct  331  CYHYTQV  337


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = +3

Query  66   KSPVFIACMLVFSM-ALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanr  242
            K  V I+ M+   + A    AQ ++QD +D HN  RA VGVGP+TWD TV AYAQ YA  
Sbjct  103  KKAVLISLMIAIGVFATSSMAQVTQQDLVDLHNVVRADVGVGPVTWDDTVAAYAQAYAKD  162

Query  243  raaDCSLTHSGSFRFGYGENIAAG  314
            R  DC L HS S    YGEN+  G
Sbjct  163  RRGDCKLQHSNS-GGKYGENLFRG  185



>ref|XP_007148301.1| hypothetical protein PHAVU_006G196900g [Phaseolus vulgaris]
 gb|ESW20295.1| hypothetical protein PHAVU_006G196900g [Phaseolus vulgaris]
Length=183

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 83/131 (63%), Gaps = 9/131 (7%)
 Frame = +3

Query  54   MGFLKSPVF--IACMLVFS-MALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEaya  224
            MG    P+   +A +L  S ++  C+AQNS QDFL+AHN AR+ VGVGPM WD TV ++A
Sbjct  1    MGLPMIPMLPLVAILLATSTLSQICDAQNSPQDFLNAHNTARSQVGVGPMRWDATVASFA  60

Query  225  qnyanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAP  404
            QNY N+   +C + HSG     YGEN+A   G LTA +AV +W  EK YY + SN+C   
Sbjct  61   QNYVNKLKGNCKMVHSGG---PYGENLAWSSGDLTATAAVKLWVGEKPYYDYNSNTC---  114

Query  405  AGQSCGHYTQV  437
             G  C HYTQV
Sbjct  115  VGGECRHYTQV  125



>gb|EMS35766.1| Pathogenesis-related protein PRMS [Triticum urartu]
Length=166

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 80/113 (71%), Gaps = 6/113 (5%)
 Frame = +3

Query  108  ALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRF  287
            A+   AQNS QDF+DAHNAARA VG+G +TWD TV A+AQ+YA++R  DC L HSG    
Sbjct  18   AMAVTAQNSEQDFVDAHNAARADVGLGEVTWDATVAAFAQDYADQRRGDCQLVHSGG---  74

Query  288  GYGENI---AAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
             YGEN+     GG   TA  AV  W +EK+YY H+SNSCSAPA +SC HYTQV
Sbjct  75   QYGENLYGGGGGGTGWTAMDAVNSWVSEKQYYDHSSNSCSAPADKSCLHYTQV  127



>sp|P11670.1|PRB1_TOBAC RecName: Full=Basic form of pathogenesis-related protein 1; Short=PRP 
1; Flags: Precursor [Nicotiana tabacum]
 emb|CAA32228.1| PRP 1 precursor (AA -23 to 154) [Nicotiana tabacum]
 prf||1807333A pathogenesis-related protein 1
Length=177

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 83/129 (64%), Gaps = 9/129 (7%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMAL-CCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MGFL +   +AC + F++ +    AQNS QD+L+ HNAAR  VGVGPMTWD  + AYAQN
Sbjct  1    MGFLTT--IVACFITFAILIHSSKAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAYAQN  58

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R  DC + HS      YGEN+AA    L A  AV MW  EKR+Y + SNSC    G
Sbjct  59   YANQRIGDCGMIHSHG---PYGENLAAAFPQLNAAGAVKMWVDEKRFYDYNSNSC---VG  112

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  113  GVCGHYTQV  121



>ref|XP_009605696.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nicotiana tomentosiformis]
Length=179

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 87/129 (67%), Gaps = 8/129 (6%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMAL-CCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG+  S   +AC + F++      AQNS QD+L+ HNAAR  VGVGPMTWD  + A+AQN
Sbjct  1    MGY--STTLVACFITFAILFHSSQAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAFAQN  58

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+RA DC + HSG     YGEN+AA    L A  AV MW  EK++Y++ SN+C+  AG
Sbjct  59   YANQRAGDCRMQHSGG---PYGENLAAAYPQLHAAGAVKMWVDEKQFYNYNSNTCA--AG  113

Query  411  QSCGHYTQV  437
            + CGHYTQV
Sbjct  114  KVCGHYTQV  122



>ref|XP_010941967.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 86/129 (67%), Gaps = 6/129 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            M F      +AC +  +MA    AQNS QDF+ AHNAARAAVGVGP++WD TV AYAQNY
Sbjct  1    MKFSNLTFALACAVFLAMAHTTIAQNSPQDFVSAHNAARAAVGVGPVSWDDTVAAYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAG-GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            AN+R  DC L HSG     YGEN+  G G   TA  AV  W +EK++Y + +N+C+  AG
Sbjct  61   ANQRIGDCKLVHSGG---PYGENLFWGLGKEYTAADAVNSWVSEKQWYDYNTNTCA--AG  115

Query  411  QSCGHYTQV  437
            + CGHYTQV
Sbjct  116  KVCGHYTQV  124



>gb|AEH25623.1| pathogenesis-related protein 1-8 [Triticum aestivum]
 gb|AHE81251.1| pathogenesis-related protein 1-8 [Triticum aestivum]
 gb|AHE81272.1| pathogenesis-related protein 1-8 [Triticum aestivum]
Length=168

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 79/113 (70%), Gaps = 4/113 (4%)
 Frame = +3

Query  108  ALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRF  287
            A+    QNS QDF+DAHNAARA VG+G +TWD TV A+AQ+YA++R  DC L H+   R 
Sbjct  18   AMAVTGQNSEQDFVDAHNAARADVGLGEVTWDATVAAFAQDYADQRRGDCQLIHTPDGR-  76

Query  288  GYGENI---AAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
             YGEN+     GG   TA  AV  W +EK+YY H SN+CSAP G+SCGHYTQV
Sbjct  77   PYGENLYGGGGGGTEWTATDAVNSWVSEKQYYDHDSNTCSAPEGESCGHYTQV  129



>ref|XP_008455064.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Cucumis 
melo]
Length=164

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 81/117 (69%), Gaps = 5/117 (4%)
 Frame = +3

Query  87   CMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLT  266
            C+L F M     AQ+S +DF++AHNAARA VGVGP+ WD  V ++A+ YAN+R  DC L 
Sbjct  14   CVLTFIMLPSSLAQDSPRDFVNAHNAARAQVGVGPVHWDERVASFARQYANQRINDCRLV  73

Query  267  HSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            HSG     YGENIA G   L+  +AV MW  EK++Y++ SN+C+  AG+ CGHYTQV
Sbjct  74   HSGG---PYGENIAWGMPDLSGTAAVQMWVNEKQFYNYGSNTCA--AGKVCGHYTQV  125



>ref|XP_010478439.1| PREDICTED: pathogenesis-related leaf protein 6-like [Camelina 
sativa]
Length=160

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 80/128 (63%), Gaps = 6/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            M   K+P  +   + F + +  NAQNS+QD+L AHN AR  VGV  + WDTTV  YA NY
Sbjct  1    MNTFKTPSLLIVAISF-LVIATNAQNSQQDYLTAHNNARTQVGVANLVWDTTVATYALNY  59

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN R A+CSL HS      YGEN+A G G  TA +AV +W  EK YY + +N+C+   GQ
Sbjct  60   ANTRKANCSLIHSNG---PYGENLAKGSGNFTAIAAVKLWVDEKPYYSYTTNACT--GGQ  114

Query  414  SCGHYTQV  437
             C HYTQV
Sbjct  115  QCLHYTQV  122



>gb|ABA34060.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
Length=163

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 82/125 (66%), Gaps = 11/125 (9%)
 Frame = +3

Query  81   IACMLVFSMALC----CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrra  248
            + C+L  +MA      C AQNS QD++D HNAARA VGVGP++WD TV AYAQ+YA +R 
Sbjct  5    LPCLLALAMAAIVVAPCTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQSYAAQRQ  64

Query  249  aDCSLTHSGSFRFGYGENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCG  422
             DC L HSG     YGEN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CG
Sbjct  65   GDCQLIHSGG---PYGENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCG  119

Query  423  HYTQV  437
            HYTQV
Sbjct  120  HYTQV  124



>gb|AAB05225.1| pathogenesis-related protein-1 [Nicotiana glutinosa]
Length=168

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 85/130 (65%), Gaps = 9/130 (7%)
 Frame = +3

Query  60   FLKSPVFIAC---MLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            F + P F+     +L   ++  C+AQNS+QD+L+AHN ARA VGV P+TWD  V AYAQN
Sbjct  6    FSQMPSFLLVSTFLLFLIISHSCHAQNSQQDYLNAHNTARADVGVEPLTWDDEVAAYAQN  65

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPA  407
            Y ++ AADC+L  S      YGEN+A G G  +TA  AV MW  EK+YY H SN C+   
Sbjct  66   YVSQLAADCNLVTSHG---QYGENLAMGSGDFMTAAKAVEMWVDEKQYYDHGSNHCA--Q  120

Query  408  GQSCGHYTQV  437
            GQ CGHYTQV
Sbjct  121  GQVCGHYTQV  130



>ref|XP_009788195.1| PREDICTED: basic form of pathogenesis-related protein 1 [Nicotiana 
sylvestris]
Length=177

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 83/129 (64%), Gaps = 9/129 (7%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMAL-CCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MGFL +   +AC + F++ +    AQNS QD+L+ HNAAR  VGVGPMTWD  + AYAQN
Sbjct  1    MGFLTT--IVACFITFAILIHSSKAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAYAQN  58

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R  DC + HS      YGEN+AA    L A  AV MW  EKR+Y + SNSC    G
Sbjct  59   YANQRIGDCGMIHSHG---PYGENLAAAFPQLNAAGAVKMWVDEKRFYDYNSNSC---VG  112

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  113  GVCGHYTQV  121



>ref|XP_002274275.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
Length=161

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 82/129 (64%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  K S   +  ++  ++A  C AQNS QD+++AHN ARA VGVG MTWD TV  YAQN
Sbjct  1    MGLCKISLPLLVGLMGLALAHTCYAQNSPQDYVNAHNTARAQVGVGSMTWDDTVATYAQN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R  DC+L HSG     YGEN+A G   LT   AV MW AEK YY + SNSC    G
Sbjct  61   YANQRIGDCNLVHSGG---PYGENLAWGSPSLTGTDAVNMWVAEKPYYDYNSNSC---VG  114

Query  411  QSCGHYTQV  437
              C HYTQV
Sbjct  115  GECRHYTQV  123



>ref|XP_002522070.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40270.1| STS14 protein precursor, putative [Ricinus communis]
Length=162

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 82/119 (69%), Gaps = 5/119 (4%)
 Frame = +3

Query  81   IACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCS  260
            + C++  ++    +AQ+++QD+L+AHN+AR  VG+GP+TWD  V +YAQ++AN+  +DCS
Sbjct  10   LVCIISIALIFSSHAQDTQQDYLNAHNSARGDVGLGPLTWDDKVASYAQHHANQHKSDCS  69

Query  261  LTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            L HS      YGEN+A   G L+   AV MW  EK YY + SNSC+  +GQ CGHYTQV
Sbjct  70   LVHS---EGPYGENLAWSSGDLSGTDAVKMWIDEKPYYDYNSNSCA--SGQICGHYTQV  123



>ref|NP_001043091.1| Os01g0382400 [Oryza sativa Japonica Group]
 dbj|BAB84473.1| putative pathogenesis-related protein [Oryza sativa Japonica 
Group]
 dbj|BAC10798.1| putative pathogenesis-related protein [Oryza sativa Japonica 
Group]
 dbj|BAF05005.1| Os01g0382400 [Oryza sativa Japonica Group]
 dbj|BAH00320.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70685.1| hypothetical protein OsI_02026 [Oryza sativa Indica Group]
Length=167

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 83/123 (67%), Gaps = 7/123 (6%)
 Frame = +3

Query  75   VFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            +F+  ++  +M  C +AQNS QD+L   NAAR+AVGVGPM+W T ++ +A++YA +R  D
Sbjct  11   LFVLAVVAATMFHCSDAQNSPQDYLSPQNAARSAVGVGPMSWSTKLQGFAEDYARQRKGD  70

Query  255  CSLTHSGSFRFGYGENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHY  428
            C L HSG     YGENI  G  G   TA  AV  W  EK+YY++ASNSC+  AG+ CGHY
Sbjct  71   CRLQHSGG---PYGENIFWGSAGADWTAADAVRSWVDEKKYYNYASNSCA--AGKVCGHY  125

Query  429  TQV  437
            TQV
Sbjct  126  TQV  128



>gb|EMT02515.1| Pathogenesis-related protein 1 [Aegilops tauschii]
Length=140

 Score =   104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 79/112 (71%), Gaps = 4/112 (4%)
 Frame = +3

Query  111  LCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFG  290
            +   AQNS QDF+DAHNAARA VG+G +TWD TV A+AQ+YA++R  DC L H+   R  
Sbjct  1    MAVTAQNSEQDFMDAHNAARADVGLGEVTWDATVAAFAQDYADQRHGDCQLIHTPDGR-P  59

Query  291  YGENI---AAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            YGEN+     GG   TA  AV  W +EK+YY H SN+CSAP G+SCGHYT+V
Sbjct  60   YGENLYGGGGGGTEWTATDAVNSWVSEKQYYDHDSNTCSAPEGESCGHYTRV  111



>gb|AHA56682.1| pathogenesis related protein [Camellia sinensis]
Length=162

 Score =   105 bits (261),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 76/119 (64%), Gaps = 5/119 (4%)
 Frame = +3

Query  81   IACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCS  260
            + C++   +     AQNS+QD+L+AHNAARA VGVGPMTWD  V AYAQ YA+ R  DC+
Sbjct  10   LVCLMSLVLVHPSYAQNSQQDYLNAHNAARAQVGVGPMTWDNNVAAYAQRYASSRMGDCN  69

Query  261  LTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            L HSG     YGEN+A G G  T  + V +W  EK YY + SNSC     + C HYTQV
Sbjct  70   LVHSGG---PYGENLAEGNGSFTGTAGVNLWVGEKPYYDYNSNSCVGR--KECRHYTQV  123



>ref|XP_008651988.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Zea mays]
 tpg|DAA59477.1| TPA: hypothetical protein ZEAMMB73_881711 [Zea mays]
Length=167

