BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19969_g1_i3 len=1010 path=[159:0-643 24:644-812 971:813-1009]

Length=1010
                                                                      Score     E

ref|XP_004242783.1|  PREDICTED: uncharacterized protein LOC101248987    155   3e-42   
ref|XP_007013463.1|  Uncharacterized protein isoform 1                  135   1e-34   
ref|XP_009625255.1|  PREDICTED: uncharacterized protein LOC104116...    134   5e-34   
ref|XP_009785325.1|  PREDICTED: uncharacterized protein LOC104233...    130   7e-33   
ref|XP_009399743.1|  PREDICTED: uncharacterized protein LOC103984060    129   2e-32   
ref|XP_011026448.1|  PREDICTED: uncharacterized protein LOC105127044    127   1e-31   
ref|XP_009800883.1|  PREDICTED: uncharacterized protein LOC104246...    126   2e-31   
ref|XP_011081564.1|  PREDICTED: uncharacterized protein LOC105164...    127   2e-31   
ref|XP_011081562.1|  PREDICTED: uncharacterized protein LOC105164...    127   3e-31   
ref|XP_002524505.1|  conserved hypothetical protein                     126   3e-31   Ricinus communis
ref|XP_006427271.1|  hypothetical protein CICLE_v10026612mg             125   5e-31   
ref|XP_006427270.1|  hypothetical protein CICLE_v10026612mg             125   6e-31   
ref|XP_003549760.1|  PREDICTED: uncharacterized protein LOC100812832    125   7e-31   
gb|KDP37090.1|  hypothetical protein JCGZ_06146                         125   7e-31   
ref|XP_006427269.1|  hypothetical protein CICLE_v10026612mg             125   8e-31   
ref|XP_009800882.1|  PREDICTED: uncharacterized protein LOC104246...    125   9e-31   
ref|XP_011039693.1|  PREDICTED: uncharacterized protein LOC105136...    124   1e-30   
ref|XP_004965939.1|  PREDICTED: uncharacterized protein LOC101759...    124   2e-30   
ref|XP_007215090.1|  hypothetical protein PRUPE_ppa012664mg             124   2e-30   
ref|XP_007215089.1|  hypothetical protein PRUPE_ppa012664mg             123   2e-30   
ref|XP_004965936.1|  PREDICTED: uncharacterized protein LOC101759...    124   3e-30   
ref|XP_011039692.1|  PREDICTED: uncharacterized protein LOC105136...    124   3e-30   
ref|XP_002517627.1|  conserved hypothetical protein                     123   6e-30   Ricinus communis
gb|EYU20266.1|  hypothetical protein MIMGU_mgv1a014871mg                122   7e-30   
ref|XP_006594270.1|  PREDICTED: uncharacterized protein LOC100813...    121   1e-29   
gb|EYU20265.1|  hypothetical protein MIMGU_mgv1a014871mg                122   1e-29   
gb|AFW87196.1|  hypothetical protein ZEAMMB73_642213                    122   2e-29   
gb|ACG43637.1|  hypothetical protein                                    121   2e-29   Zea mays [maize]
ref|XP_002285241.1|  PREDICTED: uncharacterized protein LOC100245...    121   2e-29   Vitis vinifera
ref|XP_010656431.1|  PREDICTED: uncharacterized protein LOC100245...    121   3e-29   
ref|NP_001235913.1|  uncharacterized protein LOC547651                  120   3e-29   
ref|XP_008351837.1|  PREDICTED: uncharacterized protein LOC103415...    120   3e-29   
ref|XP_006450918.1|  hypothetical protein CICLE_v10009673mg             121   3e-29   
ref|XP_004303311.1|  PREDICTED: uncharacterized protein LOC101299394    120   4e-29   
ref|XP_010656432.1|  PREDICTED: uncharacterized protein LOC100245...    120   4e-29   
gb|ACU19347.1|  unknown                                                 120   4e-29   Glycine max [soybeans]
ref|XP_010907273.1|  PREDICTED: uncharacterized protein LOC105033...    120   4e-29   
ref|XP_002308664.1|  hypothetical protein POPTR_0006s27010g             120   5e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010907276.1|  PREDICTED: uncharacterized protein LOC105033...    120   5e-29   
ref|XP_006594269.1|  PREDICTED: uncharacterized protein LOC100813...    120   5e-29   
ref|XP_007155010.1|  hypothetical protein PHAVU_003G165400g             120   5e-29   
emb|CDP13514.1|  unnamed protein product                                119   6e-29   
ref|XP_004508489.1|  PREDICTED: uncharacterized protein LOC101507961    120   7e-29   
dbj|BAK06638.1|  predicted protein                                      120   8e-29   
gb|KHG19504.1|  Interleukin-4 receptor subunit alpha                    120   1e-28   
ref|XP_008243737.1|  PREDICTED: uncharacterized protein LOC103341...    119   1e-28   
gb|KDP33595.1|  hypothetical protein JCGZ_07166                         119   1e-28   
ref|XP_009376924.1|  PREDICTED: uncharacterized protein LOC103965574    119   1e-28   
ref|XP_008243739.1|  PREDICTED: uncharacterized protein LOC103341...    119   1e-28   
gb|KHN15085.1|  hypothetical protein glysoja_011703                     119   1e-28   
ref|XP_008805619.1|  PREDICTED: uncharacterized protein LOC103718...    119   1e-28   
ref|XP_008805621.1|  PREDICTED: uncharacterized protein LOC103718...    119   1e-28   
ref|XP_008378372.1|  PREDICTED: uncharacterized protein LOC103441...    119   2e-28   
ref|XP_009624285.1|  PREDICTED: uncharacterized protein LOC104115...    119   2e-28   
ref|XP_007135747.1|  hypothetical protein PHAVU_010G155200g             118   2e-28   
ref|XP_002515517.1|  conserved hypothetical protein                     119   2e-28   Ricinus communis
ref|XP_006584501.1|  PREDICTED: uncharacterized protein LOC100499...    118   2e-28   
ref|XP_003604392.1|  hypothetical protein MTR_4g010330                  117   3e-28   
ref|XP_009409322.1|  PREDICTED: uncharacterized protein LOC103991554    118   3e-28   
ref|XP_006371740.1|  hypothetical protein POPTR_0018s01700g             117   3e-28   
ref|XP_007135748.1|  hypothetical protein PHAVU_010G155200g             118   5e-28   
gb|KDP32416.1|  hypothetical protein JCGZ_13341                         117   5e-28   
ref|XP_004291458.1|  PREDICTED: uncharacterized protein LOC101311349    117   5e-28   
gb|EYU23012.1|  hypothetical protein MIMGU_mgv1a015050mg                117   6e-28   
gb|AFK45269.1|  unknown                                                 117   7e-28   
ref|XP_008461114.1|  PREDICTED: uncharacterized protein LOC103499...    117   7e-28   
ref|XP_009624284.1|  PREDICTED: uncharacterized protein LOC104115...    118   7e-28   
ref|XP_002299754.1|  hypothetical protein POPTR_0001s19330g             116   1e-27   Populus trichocarpa [western balsam poplar]
gb|EPS58050.1|  hypothetical protein M569_16767                         117   1e-27   
ref|XP_006427272.1|  hypothetical protein CICLE_v10026612mg             117   1e-27   
ref|XP_006427273.1|  hypothetical protein CICLE_v10026612mg             117   1e-27   
ref|XP_008792026.1|  PREDICTED: uncharacterized protein LOC103708...    117   1e-27   
ref|XP_008394089.1|  PREDICTED: uncharacterized protein LOC103456...    116   1e-27   
ref|XP_008461113.1|  PREDICTED: uncharacterized protein LOC103499...    116   1e-27   
ref|XP_004506943.1|  PREDICTED: uncharacterized protein LOC101492...    115   1e-27   
ref|XP_009355740.1|  PREDICTED: uncharacterized protein LOC103946...    116   1e-27   
ref|XP_006450922.1|  hypothetical protein CICLE_v10009673mg             116   1e-27   
gb|KDO48569.1|  hypothetical protein CISIN_1g030349mg                   116   1e-27   
ref|XP_010696285.1|  PREDICTED: uncharacterized protein LOC104908...    116   1e-27   
ref|XP_010696294.1|  PREDICTED: uncharacterized protein LOC104908...    116   1e-27   
ref|XP_009355741.1|  PREDICTED: uncharacterized protein LOC103946...    116   1e-27   
ref|XP_008394088.1|  PREDICTED: uncharacterized protein LOC103456...    116   1e-27   
ref|XP_004150590.1|  PREDICTED: uncharacterized protein LOC101203426    116   1e-27   
ref|XP_010033962.1|  PREDICTED: uncharacterized protein LOC104423...    115   1e-27   
ref|XP_010696279.1|  PREDICTED: uncharacterized protein LOC104908...    116   2e-27   
ref|XP_006371742.1|  hypothetical protein POPTR_0018s01700g             116   2e-27   
ref|XP_008461112.1|  PREDICTED: uncharacterized protein LOC103499...    116   2e-27   
ref|XP_006371741.1|  hypothetical protein POPTR_0018s01700g             116   2e-27   
ref|XP_010033961.1|  PREDICTED: uncharacterized protein LOC104423...    115   2e-27   
ref|XP_009355739.1|  PREDICTED: uncharacterized protein LOC103946...    115   2e-27   
ref|XP_008792027.1|  PREDICTED: uncharacterized protein LOC103708...    116   2e-27   
ref|XP_010696274.1|  PREDICTED: uncharacterized protein LOC104908...    116   2e-27   
gb|AFK46980.1|  unknown                                                 115   2e-27   
gb|ABD96083.1|  hypothetical protein                                    115   2e-27   Nicotiana tabacum [American tobacco]
ref|XP_006450921.1|  hypothetical protein CICLE_v10009673mg             116   2e-27   
ref|XP_008394087.1|  PREDICTED: uncharacterized protein LOC103456...    115   3e-27   
ref|XP_007023178.1|  Uncharacterized protein TCM_027160                 115   3e-27   
ref|XP_008219495.1|  PREDICTED: uncharacterized protein LOC103319...    115   3e-27   
ref|NP_001241024.1|  uncharacterized protein LOC100806290 precursor     115   3e-27   
ref|XP_008443992.1|  PREDICTED: uncharacterized protein LOC103487445    115   3e-27   
ref|XP_004506941.1|  PREDICTED: uncharacterized protein LOC101492...    115   4e-27   
ref|XP_010696265.1|  PREDICTED: uncharacterized protein LOC104908...    115   4e-27   
ref|XP_009355738.1|  PREDICTED: uncharacterized protein LOC103946...    115   4e-27   
ref|XP_003609342.1|  hypothetical protein MTR_4g114620                  115   5e-27   
ref|XP_009758058.1|  PREDICTED: uncharacterized protein LOC104210...    115   5e-27   
ref|XP_009617111.1|  PREDICTED: uncharacterized protein LOC104109...    114   5e-27   
ref|XP_008394086.1|  PREDICTED: uncharacterized protein LOC103456...    115   6e-27   
ref|XP_010696258.1|  PREDICTED: uncharacterized protein LOC104908...    115   6e-27   
ref|XP_011020132.1|  PREDICTED: uncharacterized protein LOC105122...    114   7e-27   
ref|XP_008219494.1|  PREDICTED: uncharacterized protein LOC103319...    114   7e-27   
ref|XP_009355737.1|  PREDICTED: uncharacterized protein LOC103946...    115   8e-27   
ref|XP_011020131.1|  PREDICTED: uncharacterized protein LOC105122...    114   8e-27   
ref|XP_009617110.1|  PREDICTED: uncharacterized protein LOC104109...    114   9e-27   
ref|XP_007223580.1|  hypothetical protein PRUPE_ppa012337mg             114   1e-26   
ref|XP_008394085.1|  PREDICTED: uncharacterized protein LOC103456...    115   1e-26   
ref|XP_003604391.1|  hypothetical protein MTR_4g010330                  116   1e-26   
ref|XP_009758057.1|  PREDICTED: uncharacterized protein LOC104210...    114   1e-26   
ref|XP_006353690.1|  PREDICTED: uncharacterized protein LOC102587...    113   1e-26   
ref|XP_007223581.1|  hypothetical protein PRUPE_ppa012337mg             113   2e-26   
ref|XP_003563658.1|  PREDICTED: uncharacterized protein LOC100839071    113   2e-26   
gb|KGN45276.1|  hypothetical protein Csa_7G432580                       113   2e-26   
ref|XP_004135858.1|  PREDICTED: uncharacterized protein LOC101208...    113   2e-26   
ref|NP_197918.1|  uncharacterized protein                               113   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002308983.2|  hypothetical protein POPTR_0006s06780g             113   3e-26   Populus trichocarpa [western balsam poplar]
ref|XP_002285114.1|  PREDICTED: uncharacterized protein LOC100254...    113   3e-26   Vitis vinifera
ref|XP_010526211.1|  PREDICTED: uncharacterized protein LOC104803...    113   3e-26   
gb|ACF22739.1|  hypothetical protein-2                                  113   3e-26   Brachypodium distachyon [annual false brome]
ref|XP_010526213.1|  PREDICTED: uncharacterized protein LOC104803...    112   3e-26   
ref|XP_006580938.1|  PREDICTED: uncharacterized protein LOC100499...    112   3e-26   
ref|XP_010648668.1|  PREDICTED: uncharacterized protein LOC100254...    113   4e-26   
ref|XP_004135856.1|  PREDICTED: uncharacterized protein LOC101208...    112   4e-26   
dbj|BAJ89273.1|  predicted protein                                      114   4e-26   
ref|XP_009803411.1|  PREDICTED: uncharacterized protein LOC104248785    112   4e-26   
ref|XP_009376910.1|  PREDICTED: uncharacterized protein LOC103965...    112   5e-26   
ref|XP_008364554.1|  PREDICTED: uncharacterized protein LOC103428...    112   5e-26   
ref|XP_009376909.1|  PREDICTED: uncharacterized protein LOC103965...    112   5e-26   
ref|XP_009614728.1|  PREDICTED: uncharacterized protein LOC104107...    112   5e-26   
ref|XP_006353689.1|  PREDICTED: uncharacterized protein LOC102587...    112   5e-26   
gb|EAY84907.1|  hypothetical protein OsI_06275                          114   6e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_010648664.1|  PREDICTED: uncharacterized protein LOC100254...    113   6e-26   
ref|XP_004245026.1|  PREDICTED: uncharacterized protein LOC101258...    112   7e-26   
ref|XP_006364933.1|  PREDICTED: uncharacterized protein LOC102578...    112   7e-26   
ref|XP_007150749.1|  hypothetical protein PHAVU_005G177600g             112   9e-26   
ref|XP_007011866.1|  Uncharacterized protein TCM_037003                 111   1e-25   
ref|NP_001237589.1|  uncharacterized protein LOC100499896 precursor     110   1e-25   
ref|XP_010541602.1|  PREDICTED: uncharacterized protein LOC104815019    111   1e-25   
ref|XP_010250118.1|  PREDICTED: uncharacterized protein LOC104592...    110   1e-25   
ref|XP_006364934.1|  PREDICTED: uncharacterized protein LOC102578...    110   1e-25   
ref|XP_010324985.1|  PREDICTED: uncharacterized protein LOC101258...    111   1e-25   
ref|XP_009614727.1|  PREDICTED: uncharacterized protein LOC104107...    112   1e-25   
ref|XP_006394786.1|  hypothetical protein EUTSA_v10005028mg             110   2e-25   
gb|AAC32109.1|  hypothetical protein                                    110   2e-25   Picea mariana [black spruce]
ref|XP_008243735.1|  PREDICTED: uncharacterized protein LOC103341...    110   2e-25   
ref|XP_008243736.1|  PREDICTED: uncharacterized protein LOC103341...    110   2e-25   
ref|XP_006842068.1|  hypothetical protein AMTR_s00078p00048610          110   2e-25   
ref|XP_009625257.1|  PREDICTED: uncharacterized protein LOC104116...    108   2e-25   
ref|XP_010250116.1|  PREDICTED: uncharacterized protein LOC104592...    110   3e-25   
ref|NP_001237738.1|  uncharacterized protein LOC100500161               109   3e-25   
ref|XP_010097234.1|  hypothetical protein L484_025783                   113   3e-25   
ref|XP_004506942.1|  PREDICTED: uncharacterized protein LOC101492...    109   3e-25   
ref|NP_001235781.1|  uncharacterized protein LOC100499770               110   3e-25   
ref|XP_006450436.1|  hypothetical protein CICLE_v10009702mg             110   3e-25   
ref|XP_002874253.1|  hypothetical protein ARALYDRAFT_489387             110   4e-25   
ref|XP_006483362.1|  PREDICTED: uncharacterized protein LOC102620...    110   4e-25   
ref|XP_010687981.1|  PREDICTED: uncharacterized protein LOC104902...    110   4e-25   
ref|XP_006483361.1|  PREDICTED: uncharacterized protein LOC102620...    110   4e-25   
ref|XP_010250114.1|  PREDICTED: uncharacterized protein LOC104592...    110   4e-25   
ref|XP_010687980.1|  PREDICTED: uncharacterized protein LOC104902...    109   5e-25   
ref|XP_010687978.1|  PREDICTED: uncharacterized protein LOC104902...    110   5e-25   
ref|XP_010254416.1|  PREDICTED: uncharacterized protein LOC104595...    109   5e-25   
ref|XP_002324297.1|  hypothetical protein POPTR_0018s01700g             109   7e-25   Populus trichocarpa [western balsam poplar]
ref|XP_007137021.1|  hypothetical protein PHAVU_009G093300g             108   7e-25   
ref|XP_004506940.1|  PREDICTED: uncharacterized protein LOC101492...    108   8e-25   
ref|XP_009365419.1|  PREDICTED: uncharacterized protein LOC103955...    108   8e-25   
ref|XP_009365417.1|  PREDICTED: uncharacterized protein LOC103955...    108   9e-25   
ref|XP_007137023.1|  hypothetical protein PHAVU_009G093300g             107   9e-25   
ref|XP_006483360.1|  PREDICTED: uncharacterized protein LOC102620...    109   1e-24   
gb|KHN22446.1|  hypothetical protein glysoja_024955                     109   1e-24   
ref|XP_010254415.1|  PREDICTED: uncharacterized protein LOC104595...    108   1e-24   
ref|XP_011012182.1|  PREDICTED: uncharacterized protein LOC105116...    107   2e-24   
ref|XP_011012181.1|  PREDICTED: uncharacterized protein LOC105116...    107   2e-24   
ref|XP_010254414.1|  PREDICTED: uncharacterized protein LOC104595...    108   2e-24   
ref|XP_010063461.1|  PREDICTED: uncharacterized protein LOC104450...    107   2e-24   
ref|XP_003604393.1|  hypothetical protein MTR_4g010330                  110   2e-24   
ref|XP_010539506.1|  PREDICTED: uncharacterized protein LOC104813...    107   2e-24   
ref|XP_006601152.1|  PREDICTED: uncharacterized protein LOC100818...    106   2e-24   
ref|XP_010532171.1|  PREDICTED: uncharacterized protein LOC104808...    107   3e-24   
gb|ABK26133.1|  unknown                                                 107   3e-24   Picea sitchensis
ref|XP_008364553.1|  PREDICTED: uncharacterized protein LOC103428...    110   4e-24   
ref|XP_011017767.1|  PREDICTED: uncharacterized protein LOC105121...    107   4e-24   
ref|XP_009785326.1|  PREDICTED: uncharacterized protein LOC104233...    105   4e-24   
ref|XP_011017766.1|  PREDICTED: uncharacterized protein LOC105121...    107   6e-24   
ref|XP_003571413.1|  PREDICTED: uncharacterized protein LOC100833...    106   9e-24   
ref|XP_003550180.1|  PREDICTED: uncharacterized protein LOC100818...    106   9e-24   
ref|XP_004287308.1|  PREDICTED: uncharacterized protein LOC101293626    105   1e-23   
ref|XP_002325222.1|  hypothetical protein POPTR_0018s13080g             105   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010648667.1|  PREDICTED: uncharacterized protein LOC100254...    105   2e-23   
ref|XP_010648665.1|  PREDICTED: uncharacterized protein LOC100254...    105   2e-23   
ref|XP_006595165.1|  PREDICTED: uncharacterized protein LOC100802...    104   2e-23   
ref|XP_010476619.1|  PREDICTED: uncharacterized protein LOC104755...    104   3e-23   
ref|XP_010497045.1|  PREDICTED: uncharacterized protein LOC104774...    104   3e-23   
ref|XP_010322715.1|  PREDICTED: uncharacterized protein LOC101261...    104   3e-23   
ref|XP_010539505.1|  PREDICTED: uncharacterized protein LOC104813...    104   3e-23   
ref|XP_006596105.1|  PREDICTED: uncharacterized protein LOC100793281    104   3e-23   
ref|XP_010648663.1|  PREDICTED: uncharacterized protein LOC100254...    105   3e-23   
gb|KHN44177.1|  hypothetical protein glysoja_031838                     104   4e-23   
ref|XP_006601151.1|  PREDICTED: uncharacterized protein LOC100818...    105   4e-23   
ref|XP_003542117.1|  PREDICTED: uncharacterized protein LOC100802...    104   5e-23   
ref|XP_004241775.1|  PREDICTED: uncharacterized protein LOC101261...    104   5e-23   
gb|KEH32117.1|  DUF4050 family protein                                  104   7e-23   
ref|XP_004241696.1|  PREDICTED: uncharacterized protein LOC101263...    102   1e-22   
ref|XP_010459057.1|  PREDICTED: uncharacterized protein LOC104740...    102   1e-22   
ref|XP_010322666.1|  PREDICTED: uncharacterized protein LOC101263...    102   1e-22   
ref|XP_006356214.1|  PREDICTED: uncharacterized protein LOC102596...    102   2e-22   
ref|XP_006356212.1|  PREDICTED: uncharacterized protein LOC102596...    101   3e-22   
ref|XP_009148922.1|  PREDICTED: uncharacterized protein LOC103872...    101   3e-22   
ref|XP_009364027.1|  PREDICTED: uncharacterized protein LOC103953940    102   3e-22   
ref|XP_010691147.1|  PREDICTED: uncharacterized protein LOC104904...    100   4e-22   
ref|XP_002453499.1|  hypothetical protein SORBIDRAFT_04g006900          101   5e-22   Sorghum bicolor [broomcorn]
ref|XP_008681282.1|  PREDICTED: hypothetical protein isoform X2         101   5e-22   
ref|XP_004501332.1|  PREDICTED: uncharacterized protein LOC101496...    101   5e-22   
ref|NP_001142741.1|  hypothetical protein                               101   5e-22   Zea mays [maize]
ref|XP_006306126.1|  hypothetical protein CARUB_v10011587mg             103   5e-22   
ref|XP_008681284.1|  PREDICTED: hypothetical protein isoform X3         100   6e-22   
ref|XP_004501333.1|  PREDICTED: uncharacterized protein LOC101496...    100   8e-22   
ref|XP_011081379.1|  PREDICTED: uncharacterized protein LOC105164...    100   8e-22   
emb|CDX80504.1|  BnaC07g29400D                                          100   8e-22   
ref|XP_006416916.1|  hypothetical protein EUTSA_v10009002mg             100   8e-22   
gb|KHG26267.1|  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase       100   9e-22   
ref|XP_010691145.1|  PREDICTED: uncharacterized protein LOC104904...    100   9e-22   
ref|XP_010101263.1|  hypothetical protein L484_011627                   100   9e-22   
ref|XP_010687979.1|  PREDICTED: uncharacterized protein LOC104902...    100   1e-21   
ref|XP_009151062.1|  PREDICTED: uncharacterized protein LOC103874397  99.8    2e-21   
ref|XP_006647041.1|  PREDICTED: uncharacterized protein LOC102708...  97.8    2e-21   
ref|XP_010503415.1|  PREDICTED: uncharacterized protein LOC104780...  99.4    2e-21   
ref|XP_010503422.1|  PREDICTED: uncharacterized protein LOC104780...  99.4    2e-21   
ref|XP_004498738.1|  PREDICTED: uncharacterized protein LOC101513...  98.6    2e-21   
ref|XP_010487414.1|  PREDICTED: uncharacterized protein LOC104765...  99.0    2e-21   
ref|XP_006582954.1|  PREDICTED: uncharacterized protein LOC547651...  97.4    2e-21   
ref|NP_001046223.2|  Os02g0201000                                     97.4    2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010487415.1|  PREDICTED: uncharacterized protein LOC104765...  99.0    2e-21   
ref|XP_004498737.1|  PREDICTED: uncharacterized protein LOC101513...  98.6    3e-21   
ref|XP_004498736.1|  PREDICTED: uncharacterized protein LOC101513...  98.6    3e-21   
ref|XP_010421387.1|  PREDICTED: uncharacterized protein LOC104706...  98.6    3e-21   
ref|XP_004498735.1|  PREDICTED: uncharacterized protein LOC101513...  98.6    3e-21   
ref|XP_010465567.1|  PREDICTED: uncharacterized protein LOC104745...  98.6    4e-21   
