BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19976_g2_i1 len=977 path=[8887:0-288 7368:289-312 7392:313-976]

Length=977
                                                                      Score     E

ref|XP_009604501.1|  PREDICTED: uncharacterized protein LOC104099272  93.2    5e-19   
emb|CDP20383.1|  unnamed protein product                              93.2    9e-19   
ref|XP_009785246.1|  PREDICTED: uncharacterized protein LOC104233536  89.4    1e-17   
ref|XP_006359892.1|  PREDICTED: uncharacterized protein LOC102586431  88.2    2e-17   
ref|XP_011079593.1|  PREDICTED: uncharacterized protein LOC105163072  84.7    8e-17   
ref|XP_009775936.1|  PREDICTED: uncharacterized protein LOC104225770  82.8    4e-15   
ref|XP_009592738.1|  PREDICTED: uncharacterized protein LOC104089519  79.3    7e-14   
ref|XP_004152232.1|  PREDICTED: uncharacterized protein LOC101222123  73.6    1e-12   
ref|XP_008235177.1|  PREDICTED: uncharacterized protein LOC103334033  75.1    2e-12   
gb|KGN52840.1|  hypothetical protein Csa_4G002570                     73.9    3e-12   
ref|XP_010323018.1|  PREDICTED: uncharacterized protein LOC101245470  71.2    3e-11   
ref|XP_004247380.1|  PREDICTED: WASH complex subunit CCDC53 homolog   70.5    4e-11   
gb|KDP28227.1|  hypothetical protein JCGZ_13998                       69.3    1e-10   
ref|XP_009339812.1|  PREDICTED: uncharacterized protein LOC103932007  69.3    2e-10   
ref|XP_008342162.1|  PREDICTED: uncharacterized protein LOC103404976  68.6    5e-10   
ref|XP_007163162.1|  hypothetical protein PHAVU_001G211600g           66.2    2e-09   
ref|XP_004494410.1|  PREDICTED: uncharacterized protein LOC101496512  66.2    2e-09   
ref|XP_008454307.1|  PREDICTED: uncharacterized protein LOC103494745  65.1    5e-09   
gb|ACU14694.1|  unknown                                               65.1    5e-09   Glycine max [soybeans]
gb|EYU46785.1|  hypothetical protein MIMGU_mgv1a012405mg              65.9    5e-09   
gb|KHN43476.1|  hypothetical protein glysoja_002059                   65.1    5e-09   
ref|XP_007051059.1|  Uncharacterized protein TCM_004767               64.3    7e-09   
ref|XP_003536874.1|  PREDICTED: uncharacterized protein LOC100787002  63.9    1e-08   
gb|KGN44996.1|  hypothetical protein Csa_7G407000                     63.2    1e-08   
ref|XP_002455597.1|  hypothetical protein SORBIDRAFT_03g013670        62.0    8e-08   Sorghum bicolor [broomcorn]
ref|XP_010259379.1|  PREDICTED: uncharacterized protein LOC104598838  58.9    4e-07   
ref|XP_002302747.1|  hypothetical protein POPTR_0002s20010g           59.3    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_003519753.1|  PREDICTED: uncharacterized protein LOC100800206  59.3    5e-07   
gb|KHN08655.1|  hypothetical protein glysoja_024564                   58.9    5e-07   
ref|XP_010038264.1|  PREDICTED: uncharacterized protein LOC104426799  58.9    6e-07   
ref|XP_007200475.1|  hypothetical protein PRUPE_ppa011326mg           58.9    7e-07   
ref|XP_004495922.1|  PREDICTED: uncharacterized protein LOC101509716  58.5    8e-07   
ref|XP_009399324.1|  PREDICTED: uncharacterized protein LOC103983776  57.8    9e-07   
ref|XP_010103386.1|  hypothetical protein L484_007455                 58.2    1e-06   
gb|KHN19228.1|  hypothetical protein glysoja_041580                   57.8    2e-06   
ref|XP_006577726.1|  PREDICTED: uncharacterized protein LOC102662079  57.8    2e-06   
ref|XP_010069872.1|  PREDICTED: uncharacterized protein LOC104456718  57.0    2e-06   
ref|XP_007145169.1|  hypothetical protein PHAVU_007G216300g           57.0    3e-06   
ref|NP_001042953.2|  Os01g0341300                                     57.8    3e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KCW58381.1|  hypothetical protein EUGRSUZ_H01069                   56.6    3e-06   
ref|XP_010679343.1|  PREDICTED: uncharacterized protein LOC104894735  55.8    7e-06   
ref|XP_010652228.1|  PREDICTED: uncharacterized protein LOC104879792  55.1    8e-06   
gb|ACU17664.1|  unknown                                               54.7    1e-05   Glycine max [soybeans]
ref|XP_010921585.1|  PREDICTED: uncharacterized protein LOC105045127  54.7    1e-05   
ref|XP_011042205.1|  PREDICTED: uncharacterized protein LOC105137948  54.7    1e-05   
ref|XP_006645857.1|  PREDICTED: uncharacterized protein LOC102713150  54.7    2e-05   
gb|EEC70575.1|  hypothetical protein OsI_01764                        53.9    2e-05   Oryza sativa Indica Group [Indian rice]
tpg|DAA54517.1|  TPA: hypothetical protein ZEAMMB73_753064            54.7    3e-05   
ref|XP_002320317.1|  hypothetical protein POPTR_0014s11860g           53.5    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002515316.1|  conserved hypothetical protein                   51.2    2e-04   Ricinus communis
ref|XP_006855321.1|  hypothetical protein AMTR_s00057p00082640        50.8    3e-04   
ref|XP_003625949.1|  hypothetical protein MTR_7g109300                50.4    9e-04   



>ref|XP_009604501.1| PREDICTED: uncharacterized protein LOC104099272 [Nicotiana tomentosiformis]
Length=199

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 71/121 (59%), Gaps = 20/121 (17%)
 Frame = -2

Query  544  QGENSWKNIVGCMRPLTLQGKS---------PAISPSPTAPDLQALVPQGGLESPAPSYV  392
            +G+N WK +VG MRPL LQ            P  SPSPT    + +       S A    
Sbjct  86   KGDN-WKKLVGSMRPLHLQDNQSPPTTHQPPPVKSPSPTVECCENVSSPSPSTSSA----  140

Query  391  SSGGTMSRYASASDLQEL---DACDNEDDPDEVFDAITGDEMIDTKAEEFINQFYQQMKL  221
               GTMS+YASA++LQEL    + D E+DPD+VFDAI  DEMID KAE FI QFY+QM+ 
Sbjct  141  ---GTMSQYASANNLQELYGESSDDEEEDPDQVFDAIGADEMIDAKAENFIAQFYEQMRR  197

Query  220  Q  218
            Q
Sbjct  198  Q  198



>emb|CDP20383.1| unnamed protein product [Coffea canephora]
Length=239

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 85/137 (62%), Gaps = 19/137 (14%)
 Frame = -2

Query  571  DGADRKAKKQGENSWKNIVGCMRPLTLQGK---SPAISPSPTAPDLQA------------  437
            +G D   +   +  W+ +VG MRPL LQ     SPA  P P    L++            
Sbjct  100  EGVDPDDRIHSKTKWEKMVGSMRPLHLQDNRSLSPASPPRPGVESLESEDLIYNNSSAMM  159

Query  436  LVPQGGLESPAPSYVSSGGTMSRYASASDLQELDA----CDNEDDPDEVFDAITGDEMID  269
             + Q    SP+PS VSSGGTMS+YASAS+LQEL+      +++DDPDEVFDA+ GDEMID
Sbjct  160  SIHQHQPSSPSPSTVSSGGTMSQYASASNLQELEQDYYQGNDDDDPDEVFDALCGDEMID  219