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 79/122 (65%), Gaps = 3/122 (2%)
 Frame = +3

Query  75   VFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            V +A  L       C AQNS QDF++ HNAARAAVGVGP++WD  V A+A++YA +R  D
Sbjct  9    VCLALALAMVAVTPCAAQNSPQDFVNPHNAARAAVGVGPVSWDENVAAFARSYAAQRQGD  68

Query  255  CSLTHSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYT  431
            C L HSG     YGENI  GGG    A  AV +W  EK+ Y + SNSC+  AG+ CGHYT
Sbjct  69   CKLVHSGGGPNHYGENIFWGGGSAWKASDAVGLWVGEKQNYDYNSNSCA--AGKVCGHYT  126

Query  432  QV  437
            QV
Sbjct  127  QV  128



>gb|AEH25626.1| pathogenesis-related protein 1-11 [Triticum aestivum]
 gb|EMT30572.1| Pathogenesis-related protein PRMS [Aegilops tauschii]
Length=169

 Score =   105 bits (262),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 83/122 (68%), Gaps = 11/122 (9%)
 Frame = +3

Query  90   MLVFSMALC----CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDC  257
            +L F+MA      C AQN+  DF+  HN++RA VGVGP+TWDTTV  YA +YAN+R ADC
Sbjct  14   VLAFAMAAAITSPCAAQNAPADFVSLHNSSRALVGVGPVTWDTTVANYALSYANQRKADC  73

Query  258  SLTHSGSFRFGYGENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYT  431
            SL HSG     YGENI  G  GG  TA SAV MW  EK++Y +A+N+C+    + CGHYT
Sbjct  74   SLVHSGG---TYGENIFWGSAGGTWTASSAVTMWTDEKQFYDYATNTCA--TNKVCGHYT  128

Query  432  QV  437
            QV
Sbjct  129  QV  130



>ref|XP_009388942.1| PREDICTED: pathogenesis-related protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=162

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 79/120 (66%), Gaps = 6/120 (5%)
 Frame = +3

Query  81   IACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCS  260
            + C +  +MA    AQNS QDF+DAHN+ARA VGVGP++WD  V AYAQNYAN R  DC 
Sbjct  10   LVCAMALAMACTTLAQNSPQDFVDAHNSARADVGVGPVSWDDNVAAYAQNYANERIGDCQ  69

Query  261  LTHSGSFRFGYGENIAAG-GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            L HSG     YGENI  G G   TA  AV  W  EK+YY + SNSC+   GQ CGHYTQV
Sbjct  70   LVHSGG---PYGENIFWGSGADFTAADAVNSWVDEKQYYDYDSNSCA--DGQVCGHYTQV  124



>ref|XP_008652242.1| PREDICTED: pathogenesis-related protein 1-like [Zea mays]
 tpg|DAA60242.1| TPA: hypothetical protein ZEAMMB73_897468 [Zea mays]
Length=171

 Score =   105 bits (262),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 5/106 (5%)
 Frame = +3

Query  126  QNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGENI  305
            QN+ QDF++ HN+ RA VGVG + W+TTV AYAQ+YAN+RA DC L HSG     YGEN+
Sbjct  30   QNTAQDFVNLHNSPRADVGVGNVAWNTTVAAYAQSYANQRAGDCRLVHSGG---PYGENL  86

Query  306  AAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
              G  G   TA +AV  W AEK+YY+HA+N+CSAP+GQSCGHYTQ+
Sbjct  87   FWGSAGYAWTASNAVGSWAAEKQYYNHATNTCSAPSGQSCGHYTQL  132



>gb|ADN43429.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 76/107 (71%), Gaps = 6/107 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS QD++DAHNAARA VGVG +TW+ TV AYAQNYAN+R +DC+L HSG     YG
Sbjct  23   CCAQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQNYANQRISDCNLVHSGG---PYG  79

Query  297  ENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+A G G LT   AV +W  EK YY + SNSC    G  CGHYTQV
Sbjct  80   ENLAKGSGSLTGTDAVNLWVGEKSYYDYNSNSC---VGGECGHYTQV  123



>gb|AHE81270.1| pathogenesis-related protein 1-6 [Triticum aestivum]
Length=168

 Score =   105 bits (262),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = +3

Query  123  AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGEN  302
            AQNS QDF+DAHNAARA VG+G +TWD TV A+AQ+YA++R  DC L H+   R  YGEN
Sbjct  23   AQNSEQDFVDAHNAARADVGLGEVTWDPTVAAFAQDYADQRRGDCQLIHTPDGR-PYGEN  81

Query  303  I---AAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            +     GG   TA  AV  W +EK+YY H SN+CSAP G+SCGHYTQV
Sbjct  82   LYGGGGGGTEWTATDAVNSWVSEKQYYDHDSNTCSAPEGESCGHYTQV  129



>emb|CAA47374.1| prb-1b [Nicotiana tabacum]
Length=179

 Score =   105 bits (262),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 86/129 (67%), Gaps = 8/129 (6%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMAL-CCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG+  S   +AC + F++      AQNS QD+L+ HNAAR  VGVGPMTWD  + A+AQN
Sbjct  1    MGY--STTLVACFITFAILFHSSQAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAFAQN  58

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+RA DC + HSG     YGEN+AA    L A  AV MW  EK++Y++ SN+C+  AG
Sbjct  59   YANQRAGDCRMQHSGG---PYGENLAAAYPQLHAAGAVKMWVDEKQFYNYNSNTCA--AG  113

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  114  NVCGHYTQV  122



>gb|AEH25621.1| pathogenesis-related protein 1-6 [Triticum aestivum]
 gb|AHE81249.1| pathogenesis-related protein 1-6 [Triticum aestivum]
Length=168

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = +3

Query  123  AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGEN  302
            AQNS QDF+DAHNAARA VG+G +TWD TV A+AQ+YA++R  DC L H+   R  YGEN
Sbjct  23   AQNSEQDFVDAHNAARADVGLGEVTWDATVAAFAQDYADQRRGDCQLIHTPDGR-PYGEN  81

Query  303  I---AAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            +     GG   TA  AV  W +EK+YY H SN+CSAP G+SCGHYTQV
Sbjct  82   LYGGGGGGTEWTATDAVNSWVSEKQYYDHDSNTCSAPEGESCGHYTQV  129



>ref|XP_010270273.1| PREDICTED: pathogenesis-related leaf protein 6-like [Nelumbo 
nucifera]
Length=167

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 81/128 (63%), Gaps = 5/128 (4%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG+ +  + +  ++ F +     AQNS QD+L+AHNAARA VGVGPM WD  V AYA+NY
Sbjct  1    MGWCRLELALVLLISFGLWHVSQAQNSPQDYLNAHNAARAQVGVGPMRWDNNVAAYARNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN+R  DC+L HSG     YGEN+A G G  T   AV +W  EK +Y + SNSC    G 
Sbjct  61   ANQRIRDCNLVHSGGGL--YGENLAKGSGAFTGVDAVNLWVKEKPFYDYNSNSC---IGG  115

Query  414  SCGHYTQV  437
             C HYTQV
Sbjct  116  QCLHYTQV  123



>ref|XP_010088980.1| hypothetical protein L484_013560 [Morus notabilis]
 gb|EXB37195.1| hypothetical protein L484_013560 [Morus notabilis]
Length=171

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 73/123 (59%), Gaps = 3/123 (2%)
 Frame = +3

Query  69   SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrra  248
            S   I C+L   +   C AQN+ QDFL  HN ARA VGVGPMTWD +V AYAQ YAN+R 
Sbjct  7    SLALIMCILGLGVTESCCAQNTPQDFLTPHNRARAEVGVGPMTWDDSVAAYAQRYANQRR  66

Query  249  aDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHY  428
             DC L HS      YGEN+A   G L+A  AV MW AEK  Y H SN C       C HY
Sbjct  67   GDCKLIHSSG---PYGENLAWSSGDLSAAGAVKMWVAEKSLYDHNSNKCVGKNPMGCLHY  123

Query  429  TQV  437
            TQV
Sbjct  124  TQV  126



>gb|ACJ62489.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 81/123 (66%), Gaps = 11/123 (9%)
 Frame = +3

Query  87   CMLVFSMALC----CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            C+L  +MA      C AQNS QD++D HNAARA VGVGP++WD TV AYAQNYA +R  D
Sbjct  1    CLLALAMAAIVVAPCTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQNYAAQRQGD  60

Query  255  CSLTHSGSFRFGYGENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHY  428
            C L HSG     YGEN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CGHY
Sbjct  61   CKLIHSGG---PYGENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCGHY  115

Query  429  TQV  437
            TQV
Sbjct  116  TQV  118



>gb|ACJ62461.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62463.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62464.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62465.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62469.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62470.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62472.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62475.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62477.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62480.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62481.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62487.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62490.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62493.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62496.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62497.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62498.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62516.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62521.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62522.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62523.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62525.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62527.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62534.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62536.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62539.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 81/123 (66%), Gaps = 11/123 (9%)
 Frame = +3

Query  87   CMLVFSMALC----CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            C+L  +MA      C AQNS QD++D HNAARA VGVGP++WD TV AYAQ+YA +R  D
Sbjct  1    CLLALAMAAIVVAPCTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQSYAAQRQGD  60

Query  255  CSLTHSGSFRFGYGENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHY  428
            C L HSG     YGEN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CGHY
Sbjct  61   CKLIHSGG---PYGENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCGHY  115

Query  429  TQV  437
            TQV
Sbjct  116  TQV  118



>gb|ADN43439.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 84/129 (65%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  K S   +  ++  ++A  C AQNS QD++DAHNAARA VGVG +TW+ TV AYAQN
Sbjct  1    MGLFKISLALLVGLMGLALAHTCCAQNSAQDYVDAHNAARAQVGVGSITWNDTVAAYAQN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R +DC+L HSG     YGEN+A G   LT   AV +W  EK  Y + SNSC    G
Sbjct  61   YANQRISDCNLVHSGGR---YGENLAKGSPSLTGTDAVNLWVGEKPNYDYNSNSC---VG  114

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  115  GECGHYTQV  123



>gb|ACJ62530.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 81/123 (66%), Gaps = 11/123 (9%)
 Frame = +3

Query  87   CMLVFSMALC----CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            C+L  +MA      C AQNS QD++D HNAARA VGVGP++WD TV AYAQ+YA +R  D
Sbjct  1    CLLALAMAAIVVAPCTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQSYAAQRQGD  60

Query  255  CSLTHSGSFRFGYGENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHY  428
            C L HSG     YGEN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CGHY
Sbjct  61   CQLIHSGG---PYGENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCGHY  115

Query  429  TQV  437
            TQV
Sbjct  116  TQV  118



>gb|AFK93503.1| pathogenesis related protein 1 isoform 4 [Ficus pumila var. awkeotsang]
Length=169

 Score =   105 bits (261),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 82/130 (63%), Gaps = 7/130 (5%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  + S   I C+L  ++   C AQ+S QDFL  HN ARA VGVGPMTWD +V AYA++
Sbjct  1    MGLSRISLALIMCILGLAVLESCRAQDSPQDFLAPHNRARAEVGVGPMTWDESVAAYARD  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSA-PA  407
            YANRR  DC L HSG     YGENIA G G L+A  AV MW AEK  Y + +N C   P 
Sbjct  61   YANRRKGDCKLIHSGG---PYGENIAWGSGDLSAARAVGMWVAEKSLYDYNNNKCIGDPW  117

Query  408  GQSCGHYTQV  437
            G  C HYTQV
Sbjct  118  G--CLHYTQV  125



>ref|XP_010461858.1| PREDICTED: pathogenesis-related leaf protein 6-like [Camelina 
sativa]
Length=160

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 80/128 (63%), Gaps = 6/128 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            M   K+P  +   + F + +   AQNS+QD+L AHN ARA VGV  + WDTTV  YA NY
Sbjct  1    MNTFKTPSLLIVAISF-LVIATTAQNSQQDYLTAHNNARAQVGVANLVWDTTVATYALNY  59

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN R A+CSL HS      YGEN+A G G  TA +AV +W  EK YY + +N+C+   GQ
Sbjct  60   ANTRKANCSLIHSNG---PYGENLAKGSGNFTAIAAVKLWVDEKPYYSYTTNACT--GGQ  114

Query  414  SCGHYTQV  437
             C HYTQV
Sbjct  115  QCLHYTQV  122



>gb|ACJ62486.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62501.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62502.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62503.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62504.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62506.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62508.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62509.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62510.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62526.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62535.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 81/123 (66%), Gaps = 11/123 (9%)
 Frame = +3

Query  87   CMLVFSMALC----CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            C+L  +MA      C AQNS QD++D HNAARA VGVGP++WD TV AYAQNYA +R  D
Sbjct  1    CLLALAMAAIVVAPCTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQNYAAQRQGD  60

Query  255  CSLTHSGSFRFGYGENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHY  428
            C L HSG     YGEN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CGHY
Sbjct  61   CQLIHSGG---PYGENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCGHY  115

Query  429  TQV  437
            TQV
Sbjct  116  TQV  118



>gb|ACJ62462.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62466.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62467.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62468.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62471.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62473.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62474.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62476.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62478.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62479.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62482.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62483.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62484.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62485.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62488.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62491.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62492.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62495.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62511.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62512.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62514.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62515.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62517.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62518.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62519.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62520.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62524.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62528.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62529.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62531.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62532.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62533.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62537.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62538.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62540.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62541.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 81/123 (66%), Gaps = 11/123 (9%)
 Frame = +3

Query  87   CMLVFSMALC----CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            C+L  +MA      C AQNS QD++D HNAARA VGVGP++WD TV AYAQ+YA +R  D
Sbjct  1    CLLALAMAAIVVAPCTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQSYAAQRQGD  60

Query  255  CSLTHSGSFRFGYGENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHY  428
            C L HSG     YGEN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CGHY
Sbjct  61   CQLIHSGG---PYGENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCGHY  115

Query  429  TQV  437
            TQV
Sbjct  116  TQV  118



>ref|XP_009605825.1| PREDICTED: pathogenesis-related protein 1B-like [Nicotiana tomentosiformis]
Length=177

 Score =   105 bits (261),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 91/135 (67%), Gaps = 12/135 (9%)
 Frame = +3