ref|XP_010465565.1|  PREDICTED: uncharacterized protein LOC104745...  98.6    4e-21   
ref|XP_010454863.1|  PREDICTED: uncharacterized protein LOC104736...  98.6    4e-21   
ref|XP_010421388.1|  PREDICTED: uncharacterized protein LOC104706...  98.6    4e-21   
ref|XP_010691143.1|  PREDICTED: uncharacterized protein LOC104904...  99.4    4e-21   
ref|XP_007202651.1|  hypothetical protein PRUPE_ppa012244mg           98.6    5e-21   
ref|XP_010493791.1|  PREDICTED: uncharacterized protein LOC104771015  98.2    5e-21   
ref|XP_010454862.1|  PREDICTED: uncharacterized protein LOC104736...  98.2    6e-21   
ref|XP_006584502.1|  PREDICTED: uncharacterized protein LOC100499...  95.5    1e-20   
emb|CDY05352.1|  BnaC02g40600D                                        99.0    1e-20   
ref|XP_002882961.1|  hypothetical protein ARALYDRAFT_479030           97.1    1e-20   
gb|AFW87197.1|  hypothetical protein ZEAMMB73_642213                  95.5    1e-20   
ref|XP_008445215.1|  PREDICTED: uncharacterized protein LOC103488...  96.3    1e-20   
ref|XP_010691146.1|  PREDICTED: uncharacterized protein LOC104904...  97.1    1e-20   
gb|KHN33914.1|  hypothetical protein glysoja_031776                   98.2    2e-20   
gb|ACJ86181.1|  unknown                                               95.1    2e-20   Medicago truncatula
dbj|BAC41876.1|  unknown protein                                      95.9    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010691142.1|  PREDICTED: uncharacterized protein LOC104904...  97.4    2e-20   
ref|NP_001144383.1|  uncharacterized protein LOC100277310             94.7    2e-20   Zea mays [maize]
ref|NP_188198.3|  uncharacterized protein                             95.9    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001030705.1|  uncharacterized protein                          95.9    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004951537.1|  PREDICTED: uncharacterized protein LOC101766...  95.5    5e-20   
ref|XP_002266208.2|  PREDICTED: uncharacterized protein LOC100250...  95.1    5e-20   Vitis vinifera
ref|XP_008445211.1|  PREDICTED: uncharacterized protein LOC103488...  95.9    6e-20   
ref|XP_007013464.1|  Uncharacterized protein isoform 2                94.0    8e-20   
ref|XP_010654784.1|  PREDICTED: uncharacterized protein LOC100250...  94.7    1e-19   
ref|XP_006364935.1|  PREDICTED: uncharacterized protein LOC102578...  92.8    1e-19   
ref|XP_009117837.1|  PREDICTED: uncharacterized protein LOC103842...  93.6    1e-19   
ref|XP_004965938.1|  PREDICTED: uncharacterized protein LOC101759...  94.4    1e-19   
ref|XP_006286581.1|  hypothetical protein CARUB_v10002127mg           94.0    2e-19   
gb|KHN07079.1|  hypothetical protein glysoja_023262                   94.4    2e-19   
emb|CDP10418.1|  unnamed protein product                              91.3    2e-19   
ref|XP_003571414.1|  PREDICTED: uncharacterized protein LOC100833...  91.7    2e-19   
ref|NP_563972.1|  uncharacterized protein                             93.2    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008351825.1|  PREDICTED: uncharacterized protein LOC103415...  93.2    3e-19   
ref|XP_004965937.1|  PREDICTED: uncharacterized protein LOC101759...  93.6    3e-19   
ref|XP_008351813.1|  PREDICTED: uncharacterized protein LOC103415...  93.2    3e-19   
emb|CDY55978.1|  BnaA09g56760D                                        94.4    3e-19   
ref|XP_004965935.1|  PREDICTED: uncharacterized protein LOC101759...  94.0    3e-19   
emb|CBI36317.3|  unnamed protein product                              94.0    4e-19   
ref|XP_008465549.1|  PREDICTED: uncharacterized protein LOC103503177  92.4    5e-19   
ref|XP_004138726.1|  PREDICTED: uncharacterized protein LOC101216869  93.2    5e-19   
ref|XP_008337287.1|  PREDICTED: uncharacterized protein LOC103400417  92.4    7e-19   
ref|XP_004139307.1|  PREDICTED: uncharacterized protein LOC101220352  91.7    9e-19   
ref|XP_009368856.1|  PREDICTED: uncharacterized protein LOC103958328  92.0    9e-19   
ref|XP_006412484.1|  hypothetical protein EUTSA_v10027435mg           91.7    1e-18   
gb|KHN47146.1|  hypothetical protein glysoja_022447                   90.5    2e-18   
emb|CBI21042.3|  unnamed protein product                              89.4    2e-18   
gb|AFK41541.1|  unknown                                               89.0    2e-18   
ref|XP_008378374.1|  PREDICTED: uncharacterized protein LOC103441...  89.0    2e-18   
gb|EYU24644.1|  hypothetical protein MIMGU_mgv1a014863mg              90.5    3e-18   
gb|KHG30166.1|  hypothetical protein F383_13168                       90.1    3e-18   
gb|AFK43297.1|  unknown                                               88.2    4e-18   
ref|XP_010063462.1|  PREDICTED: uncharacterized protein LOC104450...  88.2    5e-18   
ref|NP_001119095.1|  uncharacterized protein                          89.4    6e-18   
ref|XP_007161213.1|  hypothetical protein PHAVU_001G051400g           90.9    6e-18   
ref|XP_006577847.1|  PREDICTED: uncharacterized protein LOC100806...  89.4    7e-18   
ref|XP_010322716.1|  PREDICTED: uncharacterized protein LOC101261...  87.4    9e-18   
emb|CDX83985.1|  BnaC08g16600D                                        89.4    2e-17   
ref|XP_009110490.1|  PREDICTED: uncharacterized protein LOC103836...  87.8    2e-17   
ref|XP_004968360.1|  PREDICTED: uncharacterized protein LOC101770...  88.6    2e-17   
ref|XP_010050015.1|  PREDICTED: uncharacterized protein LOC104438543  87.8    2e-17   
ref|XP_010535138.1|  PREDICTED: uncharacterized protein LOC104810505  87.0    3e-17   
ref|XP_009110489.1|  PREDICTED: uncharacterized protein LOC103836...  88.6    3e-17   
gb|KCW53825.1|  hypothetical protein EUGRSUZ_J03063                   86.7    4e-17   
ref|XP_003603401.1|  hypothetical protein MTR_3g107310                86.3    5e-17   
ref|XP_010654785.1|  PREDICTED: uncharacterized protein LOC100250...  87.0    5e-17   
ref|XP_010432734.1|  PREDICTED: uncharacterized protein LOC104716946  86.7    5e-17   
emb|CDX96846.1|  BnaA08g23890D                                        87.4    5e-17   
ref|XP_006353714.1|  PREDICTED: uncharacterized protein LOC102596246  85.5    6e-17   
ref|XP_010532172.1|  PREDICTED: uncharacterized protein LOC104808...  84.7    8e-17   
ref|XP_010654783.1|  PREDICTED: uncharacterized protein LOC100250...  86.7    8e-17   
ref|NP_001144305.1|  hypothetical protein                             86.7    1e-16   
emb|CDP10417.1|  unnamed protein product                              85.5    1e-16   
gb|AFK47322.1|  unknown                                               85.9    1e-16   
ref|XP_003603400.1|  hypothetical protein MTR_3g107310                85.9    1e-16   
ref|XP_010539507.1|  PREDICTED: uncharacterized protein LOC104813...  84.3    1e-16   
ref|XP_010519947.1|  PREDICTED: uncharacterized protein LOC104799...  85.1    2e-16   
ref|XP_004135857.1|  PREDICTED: uncharacterized protein LOC101208...  85.1    2e-16   
dbj|BAB02308.1|  unnamed protein product                              83.6    2e-16   
ref|XP_011081383.1|  PREDICTED: uncharacterized protein LOC105164...  83.6    2e-16   
gb|KHG12853.1|  Elongation factor Tu, plastid                         85.1    3e-16   
ref|XP_008454234.1|  PREDICTED: uncharacterized protein LOC103494...  83.2    3e-16   
ref|XP_006595166.1|  PREDICTED: uncharacterized protein LOC100802...  83.2    3e-16   
ref|XP_002455104.1|  hypothetical protein SORBIDRAFT_03g004410        85.1    3e-16   
ref|XP_004152201.1|  PREDICTED: uncharacterized protein LOC101214...  82.8    3e-16   
ref|XP_004171190.1|  PREDICTED: uncharacterized LOC101214679 isof...  82.8    4e-16   
ref|XP_003588763.1|  hypothetical protein MTR_1g012480                83.6    4e-16   
ref|XP_010476620.1|  PREDICTED: uncharacterized protein LOC104755...  82.4    5e-16   
ref|XP_010437919.1|  PREDICTED: uncharacterized protein LOC104721597  84.7    5e-16   
ref|XP_009148923.1|  PREDICTED: uncharacterized protein LOC103872...  82.4    6e-16   
ref|NP_001136666.1|  hypothetical protein                             82.0    8e-16   
gb|EMS45561.1|  hypothetical protein TRIUR3_15007                     81.6    8e-16   
ref|XP_006285786.1|  hypothetical protein CARUB_v10007273mg           83.2    8e-16   
gb|KCW70696.1|  hypothetical protein EUGRSUZ_F03865                   81.6    9e-16   
gb|KFK38932.1|  hypothetical protein AALP_AA3G178900                  82.8    1e-15   
ref|XP_010322670.1|  PREDICTED: uncharacterized protein LOC101263...  81.3    1e-15   
gb|AFW66150.1|  hypothetical protein ZEAMMB73_306186                  81.3    1e-15   
ref|XP_010497047.1|  PREDICTED: uncharacterized protein LOC104774...  81.3    1e-15   
gb|EMT30435.1|  hypothetical protein F775_31184                       80.9    2e-15   
gb|KFK38931.1|  hypothetical protein AALP_AA3G178900                  82.8    2e-15   
gb|KHN08131.1|  Phospholipase D alpha 1                               81.6    3e-15   
ref|XP_010459060.1|  PREDICTED: uncharacterized protein LOC104740...  80.5    3e-15   
emb|CDX81708.1|  BnaC08g38930D                                        80.5    3e-15   
gb|KEH39830.1|  DUF4050 family protein                                82.4    4e-15   
gb|AES73653.2|  DUF4050 family protein                                80.5    5e-15   
ref|XP_003603402.1|  hypothetical protein MTR_3g107310                80.1    6e-15   
emb|CDY36549.1|  BnaA06g10020D                                        79.0    8e-15   
emb|CDY39636.1|  BnaC05g11650D                                        79.0    9e-15   
gb|EMT22859.1|  hypothetical protein F775_29399                       81.3    1e-14   
ref|XP_010230521.1|  PREDICTED: uncharacterized protein LOC100834614  80.5    1e-14   
ref|XP_004951538.1|  PREDICTED: uncharacterized protein LOC101766...  77.4    4e-14   
ref|XP_009117838.1|  PREDICTED: uncharacterized protein LOC103842...  77.4    4e-14   
ref|XP_006416918.1|  hypothetical protein EUTSA_v10009002mg           77.0    4e-14   
ref|XP_002892862.1|  hypothetical protein ARALYDRAFT_471732           77.0    4e-14   
ref|XP_010318761.1|  PREDICTED: uncharacterized protein LOC101253...  77.4    5e-14   
gb|EEC70023.1|  hypothetical protein OsI_00587                        78.6    6e-14   
ref|NP_001042152.1|  Os01g0172300                                     78.6    6e-14   
gb|EPS64991.1|  hypothetical protein M569_09789                       75.9    6e-14   
emb|CDY39883.1|  BnaC03g67340D                                        76.3    9e-14   
ref|XP_010940521.1|  PREDICTED: uncharacterized protein LOC105059...  76.3    9e-14   
ref|XP_011024371.1|  PREDICTED: uncharacterized protein LOC105125555  76.3    1e-13   
ref|XP_004152200.1|  PREDICTED: uncharacterized protein LOC101214...  75.9    2e-13   
ref|XP_010243248.1|  PREDICTED: uncharacterized protein LOC104587...  75.9    2e-13   
ref|XP_010918612.1|  PREDICTED: uncharacterized protein LOC105042...  76.6    2e-13   
ref|XP_010918613.1|  PREDICTED: uncharacterized protein LOC105042...  75.5    2e-13   
ref|XP_008454230.1|  PREDICTED: uncharacterized protein LOC103494...  75.9    2e-13   
ref|XP_009400244.1|  PREDICTED: uncharacterized protein LOC103984470  76.6    2e-13   
ref|XP_004171189.1|  PREDICTED: uncharacterized LOC101214679 isof...  75.5    2e-13   
ref|XP_002316393.1|  hypothetical protein POPTR_0010s23450g           75.1    3e-13   
ref|XP_010940515.1|  PREDICTED: uncharacterized protein LOC105059...  76.6    3e-13   
ref|XP_006645545.1|  PREDICTED: uncharacterized protein LOC102706803  76.3    3e-13   
ref|XP_010940516.1|  PREDICTED: uncharacterized protein LOC105059...  75.9    3e-13   
emb|CDM81986.1|  unnamed protein product                              76.6    3e-13   
ref|XP_009388574.1|  PREDICTED: uncharacterized protein LOC103975...  75.5    5e-13   
ref|XP_009388499.1|  PREDICTED: uncharacterized protein LOC103975...  75.5    6e-13   
ref|XP_009388423.1|  PREDICTED: uncharacterized protein LOC103975...  75.9    6e-13   
gb|KHG14935.1|  Zinc finger protein                                   74.3    6e-13   
ref|XP_008799513.1|  PREDICTED: uncharacterized protein LOC103714...  73.9    7e-13   
ref|XP_011031658.1|  PREDICTED: uncharacterized protein LOC105130719  73.9    8e-13   
ref|XP_002519470.1|  conserved hypothetical protein                   73.6    8e-13   
ref|XP_009800884.1|  PREDICTED: uncharacterized protein LOC104246...  73.9    1e-12   
gb|KDO48575.1|  hypothetical protein CISIN_1g030349mg                 73.2    1e-12   
emb|CDY05489.1|  BnaA02g32020D                                        72.4    2e-12   
ref|XP_006427275.1|  hypothetical protein CICLE_v10026612mg           73.2    2e-12   
ref|XP_006427274.1|  hypothetical protein CICLE_v10026612mg           73.2    2e-12   
ref|NP_849668.1|  uncharacterized protein                             72.8    2e-12   
gb|KDO48570.1|  hypothetical protein CISIN_1g030349mg                 73.2    2e-12   
ref|XP_009382131.1|  PREDICTED: uncharacterized protein LOC103970...  73.2    2e-12   
ref|XP_008799510.1|  PREDICTED: uncharacterized protein LOC103714...  73.6    3e-12   
gb|ABK25963.1|  unknown                                               74.3    3e-12   
ref|XP_009382127.1|  PREDICTED: uncharacterized protein LOC103970...  73.2    4e-12   
ref|XP_006436509.1|  hypothetical protein CICLE_v10033705mg           72.0    4e-12   
ref|XP_002311069.1|  hypothetical protein POPTR_0008s03460g           71.6    5e-12   
emb|CAN74737.1|  hypothetical protein VITISV_020991                   71.6    5e-12   
gb|KHG16450.1|  Bifunctional aas                                      71.6    5e-12   
ref|XP_009377025.1|  PREDICTED: uncharacterized protein LOC103965681  71.6    5e-12   
ref|XP_010557401.1|  PREDICTED: uncharacterized protein LOC104826...  71.6    6e-12   
ref|XP_010557324.1|  PREDICTED: uncharacterized protein LOC104826...  72.0    6e-12   
ref|XP_010067347.1|  PREDICTED: uncharacterized protein LOC104454250  71.2    7e-12   
ref|XP_011084284.1|  PREDICTED: uncharacterized protein LOC105166582  71.2    7e-12   
ref|XP_009362103.1|  PREDICTED: uncharacterized protein LOC103952265  71.2    7e-12   
ref|XP_010318762.1|  PREDICTED: uncharacterized protein LOC101253...  71.2    8e-12   
ref|XP_001783102.1|  predicted protein                                71.2    8e-12   
ref|XP_008787462.1|  PREDICTED: uncharacterized protein LOC103705...  71.2    9e-12   
ref|XP_008779050.1|  PREDICTED: uncharacterized protein LOC103698...  71.6    1e-11   
ref|XP_009418261.1|  PREDICTED: uncharacterized protein LOC103998...  71.6    2e-11   
ref|XP_006450920.1|  hypothetical protein CICLE_v10009673mg           71.6    2e-11   
ref|XP_009418262.1|  PREDICTED: uncharacterized protein LOC103998...  71.6    2e-11   
ref|XP_010048203.1|  PREDICTED: uncharacterized protein LOC104437036  70.9    2e-11   
ref|XP_009774965.1|  PREDICTED: uncharacterized protein LOC104224935  70.1    2e-11   
gb|EYU21639.1|  hypothetical protein MIMGU_mgv1a016230mg              70.5    2e-11   
ref|XP_009617440.1|  PREDICTED: uncharacterized protein LOC104109785  70.1    2e-11   
ref|XP_008805708.1|  PREDICTED: uncharacterized protein LOC103718595  69.7    3e-11   
gb|EAZ03857.1|  hypothetical protein OsI_25991                        69.3    3e-11   
ref|XP_008787460.1|  PREDICTED: uncharacterized protein LOC103705...  70.5    3e-11   
gb|KCW80384.1|  hypothetical protein EUGRSUZ_C01745                   70.9    5e-11   
ref|XP_004304470.1|  PREDICTED: uncharacterized protein LOC101299...  68.9    5e-11   
ref|XP_009624286.1|  PREDICTED: uncharacterized protein LOC104115...  70.1    5e-11   
ref|XP_004150368.1|  PREDICTED: uncharacterized protein LOC101206806  68.9    6e-11   
emb|CBI31396.3|  unnamed protein product                              68.6    6e-11   
ref|XP_003633469.1|  PREDICTED: uncharacterized protein LOC100854399  68.9    6e-11   
ref|XP_008241394.1|  PREDICTED: uncharacterized protein LOC103339821  68.6    7e-11   
ref|XP_003536328.1|  PREDICTED: uncharacterized protein LOC100306...  68.9    7e-11   
ref|XP_004137841.1|  PREDICTED: uncharacterized protein LOC101221441  68.6    7e-11   
ref|XP_004957685.1|  PREDICTED: uncharacterized protein LOC101756...  69.3    9e-11   
ref|NP_001059637.1|  Os07g0479600                                     68.9    9e-11   
ref|XP_010238431.1|  PREDICTED: uncharacterized protein LOC100828...  68.9    9e-11   
ref|XP_003563127.1|  PREDICTED: uncharacterized protein LOC100828...  68.9    1e-10   
ref|XP_010519948.1|  PREDICTED: uncharacterized protein LOC104799...  67.8    1e-10   
ref|XP_011094507.1|  PREDICTED: uncharacterized protein LOC105174185  67.8    1e-10   
ref|XP_008359625.1|  PREDICTED: uncharacterized protein LOC103423...  67.8    1e-10   
ref|XP_010935827.1|  PREDICTED: uncharacterized protein LOC105055630  68.6    1e-10   
ref|XP_008442713.1|  PREDICTED: uncharacterized protein LOC103486...  67.8    1e-10   
gb|AFK41989.1|  unknown                                               67.8    2e-10   
ref|XP_006606269.1|  PREDICTED: uncharacterized protein LOC100306...  67.8    2e-10   
ref|XP_007010009.1|  Uncharacterized protein isoform 1                68.9    2e-10   
ref|XP_008363365.1|  PREDICTED: uncharacterized protein LOC103427042  67.4    2e-10   
ref|XP_001757762.1|  predicted protein                                68.6    2e-10   
ref|XP_007010010.1|  Uncharacterized protein isoform 2                68.2    2e-10   
ref|NP_001183731.1|  hypothetical protein                             67.4    2e-10   
ref|XP_009368930.1|  PREDICTED: uncharacterized protein LOC103958402  67.0    2e-10   
ref|XP_007204169.1|  hypothetical protein PRUPE_ppa017312mg           67.0    2e-10   
ref|XP_009382130.1|  PREDICTED: uncharacterized protein LOC103970...  67.8    3e-10   
ref|XP_007027439.1|  Uncharacterized protein TCM_022272               66.6    3e-10   
ref|XP_006657696.1|  PREDICTED: uncharacterized protein LOC102708262  68.2    3e-10   
ref|XP_010243250.1|  PREDICTED: uncharacterized protein LOC104587...  66.2    3e-10   
emb|CDX78276.1|  BnaA09g34710D                                        66.6    4e-10   
ref|XP_009116172.1|  PREDICTED: uncharacterized protein LOC103841393  66.6    4e-10   
ref|XP_006361689.1|  PREDICTED: uncharacterized protein LOC102604477  66.2    5e-10   
gb|EPS63356.1|  hypothetical protein M569_11431                       65.5    5e-10   
ref|XP_008667747.1|  PREDICTED: uncharacterized protein LOC100278...  67.0    5e-10   
ref|NP_001145484.1|  uncharacterized protein LOC100278878             67.0    6e-10   
ref|XP_002529592.1|  conserved hypothetical protein                   65.9    6e-10   
ref|XP_002462857.1|  hypothetical protein SORBIDRAFT_02g033190        66.6    7e-10   
gb|AES86589.2|  DUF4050 family protein                                67.8    7e-10   
ref|XP_006286582.1|  hypothetical protein CARUB_v10002127mg           66.6    9e-10   
gb|EMS50088.1|  hypothetical protein TRIUR3_19400                     66.6    9e-10   
ref|XP_010103536.1|  hypothetical protein L484_017045                 65.5    9e-10   
ref|XP_002878003.1|  hypothetical protein ARALYDRAFT_485901           65.5    1e-09   
ref|XP_011073433.1|  PREDICTED: uncharacterized protein LOC105158385  65.5    1e-09   
ref|NP_191048.1|  uncharacterized protein                             65.5    1e-09   
ref|XP_008233265.1|  PREDICTED: uncharacterized protein LOC103332323  65.1    1e-09   
ref|XP_004307350.1|  PREDICTED: uncharacterized protein LOC101309195  65.1    1e-09   
ref|XP_007218639.1|  hypothetical protein PRUPE_ppa013693mg           65.1    1e-09   
gb|KCW65462.1|  hypothetical protein EUGRSUZ_G02874                   65.1    1e-09   
gb|KDO48574.1|  hypothetical protein CISIN_1g030349mg                 65.5    1e-09   
ref|XP_006403521.1|  hypothetical protein EUTSA_v10010843mg           64.7    2e-09   
ref|XP_006292077.1|  hypothetical protein CARUB_v10018272mg           64.7    2e-09   
ref|XP_010423711.1|  PREDICTED: uncharacterized protein LOC104708786  64.3    2e-09   
ref|XP_006288878.1|  hypothetical protein CARUB_v10002237mg           64.3    2e-09   
emb|CDX73436.1|  BnaC08g25670D                                        64.3    3e-09   
ref|XP_010516031.1|  PREDICTED: uncharacterized protein LOC104791765  64.3    3e-09   
ref|XP_008653074.1|  PREDICTED: uncharacterized protein LOC103633...  65.1    3e-09   
ref|XP_010427215.1|  PREDICTED: uncharacterized protein LOC104712097  63.9    3e-09   
ref|XP_010504316.1|  PREDICTED: uncharacterized protein LOC104781357  63.9    3e-09   
ref|XP_008653076.1|  PREDICTED: uncharacterized protein LOC103633...  64.7    4e-09   
ref|XP_006288879.1|  hypothetical protein CARUB_v10002237mg           64.3    4e-09   
ref|XP_001783458.1|  predicted protein                                64.3    4e-09   
ref|XP_008779057.1|  PREDICTED: uncharacterized protein LOC103698...  64.3    5e-09   
emb|CDO99793.1|  unnamed protein product                              63.5    5e-09   
ref|XP_007143763.1|  hypothetical protein PHAVU_007G099500g           63.5    5e-09   
ref|XP_008779045.1|  PREDICTED: uncharacterized protein LOC103698...  64.3    5e-09   
ref|XP_010312598.1|  PREDICTED: uncharacterized protein LOC104644301  63.2    6e-09   
ref|XP_003521412.1|  PREDICTED: uncharacterized protein LOC100796170  63.2    6e-09   
ref|XP_007144345.1|  hypothetical protein PHAVU_007G148400g           62.8    8e-09   
ref|XP_008359630.1|  PREDICTED: uncharacterized protein LOC103423...  62.8    9e-09   
gb|EYU32423.1|  hypothetical protein MIMGU_mgv1a016689mg              62.0    1e-08   
ref|NP_568118.1|  uncharacterized protein                             61.6    2e-08   
ref|XP_008442716.1|  PREDICTED: uncharacterized protein LOC103486...  61.2    2e-08   
ref|XP_004496227.1|  PREDICTED: uncharacterized protein LOC101501...  60.8    4e-08   
ref|XP_010543438.1|  PREDICTED: uncharacterized protein LOC104816354  60.5    5e-08   
ref|XP_004968359.1|  PREDICTED: uncharacterized protein LOC101770...  61.6    6e-08   
ref|XP_010318773.1|  PREDICTED: uncharacterized protein LOC101253...  59.7    9e-08   
ref|XP_007218638.1|  hypothetical protein PRUPE_ppa013693mg           59.3    1e-07   