Query  268  TKAEEFINQFYQQMKLQ  218
             KAEEFI QFYQQMKLQ
Sbjct  220  AKAEEFIAQFYQQMKLQ  236



>ref|XP_009785246.1| PREDICTED: uncharacterized protein LOC104233536 [Nicotiana sylvestris]
Length=203

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 70/124 (56%), Gaps = 20/124 (16%)
 Frame = -2

Query  553  AKKQGENSWKNIVGCMRPLTLQGKSPAI---------SPSPTAPDLQALVPQGGLESPAP  401
            A  +G+N WK +VG MRPL LQ               SPSP     + +       S A 
Sbjct  87   ADSKGDN-WKKLVGSMRPLHLQDNQSPPTPHQPPPVKSPSPMVECCENVSSPSPSTSSA-  144

Query  400  SYVSSGGTMSRYASASDLQEL---DACDNEDDPDEVFDAITGDEMIDTKAEEFINQFYQQ  230
                  GTMS+YASA++LQEL    + D E+DPD+VFDAI  DEMID KAE FI QFY+Q
Sbjct  145  ------GTMSQYASANNLQELYGESSDDEEEDPDQVFDAIGADEMIDAKAENFIAQFYEQ  198

Query  229  MKLQ  218
            M+ Q
Sbjct  199  MRRQ  202



>ref|XP_006359892.1| PREDICTED: uncharacterized protein LOC102586431 [Solanum tuberosum]
Length=191

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 77/125 (62%), Gaps = 15/125 (12%)
 Frame = -2

Query  553  AKKQGENSWKNIVGCMRPLTLQGKSPAISP---------SPTAPDLQALVPQGGLESPAP  401
            A  +GEN WK +VG MRPL LQ      SP           T+  ++       L SP P
Sbjct  68   ADSKGEN-WKKLVGSMRPLHLQDNQSPPSPRDPQPPPPVKSTSLPVEFSEHFSSLYSPTP  126

Query  400  SYVSSGGTMSRYASASDLQEL----DACDNEDDPDEVFDAITGDEMIDTKAEEFINQFYQ  233
            S  SS GTMS+YASA++LQ+L    D  + E+DPD+VFDAI GD+MID KAE FI QFY+
Sbjct  127  S-TSSIGTMSQYASANNLQDLYNDDDEEEEEEDPDQVFDAIGGDDMIDAKAESFIAQFYE  185

Query  232  QMKLQ  218
            QM+LQ
Sbjct  186  QMRLQ  190



>ref|XP_011079593.1| PREDICTED: uncharacterized protein LOC105163072 [Sesamum indicum]
Length=117

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 70/105 (67%), Gaps = 10/105 (10%)
 Frame = -2

Query  508  MRPLTLQGKSPAISPSPTAPDLQALVPQGGLES-----PAPSYVSSGGTMSRYASASDLQ  344
            MRPL L     A+SP P   D++ ++P   +ES     PA   VS  GTMS+YASA+ L+
Sbjct  1    MRPLRLPEA--ALSPPPALKDIEEMIPPPVIESIEEIKPASPEVSCSGTMSQYASATSLR  58

Query  343  ELDACDNEDDPDE---VFDAITGDEMIDTKAEEFINQFYQQMKLQ  218
            +LD  D+E+  ++   VFDAITGDEMID KAEEFI QFY+Q+ LQ
Sbjct  59   DLDVSDDEEGEEDPDEVFDAITGDEMIDAKAEEFIAQFYRQIHLQ  103



>ref|XP_009775936.1| PREDICTED: uncharacterized protein LOC104225770 [Nicotiana sylvestris]
Length=245

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 76/139 (55%), Gaps = 35/139 (25%)
 Frame = -2

Query  529  WKNIVGCMRPLTLQGK--------------------SPAISPSPTAPDLQAL-VPQGGLE  413
            WK +VG MRPL LQ                      S  +S   +A DLQA+ VP  G  
Sbjct  97   WKKLVGSMRPLHLQDNNSQAAYDYCATTSSPSALSCSGTMSQYASASDLQAMDVPAAGAP  156

Query  412  SPAPS---YVS-----------SGGTMSRYASASDLQELDACDNEDDPDEVFDAITGDEM  275
            S   S   Y S           S GTMS+YASA++LQELD  + E+DPD+VFDAI  D+M
Sbjct  157  SITDSMSQYASANDLQALEASTSSGTMSQYASANNLQELDDEEEEEDPDQVFDAIGADDM  216

Query  274  IDTKAEEFINQFYQQMKLQ  218
            ID KAEEFI QFYQQM+ Q
Sbjct  217  IDAKAEEFILQFYQQMRRQ  235



>ref|XP_009592738.1| PREDICTED: uncharacterized protein LOC104089519 [Nicotiana tomentosiformis]
Length=253

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 74/146 (51%), Gaps = 42/146 (29%)
 Frame = -2

Query  529  WKNIVGCMRPLTLQGKSPAISPSPTAP--------------------------DLQAL--  434
            WK +VG MRPL LQ  + + +PS TA                           DLQAL  
Sbjct  98   WKKLVGSMRPLHLQDNNNSRTPSQTAAYDYCATTSSPSALSCSGTMSQYASANDLQALDV  157

Query  433  ---VPQGGLESPAPSYVSSG-----------GTMSRYASASDLQELDACDNEDDPDEVFD  296
                    +      Y SS            GTMS+YASA++LQELD  + E+DPD+VFD
Sbjct  158  PAAAAAPSITDSMSQYASSNDLQALEASTSSGTMSQYASANNLQELDDEEEEEDPDQVFD  217

Query  295  AITGDEMIDTKAEEFINQFYQQMKLQ  218
            AI  D+MID KAEEFI QFYQQM+ Q
Sbjct  218  AIGADDMIDAKAEEFILQFYQQMRRQ  243



>ref|XP_004152232.1| PREDICTED: uncharacterized protein LOC101222123 [Cucumis sativus]
 ref|XP_004156825.1| PREDICTED: uncharacterized protein LOC101230246 [Cucumis sativus]
Length=134

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 62/116 (53%), Gaps = 12/116 (10%)
 Frame = -2

Query  529  WKNIVGCMRPLTLQGKSPAISPSPTAPDLQALVPQGGLESPAPSYVSSGGT------MSR  368
            W  +VG MRPL LQ       PS  A   +  +P+        ++     +      MSR
Sbjct  2    WNRLVGAMRPLHLQSDESTTVPSLPAASTEPPLPRLPSSPSLDNFEDVNSSSSSVDGMSR  61

Query  367  YASASDLQELDACDNEDDP---DEVFDAITG---DEMIDTKAEEFINQFYQQMKLQ  218
            YASA++LQ+LD  D ED+    D+V   + G   DEMID KAE FI QFY+QMKLQ
Sbjct  62   YASAANLQDLDQNDGEDEEINNDKVSSNVDGEDEDEMIDAKAEMFIAQFYEQMKLQ  117



>ref|XP_008235177.1| PREDICTED: uncharacterized protein LOC103334033 [Prunus mume]
Length=231

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 62/116 (53%), Gaps = 18/116 (16%)
 Frame = -2

Query  538  ENSWKNIVGCMRPLTLQGKSPAISPSPTAPDLQALVPQGGLE-------SPAPS--YVSS  386
            + +WK +VG +RPL LQ  S +  PS     +    P    E       SPA +    S 
Sbjct  114  KGTWKRLVGSIRPLHLQTTSNSTPPS----SVHTPAPSERYEDVLPPPMSPARTDDLSSE  169