Query  54   MGFL---KSPVF--IACMLVF-SMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVE  215
            MGF+   + P F  ++ +L+F  ++   +AQNS+QD+LDAHN ARA V V P+TWD  V 
Sbjct  1    MGFVLFSQMPSFFLVSTLLLFLIISHSSHAQNSQQDYLDAHNTARADVAVEPLTWDDDVA  60

Query  216  ayaqnyanrraaDCSLTHSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNS  392
            AYAQNY ++ AADC+L HS      YGEN+A G G  +TA  AV MW  EK+YY + SN+
Sbjct  61   AYAQNYVSQLAADCNLVHSHG---QYGENLAQGSGDFMTAAKAVEMWVDEKQYYDYDSNT  117

Query  393  CSAPAGQSCGHYTQV  437
            C+   GQ CGHYTQV
Sbjct  118  CA--EGQVCGHYTQV  130



>gb|ACJ62513.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score =   104 bits (259),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 81/123 (66%), Gaps = 11/123 (9%)
 Frame = +3

Query  87   CMLVFSMALC----CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            C+L  +MA      C AQNS QD++D HNAARA VGVGP++WD TV AYAQ+YA +R  D
Sbjct  1    CILALAMAAIVVAPCTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQSYAAQRQGD  60

Query  255  CSLTHSGSFRFGYGENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHY  428
            C L HSG     YGEN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CGHY
Sbjct  61   CQLIHSGG---PYGENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCGHY  115

Query  429  TQV  437
            TQV
Sbjct  116  TQV  118



>ref|XP_006486822.1| PREDICTED: pathogenesis-related protein 1-like [Citrus sinensis]
Length=163

 Score =   104 bits (260),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 88/131 (67%), Gaps = 10/131 (8%)
 Frame = +3

Query  54   MGFLKS---PVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEaya  224
            MGF K+   P+F  C+L  ++ L  +AQ+S QD+++AHNAARA VGVGP+TWD  V +YA
Sbjct  1    MGFSKNSSLPLF--CILGLALILSSHAQDSPQDYVNAHNAARAQVGVGPVTWDDRVASYA  58

Query  225  qnyanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAP  404
            QNYAN+R  DC+L HSG     YGEN+A     L+   AV MW  EK  Y + SN+C+  
Sbjct  59   QNYANQRKGDCNLVHSGG---PYGENLAWSSAGLSGTDAVKMWVNEKADYDYNSNTCA--  113

Query  405  AGQSCGHYTQV  437
             G+ CGHYTQV
Sbjct  114  EGKVCGHYTQV  124



>emb|CAA36790.1| unnamed protein product [Nicotiana tabacum]
Length=184

 Score =   105 bits (261),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS QD+LDAHN ARA VGV P+TWD  V AYAQNYA++ AADC L HS      YG
Sbjct  28   CGAQNSPQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCMLVHSHG---QYG  84

Query  297  ENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+A G G  +TA  AV MW  EK+YY H SN+C+   GQ CGHYTQV
Sbjct  85   ENLAWGSGDFMTAAKAVEMWVNEKQYYDHDSNTCA--QGQVCGHYTQV  130



>gb|ADN43438.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   104 bits (259),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 83/129 (64%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  K S   +  ++  ++A  C AQNS QD++DAHNAARA VGVG +TW+ TV AYAQN
Sbjct  1    MGLFKISLALLVGLMGLALAHTCRAQNSAQDYVDAHNAARARVGVGSITWNDTVAAYAQN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R +DC+L HSG     YGEN A G   LT   AV +W  EK  Y + SNSC    G
Sbjct  61   YANQRISDCNLVHSGGR---YGENPAKGSPSLTGTDAVNLWVGEKPNYDYNSNSC---VG  114

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  115  GECGHYTQV  123



>ref|XP_009803803.1| PREDICTED: pathogenesis-related protein 1C-like [Nicotiana sylvestris]
Length=184

 Score =   105 bits (261),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS QD+LDAHN ARA VGV P+TWD  V AYAQNYA++ AADC L HS      YG
Sbjct  28   CGAQNSPQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCMLVHSHG---QYG  84

Query  297  ENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+A G G  +TA  AV MW  EK+YY H SN+C+   GQ CGHYTQV
Sbjct  85   ENLAWGSGDFMTAAKAVEMWVNEKQYYDHDSNTCA--QGQVCGHYTQV  130



>ref|XP_004136927.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 ref|XP_004155418.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 gb|KGN43832.1| hypothetical protein Csa_7G070253 [Cucumis sativus]
Length=164

 Score =   104 bits (259),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 76/117 (65%), Gaps = 5/117 (4%)
 Frame = +3

Query  87   CMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLT  266
            C+L F M     AQ+S QDFLDAHN ARA  GV P+ WD TV ++A  YAN+R  DCSL 
Sbjct  14   CVLTFFMLPSSLAQDSPQDFLDAHNTARAQDGVEPVQWDETVASFALQYANQRINDCSLV  73

Query  267  HSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            HSG     YGENIA G   L+  +AV MW  EK +Y + SN+C+  A + CGHYTQV
Sbjct  74   HSGG---PYGENIAWGMPDLSGTAAVEMWVNEKEFYDYGSNTCA--ASRVCGHYTQV  125



>gb|ADN43430.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   104 bits (259),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 83/129 (64%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLV-FSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  K  + +   L+ F++A  C AQNS QD++D HNAARA VGVGP+TW+ TV AYAQN
Sbjct  1    MGLFKISLALXVGLMGFALAHTCCAQNSPQDYVDPHNAARAQVGVGPITWNDTVAAYAQN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R  D +L HSG     YGENIA G   LT   AV MW  EK  Y + SNSC    G
Sbjct  61   YANQRIGDRNLVHSGG---PYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSC---VG  114

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  115  GECGHYTQV  123



>emb|CDY46097.1| BnaA03g52710D [Brassica napus]
Length=144

 Score =   103 bits (257),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 77/124 (62%), Gaps = 5/124 (4%)
 Frame = +3

Query  66   KSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrr  245
            ++ VF+   LV + A+   AQ S+QD+LD HN AR AVGVGP+ W   V AYA+ YA R 
Sbjct  6    QTLVFVTIALVLAFAVPLKAQESQQDYLDVHNRARPAVGVGPIRWHADVAAYARQYALRM  65

Query  246  aaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGH  425
              DC L HSG     YGEN+    G L+   AV +W  EK+ Y + SN+C   +G++CGH
Sbjct  66   RGDCRLIHSGG---RYGENLVGSTGDLSGADAVRLWVNEKKDYFYNSNTCR--SGKACGH  120

Query  426  YTQV  437
            YTQV
Sbjct  121  YTQV  124



>gb|ADB54823.1| pathogenesis-related protein 1 [Vitis pseudoreticulata]
Length=161

 Score =   103 bits (258),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 78/129 (60%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  K S   +   +   +A    AQNS QDFLDAHN  RA VGVGPM+WD TV AYAQN
Sbjct  1    MGLCKISSSLVVGFMGLVLAHISYAQNSAQDFLDAHNVPRAEVGVGPMSWDNTVAAYAQN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            Y N+R  DC+L HSG     YGEN+A G   LT   AV +W  EK  Y + SNSC    G
Sbjct  61   YTNQRIGDCNLVHSGG---PYGENLAWGSPSLTGTDAVNLWVGEKSNYDYNSNSC---VG  114

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  115  GQCGHYTQV  123



>ref|XP_010252394.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
 ref|XP_010252398.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=162

 Score =   103 bits (258),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 84/124 (68%), Gaps = 6/124 (5%)
 Frame = +3

Query  66   KSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrr  245
            KS +FI  M+  ++     AQ+S QD+++AHN AR AVGVGPMTWD T+  YAQ YAN+R
Sbjct  7    KSSLFI-LMVGLALLHVSEAQDSPQDYINAHNEARRAVGVGPMTWDNTLAGYAQRYANQR  65

Query  246  aaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGH  425
              DC++ HS      YGEN+AA    L+  +AV MW  EK++Y + SNSC+  AG+ CGH
Sbjct  66   IGDCAMKHSNG---PYGENLAAAMPSLSGTNAVKMWVNEKQFYBYNSNSCA--AGKVCGH  120

Query  426  YTQV  437
            YTQV
Sbjct  121  YTQV  124



>dbj|BAO09561.1| pathogenesis-related protein 1, partial [Morus alba]
Length=164

 Score =   103 bits (258),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 74/120 (62%), Gaps = 3/120 (3%)
 Frame = +3

Query  78   FIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDC  257
             + C+L   +   C AQ + QDFL  HN ARA VGVGPMTWD +V AYA+NYAN+R  DC
Sbjct  3    LVICILGLGVIELCYAQTTPQDFLAPHNRARAEVGVGPMTWDDSVAAYARNYANQRQGDC  62

Query  258  SLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
             L HSG     YGENIA   G L+A  AV MW AEK  Y + SN+C       C HYTQV
Sbjct  63   KLVHSGG---PYGENIAWSSGDLSAAGAVGMWVAEKSLYDYYSNTCVGQNPMGCLHYTQV  119



>ref|XP_002265050.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CBI35453.3| unnamed protein product [Vitis vinifera]
Length=161

 Score =   103 bits (258),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 85/129 (66%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCN-AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  K  V +AC++  ++ +  + AQNS+QD+L+AHN ARA V VGPMTW+ TV AYAQ+
Sbjct  1    MGLCKISVALACLIGSALLVHTSYAQNSQQDYLNAHNTARAQVSVGPMTWNNTVAAYAQS  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN++  DC+L HS      YGEN+A G G  T  +AV +W AEK  Y + SNSC    G
Sbjct  61   YANKQIGDCNLVHSNG---PYGENLAKGSGSFTGTAAVNLWVAEKPNYDYNSNSC---VG  114

Query  411  QSCGHYTQV  437
              C HYTQV
Sbjct  115  GECRHYTQV  123



>ref|XP_008796970.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Phoenix 
dactylifera]
Length=162

 Score =   103 bits (258),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 85/129 (66%), Gaps = 6/129 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            M F    + +AC +  +MA    AQNS QDF+ AHNAARAAVGVG ++WD TV AYAQNY
Sbjct  1    MKFSSLTLALACAMFLAMAHTTIAQNSPQDFVSAHNAARAAVGVGSVSWDDTVAAYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAG-GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            AN+R +DC L HSG     YGEN+  G G   TA  AV  W  EK++Y + +N+C+  AG
Sbjct  61   ANQRISDCQLKHSGG---PYGENLFGGSGADFTAADAVNSWVDEKQWYDYNTNTCA--AG  115

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  116  HECGHYTQV  124



>ref|XP_002273546.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CAN74267.1| hypothetical protein VITISV_000653 [Vitis vinifera]
 emb|CBI25096.3| unnamed protein product [Vitis vinifera]
Length=161

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 82/129 (64%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACML-VFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  K  + + C + + ++    +AQNS+QD+LD HNAARA VGV PMTWD  V AYA++
Sbjct  1    MGLCKRELALICFIGILALVHPSHAQNSQQDYLDVHNAARADVGVEPMTWDDNVAAYARD  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YA++R+ DC++ HS      YGEN+A G G  TA  A  +W  EK  Y + SNSC    G
Sbjct  61   YASQRSGDCNMVHSNG---PYGENLAMGSGDFTATDAANLWVGEKSNYDYNSNSC---VG  114

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  115  GECGHYTQV  123



>gb|EEC81456.1| hypothetical protein OsI_24758 [Oryza sativa Indica Group]
Length=173

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 75/109 (69%), Gaps = 3/109 (3%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS QDF+  HNAARA V V    W+ TV AYAQ YA +R  DC L HS S    YG
Sbjct  27   CTAQNSPQDFVSPHNAARANVSVAAAAWNDTVAAYAQGYAAQRQGDCKLVHSDSGGR-YG  85

Query  297  ENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+  G  GG  TA SAV+ W +EK++Y+H SNSCSAPAG SCGHYTQV
Sbjct  86   ENLFWGSSGGNWTAASAVSAWVSEKQWYNHTSNSCSAPAGSSCGHYTQV  134



>ref|XP_010088981.1| hypothetical protein L484_013561 [Morus notabilis]
 gb|EXB37196.1| hypothetical protein L484_013561 [Morus notabilis]
Length=171

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 77/129 (60%), Gaps = 4/129 (3%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  + S   + C+L   +   C AQ + QDFL  HN ARA VGVGPMTWD +V AYA+N
Sbjct  1    MGLSRISLALVICILGLGVIELCYAQTTPQDFLAPHNRARAEVGVGPMTWDDSVAAYARN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R  DC L HSG     YGENIA   G L+A  AV MW AEK  Y + SN C     
Sbjct  61   YANQRQGDCKLVHSGG---PYGENIAWSSGDLSAAGAVGMWVAEKSLYDYYSNKCVGQNP  117

Query  411  QSCGHYTQV  437
              C HYTQV
Sbjct  118  MGCLHYTQV  126



>ref|XP_010530685.1| PREDICTED: pathogenesis-related protein 1-like [Tarenaya hassleriana]
Length=140

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 75/105 (71%), Gaps = 5/105 (5%)
 Frame = +3

Query  123  AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGEN  302
            AQ+  QDF+DAHN ARA VGVGP+ WD TV AYA++YAN+R  DCSLTHS      YGEN
Sbjct  3    AQDQPQDFVDAHNRARAEVGVGPIEWDETVAAYARDYANQRRGDCSLTHSSG---PYGEN  59

Query  303  IAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            IA GGG L+  +AV MW  EK  Y + +N+C   AG+ CGHYTQ+
Sbjct  60   IAWGGGDLSGTAAVKMWVDEKADYDYNTNTCR--AGKQCGHYTQI  102



>ref|XP_008370577.1| PREDICTED: LOW QUALITY PROTEIN: pathogenesis-related protein 
1-like [Malus domestica]
Length=169

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 84/123 (68%), Gaps = 7/123 (6%)
 Frame = +3

Query  75   VFIACMLVFSMALC--CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrra  248
            + +A + +   AL    +AQ++RQD+L++HNAARAAVGVGP+TWD  V  YAQNYAN+R 
Sbjct  6    ISLALLFILGSALIQSSHAQDTRQDYLNSHNAARAAVGVGPLTWDDNVARYAQNYANQRV  65

Query  249  aDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHY  428
             DC L HS   +  YGEN+A   G L+  +AV +W  EK  Y + SNSC+  AG+ CGHY
Sbjct  66   GDCKLVHS---KGPYGENLAMSTGDLSGTAAVDLWVKEKADYSYKSNSCA--AGKVCGHY  120