>ref|XP_004242783.1| PREDICTED: uncharacterized protein LOC101248987 [Solanum lycopersicum]
 ref|XP_010323310.1| PREDICTED: uncharacterized protein LOC101248987 [Solanum lycopersicum]
Length=177

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+LVRK S+S+ FWSTST DLE ST+   RSM+SI+I N SL+Q SGTGN   + EF
Sbjct  46   RIQGKLVRKQSLSDDFWSTSTCDLEISTVQSHRSMSSISISNQSLSQQSGTGNASNNNEF  105

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN GYL W Q RLQW  SK  EN+R++ + +L W+ SY+    T+K FP PIPLS+MVD 
Sbjct  106  VNHGYLLWNQTRLQWLASKNPENQRVIEEPMLTWNVSYDSLFGTNKRFPQPIPLSDMVDF  165

Query  259  LVDTWEEDGLY  227
            L D WE +GLY
Sbjct  166  LADIWEHEGLY  176



>ref|XP_007013463.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31082.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=177

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G++VRK SIS+ FWSTSTYDLE+S I  QRS++SI+  N +L+Q S TG      +F
Sbjct  43   RIQGRIVRKPSISDDFWSTSTYDLENSAIQSQRSLSSISTSNPTLSQCSSTGGIANQSDF  102

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VNQG + W Q+RLQW GS +  N  +   ++ L  +A+YE    T  PFP PIPLSEM+D
Sbjct  103  VNQGLIVWNQSRLQWIGSSRPRNHTQQSRETGLSLNATYESLLGTRNPFPRPIPLSEMID  162

Query  262  LLVDTWEEDGLY  227
             LV+ WE++GLY
Sbjct  163  FLVEVWEQEGLY  174



>ref|XP_009625255.1| PREDICTED: uncharacterized protein LOC104116163 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009625256.1| PREDICTED: uncharacterized protein LOC104116163 isoform X1 [Nicotiana 
tomentosiformis]
Length=175

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 99/131 (76%), Gaps = 2/131 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+LVRK SIS+ FWSTST ++E+ST+  QRSM+SI+I + SL  +SGTG+  T+ EF
Sbjct  46   RIQGRLVRKPSISDDFWSTSTCEMENSTVQSQRSMSSISI-SNSLAHHSGTGSATTNNEF  104

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VNQGYL W Q+RLQW  SKK ENRR V + +L+W+ SYE    T+K FP PIPLS+MVD 
Sbjct  105  VNQGYLLWNQSRLQWLASKKPENRR-VEEPMLNWNVSYESLFGTNKRFPQPIPLSDMVDF  163

Query  259  LVDTWEEDGLY  227
            L D WE +GLY
Sbjct  164  LADIWEHEGLY  174



>ref|XP_009785325.1| PREDICTED: uncharacterized protein LOC104233601 isoform X1 [Nicotiana 
sylvestris]
Length=175

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 98/131 (75%), Gaps = 2/131 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+LVRK SIS+ FWSTST ++E+ST+  QRSM+SI+I + SL Q+ GTG+   + EF
Sbjct  46   RIQGKLVRKPSISDDFWSTSTCEMENSTVQSQRSMSSISI-SNSLAQHGGTGSASNNNEF  104

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VNQGYL W Q+RLQW  SKK ENR +V + +L+W+ SYE    T+K FP PIPLS+MVD 
Sbjct  105  VNQGYLLWNQSRLQWLASKKPENR-IVEEPMLNWNVSYESLFGTNKRFPQPIPLSDMVDF  163

Query  259  LVDTWEEDGLY  227
            L D WE +GLY
Sbjct  164  LADIWEHEGLY  174



>ref|XP_009399743.1| PREDICTED: uncharacterized protein LOC103984060 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009399745.1| PREDICTED: uncharacterized protein LOC103984060 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009399746.1| PREDICTED: uncharacterized protein LOC103984060 [Musa acuminata 
subsp. malaccensis]
Length=157

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G+LV+K SISE FWSTSTY++E+S    QRS++SI+    +   + GTG+T    EF
Sbjct  25   KIQGRLVKKPSISEEFWSTSTYEMENSRAHSQRSISSISTLAQTFDHHGGTGSTSNPPEF  84

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G+L W Q R QW G  + E++ + V +  L W+A+Y+    ++KPFP PIPLSEMV+
Sbjct  85   VNHGFLLWNQTRQQWIGKGRLESQSKQVQEPRLSWNATYDSLLGSNKPFPQPIPLSEMVE  144

Query  262  LLVDTWEEDGLY  227
             LVD W ++GLY
Sbjct  145  FLVDIWVQEGLY  156



>ref|XP_011026448.1| PREDICTED: uncharacterized protein LOC105127044 [Populus euphratica]
Length=172

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 89/131 (68%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            ++  +LV+KSS S  FWSTS  D+E+ST+  Q S++SI+  N  L   S  G+T    EF
Sbjct  42   RVQKRLVKKSSKSNDFWSTSAGDMENSTMHSQGSLSSISTLNQQLDP-SNAGSTSNSSEF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN+G L W Q R QW G+KKT+NR+ V +  + W+A+YE    ++KPF  P+PL+EMVD 
Sbjct  101  VNRGLLLWNQTRQQWLGNKKTQNRKQVREPTISWNATYESLLGSNKPFARPVPLAEMVDF  160

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  161  LVDVWEQEGLY  171



>ref|XP_009800883.1| PREDICTED: uncharacterized protein LOC104246705 isoform X2 [Nicotiana 
sylvestris]
Length=148

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 85/131 (65%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+  Q +RK+++ + FWS+S  ++E+ST   QRS+TSI+  N  L  +S +G T    EF
Sbjct  17   KVPSQRLRKANLRDDFWSSSAGEMENSTFPSQRSITSISTSNPPLDPHSNSGTTNNTSEF  76

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW GSK ++ R  V +  L +D SYE    T+K FP PIPLSEMVD 
Sbjct  77   VNHGLLLWNQTRQQWCGSKTSQKRASVREPKLGFDTSYETLLGTNKRFPQPIPLSEMVDF  136

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  137  LVDVWEQEGLY  147



>ref|XP_011081564.1| PREDICTED: uncharacterized protein LOC105164579 isoform X2 [Sesamum 
indicum]
Length=174

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 82/131 (63%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI GQ V+  S +E FWSTS+ D+ +S     RSM+SI+  N +L  +S TG      EF
Sbjct  43   KIQGQRVKNRSFTEDFWSTSSGDIGNSAFPSHRSMSSISTSNQTLDTHSSTGGPSNSAEF  102

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW G+K +E      +  L W+A+YE    T+KPFP PIPL+EMVD 
Sbjct  103  VNHGLLLWNQTRQQWVGNKGSEKHIQSHEPKLSWNATYESLLGTNKPFPQPIPLAEMVDF  162

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  163  LVDVWEQEGLY  173



>ref|XP_011081562.1| PREDICTED: uncharacterized protein LOC105164579 isoform X1 [Sesamum 
indicum]
Length=198

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 82/131 (63%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI GQ V+  S +E FWSTS+ D+ +S     RSM+SI+  N +L  +S TG      EF
Sbjct  67   KIQGQRVKNRSFTEDFWSTSSGDIGNSAFPSHRSMSSISTSNQTLDTHSSTGGPSNSAEF  126

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW G+K +E      +  L W+A+YE    T+KPFP PIPL+EMVD 
Sbjct  127  VNHGLLLWNQTRQQWVGNKGSEKHIQSHEPKLSWNATYESLLGTNKPFPQPIPLAEMVDF  186

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  187  LVDVWEQEGLY  197



>ref|XP_002524505.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37945.1| conserved hypothetical protein [Ricinus communis]
Length=173

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 91/134 (68%), Gaps = 7/134 (5%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V+K S+S+ FWSTST DLE+S I  QRS++SI++ N +L    GT  T +  EF
Sbjct  43   RIQGRAVKKPSVSDDFWSTSTCDLENSAIQSQRSVSSISVSNANLC--IGTSGTSSTSEF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENR---RLVWKSILDWDASYECTAETSKPFPCPIPLSEM  269
            VNQG+L W+Q+RLQW G+  +  +   RL  +  L W+A+YE    +  PF  PIPLSEM
Sbjct  101  VNQGFLLWQQSRLQWTGNNNSRGKTHYRLEHR--LSWNATYEGLLGSRNPFRRPIPLSEM  158

Query  268  VDLLVDTWEEDGLY  227
            VD LVD WE++GLY
Sbjct  159  VDFLVDIWEQEGLY  172



>ref|XP_006427271.1| hypothetical protein CICLE_v10026612mg [Citrus clementina]
 ref|XP_006465337.1| PREDICTED: uncharacterized protein LOC102625001 isoform X4 [Citrus 
sinensis]
 gb|ESR40511.1| hypothetical protein CICLE_v10026612mg [Citrus clementina]
 gb|KDO48563.1| hypothetical protein CISIN_1g030349mg [Citrus sinensis]
 gb|KDO48564.1| hypothetical protein CISIN_1g030349mg [Citrus sinensis]
Length=160

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = -2

Query  625  ESKIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHE  446
            E  + G+   K SISE FW+TST D+++S +  Q S++S+   NL      G+G+     
Sbjct  26   ELGVPGRSAGKRSISEDFWTTSTCDMDNSAVQSQGSISSLGTNNLIPDTNGGSGSASAPS  85

Query  445  EFVNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEM  269
            EFVN G+L W Q R +W G+KK ENR   V +  L+W+A+YE    ++KPFP PIPLSEM
Sbjct  86   EFVNHGFLLWNQTRQRWIGNKKAENRTHQVREPKLNWNATYESLLGSNKPFPQPIPLSEM  145

Query  268  VDLLVDTWEEDGLY  227
            VD LVD WE++G+Y
Sbjct  146  VDFLVDIWEQEGMY  159



>ref|XP_006427270.1| hypothetical protein CICLE_v10026612mg [Citrus clementina]
 ref|XP_006465338.1| PREDICTED: uncharacterized protein LOC102625001 isoform X5 [Citrus 
sinensis]
 gb|ESR40510.1| hypothetical protein CICLE_v10026612mg [Citrus clementina]
 gb|KDO48566.1| hypothetical protein CISIN_1g030349mg [Citrus sinensis]
 gb|KDO48567.1| hypothetical protein CISIN_1g030349mg [Citrus sinensis]
Length=157

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = -2

Query  625  ESKIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHE  446
            E  + G+   K SISE FW+TST D+++S +  Q S++S+   NL      G+G+     
Sbjct  23   ELGVPGRSAGKRSISEDFWTTSTCDMDNSAVQSQGSISSLGTNNLIPDTNGGSGSASAPS  82

Query  445  EFVNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEM  269
            EFVN G+L W Q R +W G+KK ENR   V +  L+W+A+YE    ++KPFP PIPLSEM
Sbjct  83   EFVNHGFLLWNQTRQRWIGNKKAENRTHQVREPKLNWNATYESLLGSNKPFPQPIPLSEM  142

Query  268  VDLLVDTWEEDGLY  227
            VD LVD WE++G+Y
Sbjct  143  VDFLVDIWEQEGMY  156



>ref|XP_003549760.1| PREDICTED: uncharacterized protein LOC100812832 [Glycine max]
Length=171

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I GQ VRK  IS+GFWS+ST DL++S I  QRS++S++  N  L    GT     + EF
Sbjct  39   RIQGQTVRKPHISDGFWSSSTCDLDNSNIQSQRSISSVSTSNQILYHSGGTSTPGANPEF  98

Query  439  VNQGYLWWKQNRLQWRGSKKT-ENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W ++RLQW GS K+ ++ +   +  L+W+A+YE    T +PFP PIPLSEMV+
Sbjct  99   VNPGLLLWNESRLQWVGSGKSRKHGQQKREPRLNWNATYESLLGTRQPFPKPIPLSEMVE  158

Query  262  LLVDTWEEDGLY  227
             LVD WE +G+Y
Sbjct  159  FLVDVWEREGMY  170



>gb|KDP37090.1| hypothetical protein JCGZ_06146 [Jatropha curcas]
Length=170

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 91/147 (62%), Gaps = 16/147 (11%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI GQ V+K SISE FW+TST D+++S +  Q SM+SI+  N +L  + G+ +TI   EF
Sbjct  23   KIRGQAVKKPSISEDFWTTSTCDMDNSAVQSQGSMSSISTVNQTLDPHGGSSSTIAPSEF  82

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILD---------------WDASYECTAET  308
            VN G L W Q R +W G K++ NR +  W   L+               W+A+Y+    +
Sbjct  83   VNHGLLLWNQTRQRWVGDKRSVNRAQQSWDPKLNTHCLSMVKNFWLCCSWNATYDSLLGS  142

Query  307  SKPFPCPIPLSEMVDLLVDTWEEDGLY  227
            +KPFP PIPLSEMVD LVD WE++G+Y
Sbjct  143  NKPFPQPIPLSEMVDFLVDIWEQEGMY  169



>ref|XP_006427269.1| hypothetical protein CICLE_v10026612mg [Citrus clementina]
 gb|ESR40509.1| hypothetical protein CICLE_v10026612mg [Citrus clementina]
 gb|KDO48568.1| hypothetical protein CISIN_1g030349mg [Citrus sinensis]
Length=165

 Score =   125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = -2

Query  625  ESKIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHE  446
            E  + G+   K SISE FW+TST D+++S +  Q S++S+   NL      G+G+     
Sbjct  31   ELGVPGRSAGKRSISEDFWTTSTCDMDNSAVQSQGSISSLGTNNLIPDTNGGSGSASAPS  90

Query  445  EFVNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEM  269
            EFVN G+L W Q R +W G+KK ENR   V +  L+W+A+YE    ++KPFP PIPLSEM
Sbjct  91   EFVNHGFLLWNQTRQRWIGNKKAENRTHQVREPKLNWNATYESLLGSNKPFPQPIPLSEM  150

Query  268  VDLLVDTWEEDGLY  227
            VD LVD WE++G+Y
Sbjct  151  VDFLVDIWEQEGMY  164



>ref|XP_009800882.1| PREDICTED: uncharacterized protein LOC104246705 isoform X1 [Nicotiana 
sylvestris]
Length=173

 Score =   125 bits (313),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 85/131 (65%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+  Q +RK+++ + FWS+S  ++E+ST   QRS+TSI+  N  L  +S +G T    EF
Sbjct  42   KVPSQRLRKANLRDDFWSSSAGEMENSTFPSQRSITSISTSNPPLDPHSNSGTTNNTSEF  101

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW GSK ++ R  V +  L +D SYE    T+K FP PIPLSEMVD 
Sbjct  102  VNHGLLLWNQTRQQWCGSKTSQKRASVREPKLGFDTSYETLLGTNKRFPQPIPLSEMVDF  161

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  162  LVDVWEQEGLY  172



>ref|XP_011039693.1| PREDICTED: uncharacterized protein LOC105136159 isoform X2 [Populus 
euphratica]
Length=164

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            ++  +LVRKSS+S+ FWSTS  ++E S    Q S++SI+  N  L      G+T    EF
Sbjct  33   RVQERLVRKSSLSDDFWSTSAGEIEDSMAHSQGSLSSISTLNQLLDPCCNAGSTSNPPEF  92

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN+G L W Q R QW G+KKT+NR  V +  + W+A+YE    +++PF  P+PL+EMVD 
Sbjct  93   VNRGLLLWNQTRQQWLGNKKTQNRTQVREPTISWNATYESLLGSNRPFSRPVPLAEMVDF  152

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  153  LVDVWEQEGLY  163



>ref|XP_004965939.1| PREDICTED: uncharacterized protein LOC101759193 isoform X5 [Setaria 
italica]
Length=174

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 90/132 (68%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+S+SE FWSTS +++E+S I  QRSM+SI+    S  Q+ G G++    EF
Sbjct  43   RIQGRSVRKASLSEDFWSTSAHEVENSGIQSQRSMSSISTVAQSSDQH-GAGSSSNPNEF  101

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VNQG + W Q R QW G+KK  +R + + +  L W+A+ E    ++KPF  PIPL EMVD
Sbjct  102  VNQGLMLWNQTRQQWVGNKKRHSRSQQLREPKLSWNATCESLLGSNKPFSQPIPLGEMVD  161

Query  262  LLVDTWEEDGLY  227
            LLVD WE++GLY
Sbjct  162  LLVDAWEQEGLY  173



>ref|XP_007215090.1| hypothetical protein PRUPE_ppa012664mg [Prunus persica]
 gb|EMJ16289.1| hypothetical protein PRUPE_ppa012664mg [Prunus persica]
Length=159

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 87/126 (69%), Gaps = 2/126 (2%)
 Frame = -2

Query  601  VRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYL  422
            + K SISE FW+TST+D+++S +  Q SM+SI+  N +L  + G+G+  T  EFVN G L
Sbjct  34   INKPSISEDFWTTSTWDMDNSAVQSQGSMSSIST-NQTLDPHGGSGSNTTPSEFVNHGLL  92

Query  421  WWKQNRLQWRGSKKTEN-RRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTW  245
             W Q R +W G+KK+E+  + + +  L W+ASYE    ++KPFP PIPL EMVD LVD W
Sbjct  93   LWNQTRQRWVGNKKSESPAKQIREPKLSWNASYESLLGSNKPFPQPIPLPEMVDFLVDVW  152

Query  244  EEDGLY  227
            E++GLY
Sbjct  153  EQEGLY  158



>ref|XP_007215089.1| hypothetical protein PRUPE_ppa012664mg [Prunus persica]
 ref|XP_007215091.1| hypothetical protein PRUPE_ppa012664mg [Prunus persica]
 gb|EMJ16288.1| hypothetical protein PRUPE_ppa012664mg [Prunus persica]
 gb|EMJ16290.1| hypothetical protein PRUPE_ppa012664mg [Prunus persica]
Length=156

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 87/126 (69%), Gaps = 2/126 (2%)
 Frame = -2

Query  601  VRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYL  422
            + K SISE FW+TST+D+++S +  Q SM+SI+  N +L  + G+G+  T  EFVN G L
Sbjct  31   INKPSISEDFWTTSTWDMDNSAVQSQGSMSSIST-NQTLDPHGGSGSNTTPSEFVNHGLL  89

Query  421  WWKQNRLQWRGSKKTEN-RRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTW  245
             W Q R +W G+KK+E+  + + +  L W+ASYE    ++KPFP PIPL EMVD LVD W
Sbjct  90   LWNQTRQRWVGNKKSESPAKQIREPKLSWNASYESLLGSNKPFPQPIPLPEMVDFLVDVW  149

Query  244  EEDGLY  227
            E++GLY
Sbjct  150  EQEGLY  155



>ref|XP_004965936.1| PREDICTED: uncharacterized protein LOC101759193 isoform X2 [Setaria 
italica]
Length=195

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 90/132 (68%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+S+SE FWSTS +++E+S I  QRSM+SI+    S  Q+ G G++    EF
Sbjct  64   RIQGRSVRKASLSEDFWSTSAHEVENSGIQSQRSMSSISTVAQSSDQH-GAGSSSNPNEF  122

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VNQG + W Q R QW G+KK  +R + + +  L W+A+ E    ++KPF  PIPL EMVD
Sbjct  123  VNQGLMLWNQTRQQWVGNKKRHSRSQQLREPKLSWNATCESLLGSNKPFSQPIPLGEMVD  182

Query  262  LLVDTWEEDGLY  227
            LLVD WE++GLY
Sbjct  183  LLVDAWEQEGLY  194



>ref|XP_011039692.1| PREDICTED: uncharacterized protein LOC105136159 isoform X1 [Populus 
euphratica]
Length=173

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            ++  +LVRKSS+S+ FWSTS  ++E S    Q S++SI+  N  L      G+T    EF
Sbjct  42   RVQERLVRKSSLSDDFWSTSAGEIEDSMAHSQGSLSSISTLNQLLDPCCNAGSTSNPPEF  101

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN+G L W Q R QW G+KKT+NR  V +  + W+A+YE    +++PF  P+PL+EMVD 
Sbjct  102  VNRGLLLWNQTRQQWLGNKKTQNRTQVREPTISWNATYESLLGSNRPFSRPVPLAEMVDF  161

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  162  LVDVWEQEGLY  172



>ref|XP_002517627.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44791.1| conserved hypothetical protein [Ricinus communis]
Length=190

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -2

Query  622  SKIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEE  443
            S I GQ V+K SISE FW+TST D+++S +  Q SM+SI+  N +L  +  + +     +
Sbjct  57   SNIQGQTVKKPSISEDFWTTSTCDMDNSAVQSQGSMSSISTVNQTLDLHGSSSSGSAPSQ  116

Query  442  FVNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMV  266
            FVN G + W Q R +W G KK+ NR R   +  L+W+A+YE    ++KPFP PIPLSEMV
Sbjct  117  FVNHGLIVWNQTRQRWVGDKKSLNRARQSREPKLNWNATYESLLGSNKPFPRPIPLSEMV  176

Query  265  DLLVDTWEEDGLY  227
            D LVD WE++G+Y
Sbjct  177  DFLVDIWEQEGMY  189



>gb|EYU20266.1| hypothetical protein MIMGU_mgv1a014871mg [Erythranthe guttata]
Length=160

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSL-TQYSGTGNTITHEE  443
            KI G+ V+K S++E FWS S+ D+++S     RS++SI+  N  L TQ +  G T    E
Sbjct  28   KIQGRRVKKPSLTEDFWSPSSGDMDNSAFASHRSISSISTSNQPLDTQSTSAGTTNNPSE  87

Query  442  FVNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            FVN G L W Q R QW G+K++E      +  L W+A+YE    T+KPFP PIPL EMVD
Sbjct  88   FVNHGLLLWNQTRQQWVGNKESEKIVKTQEPKLSWNATYESLLGTNKPFPNPIPLPEMVD  147

Query  262  LLVDTWEEDGLY  227
             L+D WE++GLY
Sbjct  148  FLIDVWEQEGLY  159



>ref|XP_006594270.1| PREDICTED: uncharacterized protein LOC100813288 isoform X2 [Glycine 
max]
Length=149