Query  385  GGTMSRYASASDLQELDACDNEDDPDEVFDAITGDEMIDTKAEEFINQFYQQMKLQ  218
             G  SRYASA +LQELD  D ++D   + +A      ID KAEEFI QFYQQM+LQ
Sbjct  170  DGMTSRYASAVNLQELDRTDEDNDNAAIVNA-----NIDAKAEEFIAQFYQQMRLQ  220



>gb|KGN52840.1| hypothetical protein Csa_4G002570 [Cucumis sativus]
Length=217

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 62/116 (53%), Gaps = 12/116 (10%)
 Frame = -2

Query  529  WKNIVGCMRPLTLQGKSPAISPSPTAPDLQALVPQGGLESPAPSYVSSGGT------MSR  368
            W  +VG MRPL LQ       PS  A   +  +P+        ++     +      MSR
Sbjct  85   WNRLVGAMRPLHLQSDESTTVPSLPAASTEPPLPRLPSSPSLDNFEDVNSSSSSVDGMSR  144

Query  367  YASASDLQELDACDNEDDP---DEVFDAITG---DEMIDTKAEEFINQFYQQMKLQ  218
            YASA++LQ+LD  D ED+    D+V   + G   DEMID KAE FI QFY+QMKLQ
Sbjct  145  YASAANLQDLDQNDGEDEEINNDKVSSNVDGEDEDEMIDAKAEMFIAQFYEQMKLQ  200



>ref|XP_010323018.1| PREDICTED: uncharacterized protein LOC101245470 [Solanum lycopersicum]
Length=198

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 77/138 (56%), Gaps = 30/138 (22%)
 Frame = -2

Query  547  KQGENSWKNIVGCMRPLTLQ---------------GKSP-AISPSPTAPDLQALVPQGGL  416
            +QG+  WK +VG MRPL LQ                 SP A+S   +A DL++L     +
Sbjct  53   QQGD--WKKLVGSMRPLHLQDNNNNNINNNNTLYCATSPSAVSQYASADDLKSLDQLDTM  110

Query  415  ESPA-----------PSYVSSGGTMSRYASASDLQELDACDNEDD-PDEVFDAITGDEMI  272
               A            S  +S  TMS+YASAS+LQ+LD  + ++D PD+VFDAI  D+MI
Sbjct  111  SQYASANDLKSLDDQASASASSETMSQYASASNLQDLDEQEEDEDDPDKVFDAIGADDMI  170

Query  271  DTKAEEFINQFYQQMKLQ  218
            D KAE FI QFYQQM+ Q
Sbjct  171  DAKAELFILQFYQQMRRQ  188



>ref|XP_004247380.1| PREDICTED: WASH complex subunit CCDC53 homolog [Solanum lycopersicum]
Length=187

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 71/120 (59%), Gaps = 12/120 (10%)
 Frame = -2

Query  544  QGENSWKNIVGCMRPLTLQGKSPAISPS---PTAPDLQALVPQGGLESPAPSYVSSGGTM  374
            +GEN WK +VG MRPL LQ      SP    P  P     +P    E  +  Y  +  T 
Sbjct  68   KGEN-WKKLVGSMRPLHLQDNQSPPSPRDTQPPPPAKTTSLPVEFSEQFSSMYSPTPSTS  126

Query  373  S-----RYASASDLQEL---DACDNEDDPDEVFDAITGDEMIDTKAEEFINQFYQQMKLQ  218
            S     +YASA++LQ+L   D  + ++DPD+VFDAI GD+MID KAE FI QFY+QM+LQ
Sbjct  127  SISTMSQYASANNLQDLYDDDEEEEQEDPDQVFDAIGGDDMIDAKAENFIAQFYEQMRLQ  186



>gb|KDP28227.1| hypothetical protein JCGZ_13998 [Jatropha curcas]
Length=205

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 70/127 (55%), Gaps = 16/127 (13%)
 Frame = -2

Query  559  RKAKKQGENSWKNIVGCMRPLTLQGKSP---AISPSP-----TAPDLQALVPQGGLESP-  407
            +K +    + W++IV  +RPL LQ +     +I   P     T P +QA        +P 
Sbjct  75   KKVRTNETSMWESIVCSIRPLHLQSQESLRYSIDCRPPRETVTLPTVQAFGEDIDDFTPP  134

Query  406  -APSYVSS--GGTMSRYASASDLQELDACDNEDDPD-EVFDAITGDEMIDTKAEEFINQF  239
             +PS  SS     MS+YASA +LQELD   N D+ + E +D   GDE ID KAE FI QF
Sbjct  135  MSPSRASSFSDNAMSQYASAVNLQELDDEGNVDNQEYEFYD---GDETIDVKAELFIAQF  191

Query  238  YQQMKLQ  218
            YQQM+LQ
Sbjct  192  YQQMRLQ  198



>ref|XP_009339812.1| PREDICTED: uncharacterized protein LOC103932007 [Pyrus x bretschneideri]
Length=249

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 66/123 (54%), Gaps = 18/123 (15%)
 Frame = -2

Query  538  ENSWKNIVGCMRPLTLQGKS-----PAISPSPTAPDLQALVPQGGLE-------SPAPS-  398
            +++WK +VG +RPL LQ  S     P+ S + +  +  + + Q   E       SPA + 
Sbjct  111  KSTWKRLVGSIRPLHLQSGSSNPSTPSASSARSTHERTSSIEQ--YEDVLLPPMSPARTD  168

Query  397  -YVSSGGTMSRYASASDLQELDACDNEDDPDEVF--DAITGDEMIDTKAEEFINQFYQQM  227
               S  G  SRYASA  LQELD  ++ D         A T D+ ID KAEEFI QFYQQM
Sbjct  169  DLSSEDGMSSRYASAVSLQELDRTEDHDSNAIAACPGAATHDQNIDAKAEEFIAQFYQQM  228

Query  226  KLQ  218
            +LQ
Sbjct  229  RLQ  231



>ref|XP_008342162.1| PREDICTED: uncharacterized protein LOC103404976 [Malus domestica]
Length=249

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 66/124 (53%), Gaps = 20/124 (16%)
 Frame = -2

Query  538  ENSWKNIVGCMRPLTLQGKSPAISPSPTAPDLQALVPQ-GGLE----------SPAPS--  398
            +++WK +VG +RPL LQ  S   S +P+A   ++   +   +E          SPA +  
Sbjct  111  KSTWKRLVGSIRPLHLQSGSSNPS-TPSASSARSTHERTSSIERYEDVLLPPISPARTDD  169

Query  397  YVSSGGTMSRYASASDLQELDACDNEDDPDEVFDAITGD----EMIDTKAEEFINQFYQQ  230
              S  G  SRYASA  LQELD    EDD      A  GD    + ID KAEEFI QFYQQ
Sbjct  170  LSSEDGMSSRYASAVSLQELDRT--EDDDTNAIAACPGDATHDQNIDAKAEEFIAQFYQQ  227

Query  229  MKLQ  218
            M+LQ
Sbjct  228  MRLQ  231



>ref|XP_007163162.1| hypothetical protein PHAVU_001G211600g [Phaseolus vulgaris]
 gb|ESW35156.1| hypothetical protein PHAVU_001G211600g [Phaseolus vulgaris]
Length=211

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 59/127 (46%), Gaps = 32/127 (25%)
 Frame = -2

Query  529  WKNIVGCMRPLTLQGKSPAISPSPTAPDLQALVPQGGLESPAPSYVSSGGTMS-------  371
            W+ IVG MRPL LQ      S S +A             SP       GG +S       
Sbjct  75   WRKIVGSMRPLHLQSNQTPRSVSDSA---------AVFYSPKSPAKDCGGNVSDFVAEEE  125