Query  429  TQV  437
            TQV
Sbjct  121  TQV  123



>ref|XP_006368156.1| PREDICTED: basic form of pathogenesis-related protein 1-like, 
partial [Solanum tuberosum]
Length=135

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +3

Query  78   FIACMLVFSM-ALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
             + C + F++    C AQN+ QD+L+AHN AR  VGVGPMTWD  +  +AQNYAN+RA D
Sbjct  8    LVVCFITFAIFPFICEAQNTPQDYLNAHNEARRQVGVGPMTWDNRLATFAQNYANQRAGD  67

Query  255  CSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
            C + HSG     YGEN+A+    L A  AV  W  E+++Y++ SN+C   AG+ CGHYTQ
Sbjct  68   CRMQHSGG---PYGENLASAFPQLNAAGAVQQWVNERQWYNYNSNTCQ--AGRVCGHYTQ  122

Query  435  V  437
            V
Sbjct  123  V  123



>dbj|BAB78476.1| PR-1 [Solanum torvum]
Length=168

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 81/119 (68%), Gaps = 5/119 (4%)
 Frame = +3

Query  81   IACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCS  260
            +AC + F++     AQ  +++FL+AHNAAR  VGVGPMTWD T+ AYAQNYAN+R  DC 
Sbjct  1    VACFITFAIFHSSQAQTPQENFLNAHNAARRRVGVGPMTWDNTLAAYAQNYANQRIGDCM  60

Query  261  LTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            + HS      YGEN+AA    L A  AV MW+ EK++Y + SN+C+   G+ CGHYTQV
Sbjct  61   MQHSDG---PYGENLAAAFPQLNAAGAVKMWEDEKQWYDYNSNTCA--PGKVCGHYTQV  114



>ref|XP_006306376.1| hypothetical protein CARUB_v10012281mg [Capsella rubella]
 gb|EOA39274.1| hypothetical protein CARUB_v10012281mg [Capsella rubella]
Length=162

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 81/129 (63%), Gaps = 6/129 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            M   K+P  I   + F + +  NAQN+ QDFL+AHN ARA VGV  + WD+ V  YA NY
Sbjct  1    MNTFKTPSLIIVAISFLLIIATNAQNTPQDFLNAHNTARAQVGVPNLVWDSAVATYALNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAG-GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            AN R ADCSLTHS      YGEN+A G     TA ++V +W  EK YY +++N+C+   G
Sbjct  61   ANSRKADCSLTHSNG---QYGENLAKGSSSTFTALASVKLWVDEKPYYSYSTNNCT--GG  115

Query  411  QSCGHYTQV  437
            + C HYTQV
Sbjct  116  KQCLHYTQV  124



>emb|CDO97323.1| unnamed protein product [Coffea canephora]
Length=163

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 79/113 (70%), Gaps = 6/113 (5%)
 Frame = +3

Query  99   FSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGS  278
             +  L  +AQNS QD+L+ HN+AR+ VGVGPMTWDTTV AYAQNYAN+R +DC+L HS  
Sbjct  19   LARVLPTHAQNSPQDYLNVHNSARSQVGVGPMTWDTTVAAYAQNYANQRISDCNLVHS--  76

Query  279  FRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
             +  YGEN+A G G  T  +A  +W AEK YY++ SNSC    G  C HYTQV
Sbjct  77   -QGPYGENLAKGTGTFTGTAAANLWVAEKPYYNYTSNSC---VGGECLHYTQV  125



>ref|XP_009135645.1| PREDICTED: pathogenesis-related protein 1 [Brassica rapa]
Length=168

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 82/124 (66%), Gaps = 9/124 (7%)
 Frame = +3

Query  84   ACMLVFSMALCCN------AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrr  245
            + +L+F++AL CN      AQ+ +Q+FL+AHN AR  VGV P+ WD  V  YA +YAN+R
Sbjct  10   SILLLFAIALSCNFILPSLAQDWKQEFLEAHNEARHEVGVEPLVWDEEVAGYASSYANQR  69

Query  246  aaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGH  425
             +DC++ HS      +GENIA   G ++A+ A  MW  EK+YY + SN+C+ P G +C H
Sbjct  70   VSDCAMVHSNG---PFGENIAWSSGDMSAEDASEMWIDEKKYYDYDSNTCNDPNGGTCLH  126

Query  426  YTQV  437
            YTQV
Sbjct  127  YTQV  130



>ref|XP_006367092.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=178

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 77/121 (64%), Gaps = 6/121 (5%)
 Frame = +3

Query  78   FIACMLVFSMAL-CCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
             I C L F++      AQNS QD+L+ HN AR  VGVGPM WD  + A+AQNYAN+R  D
Sbjct  4    LIICFLTFALLFHSSKAQNSPQDYLNPHNEARRQVGVGPMAWDNRLAAFAQNYANQRIGD  63

Query  255  CSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
            C + HSG     YGEN+AAG   L A  AV MW  EK++Y + SNSC    G+ CGHYTQ
Sbjct  64   CRMQHSGG---PYGENLAAGFPQLNAAGAVKMWVDEKQWYDYNSNSCQ--PGKVCGHYTQ  118

Query  435  V  437
            V
Sbjct  119  V  119



>ref|XP_009388943.1| PREDICTED: pathogenesis-related protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=162

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 79/120 (66%), Gaps = 6/120 (5%)
 Frame = +3

Query  81   IACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCS  260
            + C +  +MA    AQNS QDF+DAHN+ARAAVGVGP++WD  V AYAQNYAN+R  DC 
Sbjct  10   LVCAMALAMACTTLAQNSPQDFVDAHNSARAAVGVGPVSWDDNVAAYAQNYANQRIGDCQ  69

Query  261  LTHSGSFRFGYGENIAAGGG-PLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            L HSG     YGEN+  G     T   AV  W  EK+YY + SNSC+   GQ CGHYTQV
Sbjct  70   LVHSGG---PYGENLFGGSSTEFTGIDAVNSWVDEKQYYDYDSNSCA--DGQVCGHYTQV  124



>ref|XP_008455066.1| PREDICTED: basic form of pathogenesis-related protein 1 [Cucumis 
melo]
Length=164

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 80/129 (62%), Gaps = 9/129 (7%)
 Frame = +3

Query  51   KMGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            KM  L    F+    +F+ ++   AQ+S QDF+DAHNAARA VGVGP++WD TV  YAQ 
Sbjct  6    KMISLSLLFFLTSSTIFTSSI---AQDSPQDFVDAHNAARAQVGVGPVSWDETVANYAQQ  62

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+   DC + HS      YGEN+A     L+  +AV MW  EK++Y +ASNSC    G
Sbjct  63   YANQHINDCQMVHSNG---PYGENLAWSSADLSGTNAVQMWVNEKQFYDYASNSC---VG  116

Query  411  QSCGHYTQV  437
              C HYTQV
Sbjct  117  SECRHYTQV  125



>gb|KDP37600.1| hypothetical protein JCGZ_06943 [Jatropha curcas]
Length=148

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 81/115 (70%), Gaps = 5/115 (4%)
 Frame = +3

Query  93   LVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHS  272
            +  ++ +  +AQ+S QD+++AHN ARAAVGVGP+TWD TV AYA+NYAN+   DC L HS
Sbjct  1    MSVTLIIPLHAQDSPQDYVNAHNTARAAVGVGPVTWDNTVAAYARNYANQHIGDCRLVHS  60

Query  273  GSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            G     YGEN+A   G L+  +AV +W  EK +Y + SN+C+  AG+ CGHYTQV
Sbjct  61   GG---PYGENLAGSSGDLSDPAAVKLWVDEKAFYDYNSNTCA--AGKVCGHYTQV  110



>ref|XP_009138233.1| PREDICTED: pathogenesis-related protein 1-like [Brassica rapa]
Length=170

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 77/124 (62%), Gaps = 5/124 (4%)
 Frame = +3

Query  66   KSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrr  245
            ++ VF+   LV + A+   AQ S+QD+LD HN AR AVGVGP+ W   V AYA+ YA R 
Sbjct  6    QTLVFVTIALVLAFAVPLKAQESQQDYLDVHNRARPAVGVGPIRWHADVAAYARQYALRM  65

Query  246  aaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGH  425
              DC L HSG     YGEN+    G L+   AV +W  EK+ Y + SN+C   +G++CGH
Sbjct  66   RGDCRLIHSGG---RYGENLVGSTGDLSGADAVRLWVNEKKDYFYNSNTCR--SGKACGH  120

Query  426  YTQV  437
            YTQV
Sbjct  121  YTQV  124



>ref|XP_006422714.1| hypothetical protein CICLE_v10029431mg [Citrus clementina]
 gb|ESR35954.1| hypothetical protein CICLE_v10029431mg [Citrus clementina]
Length=163

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 88/131 (67%), Gaps = 10/131 (8%)
 Frame = +3

Query  54   MGFLKS---PVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEaya  224
            MGF K+   P+F  C+L  ++ L  +AQ+  QD+++AHNAARA VGVGP+TWD  V +YA
Sbjct  1    MGFSKNSSLPLF--CILGLALILSSHAQDLPQDYVNAHNAARAQVGVGPVTWDDRVASYA  58

Query  225  qnyanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAP  404
            QNYAN+R  DC+L HSG     YGEN+A     L+   AV +W  EK  Y + SN+C+  
Sbjct  59   QNYANKRKGDCNLVHSGG---PYGENLAWSSAGLSGTDAVKLWVNEKADYDYNSNTCA--  113

Query  405  AGQSCGHYTQV  437
            AG+ CGHYTQV
Sbjct  114  AGKVCGHYTQV  124



>ref|XP_010691525.1| PREDICTED: pathogenesis-related protein 1A-like [Beta vulgaris 
subsp. vulgaris]
Length=167

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 87/122 (71%), Gaps = 8/122 (7%)
 Frame = +3

Query  78   FIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDC  257
            F A + +F M   C+AQNS QD+++AHNAARAAVGVG + WD  V A+AQ YAN+R ADC
Sbjct  14   FFATLALFHM---CHAQNSPQDYVNAHNAARAAVGVGNIQWDDQVAAFAQQYANQRKADC  70

Query  258  SLTHSGSFRFGYGENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYT  431
            +L HSG     YGENIAAG  G  LT  SAV +W  EK +Y++ SN+C+  +G+ CGHYT
Sbjct  71   ALRHSGG-GGRYGENIAAGPAGVFLTGASAVKLWVDEKAFYNYNSNTCA--SGKVCGHYT  127

Query  432  QV  437
            QV
Sbjct  128  QV  129



>ref|XP_010530683.1| PREDICTED: pathogenesis-related protein 1-like [Tarenaya hassleriana]
Length=157

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 80/121 (66%), Gaps = 5/121 (4%)
 Frame = +3

Query  75   VFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            + +A  LV ++     AQ+  QDF+DAHN ARAAVGVGP+ WD TV AYA++YANRR  D
Sbjct  4    LILAMALVLALVAHTRAQDRPQDFVDAHNRARAAVGVGPIRWDETVAAYARDYANRRRGD  63

Query  255  CSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
            C L HS      YGENIA   G ++  SAV MW  EK  Y++ +N+C   AG+ CGHYTQ
Sbjct  64   CRLVHSSG---PYGENIAWSSGDMSGVSAVQMWVNEKADYNYNTNTCR--AGKVCGHYTQ  118

Query  435  V  437
            V
Sbjct  119  V  119



>ref|XP_006387932.1| hypothetical protein POPTR_0473s00220g [Populus trichocarpa]
 gb|ERP46846.1| hypothetical protein POPTR_0473s00220g [Populus trichocarpa]
Length=145

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 78/116 (67%), Gaps = 21/116 (18%)
 Frame = +3

Query  90   MLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTH  269
            ++  S+ L   AQ++ QD+LDAHNAARAAVGVGP+TWDTTV+AYAQNYAN+RA DC+L H
Sbjct  13   LITLSLILPSRAQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLVH  72

Query  270  SGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            SG+                    AV MW  EK YY + SNSC+  AGQ CGHYTQV
Sbjct  73   SGT-------------------DAVKMWVDEKAYYDYNSNSCA--AGQQCGHYTQV  107



>ref|XP_006367104.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=182

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +3

Query  78   FIACMLVFSM-ALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
             + C + F++    C AQN+ QD+L+AHN AR  VGVGPMTWD  +  +AQNYAN+RA D
Sbjct  8    LVVCFITFAIFPFICEAQNTPQDYLNAHNEARRQVGVGPMTWDNRLATFAQNYANQRAGD  67

Query  255  CSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
            C + HSG     YGEN+A+    L A  AV  W  E+++Y++ SN+C   AG+ CGHYTQ
Sbjct  68   CRMQHSGG---PYGENLASAFPQLNAAGAVQQWVNERQWYNYNSNTCQ--AGRVCGHYTQ  122

Query  435  V  437
            V
Sbjct  123  V  123



>ref|XP_003557605.1| PREDICTED: pathogenesis-related protein 1-like [Brachypodium 
distachyon]
Length=171

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 80/108 (74%), Gaps = 5/108 (5%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C+AQN+  D++  HNA RAAV VGP+TWD TV AYAQNYAN R ADC+L HSG     YG
Sbjct  29   CSAQNAPSDYVAPHNATRAAVSVGPVTWDNTVAAYAQNYANARKADCALVHSGGTL--YG  86

Query  297  ENIAAG-GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+  G G   TAK+AV MW AEK+YY +A+N+C+  AG+ CGHYTQV
Sbjct  87   ENLFWGSGSTWTAKNAVDMWAAEKQYYTYATNTCA--AGKVCGHYTQV  132



>ref|XP_006367095.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=182

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +3

Query  78   FIACMLVFSM-ALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
             + C + F++    C AQN+ QD+L+AHN AR  VGVGPMTWD  +  +AQNYAN+RA D
Sbjct  8    LVVCFITFAIFPFICEAQNTPQDYLNAHNEARRQVGVGPMTWDNRLATFAQNYANQRAGD  67

Query  255  CSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
            C + HSG     YGEN+A+    L A  AV  W  E+++Y++ SN+C   AG+ CGHYTQ
Sbjct  68   CRMQHSGG---PYGENLASAFPQLNAAGAVQQWVNERQWYNYNSNTCQ--AGRVCGHYTQ  122