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I GQ VRK  IS+GFWS+ST DL++S I  QRS++S++  N  L    GT     + EF
Sbjct  17   RIQGQTVRKPHISDGFWSSSTCDLDNSNIQSQRSISSVSTLNQILYHSGGTSTPGANPEF  76

Query  439  VNQGYLWWKQNRLQWRGSKKT-ENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W ++RLQW GS K+ ++ +   +  L+W+A+YE    T +PF  PIPL+EMV+
Sbjct  77   VNPGLLLWNESRLQWVGSGKSRKHSQQKREPRLNWNATYESLLGTRQPFSKPIPLTEMVE  136

Query  262  LLVDTWEEDGLY  227
             LVD WE +G+Y
Sbjct  137  FLVDVWEREGMY  148



>gb|EYU20265.1| hypothetical protein MIMGU_mgv1a014871mg [Erythranthe guttata]
Length=175

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSL-TQYSGTGNTITHEE  443
            KI G+ V+K S++E FWS S+ D+++S     RS++SI+  N  L TQ +  G T    E
Sbjct  43   KIQGRRVKKPSLTEDFWSPSSGDMDNSAFASHRSISSISTSNQPLDTQSTSAGTTNNPSE  102

Query  442  FVNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            FVN G L W Q R QW G+K++E      +  L W+A+YE    T+KPFP PIPL EMVD
Sbjct  103  FVNHGLLLWNQTRQQWVGNKESEKIVKTQEPKLSWNATYESLLGTNKPFPNPIPLPEMVD  162

Query  262  LLVDTWEEDGLY  227
             L+D WE++GLY
Sbjct  163  FLIDVWEQEGLY  174



>gb|AFW87196.1| hypothetical protein ZEAMMB73_642213 [Zea mays]
Length=174

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+S+SE FWSTS +++E+S I  QRSM+SI+    S  Q++  G++    EF
Sbjct  43   RIQGRSVRKASLSEDFWSTSAHEMENSGIQSQRSMSSISTLAQSSDQHTA-GSSSNPNEF  101

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            +NQG + W Q R QW GSKK  +R +   +  L W+ +YE    ++KPF  PIPL EMVD
Sbjct  102  MNQGLMLWNQTRQQWVGSKKRHSRSQQPREPKLSWNTTYESLLGSNKPFSQPIPLGEMVD  161

Query  262  LLVDTWEEDGLY  227
            LLVD WE++GLY
Sbjct  162  LLVDAWEQEGLY  173



>gb|ACG43637.1| hypothetical protein [Zea mays]
Length=174

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+S+SE FWSTS +++E+S I  QRSM+SI+    S  Q++ +G+     EF
Sbjct  43   RIQGRSVRKASLSEDFWSTSAHEMENSGIQSQRSMSSISTLAQSSDQHA-SGSCSNPNEF  101

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            +NQG + W Q R QW GSKK  +R +   +  L W+ +YE    ++KPF  PIPL EMVD
Sbjct  102  MNQGLMLWNQTRQQWVGSKKRHSRSQQPREPKLSWNTTYESLLGSNKPFSQPIPLGEMVD  161

Query  262  LLVDTWEEDGLY  227
            LLVD WE++GLY
Sbjct  162  LLVDAWEQEGLY  173



>ref|XP_002285241.1| PREDICTED: uncharacterized protein LOC100245670 isoform X2 [Vitis 
vinifera]
 emb|CBI28208.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V+K SISE FWSTST ++++ST+  QRS++SI+  N SLT YSG G+T  + EF
Sbjct  28   RIQGRTVKKPSISEDFWSTSTCEIDNSTVQSQRSISSISTSNQSLTHYSGIGSTSNNSEF  87

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            +N G L W Q RLQW G+K++EN+ + + +  L W+A+YE    T++ F  PIPLSEM+D
Sbjct  88   INHGLLLWNQTRLQWVGNKRSENQSQQIREPRLRWNATYEGLLGTNRRFSQPIPLSEMID  147

Query  262  LLVDTWEEDGLY  227
             LVD WE++G+Y
Sbjct  148  FLVDVWEQEGMY  159



>ref|XP_010656431.1| PREDICTED: uncharacterized protein LOC100245670 isoform X1 [Vitis 
vinifera]
Length=181

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V+K SISE FWSTST ++++ST+  QRS++SI+  N SLT YSG G+T  + EF
Sbjct  49   RIQGRTVKKPSISEDFWSTSTCEIDNSTVQSQRSISSISTSNQSLTHYSGIGSTSNNSEF  108

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            +N G L W Q RLQW G+K++EN+ + + +  L W+A+YE    T++ F  PIPLSEM+D
Sbjct  109  INHGLLLWNQTRLQWVGNKRSENQSQQIREPRLRWNATYEGLLGTNRRFSQPIPLSEMID  168

Query  262  LLVDTWEEDGLY  227
             LVD WE++G+Y
Sbjct  169  FLVDVWEQEGMY  180



>ref|NP_001235913.1| uncharacterized protein LOC547651 [Glycine max]
 ref|XP_006582953.1| PREDICTED: uncharacterized protein LOC547651 isoform X1 [Glycine 
max]
 gb|AAN03467.1| hypothetical protein [Glycine max]
Length=160

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 90/130 (69%), Gaps = 2/130 (2%)
 Frame = -2

Query  610  GQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHE-EFVN  434
            G  VRK S SE FW+TST+D+++S +  Q S++S ++ N ++  ++G+  + T+  EFVN
Sbjct  30   GNGVRKPSSSEDFWTTSTHDMDNSAVQSQGSISSASLTNQAVVLHAGSSKSSTNPTEFVN  89

Query  433  QGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
             G + W Q R +W G+KK ENR + + +  L+W+A+YE    ++KPF  PIPL+EMVD L
Sbjct  90   HGVILWNQTRQRWVGNKKLENRTQQLREPKLNWNATYESLLGSNKPFHQPIPLAEMVDFL  149

Query  256  VDTWEEDGLY  227
            VD WE+DGLY
Sbjct  150  VDIWEQDGLY  159



>ref|XP_008351837.1| PREDICTED: uncharacterized protein LOC103415251 isoform X3 [Malus 
domestica]
Length=159

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 89/129 (69%), Gaps = 2/129 (2%)
 Frame = -2

Query  610  GQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQ  431
            G+ V+K SISE FW+TST+D+++S +  + S+ SI+  N +L  + G+G++ T  EFVN 
Sbjct  31   GRTVKKPSISEDFWTTSTWDMDNSAVQSKGSILSIST-NQTLDLHGGSGSSSTPAEFVNH  89

Query  430  GYLWWKQNRLQWRGSKKTEN-RRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLV  254
            G L W Q R  W G+KK+E+  + + +  L W+ASYE    ++KPFP PIPL EMVD LV
Sbjct  90   GLLLWSQTRHLWVGNKKSESPSKKIREPKLGWNASYESLLGSTKPFPQPIPLPEMVDFLV  149

Query  253  DTWEEDGLY  227
            D WE++GLY
Sbjct  150  DIWEQEGLY  158



>ref|XP_006450918.1| hypothetical protein CICLE_v10009673mg [Citrus clementina]
 ref|XP_006450919.1| hypothetical protein CICLE_v10009673mg [Citrus clementina]
 ref|XP_006475853.1| PREDICTED: uncharacterized protein LOC102606763 isoform X3 [Citrus 
sinensis]
 gb|ESR64158.1| hypothetical protein CICLE_v10009673mg [Citrus clementina]
 gb|ESR64159.1| hypothetical protein CICLE_v10009673mg [Citrus clementina]
Length=168

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 90/132 (68%), Gaps = 4/132 (3%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V+K SIS+ FWSTST DLE+S +  QRS++SI+  N +L   SGT    ++ +F
Sbjct  39   RIQGRAVKKPSISDDFWSTSTCDLENSAVQSQRSISSISTSNQTLNHCSGTS---SNSDF  95

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G + W Q R+QW GS K+ENR +  W+S   W A+YE    T  PFP PIPLSEMVD
Sbjct  96   VNHGLILWNQVRMQWIGSSKSENRTQQSWESKSSWPATYESLLGTKNPFPRPIPLSEMVD  155

Query  262  LLVDTWEEDGLY  227
            LLVD WE +GLY
Sbjct  156  LLVDVWEHEGLY  167



>ref|XP_004303311.1| PREDICTED: uncharacterized protein LOC101299394 [Fragaria vesca 
subsp. vesca]
Length=159

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 86/125 (69%), Gaps = 2/125 (2%)
 Frame = -2

Query  598  RKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYLW  419
            RK SISEGFW+TST+D+++S ++ Q S++SI+  N +L  + G+  +    EFVN G L 
Sbjct  35   RKPSISEGFWTTSTWDMDNSAVLSQGSISSIST-NQTLDPHGGSAGSSAPSEFVNHGLLL  93

Query  418  WKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWE  242
            W Q R +W GSKK E + + + +  L W+A+YE    ++KPF  PIPLSEMVD LVD WE
Sbjct  94   WNQTRQRWVGSKKPEKQPQQIREPKLSWNATYESLLGSNKPFTQPIPLSEMVDFLVDNWE  153

Query  241  EDGLY  227
            ++GLY
Sbjct  154  QEGLY  158



>ref|XP_010656432.1| PREDICTED: uncharacterized protein LOC100245670 isoform X3 [Vitis 
vinifera]
Length=174

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V+K SISE FWSTST ++++ST+  QRS++SI+  N SLT YSG G+T  + EF
Sbjct  42   RIQGRTVKKPSISEDFWSTSTCEIDNSTVQSQRSISSISTSNQSLTHYSGIGSTSNNSEF  101

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            +N G L W Q RLQW G+K++EN+ + + +  L W+A+YE    T++ F  PIPLSEM+D
Sbjct  102  INHGLLLWNQTRLQWVGNKRSENQSQQIREPRLRWNATYEGLLGTNRRFSQPIPLSEMID  161

Query  262  LLVDTWEEDGLY  227
             LVD WE++G+Y
Sbjct  162  FLVDVWEQEGMY  173



>gb|ACU19347.1| unknown [Glycine max]
Length=149

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 86/132 (65%), Gaps = 1/132 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I GQ VRK  IS+GFWS+ST DL++S I  QRS++S++  N  L    GT     + EF
Sbjct  17   RIQGQTVRKPHISDGFWSSSTCDLDNSNIQSQRSISSVSTLNQILYHSGGTSTPGANPEF  76

Query  439  VNQGYLWWKQNRLQWRGSKKT-ENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G   W ++RLQW GS K+ ++ +   +  L+W+A+YE    T +PF  PIPL+EMV+
Sbjct  77   VNPGLFLWNESRLQWVGSGKSRKHSQQKREPRLNWNATYESLLGTRQPFSKPIPLTEMVE  136

Query  262  LLVDTWEEDGLY  227
             LVD WE +G+Y
Sbjct  137  FLVDVWEREGMY  148



>ref|XP_010907273.1| PREDICTED: uncharacterized protein LOC105033975 isoform X1 [Elaeis 
guineensis]
 ref|XP_010907275.1| PREDICTED: uncharacterized protein LOC105033975 isoform X1 [Elaeis 
guineensis]
Length=177

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 93/132 (70%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G+ ++K+S+SE FWSTST+++E+S +  QRS++SI+    +L  + G  +T    EF
Sbjct  46   KIQGRTIKKTSVSEDFWSTSTHEMENSGVQSQRSISSISTSMQNLDHH-GAASTSNPSEF  104

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W Q RLQW G+++ ENR + V +  L WDA+Y+    T+KPFP PIPLSEMVD
Sbjct  105  VNHGLLLWNQTRLQWTGNRRPENRSQQVREPRLSWDATYDNLLGTNKPFPQPIPLSEMVD  164

Query  262  LLVDTWEEDGLY  227
             LVD WE++G+Y
Sbjct  165  FLVDVWEQEGMY  176



>ref|XP_002308664.1| hypothetical protein POPTR_0006s27010g [Populus trichocarpa]
 gb|EEE92187.1| hypothetical protein POPTR_0006s27010g [Populus trichocarpa]
Length=173

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 82/125 (66%), Gaps = 0/125 (0%)
 Frame = -2

Query  601  VRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYL  422
            V+ SSIS+ FWSTS  ++E+S +  Q S++SI+  N  L      G+T    EFVN+G L
Sbjct  48   VKNSSISDDFWSTSAGEMENSAVHSQGSLSSISTLNQPLDPCCNAGSTSNPPEFVNRGLL  107

Query  421  WWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWE  242
             W Q R QW G+KKT+NR  V +  + W A+YE    +++PF  P+PL+EMVD LVD WE
Sbjct  108  LWNQTRQQWLGNKKTQNRTQVREPTISWSATYESLLGSNRPFSRPVPLAEMVDFLVDVWE  167

Query  241  EDGLY  227
            ++GLY
Sbjct  168  QEGLY  172



>ref|XP_010907276.1| PREDICTED: uncharacterized protein LOC105033975 isoform X2 [Elaeis 
guineensis]
 ref|XP_010907277.1| PREDICTED: uncharacterized protein LOC105033975 isoform X2 [Elaeis 
guineensis]
Length=173

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 93/132 (70%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G+ ++K+S+SE FWSTST+++E+S +  QRS++SI+    +L  + G  +T    EF
Sbjct  42   KIQGRTIKKTSVSEDFWSTSTHEMENSGVQSQRSISSISTSMQNLDHH-GAASTSNPSEF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W Q RLQW G+++ ENR + V +  L WDA+Y+    T+KPFP PIPLSEMVD
Sbjct  101  VNHGLLLWNQTRLQWTGNRRPENRSQQVREPRLSWDATYDNLLGTNKPFPQPIPLSEMVD  160

Query  262  LLVDTWEEDGLY  227
             LVD WE++G+Y
Sbjct  161  FLVDVWEQEGMY  172



>ref|XP_006594269.1| PREDICTED: uncharacterized protein LOC100813288 isoform X1 [Glycine 
max]
Length=171

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I GQ VRK  IS+GFWS+ST DL++S I  QRS++S++  N  L    GT     + EF
Sbjct  39   RIQGQTVRKPHISDGFWSSSTCDLDNSNIQSQRSISSVSTLNQILYHSGGTSTPGANPEF  98

Query  439  VNQGYLWWKQNRLQWRGSKKT-ENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W ++RLQW GS K+ ++ +   +  L+W+A+YE    T +PF  PIPL+EMV+
Sbjct  99   VNPGLLLWNESRLQWVGSGKSRKHSQQKREPRLNWNATYESLLGTRQPFSKPIPLTEMVE  158

Query  262  LLVDTWEEDGLY  227
             LVD WE +G+Y
Sbjct  159  FLVDVWEREGMY  170



>ref|XP_007155010.1| hypothetical protein PHAVU_003G165400g [Phaseolus vulgaris]
 gb|ESW27004.1| hypothetical protein PHAVU_003G165400g [Phaseolus vulgaris]
Length=170

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 90/135 (67%), Gaps = 8/135 (6%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I GQ VRK  IS+GFWS+ST DL++  I  QRS++S++  N  L    GT +T T+ EF
Sbjct  39   RIQGQTVRKPHISDGFWSSSTCDLDNGNIQSQRSISSVSTLNQILYHSGGT-STGTNSEF  97

Query  439  VNQGYLWWKQNRLQWRGSKKT----ENRRLVWKSILDWDASYECTAETSKPFPCPIPLSE  272
            VN G L W ++RLQW GS+K+    + +R+     L+W+A+YE    T +PFP  IPLSE
Sbjct  98   VNPGLLLWNESRLQWVGSEKSSKPSQQKRV---PRLNWNATYESLLGTRQPFPKSIPLSE  154

Query  271  MVDLLVDTWEEDGLY  227
            MV+ LVD WE +G+Y
Sbjct  155  MVEFLVDVWEREGMY  169



>emb|CDP13514.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 83/131 (63%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G  V++ SI E FWS+STY++E+S    QRS++SI+  NL+L Q   + +T    EF
Sbjct  28   KIQGHRVKRPSIKEDFWSSSTYEMENSAFPSQRSVSSISTSNLTLDQQGTSSSTSNPTEF  87

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G   W Q R  W G K+++  +   +  L W+A+YE    T+KPFP PI L E+VD 
Sbjct  88   VNHGLFLWNQTRQLWIGDKESKRPKQPQEPKLGWNATYESLLGTNKPFPQPIHLPEVVDF  147

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  148  LVDIWEQEGLY  158



>ref|XP_004508489.1| PREDICTED: uncharacterized protein LOC101507961 [Cicer arietinum]
Length=170

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 91/135 (67%), Gaps = 7/135 (5%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I GQ +RK ++S+GFWS+S  DL++STI  QRS++S++  N  L Q +GT    T  EF
Sbjct  38   RIQGQTMRKPTVSDGFWSSSPCDLDNSTIQSQRSISSVSTLNQILYQSNGTSTVGTDPEF  97

Query  439  VNQGYLWWKQNRLQWRG----SKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSE  272
            VNQG L W ++RLQW G     K+++ ++   +S L+ +A+YE    T +PF  P+PLSE
Sbjct  98   VNQGLLLWNESRLQWTGRGISGKQSQEKQ---ESRLNRNATYESLLGTRQPFSKPVPLSE  154

Query  271  MVDLLVDTWEEDGLY  227
            MV+ LVD WE +G+Y
Sbjct  155  MVEFLVDVWEREGMY  169



>dbj|BAK06638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=201

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+++SEGFWSTS + + +S +  QRSM+SI+    S  Q+ G G++    EF
Sbjct  70   RIQGRSVRKTNLSEGFWSTSAHGIGNSALQSQRSMSSISTAPQSSDQH-GAGSSSNTNEF  128

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VNQG   W Q R QW G+KK+++R     +  + W+ +YE    ++KPF  PIPL+EMVD
Sbjct  129  VNQGLAQWNQTRQQWVGNKKSKSRLEKPREPKISWNTTYESLLGSNKPFYQPIPLAEMVD  188

Query  262  LLVDTWEEDGLY  227
            LLVD WE++GLY
Sbjct  189  LLVDVWEQEGLY  200



>gb|KHG19504.1| Interleukin-4 receptor subunit alpha [Gossypium arboreum]
Length=200

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 87/135 (64%), Gaps = 4/135 (3%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK SIS+ FWS+STY+LE+S +  QRS++SI+  N +L+Q S +   +   +F
Sbjct  65   RIRGRRVRKPSISDDFWSSSTYELENSALQSQRSLSSISASNPTLSQCSSSSGIVNPSDF  124

Query  439  VNQG---YLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSE  272
            VNQG    + W Q RLQW GS +  N  R   +  L  +ASYE    T  PFP PI LSE
Sbjct  125  VNQGKFCLIVWNQARLQWIGSNRPRNHTRQSRQPRLSSNASYESLLGTRNPFPRPILLSE  184

Query  271  MVDLLVDTWEEDGLY  227
            MVD LV+ WEE+GLY
Sbjct  185  MVDFLVEVWEEEGLY  199



>ref|XP_008243737.1| PREDICTED: uncharacterized protein LOC103341965 isoform X3 [Prunus 
mume]
Length=159

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 86/126 (68%), Gaps = 2/126 (2%)
 Frame = -2

Query  601  VRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYL  422
            + K SISE FW+TST+D+++S +  Q SM+SI+  N +L  + G+ +  T  EFVN G L
Sbjct  34   INKPSISEDFWTTSTWDMDNSAVQSQGSMSSIST-NQTLDPHGGSCSNTTPSEFVNHGLL  92

Query  421  WWKQNRLQWRGSKKTEN-RRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTW  245
             W Q R +W G+KK+++  + + +  L W+ASYE    ++KPFP PIPL EMVD LVD W
Sbjct  93   LWNQTRQRWVGNKKSQSPAKQIREPKLSWNASYESLLGSNKPFPQPIPLPEMVDFLVDVW  152

Query  244  EEDGLY  227
            E++GLY
Sbjct  153  EQEGLY  158



>gb|KDP33595.1| hypothetical protein JCGZ_07166 [Jatropha curcas]
Length=156

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 83/131 (63%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I  +  ++ SI + FWS+S  D++ S +  QRS +SI+  N      +  G+T    EF
Sbjct  25   RIKDERAKQHSIPDDFWSSSAGDMDYSGVQSQRSASSISALNQPFDPSANAGSTSNPSEF  84

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L WKQ R QW  +K++ N++ V +  + W+A+YE    ++KPFP PIPL+EMVD 
Sbjct  85   VNYGLLLWKQTRQQWLANKRSPNKKQVREPTIRWNATYENLLGSNKPFPRPIPLAEMVDF  144

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  145  LVDVWEQEGLY  155



>ref|XP_009376924.1| PREDICTED: uncharacterized protein LOC103965574 [Pyrus x bretschneideri]
Length=155

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 86/131 (66%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I GQ VRK+SISE FWSTST ++E++ I  Q+S++SI+  N  L  +   G+T +  EF
Sbjct  25   RIQGQSVRKNSISEDFWSTSTIEMENNGIQFQKSISSISTSN-PLDSHGTAGSTSSTPEF  83

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R  W  +K+ + +  + +  + W+A+YE    T+KPF  PIPL EM+D 
Sbjct  84   VNHGLLLWNQTRNLWLANKQPQRQTQLREPRISWNATYESLLSTNKPFRQPIPLPEMIDF  143

Query  259  LVDTWEEDGLY  227
            LVD WE+DGLY
Sbjct  144  LVDIWEQDGLY  154



>ref|XP_008243739.1| PREDICTED: uncharacterized protein LOC103341965 isoform X4 [Prunus 
mume]
Length=156

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 86/126 (68%), Gaps = 2/126 (2%)
 Frame = -2

Query  601  VRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYL  422
            + K SISE FW+TST+D+++S +  Q SM+SI+  N +L  + G+ +  T  EFVN G L
Sbjct  31   INKPSISEDFWTTSTWDMDNSAVQSQGSMSSIST-NQTLDPHGGSCSNTTPSEFVNHGLL  89

Query  421  WWKQNRLQWRGSKKTEN-RRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTW  245
             W Q R +W G+KK+++  + + +  L W+ASYE    ++KPFP PIPL EMVD LVD W
Sbjct  90   LWNQTRQRWVGNKKSQSPAKQIREPKLSWNASYESLLGSNKPFPQPIPLPEMVDFLVDVW  149

Query  244  EEDGLY  227
            E++GLY
Sbjct  150  EQEGLY  155



>gb|KHN15085.1| hypothetical protein glysoja_011703 [Glycine soja]
Length=174

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 88/137 (64%), Gaps = 6/137 (4%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I GQ VRK  IS+GFWS+ST DL++S I  QRS++S++  N  L    GT     + EF
Sbjct  37   RIQGQTVRKPHISDGFWSSSTCDLDNSNIQSQRSISSVSTSNQILYHSGGTSTPGANPEF  96

Query  439  VNQ-----GYLWWKQNRLQWRGSKKT-ENRRLVWKSILDWDASYECTAETSKPFPCPIPL  278
            VN      G L W ++RLQW GS K+ ++ +   +  L+W+A+YE    T +PFP PIPL
Sbjct  97   VNPGKFYIGLLLWNESRLQWVGSGKSRKHSQQKREPRLNWNATYESLLGTRQPFPKPIPL  156

Query  277  SEMVDLLVDTWEEDGLY  227
            SEMV+ LVD WE +G+Y
Sbjct  157  SEMVEFLVDVWEREGMY  173



>ref|XP_008805619.1| PREDICTED: uncharacterized protein LOC103718530 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008805620.1| PREDICTED: uncharacterized protein LOC103718530 isoform X1 [Phoenix 
dactylifera]
Length=177

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 92/132 (70%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G+ ++K S+S+ FWSTSTY++E+S +  QRS++SI+I   +L  + G G+T    EF
Sbjct  46   KIQGRTIKKPSVSDDFWSTSTYEMENSGVQSQRSISSISISTQNLDHH-GAGSTSNPSEF  104

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            +N G L W Q R QW G+++ E + + V +  L W+A+Y+    T+KPFP PIPLSEMVD
Sbjct  105  INHGLLLWNQTRQQWIGNRRPETQLQQVREPELSWNATYDSLLGTNKPFPQPIPLSEMVD  164