Query  370  ---------RYASASDLQELDACDNEDDPDEVF-----DAITGD--EMIDTKAEEFINQF  239
                     RYASA  L EL   D E++  EV      + + GD  EMID+KAE+FI QF
Sbjct  126  PYSPSPPSSRYASAVGLNELVQSDEENEKQEVIMEEDEEQVDGDGDEMIDSKAEDFITQF  185

Query  238  YQQMKLQ  218
            YQ+M+LQ
Sbjct  186  YQEMRLQ  192



>ref|XP_004494410.1| PREDICTED: uncharacterized protein LOC101496512 [Cicer arietinum]
Length=217

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 63/138 (46%), Gaps = 32/138 (23%)
 Frame = -2

Query  544  QGENSWKNIVGCMRPLTLQ-GKSPAISPSPTAPDLQALVPQGGLESPAPSYVSSGGTM--  374
            +  N WK  VG MRPL LQ  +SP    S T  +   +     L  P+P      G++  
Sbjct  64   ESNNVWKKFVGSMRPLHLQSNRSPR---SVTESNDHQIDRANTLPPPSPCESYGSGSVFA  120

Query  373  ------------------SRYASASDLQELDACDNEDDPDEVF--------DAITGDEMI  272
                              SRYASA  L EL   D E++  +V         + + GDE I
Sbjct  121  DFPSEEEPYSPLPESPPNSRYASAIGLNELVQSDEENERQDVIKEECCDHEEDVDGDEKI  180

Query  271  DTKAEEFINQFYQQMKLQ  218
            D KAEEFI QFY+QMKLQ
Sbjct  181  DAKAEEFIAQFYKQMKLQ  198



>ref|XP_008454307.1| PREDICTED: uncharacterized protein LOC103494745 [Cucumis melo]
Length=220

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 59/116 (51%), Gaps = 12/116 (10%)
 Frame = -2

Query  529  WKNIVGCMRPLTLQGKSPAISPS-PTAPDLQALVPQGGLESPAPSYVSSGGT-------M  374
            W  +VG MRPL LQ       PS PT+ D     P         ++     +       M
Sbjct  88   WNRLVGAMRPLHLQSDESTTIPSLPTSTDPHPPPPLFPSSPSVDNFEDVNSSSSSSVDGM  147

Query  373  SRYASASDLQELDACDNED---DPDEVFDAITG-DEMIDTKAEEFINQFYQQMKLQ  218
            SRYAS  +LQ LD  D E+   + D+ +  + G DEMID KAE FI QFY+Q+KLQ
Sbjct  148  SRYASVDNLQALDQNDEEEEERNNDKFYANMDGEDEMIDAKAEMFIAQFYEQIKLQ  203



>gb|ACU14694.1| unknown [Glycine max]
Length=210

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 63/139 (45%), Gaps = 32/139 (23%)
 Frame = -2

Query  583  DQDEDGADRKAKKQGENSWKNIVGCMRPLTLQGKSPAISPSPTAPDLQALVPQGGLESPA  404
            D +EDG   K+      +W   VG MRPL LQ      S   +  + +         S  
Sbjct  60   DNNEDGERSKS------TWGKFVGSMRPLHLQSTQSPRSSPDSPSEYK---------SDC  104

Query  403  PSYVSSGGTMS----------RYASASDLQELDACDNEDDPDEV----FDAIT---GDEM  275
              YVS  G             RYASA  L EL   D E++  EV    ++      GDEM
Sbjct  105  GGYVSDFGAEEEPYSPSPPSSRYASAVGLNELVQNDEENEKQEVIVEDYEQHVDGDGDEM  164

Query  274  IDTKAEEFINQFYQQMKLQ  218
            ID KAE+FI QFYQ+MKLQ
Sbjct  165  IDAKAEDFIAQFYQEMKLQ  183



>gb|EYU46785.1| hypothetical protein MIMGU_mgv1a012405mg [Erythranthe guttata]
Length=251

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 6/61 (10%)
 Frame = -2

Query  382  GTMSRYASASDLQEL------DACDNEDDPDEVFDAITGDEMIDTKAEEFINQFYQQMKL  221
            GTMS+YASA+ L++L      +  + E+DPDEVFDAITGDEMID KAEEFI QFY+Q++L
Sbjct  177  GTMSQYASAASLRDLYNSSDDEDEEEEEDPDEVFDAITGDEMIDAKAEEFIAQFYKQIQL  236

Query  220  Q  218
            Q
Sbjct  237  Q  237



>gb|KHN43476.1| hypothetical protein glysoja_002059 [Glycine soja]
Length=223

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 63/139 (45%), Gaps = 32/139 (23%)
 Frame = -2

Query  583  DQDEDGADRKAKKQGENSWKNIVGCMRPLTLQGKSPAISPSPTAPDLQALVPQGGLESPA  404
            D +EDG   K+      +W   VG MRPL LQ      S   +  + +         S  
Sbjct  60   DNNEDGERSKS------TWGKFVGSMRPLHLQSTQSPRSSPDSPSEYK---------SDC  104

Query  403  PSYVSSGGTMS----------RYASASDLQELDACDNEDDPDEV----FDAIT---GDEM  275
              YVS  G             RYASA  L EL   D E++  EV    ++      GDEM
Sbjct  105  GGYVSDFGAEEEPYSPSPPSSRYASAVGLNELVQNDEENEKQEVIVEDYEQHVDGDGDEM  164

Query  274  IDTKAEEFINQFYQQMKLQ  218
            ID KAE+FI QFYQ+MKLQ
Sbjct  165  IDAKAEDFIAQFYQEMKLQ  183



>ref|XP_007051059.1| Uncharacterized protein TCM_004767 [Theobroma cacao]
 gb|EOX95216.1| Uncharacterized protein TCM_004767 [Theobroma cacao]
Length=202

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 61/136 (45%), Gaps = 36/136 (26%)
 Frame = -2

Query  532  SWKNIVGCMRPLTLQGKS---PAISPSPTAPDLQALVPQGGL--------------ESPA  404
            SWK +VG MRP+ LQ      PAI   P        +P G                 SP+
Sbjct  68   SWKGLVGSMRPMHLQSNQSPPPAIEAEPAMMPEAESIPLGKYVGEEISSPLSPMRDSSPS  127

Query  403  PSYVSSGGTMSRYASASDLQELDACDNEDDPDEVF---DAIT-----------GDEMIDT  266
            P +     +MS Y S SD+ + ++  N  D   V    + IT           GDEMID 
Sbjct  128  PVF-----SMSSYGSVSDMSQYESPLNLPDLQHVIKSCEEITQEPEFWYGDDDGDEMIDA  182

Query  265  KAEEFINQFYQQMKLQ  218
            KAEEFI QFY+QM+ Q
Sbjct  183  KAEEFIAQFYEQMRRQ  198



>ref|XP_003536874.1| PREDICTED: uncharacterized protein LOC100787002 [Glycine max]
 gb|KHN30658.1| hypothetical protein glysoja_037690 [Glycine soja]
Length=198

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 64/131 (49%), Gaps = 15/131 (11%)
 Frame = -2

Query  568  GADRKAKK-----QGENSWKNIVGCMRPLTLQGKSPAISPSPTAPDLQALVP------QG  422
            G  RK+K      + ++ W+ +VG MRPL LQ      + +   P    ++       + 
Sbjct  50   GRSRKSKMLAVDDESKSIWRKLVGSMRPLHLQSNHDDDNNNNVNPHQSKMMKTTSAPSEN  109

Query  421  G---LESPAPSYVSSGGTMSRYASASDLQELDACDNEDDPDEVFDAITGDEMIDTKAEEF  251
            G    +S      SS    SRYASA  L E+   + E++     D   GDEMID KAEEF
Sbjct  110  GDDSFDSATEFGNSSSPASSRYASAVGLNEMVQEEEENEKINNNDG-EGDEMIDAKAEEF  168