Query  435  V  437
            V
Sbjct  123  V  123



>ref|XP_010266628.1| PREDICTED: pathogenesis-related protein 1A-like [Nelumbo nucifera]
Length=162

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 83/129 (64%), Gaps = 6/129 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLV-FSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            M F +  +F+  +++   +     AQ+S Q++LDAHNAARA VGV  +TWD TV AYAQ+
Sbjct  1    MAFCRLGIFLFFLIMGIGLVHVSRAQDSHQNYLDAHNAARAEVGVDALTWDDTVAAYAQS  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+RA DC+  HSG     YGEN+A   G L+A  AV +W  EK+YY H SNSC     
Sbjct  61   YANKRADDCTRVHSGE---PYGENLAGSTGSLSATDAVNLWVGEKQYYDHNSNSCIGE--  115

Query  411  QSCGHYTQV  437
            Q C HYTQV
Sbjct  116  QECRHYTQV  124



>ref|XP_010691522.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Beta 
vulgaris subsp. vulgaris]
 emb|CAP66260.1| pathogenesis-related protein 1a [Beta vulgaris]
Length=168

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 86/133 (65%), Gaps = 8/133 (6%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALC--CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaq  227
            M   K+     C    ++AL   C+AQNS QD+++AHN ARAAVGVG + WD  V A+AQ
Sbjct  1    MNLPKNLASYLCFFFATLALAQMCHAQNSPQDYVNAHNDARAAVGVGNIQWDDQVAAFAQ  60

Query  228  nyanrraaDCSLTHSGSFRFGYGENIAAGGGP---LTAKSAVAMWDAEKRYYHHASNSCS  398
             YA++R  DC L HSG     YGEN+A G GP   LTA +AV MW AEK  Y + SN+C+
Sbjct  61   QYADQRKGDCVLQHSGGGGR-YGENLAGGSGPGLVLTATTAVQMWVAEKADYDYNSNTCA  119

Query  399  APAGQSCGHYTQV  437
              +G+ CGHYTQV
Sbjct  120  --SGKVCGHYTQV  130



>ref|XP_002274307.1| PREDICTED: pathogenesis-related leaf protein 6 [Vitis vinifera]
Length=161

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 84/130 (65%), Gaps = 9/130 (7%)
 Frame = +3

Query  54   MGFLKS--PVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaq  227
            MG  K   P+ +  M +    +CC AQNS QD+++AHNAARA VGVG MTW+ TV AYAQ
Sbjct  1    MGLCKISLPLLVGLMGLALAHVCC-AQNSPQDYVNAHNAARAQVGVGSMTWNDTVAAYAQ  59

Query  228  nyanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPA  407
            NYAN+R +DC+L HSG     YGEN+A G G LT   AV +W  EK  Y + SNSC    
Sbjct  60   NYANKRISDCNLVHSGG---PYGENLAKGSGSLTGTDAVNLWVGEKPNYDYNSNSC---V  113

Query  408  GQSCGHYTQV  437
            G  C HYTQV
Sbjct  114  GGECLHYTQV  123



>emb|CAE51954.1| putative basic PR1 [Pisum sativum]
Length=166

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 79/120 (66%), Gaps = 5/120 (4%)
 Frame = +3

Query  78   FIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDC  257
             +A +++ +      AQNS Q +++ HN AR+ VGVGP+ WDT + +YAQNY N+  A+C
Sbjct  12   LMAILVLSTSTQISYAQNSPQSYVNIHNKARSEVGVGPINWDTKLASYAQNYINKLKANC  71

Query  258  SLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
             + HS   R  YGEN+A G G +T   AV MW  EKRYY++ SNSC+  AG  CGHYTQV
Sbjct  72   QMVHS---RGPYGENLAWGSGDITGTGAVNMWIGEKRYYNYNSNSCA--AGYQCGHYTQV  126



>ref|XP_004289699.1| PREDICTED: pathogenesis-related protein 1B-like [Fragaria vesca 
subsp. vesca]
Length=162

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 84/130 (65%), Gaps = 9/130 (7%)
 Frame = +3

Query  48   TKMGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaq  227
            +K+  L     +A  L+ S     +AQNS QD+L+AHN+ARAAVGVG +TWD  + AYAQ
Sbjct  4    SKISILSLISLVALALLHST----HAQNSPQDYLNAHNSARAAVGVGGLTWDPNLAAYAQ  59

Query  228  nyanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPA  407
             YAN    DC+L HS      YGEN+A   G L+  SAV +W  EK YY++ SN+C+  +
Sbjct  60   RYANSHYGDCNLVHSNG---PYGENLAKSSGDLSGTSAVNLWVGEKAYYNYNSNTCA--S  114

Query  408  GQSCGHYTQV  437
            G+ CGHYTQV
Sbjct  115  GRVCGHYTQV  124



>gb|ACJ62499.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62500.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62505.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62507.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 80/122 (66%), Gaps = 11/122 (9%)
 Frame = +3

Query  90   MLVFSMALC----CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDC  257
            +L  +MA      C AQNS QD++D HNAARA VGVGP++WD TV AYAQ+YA +R  DC
Sbjct  2    LLALAMAAIVVAPCTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQSYAAQRQGDC  61

Query  258  SLTHSGSFRFGYGENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYT  431
             L HSG     YGEN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CGHYT
Sbjct  62   KLIHSGG---PYGENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCGHYT  116

Query  432  QV  437
            QV
Sbjct  117  QV  118



>ref|XP_011002613.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Populus euphratica]
Length=159

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 78/124 (63%), Gaps = 7/124 (6%)
 Frame = +3

Query  69   SPVFIACMLVFSMALCCN-AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrr  245
            S   +A  L+ S+++    AQNS QD++DAHNA RA VGVGP+TW+ TV AYAQ YAN R
Sbjct  4    SKFLLAAYLMASVSVNITLAQNSPQDYVDAHNAVRAEVGVGPITWNNTVAAYAQKYANSR  63

Query  246  aaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGH  425
               C L HSG     YGENIA G G L    AV MW +EK +Y H +NSC    G  C H
Sbjct  64   VEKCELEHSGG---PYGENIAEGYGNLNGVDAVKMWASEKPFYSHGTNSC---VGDECLH  117

Query  426  YTQV  437
            YTQV
Sbjct  118  YTQV  121



>ref|XP_010095625.1| hypothetical protein L484_003726 [Morus notabilis]
 gb|EXB61532.1| hypothetical protein L484_003726 [Morus notabilis]
Length=167

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 78/121 (64%), Gaps = 5/121 (4%)
 Frame = +3

Query  75   VFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            +F   ++  +M    NAQ+S QDFL+AHN+ARA VGVG MTWD  V +YAQ YAN    D
Sbjct  13   LFPCVIIGLAMLQASNAQDSPQDFLNAHNSARAEVGVGQMTWDDKVASYAQQYANSHIGD  72

Query  255  CSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
            CS+ HSG     YGEN+A   G L+   AV MW  EK  Y + SN+C+  +G+ CGHYTQ
Sbjct  73   CSMVHSGG---PYGENLAWSSGDLSGTDAVRMWVNEKADYDYGSNTCA--SGKVCGHYTQ  127

Query  435  V  437
            V
Sbjct  128  V  128



>ref|XP_004289697.1| PREDICTED: pathogenesis-related protein 1C-like [Fragaria vesca 
subsp. vesca]
Length=164

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 81/131 (62%), Gaps = 11/131 (8%)
 Frame = +3

Query  51   KMGFLKSPVFIACMLVFSMALC--CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEaya  224
            KM F      I+     S+AL    +AQ++ QD+LDAHNAARAAVGV P+TWD  V  +A
Sbjct  5    KMSF----ALISLTAAISLALLHSIHAQDTPQDYLDAHNAARAAVGVAPLTWDDQVARFA  60

Query  225  qnyanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAP  404
            Q+YAN    DC L HS      YGEN+A G G L+   AV +W  EK  Y + SN+C+  
Sbjct  61   QDYANTHVDDCQLVHSNG---QYGENLAMGSGDLSGTDAVNLWIGEKADYDYNSNTCA--  115

Query  405  AGQSCGHYTQV  437
            AG+ CGHYTQV
Sbjct  116  AGKVCGHYTQV  126



>ref|XP_008796972.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Phoenix 
dactylifera]
Length=162

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 84/129 (65%), Gaps = 6/129 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            M F    + +AC +  +MA    AQNS QDF+ AHNAARAAVGVG ++WD TV AYAQNY
Sbjct  1    MKFSNLTLALACAVFLAMAHTTIAQNSPQDFVSAHNAARAAVGVGSVSWDDTVAAYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAG-GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            AN+R  DC L HSG     YGEN+  G G   TA  AV  W  EK++Y + +N+C+  +G
Sbjct  61   ANQRIGDCQLKHSGG---PYGENLFWGSGADFTAADAVKSWVDEKQWYDYNTNTCA--SG  115

Query  411  QSCGHYTQV  437
              CGHYTQV
Sbjct  116  HQCGHYTQV  124



>gb|KGN43833.1| hypothetical protein Csa_7G070255 [Cucumis sativus]
Length=163

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 83/129 (64%), Gaps = 6/129 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACML-VFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            M  L     + C+L  F+M     AQ+S QD++++HN ARAAVGVGP+ WD  V  Y++ 
Sbjct  1    MDLLNLSCILFCVLSCFTMLPSSLAQDSPQDYVNSHNHARAAVGVGPIKWDEKVANYSRY  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YAN+R  DC L HS      YGENIA G   L+  +AV +W  EK+YY++ SNSC+  +G
Sbjct  61   YANKRMNDCRLVHSNG---PYGENIAWGSPDLSGINAVKLWVDEKQYYNYNSNSCA--SG  115

Query  411  QSCGHYTQV  437
            + CGHYTQV
Sbjct  116  KVCGHYTQV  124



>ref|XP_006367094.1| PREDICTED: pathogenesis-related leaf protein 6-like [Solanum 
tuberosum]
Length=164

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 86/131 (66%), Gaps = 8/131 (6%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMAL-CCNAQNSRQDFLDAHNAARAAV-GVGPMTWDTTVEayaq  227
            M   K+   + C ++F+  L  C+AQNS+ D+L+ HN+AR+ V GV  +TW+TT+E YAQ
Sbjct  1    MALFKASNVVICFIIFAFVLPYCDAQNSQTDYLNTHNSARSQVTGVSAITWNTTLENYAQ  60

Query  228  nyanrraaDCSLTHSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAP  404
             YAN+R +DC+L HS      YGENIA G G  +T  +AV +W  EK YY + SNSC+  
Sbjct  61   TYANQRISDCNLVHSNG---PYGENIAKGSGSFMTGTAAVNLWVGEKPYYDYNSNSCT--  115

Query  405  AGQSCGHYTQV  437
             G+ C HYTQV
Sbjct  116  GGKECRHYTQV  126



>ref|XP_002274105.1| PREDICTED: pathogenesis-related leaf protein 6 [Vitis vinifera]
Length=176

 Score =   102 bits (254),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 78/129 (60%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLK-SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
            MG  K S   +   +   +A    AQNS QDFLDAHN ARA VGVGPM+WD TV AYAQN
Sbjct  1    MGLCKISSSLVVGFMGLVLAHISYAQNSPQDFLDAHNVARAEVGVGPMSWDNTVAAYAQN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            Y N+R  DC+L HSG     YGEN+A G   LT   AV +W  EK  Y + SNSC    G
Sbjct  61   YTNQRIGDCNLVHSGG---PYGENLAWGSPSLTGIDAVNLWVGEKTNYDYNSNSC---VG  114

Query  411  QSCGHYTQV  437
              C HYTQV
Sbjct  115  GECRHYTQV  123



>ref|XP_008346349.1| PREDICTED: pathogenesis-related protein 1-like [Malus domestica]
Length=161

 Score =   102 bits (253),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 84/123 (68%), Gaps = 7/123 (6%)
 Frame = +3

Query  75   VFIACMLVFSMALC--CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrra  248
            + +A + +   AL    +AQ++ QD+L++HNAARAAVGVGP+TWD  V  YAQNYAN+  
Sbjct  6    ISLALLFILGSALIQSSHAQDTPQDYLNSHNAARAAVGVGPLTWDDNVAGYAQNYANQHV  65

Query  249  aDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHY  428
             DC+L HSG     YGEN+A   G ++  +AV +W AEK  Y + SNSC+  AG+ CGHY
Sbjct  66   GDCNLVHSGG---PYGENLAMSTGDMSGTAAVDLWVAEKADYSYESNSCA--AGKVCGHY  120

Query  429  TQV  437
            TQV
Sbjct  121  TQV  123



>ref|XP_010527028.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Tarenaya 
hassleriana]
Length=164

 Score =   102 bits (253),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 79/123 (64%), Gaps = 3/123 (2%)
 Frame = +3

Query  69   SPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrra  248
            S   I  +L   MA    AQ+S QD+++AHN ARA VGVGP++WD TV A+AQNYA +RA
Sbjct  7    SGTLIMALLALVMAQTLQAQDSPQDYVNAHNRARAEVGVGPVSWDNTVAAFAQNYARQRA  66

Query  249  aDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHY  428
             DC L HSG     YGEN+A   G LT   AVA+W  EK  Y + SN+C    G+ CGHY
Sbjct  67   GDCRLIHSGGGGR-YGENLAMSTGGLTGVDAVALWVNEKVDYDYNSNTCR--PGKVCGHY  123

Query  429  TQV  437
            TQV
Sbjct  124  TQV  126



>ref|XP_006657421.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Oryza brachyantha]
Length=171

 Score =   102 bits (253),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 81/126 (64%), Gaps = 8/126 (6%)
 Frame = +3

Query  81   IACMLVFSMA-----LCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrr  245
            + C LV  +A       C AQNS QDF+D HNAARA VGVGP+TWD TV AYAQ YA +R
Sbjct  8    LTCCLVVVLAAAMATTTCVAQNSPQDFVDPHNAARADVGVGPVTWDDTVAAYAQAYAEQR  67

Query  246  aaDCSLTHSGSFRFGYGENI--AAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSC  419
              DC L HS S    YGENI   + G   +A  AV+ W +EK +Y H SNS +AP G SC
Sbjct  68   RGDCQLRHSDS-GGKYGENIFWGSAGAAWSAADAVSSWVSEKEWYDHDSNSWAAPEGSSC  126