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  165  FLVDIWEQEGLY  176



>ref|XP_008805621.1| PREDICTED: uncharacterized protein LOC103718530 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008805622.1| PREDICTED: uncharacterized protein LOC103718530 isoform X3 [Phoenix 
dactylifera]
Length=173

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 92/132 (70%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G+ ++K S+S+ FWSTSTY++E+S +  QRS++SI+I   +L  + G G+T    EF
Sbjct  42   KIQGRTIKKPSVSDDFWSTSTYEMENSGVQSQRSISSISISTQNLDHH-GAGSTSNPSEF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            +N G L W Q R QW G+++ E + + V +  L W+A+Y+    T+KPFP PIPLSEMVD
Sbjct  101  INHGLLLWNQTRQQWIGNRRPETQLQQVREPELSWNATYDSLLGTNKPFPQPIPLSEMVD  160

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  161  FLVDIWEQEGLY  172



>ref|XP_008378372.1| PREDICTED: uncharacterized protein LOC103441465 isoform X1 [Malus 
domestica]
 ref|XP_008378373.1| PREDICTED: uncharacterized protein LOC103441465 isoform X1 [Malus 
domestica]
Length=158

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 86/131 (66%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I GQ VRK+SISE FWSTST ++E++ I  Q+S++SI+  N  L  +  +G+T    EF
Sbjct  28   RIQGQSVRKNSISEDFWSTSTIEMENNXIQFQKSISSISTSN-PLDSHGTSGSTSNTPEF  86

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R  W  +K+ + +  + +  + W+A+YE    T+KPF  PIPL EM+D 
Sbjct  87   VNHGLLLWNQTRNLWLANKQPQRQTQLREPRISWNATYESLLGTNKPFRQPIPLPEMIDF  146

Query  259  LVDTWEEDGLY  227
            LVD WE+DGLY
Sbjct  147  LVDIWEQDGLY  157



>ref|XP_009624285.1| PREDICTED: uncharacterized protein LOC104115374 isoform X2 [Nicotiana 
tomentosiformis]
Length=173

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 84/131 (64%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+  Q +RK+++ + FWS+S  ++E+ST    RS++SI+  N +L  +S +G T    EF
Sbjct  42   KVPSQRLRKANLRDDFWSSSAGEMENSTFPSLRSISSISTSNPALDPHSNSGTTNNTSEF  101

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW GSK ++ R  V +  L +D SYE    T+K FP  IPLSEMVD 
Sbjct  102  VNHGLLLWNQTRQQWCGSKTSQKRASVREPKLGFDTSYETLLGTNKRFPQAIPLSEMVDF  161

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  162  LVDVWEQEGLY  172



>ref|XP_007135747.1| hypothetical protein PHAVU_010G155200g [Phaseolus vulgaris]
 gb|ESW07741.1| hypothetical protein PHAVU_010G155200g [Phaseolus vulgaris]
Length=160

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = -2

Query  610  GQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQY-SGTGNTITHEEFVN  434
            G  VRK S SE FW+TST+D+++S +  Q S++S ++ N ++  + S + N+    EFVN
Sbjct  30   GSSVRKLSSSEDFWTTSTHDMDNSAVQSQGSISSASLTNQAVVPHASSSKNSTNPTEFVN  89

Query  433  QGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
             G + W Q R +W G+KK+ENR + + +  L W+A+YE    ++KPF  PIPL+EMVD L
Sbjct  90   HGLILWNQTRQRWVGNKKSENRTQQLREPKLSWNATYESLLGSNKPFRQPIPLAEMVDFL  149

Query  256  VDTWEEDGLY  227
            VD WE+DGLY
Sbjct  150  VDIWEQDGLY  159



>ref|XP_002515517.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46966.1| conserved hypothetical protein [Ricinus communis]
Length=173

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 81/127 (64%), Gaps = 0/127 (0%)
 Frame = -2

Query  607  QLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQG  428
            Q  ++  IS+ FWSTS  +++ S +  QRS++SI+  N     Y+  G+T    EFVN G
Sbjct  46   QTAKQLGISDDFWSTSAGEMDYSGVQSQRSVSSISTLNQPFDPYTNAGSTSNPSEFVNHG  105

Query  427  YLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDT  248
             L WKQ R QW  +KK+ N+  V +  L W+A+YE    T+KPFP  IPL+EMVD LVD 
Sbjct  106  LLLWKQTRQQWLANKKSPNKTQVREPTLSWNATYENLLGTNKPFPRRIPLAEMVDFLVDV  165

Query  247  WEEDGLY  227
            WE++GLY
Sbjct  166  WEQEGLY  172



>ref|XP_006584501.1| PREDICTED: uncharacterized protein LOC100499770 isoform X1 [Glycine 
max]
Length=160

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 89/128 (70%), Gaps = 2/128 (2%)
 Frame = -2

Query  604  LVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHE-EFVNQG  428
            +VRK S SE FW+TST+D+++S +  Q S++S ++ N ++  ++G+  + T+  EFVN G
Sbjct  32   VVRKPSSSEDFWTTSTHDMDNSAVQSQGSISSASLTNQAVVSHAGSSKSSTNPTEFVNHG  91

Query  427  YLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVD  251
             + W Q R +W G+KK EN+ + + +  L W+A+YE    ++KPF  PIPL+EMVD LVD
Sbjct  92   VILWNQTRQRWVGNKKPENQTQQLQEPKLSWNATYESLLGSNKPFRQPIPLAEMVDFLVD  151

Query  250  TWEEDGLY  227
             WE+DGLY
Sbjct  152  IWEQDGLY  159



>ref|XP_003604392.1| hypothetical protein MTR_4g010330 [Medicago truncatula]
 gb|AFK36342.1| unknown [Medicago truncatula]
Length=156

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 87/130 (67%), Gaps = 3/130 (2%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVN  434
             G+ V K S SE FW+TST+D+++S +  Q S++S ++ N ++  ++ + N  +  EFVN
Sbjct  28   QGKAVDKPSTSEDFWTTSTHDMDNSAVQSQGSISSTSLTNQAVAAHASSSNNPS--EFVN  85

Query  433  QGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
             G + W Q R +W G+KK ENR + + +  L W+A+YE    ++KPF  PIPL+EMVD L
Sbjct  86   HGLILWNQTRQRWVGNKKPENRTQQLREPKLSWNATYESLLTSNKPFRQPIPLAEMVDFL  145

Query  256  VDTWEEDGLY  227
            VD WE+DGLY
Sbjct  146  VDIWEQDGLY  155



>ref|XP_009409322.1| PREDICTED: uncharacterized protein LOC103991554 [Musa acuminata 
subsp. malaccensis]
Length=160

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G+ V+K + SE FWSTSTY++E+S +  Q+S++SI+    +L  + G G+T  H EF
Sbjct  28   KIQGRTVKKPNFSEEFWSTSTYEMENSGVQSQKSISSISTLVNTLDHHGGIGSTSNHPEF  87

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W Q R +W G+K+ E + + V +  L W+A+Y+    ++KPFP PIPL+EMVD
Sbjct  88   VNHGLLLWNQTRQKWVGNKRPETQSQQVREPRLSWNATYDGLLGSNKPFPQPIPLAEMVD  147

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  148  FLVDIWEQEGLY  159



>ref|XP_006371740.1| hypothetical protein POPTR_0018s01700g [Populus trichocarpa]
 gb|ERP49537.1| hypothetical protein POPTR_0018s01700g [Populus trichocarpa]
Length=158

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = -2

Query  574  FWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYLWWKQNRLQW  395
            FWSTS  D+E+ST+  Q S++SI+  N  L   S  G+T    EFVN+G L W Q R QW
Sbjct  43   FWSTSAGDMENSTMHSQGSLSSISTLNQQLDP-SNAGSTSNSSEFVNRGLLLWNQTRQQW  101

Query  394  RGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWEEDGLY  227
             G+KKT+NR+ V +  + W+A+YE    ++KPF  P+PL+EMVD LVD WE++GLY
Sbjct  102  LGNKKTQNRKQVREPTISWNATYESLLGSNKPFARPVPLAEMVDFLVDVWEQEGLY  157



>ref|XP_007135748.1| hypothetical protein PHAVU_010G155200g, partial [Phaseolus vulgaris]
 gb|ESW07742.1| hypothetical protein PHAVU_010G155200g, partial [Phaseolus vulgaris]
Length=192

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = -2

Query  610  GQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQY-SGTGNTITHEEFVN  434
            G  VRK S SE FW+TST+D+++S +  Q S++S ++ N ++  + S + N+    EFVN
Sbjct  62   GSSVRKLSSSEDFWTTSTHDMDNSAVQSQGSISSASLTNQAVVPHASSSKNSTNPTEFVN  121

Query  433  QGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
             G + W Q R +W G+KK+ENR + + +  L W+A+YE    ++KPF  PIPL+EMVD L
Sbjct  122  HGLILWNQTRQRWVGNKKSENRTQQLREPKLSWNATYESLLGSNKPFRQPIPLAEMVDFL  181

Query  256  VDTWEEDGLY  227
            VD WE+DGLY
Sbjct  182  VDIWEQDGLY  191



>gb|KDP32416.1| hypothetical protein JCGZ_13341 [Jatropha curcas]
Length=173

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V+K SIS+ FWSTST DLE+S I  QRS++SI++ N++L   +G G   ++ +F
Sbjct  43   RIQGRAVKKPSISDDFWSTSTCDLENSAIQSQRSISSISVSNVNLK--NGVGAVSSNSDF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W+Q RLQW GS  + N+ R   +S L+W+A+YE    +  PFP PIPLSEM+D
Sbjct  101  VNHGLLRWQQTRLQWIGSNTSTNQTRRKLESRLNWNATYEGLLGSRNPFPRPIPLSEMID  160

Query  262  LLVDTWEEDGLY  227
             L D WE++GLY
Sbjct  161  FLADVWEQEGLY  172



>ref|XP_004291458.1| PREDICTED: uncharacterized protein LOC101311349 [Fragaria vesca 
subsp. vesca]
Length=153

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I GQ +RK+SISE FWSTST D+++S I+ Q S+TS    N  L  + G  +T    EF
Sbjct  27   RIQGQPLRKNSISEDFWSTSTIDMDNSAILSQISITS----NNPLDAH-GASSTSNTSEF  81

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW G+KK++ R  + +  + W+A+Y+    T+K F  PIPL EM+D 
Sbjct  82   VNHGLLLWNQTRQQWVGNKKSQPRTQLREPTISWNATYDSLLSTNKRFQRPIPLPEMIDF  141

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  142  LVDIWEQEGLY  152



>gb|EYU23012.1| hypothetical protein MIMGU_mgv1a015050mg [Erythranthe guttata]
Length=169

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 87/132 (66%), Gaps = 6/132 (5%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLE-SSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEE  443
            +I GQ V KS +S+ FWSTST DLE + ++  QRS +SIT+ N +L    G      H E
Sbjct  42   RIQGQAV-KSGLSDDFWSTSTCDLEYNPSMQSQRSFSSITVSNQNL----GITTASNHPE  96

Query  442  FVNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            FV+ G   W Q+RLQW G+KK + +  V + +L+W+A+YE    TSK F  P+PLSEMVD
Sbjct  97   FVDHGLRLWNQSRLQWCGNKKPQKKGKVQEPVLNWNANYENLLGTSKRFAEPVPLSEMVD  156

Query  262  LLVDTWEEDGLY  227
             LVD W+++GLY
Sbjct  157  FLVDIWDQEGLY  168



>gb|AFK45269.1| unknown [Medicago truncatula]
Length=172

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 88/133 (66%), Gaps = 3/133 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I GQ +RK + S+GFWS+S  DL++STI  QRS++S++  N  L Q +G     T  EF
Sbjct  40   RIQGQTMRKPTTSDGFWSSSPCDLDNSTIQSQRSISSVSTLNQILYQSNGASTPGTEPEF  99

Query  439  VNQGYLWWKQNRLQW--RGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMV  266
            VNQG   W +NRLQW  RG  + +N++   +S L+ +A+YE    T +PFP  +PLSEMV
Sbjct  100  VNQGLHLWNENRLQWVGRGLSEKQNQQ-KQESRLNRNATYESLLGTRQPFPKSVPLSEMV  158

Query  265  DLLVDTWEEDGLY  227
            + LVD WE +G+Y
Sbjct  159  EFLVDVWEREGMY  171



>ref|XP_008461114.1| PREDICTED: uncharacterized protein LOC103499796 isoform X3 [Cucumis 
melo]
Length=157

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 84/132 (64%), Gaps = 3/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            + HG  VRK S+SE FW+TST+D+E+S    Q SM+S++  N     +  +GN     EF
Sbjct  27   QCHG--VRKPSLSEDFWTTSTFDVENSAGQSQGSMSSLSTINHMHDPHGSSGNVPNPSEF  84

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSI-LDWDASYECTAETSKPFPCPIPLSEMVD  263
            +N G L W Q R +W G+K++E R   ++   LDW+ +YE    ++KPF  PIPL EMVD
Sbjct  85   LNHGLLLWNQTRQRWTGNKQSEKRAPQFQEPKLDWNVTYESLLGSNKPFRQPIPLGEMVD  144

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  145  FLVDVWEQEGLY  156



>ref|XP_009624284.1| PREDICTED: uncharacterized protein LOC104115374 isoform X1 [Nicotiana 
tomentosiformis]
Length=205

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 84/131 (64%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+  Q +RK+++ + FWS+S  ++E+ST    RS++SI+  N +L  +S +G T    EF
Sbjct  74   KVPSQRLRKANLRDDFWSSSAGEMENSTFPSLRSISSISTSNPALDPHSNSGTTNNTSEF  133

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW GSK ++ R  V +  L +D SYE    T+K FP  IPLSEMVD 
Sbjct  134  VNHGLLLWNQTRQQWCGSKTSQKRASVREPKLGFDTSYETLLGTNKRFPQAIPLSEMVDF  193

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  194  LVDVWEQEGLY  204



>ref|XP_002299754.1| hypothetical protein POPTR_0001s19330g [Populus trichocarpa]
 gb|ABK94402.1| unknown [Populus trichocarpa]
 gb|EEE84559.1| hypothetical protein POPTR_0001s19330g [Populus trichocarpa]
Length=160

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+  + V+K SISE FW+TST D++ S +  Q S++SI+I N +L Q+ G+G+     EF
Sbjct  28   KVKCETVKKPSISEDFWTTSTCDMDYSAVQSQGSISSISIANQTLDQHGGSGSINNVSEF  87

Query  439  VNQGYLWWKQNRLQWRGSKKTEN-RRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W Q R  W G+K++ N  +L  +  L+W+A+YE    ++KPFP PIPL+EMVD
Sbjct  88   VNHGLLLWNQTRHCWVGNKRSGNEEQLPQEPKLNWNATYESLLGSNKPFPQPIPLTEMVD  147

Query  262  LLVDTWEEDGLY  227
             LVD WE++G+Y
Sbjct  148  FLVDIWEQEGMY  159



>gb|EPS58050.1| hypothetical protein M569_16767 [Genlisea aurea]
Length=175

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 85/132 (64%), Gaps = 1/132 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSL-TQYSGTGNTITHEE  443
            KI GQ V+K S +E FWSTS+ +L++S     RSM+SI+  N +   Q + TG+T    E
Sbjct  43   KIQGQRVKKHSFTEDFWSTSSGNLDNSAFQSHRSMSSISTTNQNPDPQAAATGSTSNPSE  102

Query  442  FVNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            +VN G L W Q R QW G++ ++ R    +  + W+A+YE    ++KPF  PIPL+EMV+
Sbjct  103  YVNHGLLLWNQTRQQWVGTRGSQPRVQSQEPKISWNATYESLLGSNKPFAQPIPLAEMVE  162

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  163  FLVDVWEQEGLY  174



>ref|XP_006427272.1| hypothetical protein CICLE_v10026612mg [Citrus clementina]
 ref|XP_006465335.1| PREDICTED: uncharacterized protein LOC102625001 isoform X2 [Citrus 
sinensis]
 ref|XP_006465336.1| PREDICTED: uncharacterized protein LOC102625001 isoform X3 [Citrus 
sinensis]
 gb|ESR40512.1| hypothetical protein CICLE_v10026612mg [Citrus clementina]
Length=171

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 87/148 (59%), Gaps = 15/148 (10%)
 Frame = -2

Query  625  ESKIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHE  446
            E  + G+   K SISE FW+TST D+++S +  Q S++S+   NL      G+G+     
Sbjct  23   ELGVPGRSAGKRSISEDFWTTSTCDMDNSAVQSQGSISSLGTNNLIPDTNGGSGSASAPS  82

Query  445  EFVNQGYLWWKQNRLQWRGSKKTENRR--------------LVWKS-ILDWDASYECTAE  311
            EFVN G+L W Q R +W G+KK ENR               LV K  +  W+A+YE    
Sbjct  83   EFVNHGFLLWNQTRQRWIGNKKAENRTHQVREPKLNTHCLCLVKKFWLCSWNATYESLLG  142

Query  310  TSKPFPCPIPLSEMVDLLVDTWEEDGLY  227
            ++KPFP PIPLSEMVD LVD WE++G+Y
Sbjct  143  SNKPFPQPIPLSEMVDFLVDIWEQEGMY  170



>ref|XP_006427273.1| hypothetical protein CICLE_v10026612mg [Citrus clementina]
 ref|XP_006465334.1| PREDICTED: uncharacterized protein LOC102625001 isoform X1 [Citrus 
sinensis]
 gb|ESR40513.1| hypothetical protein CICLE_v10026612mg [Citrus clementina]
 gb|KDO48565.1| hypothetical protein CISIN_1g030349mg [Citrus sinensis]
Length=174

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 87/148 (59%), Gaps = 15/148 (10%)
 Frame = -2

Query  625  ESKIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHE  446
            E  + G+   K SISE FW+TST D+++S +  Q S++S+   NL      G+G+     
Sbjct  26   ELGVPGRSAGKRSISEDFWTTSTCDMDNSAVQSQGSISSLGTNNLIPDTNGGSGSASAPS  85

Query  445  EFVNQGYLWWKQNRLQWRGSKKTENRR--------------LVWKS-ILDWDASYECTAE  311
            EFVN G+L W Q R +W G+KK ENR               LV K  +  W+A+YE    
Sbjct  86   EFVNHGFLLWNQTRQRWIGNKKAENRTHQVREPKLNTHCLCLVKKFWLCSWNATYESLLG  145

Query  310  TSKPFPCPIPLSEMVDLLVDTWEEDGLY  227
            ++KPFP PIPLSEMVD LVD WE++G+Y
Sbjct  146  SNKPFPQPIPLSEMVDFLVDIWEQEGMY  173



>ref|XP_008792026.1| PREDICTED: uncharacterized protein LOC103708743 isoform X1 [Phoenix 
dactylifera]
Length=177

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 91/132 (69%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G+ ++K+S+SE FWSTST+++E+S +  QRS++SI+    +L  + G G+     EF
Sbjct  46   KIQGRTIKKTSVSEDFWSTSTHEMENSGVQSQRSISSISTSVQNLDHH-GAGSASNASEF  104

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W Q R QW G+++ E R + V +  L WDA+Y+    T+KPFP PIPLSEMVD
Sbjct  105  VNHGLLLWNQTRQQWTGNRRPETRPQQVREPRLSWDATYDNLLGTNKPFPQPIPLSEMVD  164

Query  262  LLVDTWEEDGLY  227
             LVD WE++G+Y
Sbjct  165  FLVDVWEQEGMY  176



>ref|XP_008394089.1| PREDICTED: uncharacterized protein LOC103456203 isoform X5 [Malus 
domestica]
Length=158

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+SISE FWSTST ++E+S +  Q+S++S++  N  L  +S + +T     F
Sbjct  28   RIQGRSVRKNSISEDFWSTSTTEMENSGVQSQKSISSVSTSN-PLDSHSTSASTSNTTAF  86

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  +K+ + ++ + +  + W+A+YE    T+KPFP PIPL EMVD 
Sbjct  87   VNHGLLLWNQTRNQWLANKRPQRQKQLREPRISWNATYESLLSTNKPFPQPIPLPEMVDF  146

Query  259  LVDTWEEDGLY  227
            LV+ WE++GLY
Sbjct  147  LVNIWEQEGLY  157



>ref|XP_008461113.1| PREDICTED: uncharacterized protein LOC103499796 isoform X2 [Cucumis 
melo]
Length=168

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 84/132 (64%), Gaps = 3/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            + HG  VRK S+SE FW+TST+D+E+S    Q SM+S++  N     +  +GN     EF
Sbjct  38   QCHG--VRKPSLSEDFWTTSTFDVENSAGQSQGSMSSLSTINHMHDPHGSSGNVPNPSEF  95

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSI-LDWDASYECTAETSKPFPCPIPLSEMVD  263
            +N G L W Q R +W G+K++E R   ++   LDW+ +YE    ++KPF  PIPL EMVD
Sbjct  96   LNHGLLLWNQTRQRWTGNKQSEKRAPQFQEPKLDWNVTYESLLGSNKPFRQPIPLGEMVD  155

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  156  FLVDVWEQEGLY  167



>ref|XP_004506943.1| PREDICTED: uncharacterized protein LOC101492460 isoform X4 [Cicer 
arietinum]
Length=138

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 85/130 (65%), Gaps = 3/130 (2%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVN  434
             G  V K S SE FW+TST+D+++S +  Q S++S ++ N ++  +  + N  T  EFVN
Sbjct  10   QGTAVDKPSTSEDFWTTSTHDMDNSAVQSQGSISSTSLTNQAVAPHGSSSNNPT--EFVN  67

Query  433  QGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
             G + W Q R +W G+KK+EN+ +   +  L W+A+YE    ++KPF  PIPL+EMVD L
Sbjct  68   HGLILWNQTRQRWVGNKKSENQTKQPREPKLSWNATYESLLTSNKPFRQPIPLTEMVDFL  127

Query  256  VDTWEEDGLY  227
            VD WE+DGLY
Sbjct  128  VDIWEQDGLY  137



>ref|XP_009355740.1| PREDICTED: uncharacterized protein LOC103946700 isoform X4 [Pyrus 
x bretschneideri]
Length=160

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 86/131 (66%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+SISE FWSTST ++E S +  Q+S++S++  N  L  +S + +      F
Sbjct  30   RIQGRSVRKNSISEDFWSTSTTEMEDSGVQSQKSISSVSTSN-PLDSHSTSSSISNTTAF  88

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  +K+ + ++ + +  + W+A+YE    T+KPFP PIPL EMVD 
Sbjct  89   VNHGLLLWNQTRNQWLANKQPQRQKQLREPRISWNATYESLLSTNKPFPQPIPLPEMVDF  148

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  149  LVDIWEQEGLY  159



>ref|XP_006450922.1| hypothetical protein CICLE_v10009673mg [Citrus clementina]
 ref|XP_006475852.1| PREDICTED: uncharacterized protein LOC102606763 isoform X2 [Citrus 
sinensis]
 gb|ESR64162.1| hypothetical protein CICLE_v10009673mg [Citrus clementina]
Length=169

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 90/133 (68%), Gaps = 5/133 (4%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V+K SIS+ FWSTST DLE+S +  QRS++SI+  N +L   SGT    ++ +F
Sbjct  39   RIQGRAVKKPSISDDFWSTSTCDLENSAVQSQRSISSISTSNQTLNHCSGTS---SNSDF  95

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKS-ILDWDASYECTAETSKPFPCPIPLSEMV  266
            VN G + W Q R+QW GS K+ENR +  W+S    W A+YE    T  PFP PIPLSEMV
Sbjct  96   VNHGLILWNQVRMQWIGSSKSENRTQQSWESKSSSWPATYESLLGTKNPFPRPIPLSEMV  155

Query  265  DLLVDTWEEDGLY  227
            DLLVD WE +GLY
Sbjct  156  DLLVDVWEHEGLY  168



>gb|KDO48569.1| hypothetical protein CISIN_1g030349mg [Citrus sinensis]
Length=179

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 87/148 (59%), Gaps = 15/148 (10%)
 Frame = -2

Query  625  ESKIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHE  446
            E  + G+   K SISE FW+TST D+++S +  Q S++S+   NL      G+G+     
Sbjct  31   ELGVPGRSAGKRSISEDFWTTSTCDMDNSAVQSQGSISSLGTNNLIPDTNGGSGSASAPS  90