Query  250  INQFYQQMKLQ  218
            I QFY QM+LQ
Sbjct  169  IAQFYHQMRLQ  179



>gb|KGN44996.1| hypothetical protein Csa_7G407000 [Cucumis sativus]
Length=181

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 66/125 (53%), Gaps = 18/125 (14%)
 Frame = -2

Query  529  WKNIVGCMRPLTLQGKSP--------AISPSPTAPDLQ-ALVPQGGLESPAPSYVSSG--  383
            W+ ++G +RPL + G  P        ++ PS    D + AL+P     +   S   S   
Sbjct  57   WRRLLGSIRPLHIHGNEPPPTAARDMSLPPSKPKEDFEEALMPLPSHSTSPSSSSLSRTS  116

Query  382  -----GTMSRYASASDLQELDACDNEDDPD-EVFDAITGDEMIDTKAEEFINQFYQQMKL  221
                 GT S+YASAS LQE D   + DD + E+ +   GDEMID KAEEFI QFY+QM+ 
Sbjct  117  RSSSFGT-SQYASASSLQEFDDNTDGDDDENEIHEDNGGDEMIDAKAEEFIAQFYEQMRR  175

Query  220  QTEPN  206
            Q   N
Sbjct  176  QRYNN  180



>ref|XP_002455597.1| hypothetical protein SORBIDRAFT_03g013670 [Sorghum bicolor]
 gb|EES00717.1| hypothetical protein SORBIDRAFT_03g013670 [Sorghum bicolor]
Length=245

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 61/129 (47%), Gaps = 12/129 (9%)
 Frame = -2

Query  571  DGADRKAKKQGENSWKNIVGCMRPLTLQGKSPAISPSPTAPDLQALVPQGGLESPAPSYV  392
            D  D K       SWKNIV  MRPL L+G+     P P       +     L  P PS  
Sbjct  112  DAVDYKPAGDESPSWKNIVDSMRPLRLRGQELEYYPPPPPLGHADVYHDVIL--PPPSPA  169

Query  391  SSG------GTMSRYASASDLQELDACDNEDDPDEVFDAITGD----EMIDTKAEEFINQ  242
             SG      G  SRYASA DL ++D+ D+E+          GD      ID +AEEFI +
Sbjct  170  RSGFEFEEVGMTSRYASADDLHQMDSADDEEVALAAEGGNDGDSSCPHAIDMQAEEFIAK  229

Query  241  FYQQMKLQT  215
            FY+Q K ++
Sbjct  230  FYEQFKSES  238



>ref|XP_010259379.1| PREDICTED: uncharacterized protein LOC104598838 [Nelumbo nucifera]
Length=180

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 63/114 (55%), Gaps = 14/114 (12%)
 Frame = -2

Query  529  WKNIVGCMRPLTLQGKSP----AISPSPTAPD------LQALVPQGGLESPAPSYVSSGG  380
            WK ++G MR L L  +SP     I  +PT  +       Q        +S   +  SS  
Sbjct  64   WKRLLGAMRLLQLHHQSPLPPITIENNPTTVEAFQDVHPQPSSLPLPPKSTTLTPSSSTD  123

Query  379  TMSRYASASDLQELDACDNEDDPDEVFDAITGDEMIDTKAEEFINQFYQQMKLQ  218
            +MSRYASA +LQELD  + ++D D       GDEMID KAEEFI +FY+QM+LQ
Sbjct  124  SMSRYASAQNLQELDRSEQDEDGD----DDNGDEMIDAKAEEFIARFYEQMRLQ  173



>ref|XP_002302747.1| hypothetical protein POPTR_0002s20010g [Populus trichocarpa]
 gb|EEE82020.1| hypothetical protein POPTR_0002s20010g [Populus trichocarpa]
Length=195

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 58/130 (45%), Gaps = 26/130 (20%)
 Frame = -2

Query  529  WKNIVGCMRPLTLQGKSPAISPSP--------------TAPDLQALVPQGGLESPAPSYV  392
            WK  +  MRPL +      I  +P              T P     V +  LE   PSY 
Sbjct  62   WKKYLSFMRPLHVHSNQQRIEATPAPVTSTAVDEESKVTPPAASVDVVEQYLEVLTPSYS  121

Query  391  --------SSGGTMSRYASASDLQEL----DACDNEDDPDEVFDAITGDEMIDTKAEEFI  248
                    SS G  S+YASA +L +L       D + D D  +D   GDE ID KAE+FI
Sbjct  122  PAPKSIASSSSGQTSQYASAQNLLDLLIDMSDEDEDGDEDSYYDDKYGDETIDMKAEQFI  181

Query  247  NQFYQQMKLQ  218
             +FY QMKLQ
Sbjct  182  AKFYDQMKLQ  191



>ref|XP_003519753.1| PREDICTED: uncharacterized protein LOC100800206 [Glycine max]
Length=211

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 67/148 (45%), Gaps = 37/148 (25%)
 Frame = -2

Query  568  GADRKAKK-----QGENSWKNIVGCMRPLTLQ-GKSPA-----------ISPSPTAPDLQ  440
            G  RK+K      + ++ W+ +VG MRPL LQ  +SP+           I P  +     
Sbjct  53   GRSRKSKMLAVDDESKSIWRKLVGSMRPLHLQSNQSPSHDIDNNNNNNNIPPHQSKMMKI  112

Query  439  ALVPQ----GGLESPAPSYVSSGGTMSRYASASDLQELDACD---------NEDDPDEVF  299
               P      G +S +    S     SRYASA  L E+   +         N DD D   
Sbjct  113  TSAPSENGDDGFDSASEFTYSPSPASSRYASAVGLNEMVQEEEEEVAKEKINNDDGD---  169

Query  298  DAITGDEMIDTKAEEFINQFYQQMKLQT  215
                GDEMID KAEEFI QFY QM+LQ+
Sbjct  170  ----GDEMIDAKAEEFIAQFYHQMRLQS  193



>gb|KHN08655.1| hypothetical protein glysoja_024564 [Glycine soja]
Length=203

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 67/148 (45%), Gaps = 37/148 (25%)
 Frame = -2

Query  568  GADRKAKK-----QGENSWKNIVGCMRPLTLQ-GKSPA-----------ISPSPTAPDLQ  440
            G  RK+K      + ++ W+ +VG MRPL LQ  +SP+           I P  +     
Sbjct  45   GRSRKSKMLAVDDESKSIWRKLVGSMRPLHLQSNQSPSHDIDNNNNNNNIPPHQSKMMKI  104

Query  439  ALVPQ----GGLESPAPSYVSSGGTMSRYASASDLQELDACD---------NEDDPDEVF  299
               P      G +S +    S     SRYASA  L E+   +         N DD D   
Sbjct  105  TSAPSENGDDGFDSASEFTYSPSPASSRYASAVGLNEMVQEEEEEVAKEKINNDDGD---  161

Query  298  DAITGDEMIDTKAEEFINQFYQQMKLQT  215
                GDEMID KAEEFI QFY QM+LQ+
Sbjct  162  ----GDEMIDAKAEEFIAQFYHQMRLQS  185



>ref|XP_010038264.1| PREDICTED: uncharacterized protein LOC104426799 [Eucalyptus grandis]
Length=205

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 68/119 (57%), Gaps = 17/119 (14%)
 Frame = -2

Query  520  IVGCMRPLTLQ--------GKSPAISPSPTAP--DLQALVPQGGLESPAPSYVSSGGTMS  371
            +VG MRPL +Q        G +PA+  + ++P      ++P   + +PA  Y  S  + S
Sbjct  73   VVGSMRPLHMQSHQSPPHEGTAPALVHAVSSPGEHFVDVLPASPMSTPARPYSPSRSSTS  132