Query  420  GHYTQV  437
            GHYTQV
Sbjct  127  GHYTQV  132



>ref|XP_004955412.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Setaria 
italica]
Length=163

 Score =   102 bits (253),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 79/109 (72%), Gaps = 7/109 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHS-GSFRFGY  293
            C AQNS QDF+  HNAARAAVGVGP++W+  V A+A+++A +RA DC L HS GS   GY
Sbjct  22   CAAQNSPQDFVKLHNAARAAVGVGPVSWNDNVAAFARSWAAKRAGDCRLVHSRGS---GY  78

Query  294  GENIAAG-GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            GEN+  G G   +A  AV +W AEK++Y H SNSC+  AG+ CGHYTQV
Sbjct  79   GENLFGGSGADWSASDAVGLWVAEKQWYDHGSNSCA--AGKVCGHYTQV  125



>ref|XP_006379155.1| hypothetical protein POPTR_0009s08640g, partial [Populus trichocarpa]
 gb|ERP56952.1| hypothetical protein POPTR_0009s08640g, partial [Populus trichocarpa]
Length=129

 Score =   100 bits (250),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 71/105 (68%), Gaps = 5/105 (5%)
 Frame = +3

Query  123  AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGEN  302
            AQNS QD++DAHNA RA VGVGP+TW+ TV AYAQ YAN R  +C L HSG     YGEN
Sbjct  11   AQNSPQDYVDAHNAVRAEVGVGPITWNNTVAAYAQKYANSRVENCELEHSGG---PYGEN  67

Query  303  IAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            IA G G L    AV MW +EK +Y H +NSC     ++C HYTQV
Sbjct  68   IAEGYGNLNGVDAVKMWASEKPFYSHDTNSCV--VNRNCDHYTQV  110



>ref|XP_006367089.1| PREDICTED: pathogenesis-related protein 1A1-like [Solanum tuberosum]
Length=179

 Score =   102 bits (253),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 82/126 (65%), Gaps = 6/126 (5%)
 Frame = +3

Query  63   LKSPVFIACMLVFSMAL-CCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyan  239
            +K  + + C + F++      AQ  +++FL+AHNAAR  VGVGPMTWD  + AYAQNYAN
Sbjct  1    MKYSILVVCFITFAIIFHSSQAQTPQENFLNAHNAARRQVGVGPMTWDYGLAAYAQNYAN  60

Query  240  rraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSC  419
            +R  DC + HS      YGEN+AA    L A  AV MWD EK++Y + SN+C+   G+ C
Sbjct  61   QRIGDCGMIHSDG---PYGENLAAAFPQLNAAGAVKMWDDEKQWYDYNSNTCA--PGKVC  115

Query  420  GHYTQV  437
            GHYTQV
Sbjct  116  GHYTQV  121



>ref|NP_197985.2| Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 
1 protein superfamily protein [Arabidopsis thaliana]
 gb|AED93528.1| Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 
1 protein superfamily protein [Arabidopsis thaliana]
Length=166

 Score =   101 bits (252),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 77/131 (59%), Gaps = 6/131 (5%)
 Frame = +3

Query  54   MGFLKSP---VFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEaya  224
            M   KSP   +    +L  + A+   AQ+  QD+LD HN AR  VGV PM W    E YA
Sbjct  1    MKMFKSPQTLILSVIVLFLAFAVPLKAQDQPQDYLDEHNRARTQVGVPPMKWHAGAEQYA  60

Query  225  qnyanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAP  404
             NYA +R  DCSLTHS S    YGEN+A  GG L+   AV +W  EK  Y +ASN+CS  
Sbjct  61   WNYAQQRKGDCSLTHSNSNGL-YGENLAWSGGALSGAEAVKLWVNEKSDYIYASNTCS--  117

Query  405  AGQSCGHYTQV  437
             G+ CGHYTQV
Sbjct  118  DGKQCGHYTQV  128



>ref|XP_011016555.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Populus euphratica]
Length=159

 Score =   101 bits (252),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 78/124 (63%), Gaps = 7/124 (6%)
 Frame = +3

Query  69   SPVFIACMLVFSMALCCN-AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrr  245
            S   +A  L+ S+++    AQNS QD++DAHNA RA VGVGP+TW+ TV AYAQ YAN R
Sbjct  4    SKFLLAAYLMASVSVNITLAQNSPQDYVDAHNAVRAEVGVGPITWNNTVAAYAQKYANSR  63

Query  246  aaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGH  425
               C L HSG     YGENIA G G L    AV MW +EK +Y H +NSC    G  C H
Sbjct  64   VEKCELEHSGG---PYGENIAEGYGNLNGVDAVKMWASEKPFYSHDTNSC---VGDECLH  117

Query  426  YTQV  437
            YTQV
Sbjct  118  YTQV  121



>ref|XP_008236223.1| PREDICTED: pathogenesis-related protein 1-like [Prunus mume]
Length=161

 Score =   101 bits (252),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 84/128 (66%), Gaps = 5/128 (4%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG  K  + + C+L  ++    +AQ++ QD+L AHN ARAAV VGP++WD  ++ YAQ+Y
Sbjct  1    MGLSKVLLALVCVLGSALLQSTHAQDTPQDYLTAHNNARAAVNVGPLSWDEKLQGYAQDY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN+   DC+L HSG     YGEN+A   G L+   AV MW AEK  Y++ SN+C+   G+
Sbjct  61   ANQHIGDCNLVHSGGP---YGENLAMSTGDLSGTDAVNMWVAEKADYNYDSNTCA--DGK  115

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  116  VCGHYTQV  123



>ref|XP_010478440.1| PREDICTED: pathogenesis-related protein 1A-like [Camelina sativa]
Length=162

 Score =   101 bits (252),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 84/129 (65%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            M   K P F+   + F + +  NAQNS+QDFL+ HN+ARA VGV  + WDTTV AYA NY
Sbjct  1    MKTFKIPSFLLVAISF-VVIATNAQNSQQDFLNTHNSARALVGVANIVWDTTVAAYASNY  59

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGG-PLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            AN R ADC+LT SG     +GEN+A G G  LT  +AV +W A+K  Y + SNSC+   G
Sbjct  60   ANARKADCNLTPSGG---PFGENLAKGNGATLTGVAAVNLWVAQKNDYTYTSNSCT--VG  114

Query  411  QSCGHYTQV  437
            + C HYTQV
Sbjct  115  KVCKHYTQV  123



>gb|EEE54618.1| hypothetical protein OsJ_01863 [Oryza sativa Japonica Group]
Length=147

 Score =   101 bits (251),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 77/113 (68%), Gaps = 7/113 (6%)
 Frame = +3

Query  105  MALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFR  284
            M  C +AQNS QD+L   NAAR+AVGVGPM+W T ++ +A++YA +R  DC L HSG   
Sbjct  1    MFHCSDAQNSPQDYLSPQNAARSAVGVGPMSWSTKLQGFAEDYARQRKGDCRLQHSGG--  58

Query  285  FGYGENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
              YGENI  G  G   TA  AV  W  EK+YY++ASNSC+  AG+ CGHYTQV
Sbjct  59   -PYGENIFWGSAGADWTAADAVRSWVDEKKYYNYASNSCA--AGKVCGHYTQV  108



>ref|XP_010942046.1| PREDICTED: uncharacterized protein LOC105060136 [Elaeis guineensis]
Length=325

 Score =   104 bits (259),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 84/129 (65%), Gaps = 6/129 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            M F      +AC +  +MA    AQNS QD++ AHN ARAAVGVGP++WD TV AYAQNY
Sbjct  1    MKFSNLTFALACAVFLAMAHTTIAQNSPQDYVSAHNVARAAVGVGPVSWDDTVAAYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGG-PLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
             N+R  DC L HSG     YGEN+  G G   TA  AV  W +EK++Y + +N+C+  AG
Sbjct  61   VNQRIGDCQLVHSGG---PYGENLFWGSGREYTAADAVNSWVSEKQWYDYNTNTCA--AG  115

Query  411  QSCGHYTQV  437
            + CGHYTQV
Sbjct  116  KVCGHYTQV  124



>gb|ABA34062.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
Length=163

 Score =   101 bits (252),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS QD++D HNAARA VGVGP++WD TV AYAQ+YA +R  DC L HSG     YG
Sbjct  21   CTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQSYAAQRQGDCQLIHSGGH---YG  77

Query  297  ENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CGHYTQV
Sbjct  78   ENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCGHYTQV  124



>ref|NP_001105399.1| pathogenesis related protein4 precursor [Zea mays]
 gb|AAC25629.1| pathogenesis related protein-1 [Zea mays]
 gb|ABA34057.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34058.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34061.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34065.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
Length=163

 Score =   101 bits (252),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS QD++D HNAARA VGVGP++WD TV AYAQ+YA +R  DC L HSG     YG
Sbjct  21   CTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQSYAAQRQGDCKLIHSGG---PYG  77

Query  297  ENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CGHYTQV
Sbjct  78   ENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCGHYTQV  124



>gb|ABA34056.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
Length=158

 Score =   101 bits (251),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS QD++D HNAARA VGVGP++WD TV AYAQ+YA +R  DC L HSG     YG
Sbjct  16   CTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQSYAAQRQGDCKLIHSGG---PYG  72

Query  297  ENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CGHYTQV
Sbjct  73   ENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCGHYTQV  119



>gb|ABA34079.1| pathogenesis-related protein 1 [Zea diploperennis]
Length=163

 Score =   101 bits (251),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS QD++D HNAARA VGVGP++WD TV AYAQNYA +R  DC L HSG     YG
Sbjct  21   CTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQNYAAQRQGDCQLIHSGG---PYG  77

Query  297  ENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CGHYTQV
Sbjct  78   ENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCGHYTQV  124



>gb|ABA34063.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34064.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34069.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34075.1| pathogenesis-related protein 1 [Zea diploperennis]
Length=163

 Score =   101 bits (251),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS QD++D HNAARA VGVGP++WD TV AYAQNYA +R  DC L HSG     YG
Sbjct  21   CTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQNYAAQRQGDCQLIHSGG---PYG  77

Query  297  ENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CGHYTQV
Sbjct  78   ENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCGHYTQV  124



>gb|ABA34055.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34059.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34068.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34070.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34071.1| pathogenesis-related protein 1 [Zea diploperennis]
 gb|ABA34072.1| pathogenesis-related protein 1 [Zea diploperennis]
 gb|ABA34073.1| pathogenesis-related protein 1 [Zea diploperennis]
 gb|ABA34074.1| pathogenesis-related protein 1 [Zea diploperennis]
 gb|ABA34076.1| pathogenesis-related protein 1 [Zea diploperennis]
 gb|ABA34078.1| pathogenesis-related protein 1 [Zea diploperennis]
 gb|ACF86188.1| unknown [Zea mays]
 gb|ACF86501.1| unknown [Zea mays]
 tpg|DAA59479.1| TPA: pathogeneis protein 1 [Zea mays]
Length=163

 Score =   101 bits (251),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS QD++D HNAARA VGVGP++WD TV AYAQ+YA +R  DC L HSG     YG
Sbjct  21   CTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQSYAAQRQGDCQLIHSGG---PYG  77

Query  297  ENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CGHYTQV
Sbjct  78   ENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCGHYTQV  124



>gb|ACJ62494.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score =   101 bits (251),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS QD++D HNAARA VGVGP++WD TV AYAQ+YA +R  DC L HSG     YG
Sbjct  15   CTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQSYAAQRQGDCQLIHSGG---PYG  71

Query  297  ENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CGHYTQV
Sbjct  72   ENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCGHYTQV  118



>gb|ABA34077.1| pathogenesis-related protein 1 [Zea diploperennis]
Length=158

 Score =   101 bits (251),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS QD++D HNAARA VGVGP++WD TV AYAQ+YA +R  DC L HSG     YG
Sbjct  16   CTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQSYAAQRQGDCQLIHSGG---PYG  72

Query  297  ENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CGHYTQV
Sbjct  73   ENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCGHYTQV  119



>gb|ADN43442.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   101 bits (251),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 75/107 (70%), Gaps = 6/107 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS QD++DAHNAARA VGVG +TW+ TV AYAQNYAN+R +DC+L HSG     YG
Sbjct  23   CCAQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQNYANQRISDCNLVHSGG---PYG  79

Query  297  ENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+A G G LT   AV +W  EK YY + SNSC    G  CG YTQV
Sbjct  80   ENLAKGSGSLTGTDAVNLWVGEKPYYDYNSNSC---VGGECGLYTQV  123



>gb|EMT26678.1| Pathogenesis-related protein 1 [Aegilops tauschii]
Length=146

 Score =   100 bits (250),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = +3

Query  111  LCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFG  290
            +   AQNS QDF+DAHNAARA VG+G +TWD TV A+AQ+YA++R  DC L H+   R  
Sbjct  1    MAVTAQNSEQDFVDAHNAARADVGLGEVTWDATVAAFAQDYADQRRGDCQLIHTPDGRPY  60

Query  291  YGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            YG          TA  AV  W +EK+YY H SN+CSAP G+SCGHYTQV
Sbjct  61   YGGGGGGT--EWTATDAVNSWVSEKQYYDHDSNTCSAPDGESCGHYTQV  107



>gb|ABK55610.1| pathogenesis-related protein PR1c [Oryza sativa Indica Group]
Length=167

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 76/110 (69%), Gaps = 7/110 (6%)
 Frame = +3

Query  114  CCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGY  293
            C +AQNS QD+L   NAAR+AVGVGPM+W T ++ +A++YA +R  DC L HSG     Y
Sbjct  24   CSDAQNSPQDYLSPQNAARSAVGVGPMSWSTKLQGFAESYARQRKGDCRLQHSGG---PY  80

Query  294  GENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            GENI  G  G   TA  AV  W  EK+YY++ASNSC+  AG+ CGHYTQV
Sbjct  81   GENIFWGSAGADWTAADAVRSWVDEKKYYNYASNSCA--AGKVCGHYTQV  128



>ref|XP_007201612.1| hypothetical protein PRUPE_ppa019807mg [Prunus persica]
 gb|EMJ02811.1| hypothetical protein PRUPE_ppa019807mg [Prunus persica]
Length=157

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 75/105 (71%), Gaps = 5/105 (5%)
 Frame = +3