Query  445  EFVNQGYLWWKQNRLQWRGSKKTENRR--------------LVWKS-ILDWDASYECTAE  311
            EFVN G+L W Q R +W G+KK ENR               LV K  +  W+A+YE    
Sbjct  91   EFVNHGFLLWNQTRQRWIGNKKAENRTHQVREPKLNTHCLCLVKKFWLCSWNATYESLLG  150

Query  310  TSKPFPCPIPLSEMVDLLVDTWEEDGLY  227
            ++KPFP PIPLSEMVD LVD WE++G+Y
Sbjct  151  SNKPFPQPIPLSEMVDFLVDIWEQEGMY  178



>ref|XP_010696285.1| PREDICTED: uncharacterized protein LOC104908799 isoform X5 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010696288.1| PREDICTED: uncharacterized protein LOC104908799 isoform X5 [Beta 
vulgaris subsp. vulgaris]
Length=159

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G+ V+KSS+++  WS+STY++++S +  QRS++SI+  N +L  + G+G+     E+
Sbjct  28   KIQGRAVKKSSLTQDIWSSSTYEMDNSAVQSQRSISSISASNQNLDPHGGSGSASNPSEY  87

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW G +K  N+  + +  L W+A+YE    T+KPFP PIPL EMVD 
Sbjct  88   VNNGLLLWNQIRQQWVGDRKPCNQPKMREPRLSWNATYENLLGTNKPFPQPIPLPEMVDF  147

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  148  LVDVWEQEGLY  158



>ref|XP_010696294.1| PREDICTED: uncharacterized protein LOC104908799 isoform X6 [Beta 
vulgaris subsp. vulgaris]
Length=156

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G+ V+KSS+++  WS+STY++++S +  QRS++SI+  N +L  + G+G+     E+
Sbjct  25   KIQGRAVKKSSLTQDIWSSSTYEMDNSAVQSQRSISSISASNQNLDPHGGSGSASNPSEY  84

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW G +K  N+  + +  L W+A+YE    T+KPFP PIPL EMVD 
Sbjct  85   VNNGLLLWNQIRQQWVGDRKPCNQPKMREPRLSWNATYENLLGTNKPFPQPIPLPEMVDF  144

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  145  LVDVWEQEGLY  155



>ref|XP_009355741.1| PREDICTED: uncharacterized protein LOC103946700 isoform X5 [Pyrus 
x bretschneideri]
Length=158

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 86/131 (66%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+SISE FWSTST ++E S +  Q+S++S++  N  L  +S + +      F
Sbjct  28   RIQGRSVRKNSISEDFWSTSTTEMEDSGVQSQKSISSVSTSN-PLDSHSTSSSISNTTAF  86

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  +K+ + ++ + +  + W+A+YE    T+KPFP PIPL EMVD 
Sbjct  87   VNHGLLLWNQTRNQWLANKQPQRQKQLREPRISWNATYESLLSTNKPFPQPIPLPEMVDF  146

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  147  LVDIWEQEGLY  157



>ref|XP_008394088.1| PREDICTED: uncharacterized protein LOC103456203 isoform X4 [Malus 
domestica]
Length=161

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+SISE FWSTST ++E+S +  Q+S++S++  N  L  +S + +T     F
Sbjct  31   RIQGRSVRKNSISEDFWSTSTTEMENSGVQSQKSISSVSTSN-PLDSHSTSASTSNTTAF  89

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  +K+ + ++ + +  + W+A+YE    T+KPFP PIPL EMVD 
Sbjct  90   VNHGLLLWNQTRNQWLANKRPQRQKQLREPRISWNATYESLLSTNKPFPQPIPLPEMVDF  149

Query  259  LVDTWEEDGLY  227
            LV+ WE++GLY
Sbjct  150  LVNIWEQEGLY  160



>ref|XP_004150590.1| PREDICTED: uncharacterized protein LOC101203426 [Cucumis sativus]
 ref|XP_004168824.1| PREDICTED: uncharacterized LOC101203426 [Cucumis sativus]
Length=177

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 92/134 (69%), Gaps = 3/134 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G++V+K SIS+GFWSTST DL++STI  QRS++SI+  NL+L+  +  G+  +  EF
Sbjct  43   RIQGRVVKKPSISDGFWSTSTCDLDNSTIQSQRSISSISTSNLTLSHSNVAGSVSSSSEF  102

Query  439  VNQGYLWWKQNRLQWRGS---KKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEM  269
            VN G L W Q R+QW GS   K T+      K+ + W A+Y+    T +PFP PIPLSEM
Sbjct  103  VNHGLLLWNQTRMQWIGSGTTKTTDETEQRQKAKISWRATYDSLLGTRQPFPHPIPLSEM  162

Query  268  VDLLVDTWEEDGLY  227
            V+ LV+ WE++GLY
Sbjct  163  VNFLVEVWEQEGLY  176



>ref|XP_010033962.1| PREDICTED: uncharacterized protein LOC104423178 isoform X2 [Eucalyptus 
grandis]
 gb|KCW53823.1| hypothetical protein EUGRSUZ_J03063 [Eucalyptus grandis]
 gb|KCW53824.1| hypothetical protein EUGRSUZ_J03063 [Eucalyptus grandis]
Length=153

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = -2

Query  622  SKIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEE  443
            S+IH   ++K S SE FWS+ST+D+++S    Q S++SI+  N ++   +G  N  T  E
Sbjct  23   SEIHDHKLKKPSKSEDFWSSSTFDMDNSAAQSQGSISSISTSNPTIDPQAG--NPGTPSE  80

Query  442  FVNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            FVN G + W QNR +WR +K++EN+    +  L+W A+Y+    + KPFP PIPLSEMVD
Sbjct  81   FVNHGLILWNQNRQRWRSNKRSENQTQQVQPKLNWSATYDNLLGSDKPFPHPIPLSEMVD  140

Query  262  LLVDTWEEDGLY  227
             LVDTWE++GLY
Sbjct  141  FLVDTWEQEGLY  152



>ref|XP_010696279.1| PREDICTED: uncharacterized protein LOC104908799 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=162

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G+ V+KSS+++  WS+STY++++S +  QRS++SI+  N +L  + G+G+     E+
Sbjct  31   KIQGRAVKKSSLTQDIWSSSTYEMDNSAVQSQRSISSISASNQNLDPHGGSGSASNPSEY  90

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW G +K  N+  + +  L W+A+YE    T+KPFP PIPL EMVD 
Sbjct  91   VNNGLLLWNQIRQQWVGDRKPCNQPKMREPRLSWNATYENLLGTNKPFPQPIPLPEMVDF  150

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  151  LVDVWEQEGLY  161



>ref|XP_006371742.1| hypothetical protein POPTR_0018s01700g [Populus trichocarpa]
 gb|ERP49539.1| hypothetical protein POPTR_0018s01700g [Populus trichocarpa]
Length=173

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = -2

Query  574  FWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYLWWKQNRLQW  395
            FWSTS  D+E+ST+  Q S++SI+  N  L   S  G+T    EFVN+G L W Q R QW
Sbjct  58   FWSTSAGDMENSTMHSQGSLSSISTLNQQLDP-SNAGSTSNSSEFVNRGLLLWNQTRQQW  116

Query  394  RGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWEEDGLY  227
             G+KKT+NR+ V +  + W+A+YE    ++KPF  P+PL+EMVD LVD WE++GLY
Sbjct  117  LGNKKTQNRKQVREPTISWNATYESLLGSNKPFARPVPLAEMVDFLVDVWEQEGLY  172



>ref|XP_008461112.1| PREDICTED: uncharacterized protein LOC103499796 isoform X1 [Cucumis 
melo]
Length=176

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 84/132 (64%), Gaps = 3/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            + HG  VRK S+SE FW+TST+D+E+S    Q SM+S++  N     +  +GN     EF
Sbjct  46   QCHG--VRKPSLSEDFWTTSTFDVENSAGQSQGSMSSLSTINHMHDPHGSSGNVPNPSEF  103

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSI-LDWDASYECTAETSKPFPCPIPLSEMVD  263
            +N G L W Q R +W G+K++E R   ++   LDW+ +YE    ++KPF  PIPL EMVD
Sbjct  104  LNHGLLLWNQTRQRWTGNKQSEKRAPQFQEPKLDWNVTYESLLGSNKPFRQPIPLGEMVD  163

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  164  FLVDVWEQEGLY  175



>ref|XP_006371741.1| hypothetical protein POPTR_0018s01700g [Populus trichocarpa]
 gb|ABK93715.1| unknown [Populus trichocarpa]
 gb|ERP49538.1| hypothetical protein POPTR_0018s01700g [Populus trichocarpa]
Length=172

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = -2

Query  574  FWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYLWWKQNRLQW  395
            FWSTS  D+E+ST+  Q S++SI+  N  L   S  G+T    EFVN+G L W Q R QW
Sbjct  57   FWSTSAGDMENSTMHSQGSLSSISTLNQQLDP-SNAGSTSNSSEFVNRGLLLWNQTRQQW  115

Query  394  RGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWEEDGLY  227
             G+KKT+NR+ V +  + W+A+YE    ++KPF  P+PL+EMVD LVD WE++GLY
Sbjct  116  LGNKKTQNRKQVREPTISWNATYESLLGSNKPFARPVPLAEMVDFLVDVWEQEGLY  171



>ref|XP_010033961.1| PREDICTED: uncharacterized protein LOC104423178 isoform X1 [Eucalyptus 
grandis]
 gb|KCW53822.1| hypothetical protein EUGRSUZ_J03063 [Eucalyptus grandis]
Length=160

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = -2

Query  622  SKIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEE  443
            S+IH   ++K S SE FWS+ST+D+++S    Q S++SI+  N ++   +G  N  T  E
Sbjct  30   SEIHDHKLKKPSKSEDFWSSSTFDMDNSAAQSQGSISSISTSNPTIDPQAG--NPGTPSE  87

Query  442  FVNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            FVN G + W QNR +WR +K++EN+    +  L+W A+Y+    + KPFP PIPLSEMVD
Sbjct  88   FVNHGLILWNQNRQRWRSNKRSENQTQQVQPKLNWSATYDNLLGSDKPFPHPIPLSEMVD  147

Query  262  LLVDTWEEDGLY  227
             LVDTWE++GLY
Sbjct  148  FLVDTWEQEGLY  159



>ref|XP_009355739.1| PREDICTED: uncharacterized protein LOC103946700 isoform X3 [Pyrus 
x bretschneideri]
Length=161

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 86/131 (66%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+SISE FWSTST ++E S +  Q+S++S++  N  L  +S + +      F
Sbjct  31   RIQGRSVRKNSISEDFWSTSTTEMEDSGVQSQKSISSVSTSN-PLDSHSTSSSISNTTAF  89

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  +K+ + ++ + +  + W+A+YE    T+KPFP PIPL EMVD 
Sbjct  90   VNHGLLLWNQTRNQWLANKQPQRQKQLREPRISWNATYESLLSTNKPFPQPIPLPEMVDF  149

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  150  LVDIWEQEGLY  160



>ref|XP_008792027.1| PREDICTED: uncharacterized protein LOC103708743 isoform X2 [Phoenix 
dactylifera]
Length=173

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 91/132 (69%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G+ ++K+S+SE FWSTST+++E+S +  QRS++SI+    +L  + G G+     EF
Sbjct  42   KIQGRTIKKTSVSEDFWSTSTHEMENSGVQSQRSISSISTSVQNLDHH-GAGSASNASEF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W Q R QW G+++ E R + V +  L WDA+Y+    T+KPFP PIPLSEMVD
Sbjct  101  VNHGLLLWNQTRQQWTGNRRPETRPQQVREPRLSWDATYDNLLGTNKPFPQPIPLSEMVD  160

Query  262  LLVDTWEEDGLY  227
             LVD WE++G+Y
Sbjct  161  FLVDVWEQEGMY  172



>ref|XP_010696274.1| PREDICTED: uncharacterized protein LOC104908799 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=172

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G+ V+KSS+++  WS+STY++++S +  QRS++SI+  N +L  + G+G+     E+
Sbjct  41   KIQGRAVKKSSLTQDIWSSSTYEMDNSAVQSQRSISSISASNQNLDPHGGSGSASNPSEY  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW G +K  N+  + +  L W+A+YE    T+KPFP PIPL EMVD 
Sbjct  101  VNNGLLLWNQIRQQWVGDRKPCNQPKMREPRLSWNATYENLLGTNKPFPQPIPLPEMVDF  160

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  161  LVDVWEQEGLY  171



>gb|AFK46980.1| unknown [Lotus japonicus]
Length=159

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 84/130 (65%), Gaps = 1/130 (1%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVN  434
             G+ V+K S SE FW+TST+D+++S +  Q S++S ++ N ++  +  +  +    EFVN
Sbjct  29   QGEAVKKHSTSEDFWTTSTHDMDNSAVQSQGSISSASVTNQAVVPHGVSSKSSNPTEFVN  88

Query  433  QGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
            QG   W Q R +W G KK E R + + +  L W+A+YE    ++KPF  PIPL+EMVD L
Sbjct  89   QGLNLWNQTRQRWVGPKKPETRTQQLREPKLSWNATYESLLGSNKPFRQPIPLAEMVDFL  148

Query  256  VDTWEEDGLY  227
            VD WE+DGLY
Sbjct  149  VDIWEQDGLY  158



>gb|ABD96083.1| hypothetical protein [Nicotiana tabacum]
Length=158

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+ G+ +RK S  + FWS+S  ++E+S    QRS++SI+  N  L  +S +  T  + EF
Sbjct  27   KVQGKHLRKRSSRDDFWSSSACEMENSAFPSQRSISSISTSNQGLDPHSSSSTTNNNAEF  86

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G + W + R +W GS+  + R    +  L + ASYE    T+KPFP  IPLSEMVD 
Sbjct  87   VNHGLILWSKTRQEWIGSRTPQKRTAAREPKLSFGASYETLLGTNKPFPQSIPLSEMVDF  146

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  147  LVDVWEQEGLY  157



>ref|XP_006450921.1| hypothetical protein CICLE_v10009673mg [Citrus clementina]
 ref|XP_006475851.1| PREDICTED: uncharacterized protein LOC102606763 isoform X1 [Citrus 
sinensis]
 gb|ESR64161.1| hypothetical protein CICLE_v10009673mg [Citrus clementina]
Length=177

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 90/141 (64%), Gaps = 13/141 (9%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V+K SIS+ FWSTST DLE+S +  QRS++SI+  N +L   SGT    ++ +F
Sbjct  39   RIQGRAVKKPSISDDFWSTSTCDLENSAVQSQRSISSISTSNQTLNHCSGTS---SNSDF  95

Query  439  VNQGYLWWKQNRLQWRGSKKTENRR----------LVWKSILDWDASYECTAETSKPFPC  290
            VN G + W Q R+QW GS K+ENR           L + ++  W A+YE    T  PFP 
Sbjct  96   VNHGLILWNQVRMQWIGSSKSENRTQQSWESKSSTLDFLALSSWPATYESLLGTKNPFPR  155

Query  289  PIPLSEMVDLLVDTWEEDGLY  227
            PIPLSEMVDLLVD WE +GLY
Sbjct  156  PIPLSEMVDLLVDVWEHEGLY  176



>ref|XP_008394087.1| PREDICTED: uncharacterized protein LOC103456203 isoform X3 [Malus 
domestica]
Length=172

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+SISE FWSTST ++E+S +  Q+S++S++  N  L  +S + +T     F
Sbjct  42   RIQGRSVRKNSISEDFWSTSTTEMENSGVQSQKSISSVSTSN-PLDSHSTSASTSNTTAF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  +K+ + ++ + +  + W+A+YE    T+KPFP PIPL EMVD 
Sbjct  101  VNHGLLLWNQTRNQWLANKRPQRQKQLREPRISWNATYESLLSTNKPFPQPIPLPEMVDF  160

Query  259  LVDTWEEDGLY  227
            LV+ WE++GLY
Sbjct  161  LVNIWEQEGLY  171



>ref|XP_007023178.1| Uncharacterized protein TCM_027160 [Theobroma cacao]
 gb|EOY25800.1| Uncharacterized protein TCM_027160 [Theobroma cacao]
Length=157

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = -2

Query  616  IHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFV  437
            +  Q VRK+SISE FW+TST D+++S +  Q S++SI+  N +L  +    +     EFV
Sbjct  26   VQDQTVRKASISEDFWTTSTCDMDNSAVQSQGSISSISTSNQTLDPHDSAASANAPSEFV  85

Query  436  NQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            N G L W Q+R +W G+KK +NR R   +  L+W+A+YE    ++KPFP PIPL+EM+D 
Sbjct  86   NHGLLLWNQSRQRWVGNKKFKNRPRQGREPKLNWNATYESLLGSNKPFPQPIPLAEMIDF  145

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  146  LVDIWEQEGLY  156



>ref|XP_008219495.1| PREDICTED: uncharacterized protein LOC103319700 isoform X2 [Prunus 
mume]
Length=159

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+  RK+SISE FWSTST ++E+S +  Q+S++S++  NL +  +  +G+T    EF
Sbjct  30   RIQGRSARKNSISEDFWSTSTMEMENSGVQSQKSISSVSTSNL-VDSHGTSGSTSNTPEF  88

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  ++     +L    I  W+A+YE    T+KPF  PIPL EM+D 
Sbjct  89   VNHGLLLWNQTRSQWLANRSQHQTQLREPRI-SWNATYESLLSTNKPFRQPIPLPEMIDF  147

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  148  LVDIWEQEGLY  158



>ref|NP_001241024.1| uncharacterized protein LOC100806290 precursor [Glycine max]
 gb|ACU24467.1| unknown [Glycine max]
Length=155

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 80/128 (63%), Gaps = 3/128 (2%)
 Frame = -2

Query  610  GQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQ  431
            G    K + SE FWS+S ++++ S +  Q+S++SI IP+      S     I   E+VN 
Sbjct  30   GHATNKDNRSEDFWSSSAFEIDQSALQSQKSISSIGIPS---DPQSSADIQIDSSEYVNH  86

Query  430  GYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVD  251
            G L W Q R QW G+++ EN++ V + I+ W+A+YE    T+KPFP PIPL EMVD LVD
Sbjct  87   GLLLWNQMRRQWVGNRRHENKKQVGEPIISWNATYESLMGTNKPFPRPIPLGEMVDFLVD  146

Query  250  TWEEDGLY  227
             WE +GLY
Sbjct  147  IWEMEGLY  154



>ref|XP_008443992.1| PREDICTED: uncharacterized protein LOC103487445 [Cucumis melo]
Length=177

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 93/134 (69%), Gaps = 3/134 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G++V+K SIS+GFWSTST DL++STI  QRS++SI+  NL+L+  +  G+  +  EF
Sbjct  43   RIQGRVVKKPSISDGFWSTSTCDLDNSTIQSQRSISSISTLNLTLSNSNVAGSVSSSSEF  102

Query  439  VNQGYLWWKQNRLQWRGS---KKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEM  269
            +N G L W Q R+QW GS   K T+  +   K+ + W A+Y+    T +PFP PIPLSEM
Sbjct  103  INHGLLLWNQTRMQWIGSGTTKLTDETQQRQKAKISWRATYDSLLGTRQPFPHPIPLSEM  162

Query  268  VDLLVDTWEEDGLY  227
            V+ LV+ WE++GLY
Sbjct  163  VNFLVEVWEQEGLY  176



>ref|XP_004506941.1| PREDICTED: uncharacterized protein LOC101492460 isoform X2 [Cicer 
arietinum]
Length=158

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 85/130 (65%), Gaps = 3/130 (2%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVN  434
             G  V K S SE FW+TST+D+++S +  Q S++S ++ N ++  +  + N  T  EFVN
Sbjct  30   QGTAVDKPSTSEDFWTTSTHDMDNSAVQSQGSISSTSLTNQAVAPHGSSSNNPT--EFVN  87

Query  433  QGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
             G + W Q R +W G+KK+EN+ +   +  L W+A+YE    ++KPF  PIPL+EMVD L
Sbjct  88   HGLILWNQTRQRWVGNKKSENQTKQPREPKLSWNATYESLLTSNKPFRQPIPLTEMVDFL  147

Query  256  VDTWEEDGLY  227
            VD WE+DGLY
Sbjct  148  VDIWEQDGLY  157



>ref|XP_010696265.1| PREDICTED: uncharacterized protein LOC104908799 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=174

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G+ V+KSS+++  WS+STY++++S +  QRS++SI+  N +L  + G+G+     E+
Sbjct  43   KIQGRAVKKSSLTQDIWSSSTYEMDNSAVQSQRSISSISASNQNLDPHGGSGSASNPSEY  102

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW G +K  N+  + +  L W+A+YE    T+KPFP PIPL EMVD 
Sbjct  103  VNNGLLLWNQIRQQWVGDRKPCNQPKMREPRLSWNATYENLLGTNKPFPQPIPLPEMVDF  162

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  163  LVDVWEQEGLY  173



>ref|XP_009355738.1| PREDICTED: uncharacterized protein LOC103946700 isoform X2 [Pyrus 
x bretschneideri]
Length=172

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 86/131 (66%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+SISE FWSTST ++E S +  Q+S++S++  N  L  +S + +      F
Sbjct  42   RIQGRSVRKNSISEDFWSTSTTEMEDSGVQSQKSISSVSTSN-PLDSHSTSSSISNTTAF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  +K+ + ++ + +  + W+A+YE    T+KPFP PIPL EMVD 
Sbjct  101  VNHGLLLWNQTRNQWLANKQPQRQKQLREPRISWNATYESLLSTNKPFPQPIPLPEMVDF  160

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  161  LVDIWEQEGLY  171



>ref|XP_003609342.1| hypothetical protein MTR_4g114620 [Medicago truncatula]
 gb|AES91539.1| DUF4050 family protein [Medicago truncatula]
Length=172

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 88/133 (66%), Gaps = 3/133 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I GQ +RK + S+GFWS+S  DL++STI  QRS++S++  N  L Q +G     T  EF
Sbjct  40   RIQGQTMRKPTTSDGFWSSSPCDLDNSTIQSQRSISSVSTLNQILYQSNGASTPGTEPEF  99

Query  439  VNQGYLWWKQNRLQW--RGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMV  266
            VNQG   W ++RLQW  RG  + +N++   +S L+ +A+YE    T +PFP  +PLSEMV
Sbjct  100  VNQGLHLWNESRLQWVGRGLSEKQNQQ-KQESRLNRNATYESLLGTRQPFPKSVPLSEMV  158

Query  265  DLLVDTWEEDGLY  227
            + LVD WE +G+Y
Sbjct  159  EFLVDVWEREGMY  171



>ref|XP_009758058.1| PREDICTED: uncharacterized protein LOC104210791 isoform X2 [Nicotiana 
sylvestris]
Length=173

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+ G+ +RK S  + FWS+S  ++E+S    QRS++SI+  N  L  +S +  T  + EF
Sbjct  42   KVQGKHLRKRSSRDDFWSSSACEMENSAFPSQRSISSISTSNQGLDPHSSSSTTNNNAEF  101

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G + W + R +W GS+  + R    +  L + ASYE    T+KPFP  IPLSEMVD 
Sbjct  102  VNHGLILWSKTRQEWIGSRTPQKRTAAREPKLSFGASYETLLGTNKPFPQSIPLSEMVDF  161

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  162  LVDVWEQEGLY  172



>ref|XP_009617111.1| PREDICTED: uncharacterized protein LOC104109495 isoform X2 [Nicotiana 
tomentosiformis]
Length=159

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = -2

Query  607  QLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQG  428
            Q+V K+ +S+ FW+TST D+ES++    R   S    +       G  NT  H EFVN G
Sbjct  32   QVVHKAKLSKDFWTTSTCDMESNSAAQSRGSISSISTSTQAHDAHGAANTNEHSEFVNHG  91

Query  427  YLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDT  248
             L W Q R QW G K  E  + + +  L W+A+Y+    ++KPFP PIPL+EMVD LVD 
Sbjct  92   VLLWSQTRQQWVGHKIPEKPKQLLEPKLSWNATYDSLLGSNKPFPKPIPLAEMVDFLVDV  151