Query  370  R----YASASDLQEL---DACDNEDDPDEVFDAITGDEMIDTKAEEFINQFYQQMKLQT  215
                 YASA +LQ+L   ++ D+EDD D  +D   GD+ ID KAEEFI QFY+QM+ QT
Sbjct  133  GSTSRYASAVNLQDLVQGNSDDDEDDEDGAYDGNGGDDKIDAKAEEFIAQFYRQMRAQT  191



>ref|XP_007200475.1| hypothetical protein PRUPE_ppa011326mg [Prunus persica]
 gb|EMJ01674.1| hypothetical protein PRUPE_ppa011326mg [Prunus persica]
Length=215

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 37/58 (64%), Gaps = 5/58 (9%)
 Frame = -2

Query  391  SSGGTMSRYASASDLQELDACDNEDDPDEVFDAITGDEMIDTKAEEFINQFYQQMKLQ  218
            S  G  SRY SA +LQELD  D ++D   + +A      ID KAEEFI QFYQQM+LQ
Sbjct  142  SEDGMTSRYTSAVNLQELDRTDEDNDNAAIVNA-----NIDAKAEEFIAQFYQQMRLQ  194



>ref|XP_004495922.1| PREDICTED: uncharacterized protein LOC101509716 [Cicer arietinum]
Length=209

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 69/154 (45%), Gaps = 46/154 (30%)
 Frame = -2

Query  568  GADRKAK------KQGENSWKNIVGCMRPLTLQGKSPAISPSPTAPD--LQALVPQG---  422
            G  RK+K       + ++ W+ +VG MRP+ LQ    A SP     D  L+ +V +    
Sbjct  46   GRSRKSKPILPVDDESKSIWRKLVGSMRPMHLQSSDSA-SPPQILNDHKLKNVVTENANN  104

Query  421  ---------GLES-------PAPSYVSSGGTMSRYASASDLQELDACD----------NE  320
                     G +S       P  S  +S    SRYASA  L E+   D          NE
Sbjct  105  ISVDQYYEDGFDSASEFPNSPGSSRFASAAG-SRYASAVGLNEMVEEDEEIKEEEINVNE  163

Query  319  DDPDEVFDAITGDEMIDTKAEEFINQFYQQMKLQ  218
            D  D       GD MID KAEEFI QFYQ+M+LQ
Sbjct  164  DHGD-------GDHMIDAKAEEFIAQFYQEMRLQ  190



>ref|XP_009399324.1| PREDICTED: uncharacterized protein LOC103983776 [Musa acuminata 
subsp. malaccensis]
Length=172

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 37/62 (60%), Gaps = 14/62 (23%)
 Frame = -2

Query  376  MSRYASASDLQELDACDNEDDPDEVFDAITG---------DEMIDTKAEEFINQFYQQMK  224
            MSRYASA DLQ LD     DD DE  D  TG            IDTKAEEFI +FY+QM+
Sbjct  108  MSRYASAEDLQALD-----DDTDEGNDGSTGANDVDEGEASHAIDTKAEEFITRFYEQMR  162

Query  223  LQ  218
            LQ
Sbjct  163  LQ  164



>ref|XP_010103386.1| hypothetical protein L484_007455 [Morus notabilis]
 gb|EXB95705.1| hypothetical protein L484_007455 [Morus notabilis]
Length=232

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 65/144 (45%), Gaps = 41/144 (28%)
 Frame = -2

Query  529  WKNIVGCMRPLTLQGKSPAISPSPTAPDLQALVPQ--------------GGLESPA----  404
            W  +VG +RPL LQ        S   P   +++P+                L+ P     
Sbjct  72   WNRLVGSIRPLHLQNNGSPRQNSSHNPK-NSIIPEVQDQRNDDVISNITSILQQPMSPAA  130

Query  403  ---------------PSYVSSGGTM---SRYASASDLQELDA-CDNEDDPDEV---FDAI  290
                            SY S G      SRY SA +L++LD+ C+ E++  E    +D  
Sbjct  131  SSSYSSSASSGHDGMSSYASVGNLQDLESRYTSAVNLRDLDSSCEEEEEERECGYRYDEN  190

Query  289  TGDEMIDTKAEEFINQFYQQMKLQ  218
             GDEMID KAEEFI QFY+QM+LQ
Sbjct  191  GGDEMIDVKAEEFIAQFYEQMRLQ  214



>gb|KHN19228.1| hypothetical protein glysoja_041580 [Glycine soja]
Length=210

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 60/118 (51%), Gaps = 13/118 (11%)
 Frame = -2

Query  538  ENSWKNIVGCMRPLTLQG-KSPAISP----SPTAPDLQALVPQGGLESPAPSYVSSGGTM  374
            +++W   VG MRPL LQ  +SP  SP    S    D    V     +   P   S    +
Sbjct  76   KSTWGRFVGSMRPLHLQSTQSPRSSPDLPSSEYKKDCGGYVSDFVADEQEP--YSPSPPI  133

Query  373  SRYASASDLQELDACDNEDDPDE---VFDAIT---GDEMIDTKAEEFINQFYQQMKLQ  218
            S YASA  L EL   D E++  +   V D+     GD MID KAE+FI QFYQ+MKLQ
Sbjct  134  SCYASAVGLSELVQNDEENEYKQEVIVEDSHVDGDGDWMIDAKAEDFIAQFYQEMKLQ  191



>ref|XP_006577726.1| PREDICTED: uncharacterized protein LOC102662079, partial [Glycine 
max]
Length=214

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 60/118 (51%), Gaps = 13/118 (11%)
 Frame = -2

Query  538  ENSWKNIVGCMRPLTLQG-KSPAISP----SPTAPDLQALVPQGGLESPAPSYVSSGGTM  374
            +++W   VG MRPL LQ  +SP  SP    S    D    V     +   P   S    +
Sbjct  80   KSTWGRFVGSMRPLHLQSTQSPRSSPDLPSSEYKKDCGGYVSDFVADEQEP--YSPSPPI  137

Query  373  SRYASASDLQELDACDNEDDPDE---VFDAIT---GDEMIDTKAEEFINQFYQQMKLQ  218
            S YASA  L EL   D E++  +   V D+     GD MID KAE+FI QFYQ+MKLQ
Sbjct  138  SCYASAVGLSELVQNDEENEYKQEVIVEDSHVDGDGDWMIDAKAEDFIAQFYQEMKLQ  195



>ref|XP_010069872.1| PREDICTED: uncharacterized protein LOC104456718 [Eucalyptus grandis]
Length=184

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 56/119 (47%), Gaps = 25/119 (21%)
 Frame = -2

Query  520  IVGCMRPLTLQG----KSPAISPSPTAPDLQALVPQGGLESPAPSYVSSGGTM-------  374
            +VG MRPL L G    + P  S S T P         G E    S VS+   M       
Sbjct  61   VVGSMRPLHLHGHRSPQHPRASGSVTPPSTNE-----GYEDELLSPVSAPRKMTRSSSRS  115

Query  373  -------SRYASASDLQELDACDNEDDPDEVFDAITGDEMIDTKAEEFINQFYQQMKLQ  218
                   SR+ASA +L +LD    + D D   +   GDE ID KA++FI QFY+QM+ Q
Sbjct  116  SASEEGGSRFASAVNLADLDCGSEDSDHDRGIE--EGDETIDVKADQFIAQFYEQMRTQ  172



>ref|XP_007145169.1| hypothetical protein PHAVU_007G216300g [Phaseolus vulgaris]
 gb|ESW17163.1| hypothetical protein PHAVU_007G216300g [Phaseolus vulgaris]
Length=208