Query  123  AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGEN  302
            AQNS+QD+L+AHN AR  VGV  +TWD+TVEAYAQNYAN RAADC+L HS      YGEN
Sbjct  20   AQNSQQDYLNAHNVAREQVGVPNITWDSTVEAYAQNYANSRAADCNLVHSNG---TYGEN  76

Query  303  IAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            +A G G  T  SAV +W AEK  Y++ SNSC    GQ C HYTQV
Sbjct  77   LAEGSGSFTGTSAVNLWVAEKPNYNYTSNSCV--GGQQCLHYTQV  119



>sp|Q41359.1|PR1_SAMNI RecName: Full=Pathogenesis-related protein PR-1 type; Flags: 
Precursor [Sambucus nigra]
 emb|CAA87071.1| pathogenesis-related protein, PR-1 type [Sambucus nigra]
Length=167

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 77/106 (73%), Gaps = 5/106 (5%)
 Frame = +3

Query  123  AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGEN  302
            AQNS QD++DAHNAAR+AV VGP+TWD +V A+A+ YA  RA DC L HSG  R  YGEN
Sbjct  28   AQNSPQDYVDAHNAARSAVNVGPVTWDESVAAFARQYAQSRAGDCRLVHSGDPR--YGEN  85

Query  303  IAAGGG-PLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            +A G G  LT ++AV MW AE+  Y+  +N+C+   G+ CGHYTQV
Sbjct  86   LAFGSGFELTGRNAVDMWVAERNDYNPNTNTCA--PGKVCGHYTQV  129



>ref|XP_011092473.1| PREDICTED: pathogenesis-related leaf protein 6-like [Sesamum 
indicum]
Length=162

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 80/119 (67%), Gaps = 8/119 (7%)
 Frame = +3

Query  81   IACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCS  260
            IA +L +S    C+AQNS QD++ AHNAARA VGVGP+ WD  V A+A+NY N+R  DC+
Sbjct  14   IATILQYS---SCHAQNSPQDYVSAHNAARAQVGVGPIAWDEKVAAFARNYVNQRIGDCN  70

Query  261  LTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            L HS +    YGEN+A G G  T ++AV +W  EK +Y ++SNSC    G  C HYTQV
Sbjct  71   LVHSTN--RPYGENLAKGSGEFTGRAAVELWVREKPFYDYSSNSC---VGGECLHYTQV  124



>emb|CDY22960.1| BnaC03g41090D [Brassica napus]
Length=168

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 82/124 (66%), Gaps = 9/124 (7%)
 Frame = +3

Query  84   ACMLVFSMALCCN------AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrr  245
            + +L+F++AL CN      AQ+ +Q+FL+AHN AR  VGV P+ W   V AYA +YAN+R
Sbjct  10   SILLLFAIALSCNFILPSLAQDWKQEFLEAHNEARHEVGVEPLVWSDEVAAYASSYANQR  69

Query  246  aaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGH  425
             +DC++ HS      +GENIA   G ++A+ A  MW  EK+YY + SN+C+ P G +C H
Sbjct  70   VSDCAMVHSNG---PFGENIAWSSGDMSAEDASEMWIDEKKYYDYDSNTCNDPNGGTCLH  126

Query  426  YTQV  437
            YTQV
Sbjct  127  YTQV  130



>ref|XP_006406470.1| hypothetical protein EUTSA_v10022205mg [Eutrema salsugineum]
 gb|ESQ47923.1| hypothetical protein EUTSA_v10022205mg [Eutrema salsugineum]
Length=165

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = +3

Query  54   MGFLKSPVFI--ACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaq  227
            M  LK+ +    A  + +S+ +   A++ +QDFL+AHN AR  VG+ P+ WD  V AYA 
Sbjct  1    MSLLKTNILFLFAIAISYSLTVPSLAEDWKQDFLEAHNEARNEVGLSPLVWDDEVAAYAS  60

Query  228  nyanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPA  407
            +YAN+R +DC++ HS      +GENIA   G ++A+ A  MW  EK+YY + SN+C+ P 
Sbjct  61   SYANQRISDCAMVHSNG---PFGENIAWSSGDMSAEDASEMWIDEKKYYDYNSNTCNDPN  117

Query  408  GQSCGHYTQV  437
            G +C HYTQV
Sbjct  118  GGTCLHYTQV  127



>ref|NP_001043089.1| Os01g0382000 [Oryza sativa Japonica Group]
 gb|AAB49685.1| pathogenesis-related protein class 1 [Oryza sativa Indica Group]
 dbj|BAB84468.1| putative pathogenesis-related protein 1 [Oryza sativa Japonica 
Group]
 dbj|BAC10793.1| putative pathogenesis-related protein 1 [Oryza sativa Japonica 
Group]
 dbj|BAF05003.1| Os01g0382000 [Oryza sativa Japonica Group]
 gb|ABK55609.1| pathogenesis-related protein PR1b [Oryza sativa Indica Group]
Length=164

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 79/107 (74%), Gaps = 5/107 (5%)
 Frame = +3

Query  123  AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGEN  302
            AQNS QD++  HNAARAAVGVGP+TWDT+V+A+A+NYA++R+ DCSL HS S R   GEN
Sbjct  22   AQNSPQDYVRLHNAARAAVGVGPVTWDTSVQAFAENYASQRSGDCSLIHS-SNRNNLGEN  80

Query  303  IAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            +  G  GG  TA SAV  W  EK  Y +ASNSC+   G+ CGHYTQV
Sbjct  81   LFWGSAGGDWTAASAVQSWVGEKSDYDYASNSCA--QGKVCGHYTQV  125



>ref|XP_009397726.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Musa acuminata 
subsp. malaccensis]
Length=240

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 79/121 (65%), Gaps = 6/121 (5%)
 Frame = +3

Query  78   FIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDC  257
             + C L  +MA    AQN++QD +DAHN+ARAAVGVGP++WD  + +YAQ +AN+R  DC
Sbjct  59   LVVCALALAMACTAVAQNTQQDGVDAHNSARAAVGVGPVSWDDDIASYAQKFANKRVTDC  118

Query  258  SLTHSGSFRFGYGENIAAG-GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
             L HSG     YGEN+  G G   T   AV  W AEK+YY + +NSC+   GQ C HYTQ
Sbjct  119  QLVHSGG---PYGENLFWGTGSAFTLTDAVNTWIAEKQYYDYENNSCA--DGQVCRHYTQ  173

Query  435  V  437
            V
Sbjct  174  V  174



>gb|AFK64734.1| pathogenesis related protein 1a, partial [Cydonia oblonga]
Length=153

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 83/121 (69%), Gaps = 9/121 (7%)
 Frame = +3

Query  75   VFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            V++  +L+ S     +AQ++ QD+L++HNAARAAVGVGP+TWD  V  YAQNYAN+   D
Sbjct  4    VYLGSVLIQS----SHAQDAPQDYLNSHNAARAAVGVGPLTWDDNVAGYAQNYANQHVGD  59

Query  255  CSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
            C+L HSG     YGEN+A   G ++  +AV MW AEK  Y + SNSC+   G+ CGHYTQ
Sbjct  60   CNLVHSGGP---YGENLAMSTGDMSGTAAVDMWVAEKADYDYESNSCA--DGKVCGHYTQ  114

Query  435  V  437
            V
Sbjct  115  V  115



>ref|XP_010517589.1| PREDICTED: pathogenesis-related protein 1-like [Camelina sativa]
Length=161

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 79/121 (65%), Gaps = 9/121 (7%)
 Frame = +3

Query  75   VFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            VF+A  LV ++ L   AQ+S QD+L  HN ARAAVGVGPM WD TV AYA++YA +   +
Sbjct  12   VFVA--LVGALVLPTKAQDSPQDYLRVHNQARAAVGVGPMQWDETVAAYARSYAAQLRGN  69

Query  255  CSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
            C L HS   R  YGEN++ G   L+  SAV MW  EK  Y++ASN+C+      CGHYTQ
Sbjct  70   CRLVHS---RGPYGENLSWGSSDLSGVSAVNMWVNEKANYNYASNTCNG----VCGHYTQ  122

Query  435  V  437
            V
Sbjct  123  V  123



>ref|XP_010488899.1| PREDICTED: pathogenesis-related protein 1 [Camelina sativa]
Length=161

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 79/121 (65%), Gaps = 9/121 (7%)
 Frame = +3

Query  75   VFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            VF+A  LV ++ L   AQ+S QD+L  HN ARAAVGVGPM WD TV AYA++YA +   +
Sbjct  12   VFVA--LVGALVLPTKAQDSPQDYLRVHNQARAAVGVGPMQWDETVAAYARSYAEQLRGN  69

Query  255  CSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
            C L HS   R  YGEN++ G   L+  SAV MW  EK  Y++ASN+C+      CGHYTQ
Sbjct  70   CRLVHS---RGPYGENLSWGSSDLSGVSAVNMWVNEKANYNYASNTCNG----VCGHYTQ  122

Query  435  V  437
            V
Sbjct  123  V  123



>gb|KDP37598.1| hypothetical protein JCGZ_06941 [Jatropha curcas]
Length=148

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 79/114 (69%), Gaps = 5/114 (4%)
 Frame = +3

Query  93   LVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHS  272
            +  ++ +  NAQ+S QD+++AHN ARAAVG GP+TWD TV AYA+NYA++   +C L HS
Sbjct  1    MSVALIIHLNAQDSHQDYVNAHNTARAAVGGGPVTWDNTVAAYARNYASQHIGNCRLVHS  60

Query  273  GSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
            G     YGEN+A   G L+  +AV +W  EK +Y + SN+C+  AGQ CGHYTQ
Sbjct  61   GGR---YGENLAGSSGDLSGTAAVQLWVDEKVFYDYNSNTCA--AGQVCGHYTQ  109



>ref|NP_179068.1| pathogenesis-related protein 1 [Arabidopsis thaliana]
 sp|P33154.1|PR1_ARATH RecName: Full=Pathogenesis-related protein 1; Short=PR-1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAA32863.1| PR-1-like protein [Arabidopsis thaliana]
 gb|AAC69381.1| pathogenesis-related PR-1-like protein [Arabidopsis thaliana]
 gb|AAL36379.1| putative pathogenesis-related PR-1 protein [Arabidopsis thaliana]
 gb|AAM51262.1| putative pathogenesis-related PR-1 protein [Arabidopsis thaliana]
 gb|ABE65442.1| pathogenesis-like protein 1 [Arabidopsis thaliana]
 gb|AEC06314.1| pathogenesis-related protein 1 [Arabidopsis thaliana]
Length=161

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 79/121 (65%), Gaps = 9/121 (7%)
 Frame = +3

Query  75   VFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            VF+A  LV ++ L   AQ+S QD+L  HN AR AVGVGPM WD  V AYA++YA +   +
Sbjct  12   VFVA--LVGALVLPSKAQDSPQDYLRVHNQARGAVGVGPMQWDERVAAYARSYAEQLRGN  69

Query  255  CSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
            C L HSG     YGEN+A G G L+  SAV MW +EK  Y++A+N+C+      CGHYTQ
Sbjct  70   CRLIHSGG---PYGENLAWGSGDLSGVSAVNMWVSEKANYNYAANTCNG----VCGHYTQ  122

Query  435  V  437
            V
Sbjct  123  V  123



>gb|ABK28181.1| unknown [Arabidopsis thaliana]
Length=162

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 79/121 (65%), Gaps = 9/121 (7%)
 Frame = +3

Query  75   VFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            VF+A  LV ++ L   AQ+S QD+L  HN AR AVGVGPM WD  V AYA++YA +   +
Sbjct  12   VFVA--LVGALVLPSKAQDSPQDYLRVHNQARGAVGVGPMQWDERVAAYARSYAEQLRGN  69

Query  255  CSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
            C L HSG     YGEN+A G G L+  SAV MW +EK  Y++A+N+C+      CGHYTQ
Sbjct  70   CRLIHSGG---PYGENLAWGSGDLSGVSAVNMWVSEKANYNYAANTCNG----VCGHYTQ  122

Query  435  V  437
            V
Sbjct  123  V  123



>ref|XP_004168739.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
Length=158

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 79/123 (64%), Gaps = 11/123 (9%)
 Frame = +3

Query  75   VFIAC-MLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraa  251
            +FI   M +F +A   +AQNS QD++  HN ARAAVGVGPMTW+ TV AYAQ+YAN+R  
Sbjct  3    IFIPTFMFLFFLA---HAQNSPQDYISLHNKARAAVGVGPMTWNNTVAAYAQSYANKRIN  59

Query  252  DCSLTHSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHY  428
            DC+L HS      YGENIA G  P  T    V MW  EK  Y +ASNSC    G  CGHY
Sbjct  60   DCALVHSTG---PYGENIAVGYYPEFTGADGVKMWVGEKHLYDYASNSCK---GGDCGHY  113

Query  429  TQV  437
            TQV
Sbjct  114  TQV  116



>emb|CDX72421.1| BnaC07g44430D [Brassica napus]
Length=176

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 77/124 (62%), Gaps = 5/124 (4%)
 Frame = +3

Query  66   KSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrr  245
            ++ VF+   LV + A+   AQ+S+QD+LD HN AR AVGV P+ W   V AYA+ YA R 
Sbjct  6    QTLVFVTIALVLAFAVPLKAQDSQQDYLDVHNRARRAVGVAPIRWHADVAAYARQYALRM  65

Query  246  aaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGH  425
              DC L HSG     YGEN+A   G L+   AV +W  EK  Y + SN+C   +G++CGH
Sbjct  66   RGDCRLIHSGG---RYGENLAGSTGDLSGADAVRLWVNEKNDYFYNSNTCR--SGKACGH  120

Query  426  YTQV  437
            YTQV
Sbjct  121  YTQV  124



>gb|ACN52596.1| pathogenesis-related protein, partial [Pyrus x bretschneideri]
Length=132

 Score = 99.4 bits (246),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 83/128 (65%), Gaps = 5/128 (4%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            MG     + +  +L   +    +AQ++ QD+L++HN ARAAVGVGP+TWD  V  YAQNY
Sbjct  1    MGLCNISLALLFILGSVLIQSSHAQDTPQDYLNSHNTARAAVGVGPLTWDDNVAGYAQNY  60

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQ  413
            AN+   DC+L HSG     YGEN+A   G ++  +AV +W AEK  Y++ SNSC+   G+
Sbjct  61   ANQHVGDCNLVHSGG---PYGENLAMSTGDMSGTAAVDLWVAEKADYNYESNSCA--DGK  115