Query  247  WEEDGLY  227
            WE++G+Y
Sbjct  152  WEQEGMY  158



>ref|XP_008394086.1| PREDICTED: uncharacterized protein LOC103456203 isoform X2 [Malus 
domestica]
Length=206

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+SISE FWSTST ++E+S +  Q+S++S++  N  L  +S + +T     F
Sbjct  76   RIQGRSVRKNSISEDFWSTSTTEMENSGVQSQKSISSVSTSN-PLDSHSTSASTSNTTAF  134

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  +K+ + ++ + +  + W+A+YE    T+KPFP PIPL EMVD 
Sbjct  135  VNHGLLLWNQTRNQWLANKRPQRQKQLREPRISWNATYESLLSTNKPFPQPIPLPEMVDF  194

Query  259  LVDTWEEDGLY  227
            LV+ WE++GLY
Sbjct  195  LVNIWEQEGLY  205



>ref|XP_010696258.1| PREDICTED: uncharacterized protein LOC104908799 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=207

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G+ V+KSS+++  WS+STY++++S +  QRS++SI+  N +L  + G+G+     E+
Sbjct  76   KIQGRAVKKSSLTQDIWSSSTYEMDNSAVQSQRSISSISASNQNLDPHGGSGSASNPSEY  135

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW G +K  N+  + +  L W+A+YE    T+KPFP PIPL EMVD 
Sbjct  136  VNNGLLLWNQIRQQWVGDRKPCNQPKMREPRLSWNATYENLLGTNKPFPQPIPLPEMVDF  195

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  196  LVDVWEQEGLY  206



>ref|XP_011020132.1| PREDICTED: uncharacterized protein LOC105122612 isoform X2 [Populus 
euphratica]
Length=173

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G++V K SIS+ FWSTST DL++ST+  QRS++SI++PN +    S TG   ++ EF
Sbjct  43   RIQGRVVTKPSISDDFWSTSTCDLDNSTVQSQRSISSISLPNQN--PASSTGGMGSNSEF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWK-SILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W+ +RLQW GS  + N+    + S L W+A+YE    +S PFP PIPLSEMV+
Sbjct  101  VNHGLLLWQLSRLQWIGSGTSGNQNQRRRESRLSWNATYEGLLGSSNPFPKPIPLSEMVN  160

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  161  FLVDVWEQEGLY  172



>ref|XP_008219494.1| PREDICTED: uncharacterized protein LOC103319700 isoform X1 [Prunus 
mume]
Length=173

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+  RK+SISE FWSTST ++E+S +  Q+S++S++  NL +  +  +G+T    EF
Sbjct  44   RIQGRSARKNSISEDFWSTSTMEMENSGVQSQKSISSVSTSNL-VDSHGTSGSTSNTPEF  102

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  ++     +L    I  W+A+YE    T+KPF  PIPL EM+D 
Sbjct  103  VNHGLLLWNQTRSQWLANRSQHQTQLREPRI-SWNATYESLLSTNKPFRQPIPLPEMIDF  161

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  162  LVDIWEQEGLY  172



>ref|XP_009355737.1| PREDICTED: uncharacterized protein LOC103946700 isoform X1 [Pyrus 
x bretschneideri]
Length=206

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 86/131 (66%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+SISE FWSTST ++E S +  Q+S++S++  N  L  +S + +      F
Sbjct  76   RIQGRSVRKNSISEDFWSTSTTEMEDSGVQSQKSISSVSTSN-PLDSHSTSSSISNTTAF  134

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  +K+ + ++ + +  + W+A+YE    T+KPFP PIPL EMVD 
Sbjct  135  VNHGLLLWNQTRNQWLANKQPQRQKQLREPRISWNATYESLLSTNKPFPQPIPLPEMVDF  194

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  195  LVDIWEQEGLY  205



>ref|XP_011020131.1| PREDICTED: uncharacterized protein LOC105122612 isoform X1 [Populus 
euphratica]
Length=178

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G++V K SIS+ FWSTST DL++ST+  QRS++SI++PN +    S TG   ++ EF
Sbjct  48   RIQGRVVTKPSISDDFWSTSTCDLDNSTVQSQRSISSISLPNQN--PASSTGGMGSNSEF  105

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWK-SILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W+ +RLQW GS  + N+    + S L W+A+YE    +S PFP PIPLSEMV+
Sbjct  106  VNHGLLLWQLSRLQWIGSGTSGNQNQRRRESRLSWNATYEGLLGSSNPFPKPIPLSEMVN  165

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  166  FLVDVWEQEGLY  177



>ref|XP_009617110.1| PREDICTED: uncharacterized protein LOC104109495 isoform X1 [Nicotiana 
tomentosiformis]
Length=177

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = -2

Query  607  QLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQG  428
            Q+V K+ +S+ FW+TST D+ES++    R   S    +       G  NT  H EFVN G
Sbjct  50   QVVHKAKLSKDFWTTSTCDMESNSAAQSRGSISSISTSTQAHDAHGAANTNEHSEFVNHG  109

Query  427  YLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDT  248
             L W Q R QW G K  E  + + +  L W+A+Y+    ++KPFP PIPL+EMVD LVD 
Sbjct  110  VLLWSQTRQQWVGHKIPEKPKQLLEPKLSWNATYDSLLGSNKPFPKPIPLAEMVDFLVDV  169

Query  247  WEEDGLY  227
            WE++G+Y
Sbjct  170  WEQEGMY  176



>ref|XP_007223580.1| hypothetical protein PRUPE_ppa012337mg [Prunus persica]
 gb|EMJ24779.1| hypothetical protein PRUPE_ppa012337mg [Prunus persica]
Length=159

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+SISE FWSTST ++E+S +  Q+S++S++  N  +  +  +G+T    EF
Sbjct  30   RIQGRSVRKNSISEDFWSTSTMEMENSGVQCQKSISSVSTSN-PIDSHGTSGSTSNTPEF  88

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  ++     +L    I  W+A+YE    T+KPF  PIPL EM+D 
Sbjct  89   VNHGLLLWNQTRSQWLANRSQHQTQLREPRI-SWNATYESLLSTNKPFRQPIPLPEMIDF  147

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  148  LVDIWEQEGLY  158



>ref|XP_008394085.1| PREDICTED: uncharacterized protein LOC103456203 isoform X1 [Malus 
domestica]
Length=244

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+SISE FWSTST ++E+S +  Q+S++S++  N  L  +S + +T     F
Sbjct  114  RIQGRSVRKNSISEDFWSTSTTEMENSGVQSQKSISSVSTSN-PLDSHSTSASTSNTTAF  172

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  +K+ + ++ + +  + W+A+YE    T+KPFP PIPL EMVD 
Sbjct  173  VNHGLLLWNQTRNQWLANKRPQRQKQLREPRISWNATYESLLSTNKPFPQPIPLPEMVDF  232

Query  259  LVDTWEEDGLY  227
            LV+ WE++GLY
Sbjct  233  LVNIWEQEGLY  243



>ref|XP_003604391.1| hypothetical protein MTR_4g010330 [Medicago truncatula]
 gb|AES86588.1| DUF4050 family protein [Medicago truncatula]
Length=274

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 87/129 (67%), Gaps = 3/129 (2%)
 Frame = -2

Query  610  GQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQ  431
            G+ V K S SE FW+TST+D+++S +  Q S++S ++ N ++  ++ + N  +  EFVN 
Sbjct  147  GKAVDKPSTSEDFWTTSTHDMDNSAVQSQGSISSTSLTNQAVAAHASSSNNPS--EFVNH  204

Query  430  GYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLV  254
            G + W Q R +W G+KK ENR + + +  L W+A+YE    ++KPF  PIPL+EMVD LV
Sbjct  205  GLILWNQTRQRWVGNKKPENRTQQLREPKLSWNATYESLLTSNKPFRQPIPLAEMVDFLV  264

Query  253  DTWEEDGLY  227
            D WE+DGLY
Sbjct  265  DIWEQDGLY  273



>ref|XP_009758057.1| PREDICTED: uncharacterized protein LOC104210791 isoform X1 [Nicotiana 
sylvestris]
Length=206

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+ G+ +RK S  + FWS+S  ++E+S    QRS++SI+  N  L  +S +  T  + EF
Sbjct  75   KVQGKHLRKRSSRDDFWSSSACEMENSAFPSQRSISSISTSNQGLDPHSSSSTTNNNAEF  134

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G + W + R +W GS+  + R    +  L + ASYE    T+KPFP  IPLSEMVD 
Sbjct  135  VNHGLILWSKTRQEWIGSRTPQKRTAAREPKLSFGASYETLLGTNKPFPQSIPLSEMVDF  194

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  195  LVDVWEQEGLY  205



>ref|XP_006353690.1| PREDICTED: uncharacterized protein LOC102587303 isoform X2 [Solanum 
tuberosum]
Length=148

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 84/131 (64%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+  + +RK+S+ + FWS+S  ++E+ST   QRS++SI+  N +L  +S +G T +  EF
Sbjct  17   KVPSKRLRKTSLRDDFWSSSACEMENSTFPSQRSISSISTSNPALDPHSNSGTTSSTSEF  76

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW G+K  + R  V +  L  D SYE    T+K FP PIPL EMVD 
Sbjct  77   VNHGLLLWNQTRQQWCGNKTPQKRASVREPKLSADTSYETLLGTNKLFPQPIPLPEMVDF  136

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  137  LVDVWEQEGLY  147



>ref|XP_007223581.1| hypothetical protein PRUPE_ppa012337mg [Prunus persica]
 gb|EMJ24780.1| hypothetical protein PRUPE_ppa012337mg [Prunus persica]
Length=173

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+SISE FWSTST ++E+S +  Q+S++S++  N  +  +  +G+T    EF
Sbjct  44   RIQGRSVRKNSISEDFWSTSTMEMENSGVQCQKSISSVSTSN-PIDSHGTSGSTSNTPEF  102

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  ++     +L    I  W+A+YE    T+KPF  PIPL EM+D 
Sbjct  103  VNHGLLLWNQTRSQWLANRSQHQTQLREPRI-SWNATYESLLSTNKPFRQPIPLPEMIDF  161

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  162  LVDIWEQEGLY  172



>ref|XP_003563658.1| PREDICTED: uncharacterized protein LOC100839071 [Brachypodium 
distachyon]
Length=176

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 86/132 (65%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+++SE FWSTS + +E+S +  QRS++S++ P L  +   G G++    EF
Sbjct  45   RIQGRSVRKANLSEDFWSTSVHKIENSAVQSQRSISSMS-PALQSSDQHGDGSSSNPNEF  103

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VNQG + W Q R QW G+KK   R     +  L  +A+YE    ++K F  PIPL+EMVD
Sbjct  104  VNQGLMQWNQTRQQWLGNKKFNFRPEKPREPKLSLNATYESLLGSNKSFSQPIPLAEMVD  163

Query  262  LLVDTWEEDGLY  227
            LLVD WE++GLY
Sbjct  164  LLVDVWEQEGLY  175



>gb|KGN45276.1| hypothetical protein Csa_7G432580 [Cucumis sativus]
Length=158

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 83/131 (63%), Gaps = 3/131 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            + HG  +RK S+SE FW+TST+D+++S    Q SM+S++  N     +  +GN     EF
Sbjct  30   QCHG--LRKPSLSEDFWTTSTFDVDNSAGQSQGSMSSLSTINHMHDPHGSSGNVPNPSEF  87

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            +N G L W Q R +W G+K++E  +   +  LDW+ +YE    ++KPF  PIPL EMVD 
Sbjct  88   LNHGLLLWNQTRQRWTGNKRSEKPQFQ-EPKLDWNVTYESLLGSNKPFRQPIPLGEMVDF  146

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  147  LVDVWEQEGLY  157



>ref|XP_004135858.1| PREDICTED: uncharacterized protein LOC101208775 isoform 3 [Cucumis 
sativus]
 ref|XP_004158780.1| PREDICTED: uncharacterized LOC101208775 isoform 3 [Cucumis sativus]
Length=155

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 83/131 (63%), Gaps = 3/131 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            + HG  +RK S+SE FW+TST+D+++S    Q SM+S++  N     +  +GN     EF
Sbjct  27   QCHG--LRKPSLSEDFWTTSTFDVDNSAGQSQGSMSSLSTINHMHDPHGSSGNVPNPSEF  84

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            +N G L W Q R +W G+K++E  +   +  LDW+ +YE    ++KPF  PIPL EMVD 
Sbjct  85   LNHGLLLWNQTRQRWTGNKRSEKPQFQ-EPKLDWNVTYESLLGSNKPFRQPIPLGEMVDF  143

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  144  LVDVWEQEGLY  154



>ref|NP_197918.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001190393.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAO64181.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04059.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00354.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED93430.1| uncharacterized protein AT5G25360 [Arabidopsis thaliana]
 gb|AED93431.1| uncharacterized protein AT5G25360 [Arabidopsis thaliana]
Length=169

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 83/131 (63%), Gaps = 4/131 (3%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+LV+K S+SE FWSTST ++++ST+  QRSM+SI+  N + T  S +  T    EF
Sbjct  42   RIQGRLVKKPSVSEDFWSTSTCEMDNSTLQSQRSMSSISFTNNTSTSASTSNPT----EF  97

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G   W Q R QW  +  ++ +  V +  + W+A+YE     +K F  PIPL EMVD 
Sbjct  98   VNHGLNLWNQTRQQWLANGTSQKKAKVREPTISWNATYESLLGMNKRFSRPIPLPEMVDF  157

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  158  LVDVWEQEGLY  168



>ref|XP_002308983.2| hypothetical protein POPTR_0006s06780g [Populus trichocarpa]
 gb|EEE92506.2| hypothetical protein POPTR_0006s06780g [Populus trichocarpa]
Length=173

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G++V K SIS+ FWSTST DL++ST+  QRS++SI++PN +    S TG   ++ EF
Sbjct  43   RIQGRVVTKPSISDDFWSTSTCDLDNSTVQSQRSISSISLPNKN--PASSTGGMSSNSEF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W+ +RLQW GS  + N+ +   +S L W+A+YE    +  PFP PIPLSEMV+
Sbjct  101  VNHGLLLWQLSRLQWIGSGTSGNQNQRRQESRLSWNATYEGLLGSRNPFPKPIPLSEMVN  160

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  161  FLVDVWEQEGLY  172



>ref|XP_002285114.1| PREDICTED: uncharacterized protein LOC100254371 isoform X4 [Vitis 
vinifera]
Length=173

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 84/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  616  IHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFV  437
            I G+   + S  E FWSTST ++++S +  Q S++SI+  N +   +S  G+T    EFV
Sbjct  43   IQGRTAMRPSPVEDFWSTSTGEMDNSAVQSQGSISSISTSNQTFDPHSNAGSTSNPPEFV  102

Query  436  NQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
            N G L W Q R QW G++K++NR+ V +  + W+A+YE    T+KP P PIPL EMVD L
Sbjct  103  NHGLLLWNQTRQQWIGNQKSQNRKQVQEPRISWNATYESLLGTNKPLPQPIPLPEMVDFL  162

Query  256  VDTWEEDGLY  227
            VD WE++GLY
Sbjct  163  VDVWEQEGLY  172



>ref|XP_010526211.1| PREDICTED: uncharacterized protein LOC104803836 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010526212.1| PREDICTED: uncharacterized protein LOC104803836 isoform X1 [Tarenaya 
hassleriana]
Length=188

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 83/131 (63%), Gaps = 3/131 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G++V+K+  S+ FWSTST ++E+ST+  + S++SI+  NL L   S T N   + EF
Sbjct  60   KIQGRVVKKTGFSDDFWSTSTCEMENSTLQSRGSVSSISTLNLPLDPQSSTSN---NPEF  116

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G + W Q+R QW   K +  +  V +  + W+ +YE    T+KPFP  IPL EMV  
Sbjct  117  VNHGLILWNQSRQQWLSGKNSRKQPQVREPAISWNTTYESLLSTNKPFPRRIPLQEMVHF  176

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  177  LVDVWEQEGLY  187



>gb|ACF22739.1| hypothetical protein-2 [Brachypodium distachyon]
Length=198

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 86/132 (65%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ VRK+++SE FWSTS + +E+S +  QRS++S++ P L  +   G G++    EF
Sbjct  67   RIQGRSVRKANLSEDFWSTSVHKIENSAVQSQRSISSMS-PALQSSDQHGDGSSSNPNEF  125

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VNQG + W Q R QW G+KK   R     +  L  +A+YE    ++K F  PIPL+EMVD
Sbjct  126  VNQGLMQWNQTRQQWLGNKKFNFRPEKPREPKLSLNATYESLLGSNKSFSQPIPLAEMVD  185

Query  262  LLVDTWEEDGLY  227
            LLVD WE++GLY
Sbjct  186  LLVDVWEQEGLY  197



>ref|XP_010526213.1| PREDICTED: uncharacterized protein LOC104803836 isoform X2 [Tarenaya 
hassleriana]
Length=172

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 83/131 (63%), Gaps = 3/131 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G++V+K+  S+ FWSTST ++E+ST+  + S++SI+  NL L   S T N   + EF
Sbjct  44   KIQGRVVKKTGFSDDFWSTSTCEMENSTLQSRGSVSSISTLNLPLDPQSSTSN---NPEF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G + W Q+R QW   K +  +  V +  + W+ +YE    T+KPFP  IPL EMV  
Sbjct  101  VNHGLILWNQSRQQWLSGKNSRKQPQVREPAISWNTTYESLLSTNKPFPRRIPLQEMVHF  160

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  161  LVDVWEQEGLY  171



>ref|XP_006580938.1| PREDICTED: uncharacterized protein LOC100499896 isoform X1 [Glycine 
max]
Length=152

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 79/128 (62%), Gaps = 3/128 (2%)
 Frame = -2

Query  610  GQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQ  431
            GQ   K + SE FWS+S ++++   +  Q+S++SI IP+      S     I   E+VN 
Sbjct  27   GQSTNKDNRSEDFWSSSAFEIDQGALQSQKSISSIGIPS---DPQSSADIQIDSPEYVNH  83

Query  430  GYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVD  251
            G L W Q R QW G+++ EN++ V + I+ W+A+YE    T+KPF  PIPL EMVD LVD
Sbjct  84   GLLLWNQMRRQWVGNRRRENKKQVGEPIISWNATYESLMGTNKPFHRPIPLGEMVDFLVD  143

Query  250  TWEEDGLY  227
             WE +GLY
Sbjct  144  IWEMEGLY  151



>ref|XP_010648668.1| PREDICTED: uncharacterized protein LOC100254371 isoform X6 [Vitis 
vinifera]
Length=182

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 84/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  616  IHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFV  437
            I G+   + S  E FWSTST ++++S +  Q S++SI+  N +   +S  G+T    EFV
Sbjct  52   IQGRTAMRPSPVEDFWSTSTGEMDNSAVQSQGSISSISTSNQTFDPHSNAGSTSNPPEFV  111

Query  436  NQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
            N G L W Q R QW G++K++NR+ V +  + W+A+YE    T+KP P PIPL EMVD L
Sbjct  112  NHGLLLWNQTRQQWIGNQKSQNRKQVQEPRISWNATYESLLGTNKPLPQPIPLPEMVDFL  171

Query  256  VDTWEEDGLY  227
            VD WE++GLY
Sbjct  172  VDVWEQEGLY  181



>ref|XP_004135856.1| PREDICTED: uncharacterized protein LOC101208775 isoform 1 [Cucumis 
sativus]
 ref|XP_004158778.1| PREDICTED: uncharacterized LOC101208775 isoform 1 [Cucumis sativus]
Length=174

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 83/131 (63%), Gaps = 3/131 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            + HG  +RK S+SE FW+TST+D+++S    Q SM+S++  N     +  +GN     EF
Sbjct  46   QCHG--LRKPSLSEDFWTTSTFDVDNSAGQSQGSMSSLSTINHMHDPHGSSGNVPNPSEF  103

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            +N G L W Q R +W G+K++E  +   +  LDW+ +YE    ++KPF  PIPL EMVD 
Sbjct  104  LNHGLLLWNQTRQRWTGNKRSEKPQFQ-EPKLDWNVTYESLLGSNKPFRQPIPLGEMVDF  162

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  163  LVDVWEQEGLY  173



>dbj|BAJ89273.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 84/132 (64%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ ++  S+SE FWSTS  ++E+S +  QRSM+SI+    S  Q+ G G++    EF
Sbjct  95   RIQGRSIKHRSLSEDFWSTSPREMENSALQSQRSMSSISTAAQSSEQH-GAGSSSNPNEF  153

Query  439  VNQGYLWWKQNRLQWRGSKK-TENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VNQG L W Q R QW G+++    R+   +  + W+A+YE    ++K F  PIPL EMVD
Sbjct  154  VNQGLLLWNQTRQQWVGNRRLNSQRQKTREPKIGWNATYESLLGSTKTFAQPIPLGEMVD  213

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  214  FLVDGWEQEGLY  225



>ref|XP_009803411.1| PREDICTED: uncharacterized protein LOC104248785, partial [Nicotiana 
sylvestris]
Length=183

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = -2

Query  607  QLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQG  428
            Q+V K+ +S+ FW+TST D+ES++    R   S    +       G  NT  H EFVN G
Sbjct  56   QVVHKAKLSKDFWTTSTCDMESNSAAQSRGSISSISTSTQTHDAHGAANTNEHSEFVNHG  115

Query  427  YLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDT  248
             L W Q R QW G K  E  + + +  L W+A+Y+    ++KPFP PIPL+EMVD LVD 
Sbjct  116  VLLWSQIRQQWVGHKIPEKPKQLLEPKLSWNATYDSLLGSNKPFPKPIPLAEMVDFLVDV  175

Query  247  WEEDGLY  227
            WE++G+Y
Sbjct  176  WEQEGMY  182



>ref|XP_009376910.1| PREDICTED: uncharacterized protein LOC103965567 isoform X2 [Pyrus 
x bretschneideri]
Length=155

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 87/131 (66%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I GQ VRK+SISE FWSTST ++E++ I  Q+S++S++  N  L  +  +G+T +  EF
Sbjct  25   RIQGQSVRKNSISEDFWSTSTVEMENNGIQFQKSISSVSTSN-PLDSHGTSGSTSSAPEF  83

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R  W  +K+ + +  + +  + W+A+YE    T+KPF  PIPL EM+D 
Sbjct  84   VNHGLLLWNQTRNLWLANKQPQRQTQLREPRISWNATYESLLSTNKPFRQPIPLPEMIDF  143

Query  259  LVDTWEEDGLY  227
            LVD WE+DGLY
Sbjct  144  LVDIWEQDGLY  154



>ref|XP_008364554.1| PREDICTED: uncharacterized protein LOC103428234 isoform X2 [Malus 
domestica]
Length=156

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 87/125 (70%), Gaps = 2/125 (2%)
 Frame = -2

Query  598  RKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYLW  419
            +K SISE FW+TST+D+++S +  Q S++SI+  N +L  + G+G+  T  EFVN G L 
Sbjct  32   KKPSISEDFWTTSTWDMDNSAVQSQGSISSIST-NQTLDPHGGSGSNSTPSEFVNHGLLL  90

Query  418  WKQNRLQWRGSKKTEN-RRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWE  242
            W Q R +W G+KK+E+  + + +  L W+ASYE    +SKPFP PIPL EMVD LVD WE
Sbjct  91   WNQTRHRWVGNKKSESPSKKIREPKLSWNASYESLLGSSKPFPQPIPLPEMVDFLVDIWE  150

Query  241  EDGLY  227
            ++GLY
Sbjct  151  QEGLY  155



>ref|XP_009376909.1| PREDICTED: uncharacterized protein LOC103965567 isoform X1 [Pyrus 
x bretschneideri]
Length=158

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 87/131 (66%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I GQ VRK+SISE FWSTST ++E++ I  Q+S++S++  N  L  +  +G+T +  EF
Sbjct  28   RIQGQSVRKNSISEDFWSTSTVEMENNGIQFQKSISSVSTSN-PLDSHGTSGSTSSAPEF  86

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R  W  +K+ + +  + +  + W+A+YE    T+KPF  PIPL EM+D 
Sbjct  87   VNHGLLLWNQTRNLWLANKQPQRQTQLREPRISWNATYESLLSTNKPFRQPIPLPEMIDF  146