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 71/143 (50%), Gaps = 31/143 (22%)
 Frame = -2

Query  568  GADRKAKK----QGENSWKNIVGCMRPLTLQG-KSPAISPSPTAPDLQALVPQGGLESPA  404
            G  RK+K     + ++ W+ IVG MRPL LQG +SP    S + P  + +V      +P 
Sbjct  52   GRSRKSKMLVDDESKSVWRKIVGSMRPLHLQGDQSPRHHNSASIPQSKTIVTS----TPF  107

Query  403  PSYVSSG-------------GTMSRYASASDLQELDACDNEDDPDEVFDAIT--------  287
             + V  G              + SRYASA  L E+   + E++ D V    T        
Sbjct  108  ENDVDHGDDAFDSASEYSPSPSSSRYASAVGLNEM-VQEAENEEDGVKGRNTNGDNNDGE  166

Query  286  GDEMIDTKAEEFINQFYQQMKLQ  218
            GDEMID KAEEFI +FY QM+LQ
Sbjct  167  GDEMIDAKAEEFIAEFYHQMRLQ  189



>ref|NP_001042953.2| Os01g0341300 [Oryza sativa Japonica Group]
 dbj|BAD53210.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ11761.1| hypothetical protein OsJ_01629 [Oryza sativa Japonica Group]
 dbj|BAG92065.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04867.2| Os01g0341300 [Oryza sativa Japonica Group]
Length=249

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 52/111 (47%), Gaps = 24/111 (22%)
 Frame = -2

Query  532  SWKNIVGCMRPLTLQGKSPAISPSPTAPDLQALVPQGGLESPAPSYVSSGGTMSRYASAS  353
            SWKN+V  MRPL L G      P                  P+P         S Y+SA 
Sbjct  147  SWKNLVDGMRPLRLHGHLEYYPP------------------PSPDRSDGTSMTSSYSSAQ  188

Query  352  DLQELDACDNEDDPDEVFDAITGDEM------IDTKAEEFINQFYQQMKLQ  218
            DLQEL     ++D +E  +++  ++       ID +AEEFI +FY+Q +LQ
Sbjct  189  DLQELVNGHGKEDEEEEKNSLETEDGGCSPNPIDMQAEEFIAKFYEQFRLQ  239



>gb|KCW58381.1| hypothetical protein EUGRSUZ_H01069 [Eucalyptus grandis]
Length=181

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 56/119 (47%), Gaps = 25/119 (21%)
 Frame = -2

Query  520  IVGCMRPLTLQG----KSPAISPSPTAPDLQALVPQGGLESPAPSYVSSGGTM-------  374
            +VG MRPL L G    + P  S S T P         G E    S VS+   M       
Sbjct  61   VVGSMRPLHLHGHRSPQHPRASGSVTPPSTNE-----GYEDELLSPVSAPRKMTRSSSRS  115

Query  373  -------SRYASASDLQELDACDNEDDPDEVFDAITGDEMIDTKAEEFINQFYQQMKLQ  218
                   SR+ASA +L +LD    + D D   +   GDE ID KA++FI QFY+QM+ Q
Sbjct  116  SASEEGGSRFASAVNLADLDCGSEDSDHDRGIE--EGDETIDVKADQFIAQFYEQMRTQ  172



>ref|XP_010679343.1| PREDICTED: uncharacterized protein LOC104894735 [Beta vulgaris 
subsp. vulgaris]
Length=204

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 66/124 (53%), Gaps = 22/124 (18%)
 Frame = -2

Query  523  NIVGCMRPLTLQGKSPAISPSPTAPD--LQALVPQGGL----ESPA--PSYVSS------  386
            N+VG  RP  LQ     +SP    P   L++ V +  +     SPA  P Y +S      
Sbjct  78   NLVGAFRPFHLQMDVGGMSPPAPPPHNFLESHVAEVVVPPEETSPAYNPKYAASTCSSSS  137

Query  385  GGTMSRYASASDLQELDACDNE--------DDPDEVFDAITGDEMIDTKAEEFINQFYQQ  230
            GG MSRY SA  L +LD  D++        DD D  +D + GDEMID KA+ FI +FYQQ
Sbjct  138  GGGMSRYDSAQSLYDLDDHDDDDDHEEGMMDDGDAYYDGLEGDEMIDAKADMFIAKFYQQ  197

Query  229  MKLQ  218
            M+LQ
Sbjct  198  MRLQ  201



>ref|XP_010652228.1| PREDICTED: uncharacterized protein LOC104879792 [Vitis vinifera]
Length=166

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 62/110 (56%), Gaps = 10/110 (9%)
 Frame = -2

Query  535  NSWKNIVGCMRPLTLQGKS----PAISPSPTAPDLQALVPQGGLESPAPSYVSSGGTMSR  368
            N+ K +VG MRPL LQ  +    P I  S +  + Q + P     S A S  SS   MSR
Sbjct  53   NAMK-LVGSMRPLHLQESNSPPQPRIHVSISMDNFQDVYPPPISPSAASSSGSSIDGMSR  111

Query  367  YASASDLQELDACDNEDDPDEVFDAITGDEMIDTKAEEFINQFYQQMKLQ  218
            YASA +LQEL   D++D          GDEMID KA+EFI QFY QM+L+
Sbjct  112  YASAQNLQELGRSDDDDV-----WGDGGDEMIDIKAKEFIAQFYAQMRLE  156



>gb|ACU17664.1| unknown [Glycine max]
Length=174

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 59/126 (47%), Gaps = 15/126 (12%)
 Frame = -2

Query  568  GADRKAKK-----QGENSWKNIVGCMRPLTLQGKSPAISPSPTAPDLQALVP------QG  422
            G  RK+K      + ++ W+ +VG MRPL LQ      + +   P    ++       + 
Sbjct  50   GRSRKSKMLAVDDESKSIWRKLVGSMRPLHLQSNHDDDNNNNVNPHQSKMMKTTSAPSEN  109

Query  421  G---LESPAPSYVSSGGTMSRYASASDLQELDACDNEDDPDEVFDAITGDEMIDTKAEEF  251
            G    +S      SS    SRYASA  L E+   + E++     D   GDEMID KAEEF
Sbjct  110  GDDSFDSATEFGNSSSPASSRYASAVGLNEMVQEEEENEKINNNDG-EGDEMIDAKAEEF  168

Query  250  INQFYQ  233
            I QFY 
Sbjct  169  IAQFYH  174



>ref|XP_010921585.1| PREDICTED: uncharacterized protein LOC105045127 [Elaeis guineensis]
Length=184

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 61/117 (52%), Gaps = 17/117 (15%)
 Frame = -2

Query  529  WKNIVGCMRPLTL-QGKSPAISPSPTAPDLQALVPQGGLE---------SPAPSYVSSGG  380
            WK+++  MRPL   Q +   ++P    P+L   +P   L          +PA S + S G
Sbjct  68   WKSLLAGMRPLHHHQLEHQEVAP----PELVVALPALRLTKVDSLHEVFTPATSPMHSDG  123

Query  379  TMSRYASASDLQELDACDNEDDPDEVFDAITGDE--MIDTKAEEFINQFYQQMKLQT  215
             MS YASA DL  LD C++ D   +  D     E   ID KAEEFI +FY+Q +L++
Sbjct  124  -MSGYASAEDLHVLDTCEDGDAERDGGDDGDDGEPNEIDVKAEEFIARFYEQQRLES  179



>ref|XP_011042205.1| PREDICTED: uncharacterized protein LOC105137948 [Populus euphratica]
Length=195

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 61/130 (47%), Gaps = 26/130 (20%)
 Frame = -2