Query  414  SCGHYTQV  437
             CGHYTQV
Sbjct  116  VCGHYTQV  123



>gb|ABA34066.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34067.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
Length=163

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 74/109 (68%), Gaps = 7/109 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS QD++D HN ARA VGVGP++WD TV AYAQ+YA +R  DC L HSG     YG
Sbjct  21   CTAQNSPQDYVDPHNTARADVGVGPVSWDDTVAAYAQSYAAQRQGDCKLIHSGG---PYG  77

Query  297  ENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            EN+  G  G   +A  AV  W +EK+YY H +NSC+   GQ CGHYTQV
Sbjct  78   ENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCA--EGQVCGHYTQV  124



>ref|XP_004487816.1| PREDICTED: pathogenesis-related protein 1-like [Cicer arietinum]
Length=199

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 83/131 (63%), Gaps = 7/131 (5%)
 Frame = +3

Query  45   KTKMGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEaya  224
            K  + F+  P+    +L+ +     +AQNS QD+L  HN AR+ VGVGP+ W +TV +YA
Sbjct  18   KPTISFVLLPLI--SILISTSTQISHAQNSPQDYLKIHNKARSEVGVGPIYWASTVASYA  75

Query  225  qnyanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAP  404
            QNYAN+   +C + HS   +  YGEN+A   G LTA SAV MW  EK+YY + +N+CS  
Sbjct  76   QNYANQLKGNCKMVHS---KGPYGENLAWSSGDLTATSAVTMWVGEKQYYDYNTNTCS--  130

Query  405  AGQSCGHYTQV  437
             G  CGHYTQV
Sbjct  131  NGYKCGHYTQV  141



>gb|AFM77011.1| pathogenesis related protein 1a, partial [Cydonia oblonga]
Length=154

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 82/121 (68%), Gaps = 8/121 (7%)
 Frame = +3

Query  75   VFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaD  254
            V + C ++   +   +AQ++ QD+L++HNAARAAVGVGP+TWD  V  YAQNYAN+   D
Sbjct  4    VVVLCSVLIQSS---HAQDTPQDYLNSHNAARAAVGVGPLTWDDKVAGYAQNYANQHVGD  60

Query  255  CSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
            C+L HSG     YGEN+A   G ++  +AV MW AEK  Y + SNSC+   G+ CGHYTQ
Sbjct  61   CNLVHSGGP---YGENLAMSTGDMSGTAAVDMWVAEKADYDYESNSCA--DGKVCGHYTQ  115

Query  435  V  437
            V
Sbjct  116  V  116



>ref|XP_008236237.1| PREDICTED: LOW QUALITY PROTEIN: pathogenesis-related leaf protein 
6-like [Prunus mume]
Length=157

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 74/105 (70%), Gaps = 5/105 (5%)
 Frame = +3

Query  123  AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGEN  302
            AQNS+QD+L+AHN AR  VGV  +TWD+TVEAYAQNYAN  AADC+L HS      YGEN
Sbjct  20   AQNSQQDYLNAHNVARKQVGVPNITWDSTVEAYAQNYANSSAADCNLVHSNG---TYGEN  76

Query  303  IAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            +A G G  T  +AV +W AEK  Y++ SNSC    GQ C HYTQV
Sbjct  77   LAKGSGSFTGTAAVNLWVAEKPNYNYTSNSCV--GGQQCLHYTQV  119



>ref|XP_009787160.1| PREDICTED: pathogenesis-related leaf protein 6-like [Nicotiana 
sylvestris]
Length=163

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 77/120 (64%), Gaps = 5/120 (4%)
 Frame = +3

Query  78   FIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDC  257
             + C ++ + A   +AQNS+ D+L+AHN+AR  VGV  +TWD T+  YAQNYAN+R  DC
Sbjct  11   LLICFIILAFAFPSHAQNSQTDYLNAHNSARTQVGVSAITWDITLANYAQNYANQRIGDC  70

Query  258  SLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            +L HS      YGEN+A G G  T  +AV MW AEK YY + +N C+   G  C HYTQV
Sbjct  71   NLVHSNG---PYGENLAKGSGSFTGAAAVNMWVAEKPYYDYTNNCCT--TGNQCLHYTQV  125



>gb|AAD40121.1|AF149413_2 contains similarity to SCP-like extracellular proteins; Pfam 
PF00188, Score=196.7, E=3.7e-55, N=1 [Arabidopsis thaliana]
Length=164

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 76/129 (59%), Gaps = 6/129 (5%)
 Frame = +3

Query  60   FLKSP---VFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqn  230
              KSP   +    +L  + A+   AQ+  QD+LD HN AR  VGV PM W    E YA N
Sbjct  1    MFKSPQTLILSVIVLFLAFAVPLKAQDQPQDYLDEHNRARTQVGVPPMKWHAGAEQYAWN  60

Query  231  yanrraaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            YA +R  DCSLTHS S    YGEN+A  GG L+   AV +W  EK  Y +ASN+CS   G
Sbjct  61   YAQQRKGDCSLTHSNSNGL-YGENLAWSGGALSGAEAVKLWVNEKSDYIYASNTCS--DG  117

Query  411  QSCGHYTQV  437
            + CGHYTQV
Sbjct  118  KQCGHYTQV  126



>ref|XP_004486257.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cicer arietinum]
Length=158

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 79/127 (62%), Gaps = 9/127 (7%)
 Frame = +3

Query  63   LKSPVFIACMLVFSMA-LCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyan  239
            ++S + +A   +F  + LCC AQNS QDF+D HN AR  VGVGP+ W+ T+EAYAQNYAN
Sbjct  1    MRSHMILAIFFLFMCSNLCCIAQNSPQDFVDVHNEAREVVGVGPLYWNHTLEAYAQNYAN  60

Query  240  rraaDCSLTHS-GSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQS  416
            +R  DC L HS G F    GEN+A G G +    AV  W  EK YY + SNSC       
Sbjct  61   KRIKDCELEHSMGPF----GENLAEGYGEMNGSDAVKFWLTEKPYYDYNSNSC---VHDE  113

Query  417  CGHYTQV  437
            C HYTQ+
Sbjct  114  CLHYTQI  120



>gb|ABK41053.2| pathogenesis-related protein 1 [Musa acuminata]
Length=162

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 85/123 (69%), Gaps = 9/123 (7%)
 Frame = +3

Query  81   IACMLVFSMALCCN---AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraa  251
            +A +   ++A+ C    AQNS QDF+  HNAARAAVGVGP++WD TV AYAQNYAN+RAA
Sbjct  8    LAMLSAVALAMACTGILAQNSPQDFVSPHNAARAAVGVGPVSWDNTVAAYAQNYANQRAA  67

Query  252  DCSLTHSGSFRFGYGENIAAGGG-PLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHY  428
            DC L HSG     YGENI  G G   TA  AV  W +EK+YY + SN+C AP  + CGHY
Sbjct  68   DCQLVHSGG---PYGENIFWGSGRDYTAADAVNAWVSEKQYYDYNSNTC-AP-NKVCGHY  122

Query  429  TQV  437
            TQV
Sbjct  123  TQV  125



>gb|AFD29286.1| pathogenesis-related protein 1 [Vicia faba]
Length=157

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 79/124 (64%), Gaps = 8/124 (6%)
 Frame = +3

Query  75   VFIACMLVFSMALCCN---AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrr  245
            + +A M++  ++       AQNS QD+L+ HN AR+ VGVGP+ WDT + +YAQNY N+ 
Sbjct  8    LLLALMVILILSTLTQISYAQNSPQDYLNIHNKARSQVGVGPIYWDTKLASYAQNYINQL  67

Query  246  aaDCSLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGH  425
             A+C + HS   +  YGEN+A   G +T   AV MW  EK+YY + SNSC+   G  CGH
Sbjct  68   KANCKMVHS---KGPYGENLAWSSGDITGAGAVNMWVGEKKYYDYKSNSCA--VGYKCGH  122

Query  426  YTQV  437
            YTQV
Sbjct  123  YTQV  126



>ref|XP_010500560.1| PREDICTED: pathogenesis-related protein 1B-like [Camelina sativa]
Length=162

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 82/129 (64%), Gaps = 7/129 (5%)
 Frame = +3

Query  54   MGFLKSPVFIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqny  233
            M   K P  +   + F + +  NAQNS+QDFL+ HN+ARA VGV  + WDTTV AYA NY
Sbjct  1    MKTFKIPSLLLVAISF-VVIATNAQNSQQDFLNTHNSARAQVGVANIVWDTTVAAYALNY  59

Query  234  anrraaDCSLTHSGSFRFGYGENIAAGGGP-LTAKSAVAMWDAEKRYYHHASNSCSAPAG  410
            AN R ADCSLT SG     +GEN+A G G   T  +AV +W A+K  Y + SNSC+   G
Sbjct  60   ANARKADCSLTPSGG---SFGENLAKGSGAFFTGVAAVNLWVAQKNDYTYTSNSCT--VG  114

Query  411  QSCGHYTQV  437
            + C HYTQV
Sbjct  115  KVCKHYTQV  123



>ref|XP_004170276.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
Length=162

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 79/121 (65%), Gaps = 8/121 (7%)
 Frame = +3

Query  78   FIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDC  257
            F+   L+  +A    AQNS QDF++AHNAARA VGVGP++W+ T+ AYAQ YAN++   C
Sbjct  11   FMMMGLITQLASITLAQNSHQDFVNAHNAARAKVGVGPVSWNYTLAAYAQTYANKKIGTC  70

Query  258  SLTHSGSFRFG-YGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
             + HS    +G YGEN+A G G +TA  AV  W +EK+YY H SN C    G  C HYTQ
Sbjct  71   EMQHS----YGPYGENLAEGYGEMTAVEAVNFWVSEKKYYDHHSNRC---IGDECRHYTQ  123

Query  435  V  437
            V
Sbjct  124  V  124



>ref|XP_009605697.1| PREDICTED: pathogenesis-related leaf protein 6-like [Nicotiana 
tomentosiformis]
Length=163

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 78/120 (65%), Gaps = 5/120 (4%)
 Frame = +3

Query  78   FIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDC  257
             + C ++ + A   +AQNS+ D+L AHN+AR+ VGV  +TWDTT+  YAQNYAN+R  DC
Sbjct  11   LLICFIILAFAFPSHAQNSQTDYLAAHNSARSQVGVSAITWDTTLANYAQNYANQRIGDC  70

Query  258  SLTHSGSFRFGYGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            +L HS      YGEN+A G G  T  +AV +W AEK YY + +N C+   G  C HYTQV
Sbjct  71   NLVHSNG---PYGENLAKGTGSFTGTAAVNLWVAEKPYYDYTNNYCT--GGNQCLHYTQV  125



>ref|XP_002459310.1| hypothetical protein SORBIDRAFT_02g002150 [Sorghum bicolor]
 gb|EER95831.1| hypothetical protein SORBIDRAFT_02g002150 [Sorghum bicolor]
Length=172

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 77/109 (71%), Gaps = 7/109 (6%)
 Frame = +3

Query  117  CNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYG  296
            C AQNS QD+++ HNAARA VGVGP++WD TV AYAQ+YA +R  DC L HSG     YG
Sbjct  30   CAAQNSPQDYVNPHNAARADVGVGPVSWDDTVAAYAQSYAAQRQGDCKLIHSGG---PYG  86

Query  297  ENIAAG--GGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            ENI  G  G   +A  AVA W +EK+YY+H +NSC+   G+ CGHYTQV
Sbjct  87   ENIFWGSAGADWSASDAVASWVSEKQYYNHDTNSCA--DGKVCGHYTQV  133



>ref|XP_004136921.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 gb|KGN43824.1| hypothetical protein Csa_7G070225 [Cucumis sativus]
Length=162

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 79/121 (65%), Gaps = 8/121 (7%)
 Frame = +3

Query  78   FIACMLVFSMALCCNAQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDC  257
            F+   L+  +A    AQNS QDF++AHNAARA VGVGP++W+ T+ AYAQ YAN++   C
Sbjct  11   FMMMGLITQLASITLAQNSHQDFVNAHNAARAKVGVGPVSWNYTLAAYAQTYANKKIGTC  70

Query  258  SLTHSGSFRFG-YGENIAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQ  434
             + HS    +G YGEN+A G G +TA  AV  W +EK+YY H SN C    G  C HYTQ
Sbjct  71   EMQHS----YGPYGENLAEGYGEMTAVEAVNFWVSEKKYYDHHSNRC---IGDECRHYTQ  123

Query  435  V  437
            V
Sbjct  124  V  124



>gb|AAL84768.1|AF475286_1 pathogenesis-related protein 1-1a [Cucumis sativus]
Length=140

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 74/105 (70%), Gaps = 5/105 (5%)
 Frame = +3

Query  123  AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGEN  302
            AQ+S QDF+  HN ARA VGVGP+ WD TV ++AQ YANRR  DC L +SG     YGEN
Sbjct  1    AQDSPQDFVGVHNVARAQVGVGPIEWDKTVASFAQQYANRRLNDCRLVNSGG---PYGEN  57

Query  303  IAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            IA G   L+AK AV +W  EK +Y++ +N+C+  AG+ CGHYTQV
Sbjct  58   IAWGSPDLSAKDAVQLWVDEKPFYNYETNTCA--AGELCGHYTQV  100



>ref|XP_006486832.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Citrus 
sinensis]
Length=164

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 78/105 (74%), Gaps = 5/105 (5%)
 Frame = +3

Query  123  AQNSRQDFLDAHNAARAAVGVGPMTWDTTVEayaqnyanrraaDCSLTHSGSFRFGYGEN  302
            AQNS QD+LDAHN+ARAAV V  + W+ TV AYAQNY+N R ADC+L HSG     YGEN
Sbjct  27   AQNSPQDYLDAHNSARAAVYVPNIIWNDTVAAYAQNYSNSRIADCNLVHSGG---PYGEN  83

Query  303  IAAGGGPLTAKSAVAMWDAEKRYYHHASNSCSAPAGQSCGHYTQV  437
            IA G G  T  +AV++W AEK  Y++++N+C+  AG+ CGHYTQV
Sbjct  84   IAKGSGTFTGTAAVSLWVAEKANYNYSTNTCA--AGKVCGHYTQV  126



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519632749224