Query  529  WKNIVGCMRPLTLQGKSPAISPSP--------------TAPDLQALVPQGGLE------S  410
            WK  +  MRPL +      I  +P              T P     V +  LE      S
Sbjct  62   WKKYLSFMRPLHVHSNQQRIEATPAPVTSTAVHEESKVTPPAASVDVVEQYLEVFTPSYS  121

Query  409  PAPSYV--SSGGTMSRYASASDLQEL----DACDNEDDPDEVFDAITGDEMIDTKAEEFI  248
            PAP  +  SS G  S+YASA +L +L       D++ D D  +D   GDE ID KAE+FI
Sbjct  122  PAPKSIASSSSGQTSQYASAQNLLDLLIDMSDEDDDGDEDSYYDDKYGDETIDMKAEQFI  181

Query  247  NQFYQQMKLQ  218
             +FY QMKLQ
Sbjct  182  AKFYDQMKLQ  191



>ref|XP_006645857.1| PREDICTED: uncharacterized protein LOC102713150 [Oryza brachyantha]
Length=241

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 64/131 (49%), Gaps = 27/131 (21%)
 Frame = -2

Query  589  VSDQDEDGADRKAKKQGE-NSWKNIVGCMRPLTLQGKSPAISPSPTAPDLQALVPQGGLE  413
            V++ D++  D  A+   +  SWKN+V  MRPL L G+     P                 
Sbjct  121  VNNGDKEAMDIVARSSSDVTSWKNLVDGMRPLRLYGQLEYYPP-----------------  163

Query  412  SPAPSYVSSGGTMSRYASASDLQELDACDNEDDPDEVFDAITGDE------MIDTKAEEF  251
             P+P    + G  SRY+S  DL+EL    +E + +   D+ T ++       ID +AEEF
Sbjct  164  -PSPD--RTEGVTSRYSSTEDLRELGNYSHEKEEEVEEDSPTTEDGGYSSNAIDRQAEEF  220

Query  250  INQFYQQMKLQ  218
            I +FY+Q +LQ
Sbjct  221  IAKFYEQFRLQ  231



>gb|EEC70575.1| hypothetical protein OsI_01764 [Oryza sativa Indica Group]
Length=195

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 49/113 (43%), Gaps = 26/113 (23%)
 Frame = -2

Query  532  SWKNIVGCMRPLTLQGKSPAISPSPTAPDLQALVPQGGLESPAPSYVSSGGTMSRYASAS  353
            SWKN+V  MRPL L G      P                  P+P         S Y+SA 
Sbjct  91   SWKNLVDGMRPLRLHGHLEYYPP------------------PSPDRSEGMSMTSSYSSAQ  132

Query  352  DLQEL---DACDNEDDPDEVF-----DAITGDEMIDTKAEEFINQFYQQMKLQ  218
            DLQEL   +    ED+ +E       D       ID +AEEFI +FY+Q +LQ
Sbjct  133  DLQELVNVNGHGKEDEEEEKNSPEREDGGCSPNPIDMQAEEFIAKFYEQFRLQ  185



>tpg|DAA54517.1| TPA: hypothetical protein ZEAMMB73_753064 [Zea mays]
Length=262

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 56/117 (48%), Gaps = 16/117 (14%)
 Frame = -2

Query  532  SWKNIVGCMRPLTLQGKSPAISPSPTAPDLQALVPQGGLESPAPSYVSSG------GTMS  371
            SWK +V  MRPL L+G+     P P  P L        +  P PS    G      G  S
Sbjct  144  SWKRLVDGMRPLRLRGQLEYYPPPPPPPPLGHADVYHDVILPPPSQARFGFEIKEVGMTS  203

Query  370  RYASASDLQELDACDNE-----DDPDEVFDAITGDEMIDTKAEEFINQFYQQMKLQT  215
            RYASA DL ++D+   E     DD D      +    ID +AEEFI +FY+Q K ++
Sbjct  204  RYASAEDLHQMDSDQEEGAEGGDDGDS-----SCPHAIDMQAEEFITKFYEQFKSES  255



>ref|XP_002320317.1| hypothetical protein POPTR_0014s11860g [Populus trichocarpa]
 gb|EEE98632.1| hypothetical protein POPTR_0014s11860g [Populus trichocarpa]
Length=196

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 66/146 (45%), Gaps = 25/146 (17%)
 Frame = -2

Query  574  EDGADRKAKKQGENSWKNIVGCMRPLTLQG------------------------KSPAIS  467
            + G  + A     + WK ++  MRPL +                          +S   +
Sbjct  50   KSGKSKTAHTDAVSKWKKLLSSMRPLHINSNQSAQRSIGDRAPMAPLTSKEVVEQSKVYA  109

Query  466  PSPTAPDLQALVPQGGLESPAPSYVSSGGTMSR-YASASDLQELDACDNEDDPDEVFDAI  290
            PS  + D++         SPAP    S    +  YASA +LQELD   +EDD D  +D  
Sbjct  110  PSAASEDVEQFELFTPPWSPAPKSTGSSSGQTSQYASAQNLQELDDQSDEDDEDSYYDDK  169

Query  289  TGDEMIDTKAEEFINQFYQQMKLQTE  212
             GDE ID KAEEFI +FY QMKLQ +
Sbjct  170  FGDEKIDMKAEEFIAKFYGQMKLQHK  195



>ref|XP_002515316.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47300.1| conserved hypothetical protein [Ricinus communis]
Length=207

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 3/58 (5%)
 Frame = -2

Query  376  MSRYASASDLQELDACDNEDDPDE---VFDAITGDEMIDTKAEEFINQFYQQMKLQTE  212
            MS+YASA++LQ LD  D  D+ D+   +     GDEMID KAE+FI QFYQQM+LQ E
Sbjct  136  MSQYASATNLQLLDEGDESDEDDQEVDINGDKGGDEMIDLKAEKFIAQFYQQMRLQDE  193



>ref|XP_006855321.1| hypothetical protein AMTR_s00057p00082640 [Amborella trichopoda]
 gb|ERN16788.1| hypothetical protein AMTR_s00057p00082640 [Amborella trichopoda]
Length=184

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 62/129 (48%), Gaps = 32/129 (25%)
 Frame = -2

Query  529  WKNIVGCMRP------LTLQGKSPAISPSPT-------APDLQA-LVPQGGLESP-----  407
            WK+++  MRP        L+     I P P         P ++  L P   +++P     
Sbjct  46   WKSLISAMRPGHHNLQHNLEAPKTGIEPEPVPEKKLEPEPKVECELEPFHDVQAPPRACR  105

Query  406  APSYVSSGGTMSRYASASDLQEL------DACDNEDDPDEVFDAITGDEMIDTKAEEFIN  245
               Y S GG MS YASA +L EL          +E+  +E FD+I      D +AEEFI+
Sbjct  106  EKEYDSDGG-MSCYASAENLAELVKNGGEGKEGSEEIREESFDSI------DERAEEFIS  158

Query  244  QFYQQMKLQ  218
            QFY+QMKLQ
Sbjct  159  QFYEQMKLQ  167



>ref|XP_003625949.1| hypothetical protein MTR_7g109300 [Medicago truncatula]
 gb|AES82167.1| DUF761 domain protein [Medicago truncatula]
Length=264

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 3/55 (5%)
 Frame = -2

Query  373  SRYASASDLQELDACDNEDDPDEVFDAI---TGDEMIDTKAEEFINQFYQQMKLQ  218
            SRYASA  L +L   D E+D +++        GD+ ID KA+EFI QFYQQM+LQ
Sbjct  191  SRYASAIGLNKLVQSDEENDRNDLIIEECNENGDDKIDDKADEFIAQFYQQMRLQ  245



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2183448245968