Query  259  LVDTWEEDGLY  227
            LVD WE+DGLY
Sbjct  147  LVDIWEQDGLY  157



>ref|XP_009614728.1| PREDICTED: uncharacterized protein LOC104107586 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009614729.1| PREDICTED: uncharacterized protein LOC104107586 isoform X2 [Nicotiana 
tomentosiformis]
Length=173

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 82/131 (63%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+ G+ +RK S  + FWS+S  ++E+S    QRS++SI+  N  L  +S +  T  + EF
Sbjct  42   KVQGKHLRKRSSRDDFWSSSACEMENSAFPSQRSISSISTSNQGLDPHSSSSTTNNNSEF  101

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G + W + R +W GS+  + R    +  L +DASYE    T+KPFP  IPLSEMVD 
Sbjct  102  VNHGLILWSKTRQEWIGSRTPQKRTAAGEPKLSFDASYETLLGTNKPFPQSIPLSEMVDF  161

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  162  LVDVWEQEGLY  172



>ref|XP_006353689.1| PREDICTED: uncharacterized protein LOC102587303 isoform X1 [Solanum 
tuberosum]
Length=173

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 84/131 (64%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+  + +RK+S+ + FWS+S  ++E+ST   QRS++SI+  N +L  +S +G T +  EF
Sbjct  42   KVPSKRLRKTSLRDDFWSSSACEMENSTFPSQRSISSISTSNPALDPHSNSGTTSSTSEF  101

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW G+K  + R  V +  L  D SYE    T+K FP PIPL EMVD 
Sbjct  102  VNHGLLLWNQTRQQWCGNKTPQKRASVREPKLSADTSYETLLGTNKLFPQPIPLPEMVDF  161

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  162  LVDVWEQEGLY  172



>gb|EAY84907.1| hypothetical protein OsI_06275 [Oryza sativa Indica Group]
Length=257

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 86/132 (65%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ +++ S+SE FWS+S   +E+S +  QRSM+SI+    S  Q+ G G++    EF
Sbjct  126  RIQGRSIKQRSLSEDFWSSSPPGMENSAMQSQRSMSSISTAAQSSDQH-GAGSSTNPNEF  184

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VNQG L W Q R QW G+++  ++ +   +  + W+A+YE    ++KPFP  IPL EMVD
Sbjct  185  VNQGLLLWNQTRQQWVGNRRHNSQLQQPREPKISWNATYESLLGSTKPFPQAIPLGEMVD  244

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  245  FLVDGWEQEGLY  256



>ref|XP_010648664.1| PREDICTED: uncharacterized protein LOC100254371 isoform X2 [Vitis 
vinifera]
Length=207

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 84/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  616  IHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFV  437
            I G+   + S  E FWSTST ++++S +  Q S++SI+  N +   +S  G+T    EFV
Sbjct  77   IQGRTAMRPSPVEDFWSTSTGEMDNSAVQSQGSISSISTSNQTFDPHSNAGSTSNPPEFV  136

Query  436  NQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
            N G L W Q R QW G++K++NR+ V +  + W+A+YE    T+KP P PIPL EMVD L
Sbjct  137  NHGLLLWNQTRQQWIGNQKSQNRKQVQEPRISWNATYESLLGTNKPLPQPIPLPEMVDFL  196

Query  256  VDTWEEDGLY  227
            VD WE++GLY
Sbjct  197  VDVWEQEGLY  206



>ref|XP_004245026.1| PREDICTED: uncharacterized protein LOC101258679 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010324986.1| PREDICTED: uncharacterized protein LOC101258679 isoform X2 [Solanum 
lycopersicum]
Length=173

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 82/131 (63%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+ GQ +RK    + FWS+S  ++E+S    QRS++SI+  N  L  +S +  T  + EF
Sbjct  42   KVQGQRLRKRGSRDDFWSSSACEMENSAFPSQRSVSSISTSNQGLDAHSSSSTTNNNTEF  101

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G + W + R +W G++  + +    +S L +DASYE    T+KPFP  IPLSEMVD 
Sbjct  102  VNHGLILWSKTRQEWIGNRTPQKQTAAQESKLSFDASYETLLGTNKPFPQSIPLSEMVDF  161

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  162  LVDVWEQEGLY  172



>ref|XP_006364933.1| PREDICTED: uncharacterized protein LOC102578862 isoform X1 [Solanum 
tuberosum]
Length=173

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 82/131 (63%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+ GQ +RK S  + FWS+S  ++E+S    QRS++SI+  N  L  +S +  T  + EF
Sbjct  42   KVQGQHLRKRSSRDDFWSSSACEMENSAFPSQRSVSSISTSNQGLDAHSSSSTTNNNTEF  101

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G + W + R +W G++  +      +S L +DASYE    T+KPFP  IPLSEMVD 
Sbjct  102  VNHGLILWSKTRQEWIGNRTPQKHTPARESKLSFDASYETLLGTNKPFPQSIPLSEMVDF  161

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  162  LVDVWEQEGLY  172



>ref|XP_007150749.1| hypothetical protein PHAVU_005G177600g [Phaseolus vulgaris]
 gb|ESW22743.1| hypothetical protein PHAVU_005G177600g [Phaseolus vulgaris]
Length=200

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 82/132 (62%), Gaps = 4/132 (3%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K  G+  +  S SE FW TST+D+++S +  Q S++S +I N +   + G+ N     EF
Sbjct  71   KKRGKAAKIPSTSEDFWITSTHDMDNSAVQSQGSISSASITNQAADPHGGSCNPT---EF  127

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G   W QNR  W GSK++ENR     +S + W+A+YE     +KPFP  IPL+EMVD
Sbjct  128  VNHGLTLWNQNRQAWIGSKRSENRTEKSRESKVSWNATYESLLGGNKPFPQHIPLAEMVD  187

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  188  FLVDIWEQEGLY  199



>ref|XP_007011866.1| Uncharacterized protein TCM_037003 [Theobroma cacao]
 gb|EOY29485.1| Uncharacterized protein TCM_037003 [Theobroma cacao]
Length=173

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 80/130 (62%), Gaps = 3/130 (2%)
 Frame = -2

Query  616  IHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFV  437
            I G+ V+KSS+SE F S+S  ++E S    Q S++S ++ N        +G+T    EFV
Sbjct  43   IQGRKVKKSSLSEDFPSSSACEMEYSAAQSQGSVSSTSLSNQPPDP---SGSTSYPSEFV  99

Query  436  NQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
            N G L W Q R QWRG+K++E R    +  + WDA+YE     +KPFP PI L EMVD L
Sbjct  100  NHGLLLWNQTRQQWRGNKRSEKRAQTQEPTISWDATYESLLGDNKPFPQPIALPEMVDFL  159

Query  256  VDTWEEDGLY  227
            VD WE++GLY
Sbjct  160  VDYWEQEGLY  169



>ref|NP_001237589.1| uncharacterized protein LOC100499896 precursor [Glycine max]
 gb|ACU14091.1| unknown [Glycine max]
Length=155

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 79/128 (62%), Gaps = 3/128 (2%)
 Frame = -2

Query  610  GQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQ  431
            GQ   K + SE FWS+S ++++   +  Q+S++SI IP+      S     I   E+VN 
Sbjct  30   GQSTNKDNRSEDFWSSSAFEIDQGALQSQKSISSIGIPS---DPQSSADIQIDSPEYVNH  86

Query  430  GYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVD  251
            G L W Q R QW G+++ EN++ V + I+ W+A+YE    T+KPF  PIPL EMVD LVD
Sbjct  87   GLLLWNQMRRQWVGNRRRENKKQVGEPIISWNATYESLMGTNKPFHRPIPLGEMVDFLVD  146

Query  250  TWEEDGLY  227
             WE +GLY
Sbjct  147  IWEMEGLY  154



>ref|XP_010541602.1| PREDICTED: uncharacterized protein LOC104815019 [Tarenaya hassleriana]
Length=169

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 85/131 (65%), Gaps = 4/131 (3%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+LVR++S+S+ FWSTST ++++ST+  QRS++SI+  N ++    GT N     EF
Sbjct  42   RIQGRLVRRASVSDDFWSTSTCEMDNSTLQSQRSLSSISFTNNNVVS-CGTSNPT---EF  97

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G + W Q R QW  +  ++ +  + +  + W+A+YE     +K F  PIPL EMVD 
Sbjct  98   VNHGLILWNQTRQQWLANGTSQTKSKLREPTISWNATYESLLGMNKRFSRPIPLPEMVDF  157

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  158  LVDVWEQEGLY  168



>ref|XP_010250118.1| PREDICTED: uncharacterized protein LOC104592441 isoform X3 [Nelumbo 
nucifera]
Length=158

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 88/132 (67%), Gaps = 3/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V K SISE FWSTST ++++S +  QRS++SI+  N +   + G G+T    EF
Sbjct  28   RIQGRTVNKPSISEDFWSTSTCEMDNSAVQSQRSISSISTLNQAFDPHGGVGSTSNPPEF  87

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSI-LDWDASYECTAETSKPFPCPIPLSEMVD  263
            +N G+L W Q R QW G  K+EN+   ++   L W+A+Y+    T+KPFP PI LSEMVD
Sbjct  88   INHGFLLWTQTRQQWVG--KSENKTQQFREPRLSWNATYDSLLGTNKPFPQPISLSEMVD  145

Query  262  LLVDTWEEDGLY  227
             LVD WE++G+Y
Sbjct  146  FLVDVWEQEGMY  157



>ref|XP_006364934.1| PREDICTED: uncharacterized protein LOC102578862 isoform X2 [Solanum 
tuberosum]
Length=166

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 82/131 (63%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+ GQ +RK S  + FWS+S  ++E+S    QRS++SI+  N  L  +S +  T  + EF
Sbjct  35   KVQGQHLRKRSSRDDFWSSSACEMENSAFPSQRSVSSISTSNQGLDAHSSSSTTNNNTEF  94

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G + W + R +W G++  +      +S L +DASYE    T+KPFP  IPLSEMVD 
Sbjct  95   VNHGLILWSKTRQEWIGNRTPQKHTPARESKLSFDASYETLLGTNKPFPQSIPLSEMVDF  154

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  155  LVDVWEQEGLY  165



>ref|XP_010324985.1| PREDICTED: uncharacterized protein LOC101258679 isoform X1 [Solanum 
lycopersicum]
Length=194

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 82/131 (63%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+ GQ +RK    + FWS+S  ++E+S    QRS++SI+  N  L  +S +  T  + EF
Sbjct  63   KVQGQRLRKRGSRDDFWSSSACEMENSAFPSQRSVSSISTSNQGLDAHSSSSTTNNNTEF  122

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G + W + R +W G++  + +    +S L +DASYE    T+KPFP  IPLSEMVD 
Sbjct  123  VNHGLILWSKTRQEWIGNRTPQKQTAAQESKLSFDASYETLLGTNKPFPQSIPLSEMVDF  182

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  183  LVDVWEQEGLY  193



>ref|XP_009614727.1| PREDICTED: uncharacterized protein LOC104107586 isoform X1 [Nicotiana 
tomentosiformis]
Length=207

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 82/131 (63%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+ G+ +RK S  + FWS+S  ++E+S    QRS++SI+  N  L  +S +  T  + EF
Sbjct  76   KVQGKHLRKRSSRDDFWSSSACEMENSAFPSQRSISSISTSNQGLDPHSSSSTTNNNSEF  135

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G + W + R +W GS+  + R    +  L +DASYE    T+KPFP  IPLSEMVD 
Sbjct  136  VNHGLILWSKTRQEWIGSRTPQKRTAAGEPKLSFDASYETLLGTNKPFPQSIPLSEMVDF  195

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  196  LVDVWEQEGLY  206



>ref|XP_006394786.1| hypothetical protein EUTSA_v10005028mg [Eutrema salsugineum]
 gb|ESQ32072.1| hypothetical protein EUTSA_v10005028mg [Eutrema salsugineum]
Length=169

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 83/131 (63%), Gaps = 4/131 (3%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+LV+K S+S+ FWSTST ++++ST+  QRSM+SI+  N + T  S +  T    EF
Sbjct  42   RIQGRLVKKPSVSDDFWSTSTCEMDNSTMQSQRSMSSISFTNNTATSASTSNPT----EF  97

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G   W Q R QW  +  ++ +  + +  + W+A+YE     +K F  PIPL EMVD 
Sbjct  98   VNNGLNLWNQTRQQWLANGTSQTKAKLREPTISWNATYESLLGMNKRFTRPIPLPEMVDF  157

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  158  LVDVWEQEGLY  168



>gb|AAC32109.1| hypothetical protein [Picea mariana]
 gb|ABK22316.1| unknown [Picea sitchensis]
Length=158

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 82/131 (63%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+ G+ ++  S SE FWS+ST ++++ST+  QRS++SI+  N +    +   N   + EF
Sbjct  28   KVQGRSLKGPSFSEDFWSSSTNEMDNSTVQSQRSVSSISASNQNSDSRAANTNA-NNTEF  86

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN   + W + R QW G +   + R + + +L W+ +YE    T++PFP  IPLSEMVD 
Sbjct  87   VNHALILWNEMRQQWVGDRPRNHARQLREPVLSWNTTYESLLGTNRPFPQLIPLSEMVDF  146

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  147  LVDVWEQEGLY  157



>ref|XP_008243735.1| PREDICTED: uncharacterized protein LOC103341965 isoform X1 [Prunus 
mume]
Length=173

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 84/140 (60%), Gaps = 16/140 (11%)
 Frame = -2

Query  601  VRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYL  422
            + K SISE FW+TST+D+++S +  Q SM+SI+  N +L  + G+ +  T  EFVN G L
Sbjct  34   INKPSISEDFWTTSTWDMDNSAVQSQGSMSSIST-NQTLDPHGGSCSNTTPSEFVNHGLL  92

Query  421  WWKQNRLQWRGSKKTENRRLVWK---------------SILDWDASYECTAETSKPFPCP  287
             W Q R +W G+KK+++     +                +  W+ASYE    ++KPFP P
Sbjct  93   LWNQTRQRWVGNKKSQSPAKQIREPKLSTHCLSMVKSFCLCSWNASYESLLGSNKPFPQP  152

Query  286  IPLSEMVDLLVDTWEEDGLY  227
            IPL EMVD LVD WE++GLY
Sbjct  153  IPLPEMVDFLVDVWEQEGLY  172



>ref|XP_008243736.1| PREDICTED: uncharacterized protein LOC103341965 isoform X2 [Prunus 
mume]
Length=170

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 84/140 (60%), Gaps = 16/140 (11%)
 Frame = -2

Query  601  VRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYL  422
            + K SISE FW+TST+D+++S +  Q SM+SI+  N +L  + G+ +  T  EFVN G L
Sbjct  31   INKPSISEDFWTTSTWDMDNSAVQSQGSMSSIST-NQTLDPHGGSCSNTTPSEFVNHGLL  89

Query  421  WWKQNRLQWRGSKKTENRRLVWK---------------SILDWDASYECTAETSKPFPCP  287
             W Q R +W G+KK+++     +                +  W+ASYE    ++KPFP P
Sbjct  90   LWNQTRQRWVGNKKSQSPAKQIREPKLSTHCLSMVKSFCLCSWNASYESLLGSNKPFPQP  149

Query  286  IPLSEMVDLLVDTWEEDGLY  227
            IPL EMVD LVD WE++GLY
Sbjct  150  IPLPEMVDFLVDVWEQEGLY  169



>ref|XP_006842068.1| hypothetical protein AMTR_s00078p00048610 [Amborella trichopoda]
 gb|ERN03743.1| hypothetical protein AMTR_s00078p00048610 [Amborella trichopoda]
Length=179

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 90/132 (68%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V+K S+SE FWSTS Y++++S +  QRS++SI+  N +   +SG  +T    EF
Sbjct  48   RIQGRTVKKPSLSEDFWSTSPYEMDNSGVQSQRSISSISTSNQNPDPHSGQCST-GPTEF  106

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G+L W Q R +W G++  ENR   V +  L W+A+Y+    T+KPFP PIPLSEMVD
Sbjct  107  VNHGFLLWNQIRQEWVGNRPAENRTPQVREPRLSWNATYDSLLGTNKPFPQPIPLSEMVD  166

Query  262  LLVDTWEEDGLY  227
             LVD WE++G+Y
Sbjct  167  FLVDVWEQEGMY  178



>ref|XP_009625257.1| PREDICTED: uncharacterized protein LOC104116163 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009625258.1| PREDICTED: uncharacterized protein LOC104116163 isoform X2 [Nicotiana 
tomentosiformis]
Length=107

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -2

Query  487  LTQYSGTGNTITHEEFVNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAET  308
            L  +SGTG+  T+ EFVNQGYL W Q+RLQW  SKK ENRR V + +L+W+ SYE    T
Sbjct  21   LAHHSGTGSATTNNEFVNQGYLLWNQSRLQWLASKKPENRR-VEEPMLNWNVSYESLFGT  79

Query  307  SKPFPCPIPLSEMVDLLVDTWEEDGLY  227
            +K FP PIPLS+MVD L D WE +GLY
Sbjct  80   NKRFPQPIPLSDMVDFLADIWEHEGLY  106



>ref|XP_010250116.1| PREDICTED: uncharacterized protein LOC104592441 isoform X2 [Nelumbo 
nucifera]
Length=172

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 88/132 (67%), Gaps = 3/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V K SISE FWSTST ++++S +  QRS++SI+  N +   + G G+T    EF
Sbjct  42   RIQGRTVNKPSISEDFWSTSTCEMDNSAVQSQRSISSISTLNQAFDPHGGVGSTSNPPEF  101

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSI-LDWDASYECTAETSKPFPCPIPLSEMVD  263
            +N G+L W Q R QW G  K+EN+   ++   L W+A+Y+    T+KPFP PI LSEMVD
Sbjct  102  INHGFLLWTQTRQQWVG--KSENKTQQFREPRLSWNATYDSLLGTNKPFPQPISLSEMVD  159

Query  262  LLVDTWEEDGLY  227
             LVD WE++G+Y
Sbjct  160  FLVDVWEQEGMY  171



>ref|NP_001237738.1| uncharacterized protein LOC100500161 [Glycine max]
 gb|ACU15093.1| unknown [Glycine max]
Length=156

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 83/130 (64%), Gaps = 4/130 (3%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVN  434
             G+  +K S SE FW TST+D+++S +  Q S++S +I N +   + G+ N     EFVN
Sbjct  29   QGKAAKKPSTSEDFWITSTHDMDNSAVQSQGSISSASITNQAADPHGGSCNPT---EFVN  85

Query  433  QGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
             G + W Q R  W G+K+++N+   + +  L W+A+YE    ++KPFP  IPL+EMVD L
Sbjct  86   HGLILWNQTRQGWIGNKRSKNQTEQLREPKLSWNATYESLLGSNKPFPQHIPLAEMVDFL  145

Query  256  VDTWEEDGLY  227
            VD WE++GLY
Sbjct  146  VDIWEQEGLY  155



>ref|XP_010097234.1| hypothetical protein L484_025783 [Morus notabilis]
 gb|EXB67301.1| hypothetical protein L484_025783 [Morus notabilis]
Length=322

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVN  434
             G+ VRK SISE FW++ST+D+++S +  Q S++SI+  N +L   SG   T    EFVN
Sbjct  193  QGRAVRKPSISEDFWTSSTFDMDNSAVQSQGSISSISTINQTLDPNSGACAT-NSSEFVN  251

Query  433  QGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
             G L W Q R +W G+K++ENR + + +  L W+A+YE    ++KPFP PIPL+EMVD L
Sbjct  252  HGLLLWNQTRQRWLGNKRSENRSQQIREPKLSWNATYESLLGSNKPFPQPIPLAEMVDFL  311

Query  256  VDTWEEDGLY  227
            VD WE++G+Y
Sbjct  312  VDIWEQEGMY  321



>ref|XP_004506942.1| PREDICTED: uncharacterized protein LOC101492460 isoform X3 [Cicer 
arietinum]
Length=152

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 85/146 (58%), Gaps = 21/146 (14%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVN  434
             G  V K S SE FW+TST+D+++S +  Q S++S ++ N ++  +  + N  T  EFVN
Sbjct  10   QGTAVDKPSTSEDFWTTSTHDMDNSAVQSQGSISSTSLTNQAVAPHGSSSNNPT--EFVN  67

Query  433  QGYLWWKQNRLQWRGSKKTENR-----------------RLVWKSILDWDASYECTAETS  305
             G + W Q R +W G+KK+EN+                 +  W  +  W+A+YE    ++
Sbjct  68   HGLILWNQTRQRWVGNKKSENQTKQPREPKLRTYSLCPAKFFW--LCSWNATYESLLTSN  125

Query  304  KPFPCPIPLSEMVDLLVDTWEEDGLY  227
            KPF  PIPL+EMVD LVD WE+DGLY
Sbjct  126  KPFRQPIPLTEMVDFLVDIWEQDGLY  151



>ref|NP_001235781.1| uncharacterized protein LOC100499770 [Glycine max]
 gb|ACU13561.1| unknown [Glycine max]
Length=174

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 87/142 (61%), Gaps = 16/142 (11%)
 Frame = -2

Query  604  LVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHE-EFVNQG  428
            +VRK S SE FW+TST+D+++S +  Q S++S ++ N ++  ++G+  + T+  EFVN G
Sbjct  32   VVRKPSSSEDFWTTSTHDMDNSAVQSQGSISSASLTNQAVVSHAGSSKSSTNPTEFVNHG  91

Query  427  YLWWKQNRLQWRGSKKTENRRLVWKS---------------ILDWDASYECTAETSKPFP  293
             + W Q R +W G+KK EN+    +                +  W+A+YE    ++KPF 
Sbjct  92   VILWNQTRQRWVGNKKPENQTQQLQEPKLRTYCLCLAKNFWLCSWNATYESLLGSNKPFR  151

Query  292  CPIPLSEMVDLLVDTWEEDGLY  227
             PIPL+EMVD LVD WE+DGLY
Sbjct  152  QPIPLAEMVDFLVDIWEQDGLY  173



>ref|XP_006450436.1| hypothetical protein CICLE_v10009702mg [Citrus clementina]
 gb|ESR63676.1| hypothetical protein CICLE_v10009702mg [Citrus clementina]
Length=172

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 81/131 (62%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V+K SI E FWS+ST +++++ +  +   +     N  L   +GT +    +EF
Sbjct  42   RIQGRTVKKPSILEDFWSSSTCEMDNNVVQSRSLSSISIS-NQPLDPSTGTSSANNPQEF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  +KK +NR  V +  + W+ASYE    T+KPFP  +PL+EMVD 
Sbjct  101  VNHGLLLWNQTRQQWLANKKPQNRPQVREPSISWNASYESLLGTNKPFPQRVPLAEMVDF  160

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  161  LVDVWEQEGLY  171



>ref|XP_002874253.1| hypothetical protein ARALYDRAFT_489387 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50512.1| hypothetical protein ARALYDRAFT_489387 [Arabidopsis lyrata subsp. 
lyrata]
Length=169

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 82/131 (63%), Gaps = 4/131 (3%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+LV+K S+S+ FWSTST ++++ST+  QRSM+SI+  N + T  S +  T    EF
Sbjct  42   RIQGRLVKKPSVSDDFWSTSTCEMDNSTLQSQRSMSSISFTNNTSTSASTSNPT----EF  97

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G   W Q R QW  +  +  +  + +  + W+A+YE     +K F  PIPL EMVD 
Sbjct  98   VNHGLNLWNQTRQQWLANGTSHKKAKLREPTISWNATYESLLGMNKRFSRPIPLPEMVDF  157

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  158  LVDVWEQEGLY  168



>ref|XP_006483362.1| PREDICTED: uncharacterized protein LOC102620837 isoform X3 [Citrus 
sinensis]
 gb|KDO61729.1| hypothetical protein CISIN_1g030745mg [Citrus sinensis]
Length=172

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 80/131 (61%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V+K SI E FWS+ST +++++ +  +   +     N  L   +GT      +EF
Sbjct  42   RIQGRTVKKPSILEDFWSSSTCEMDNNVVQSRSLSSISIS-NQPLDPSTGTSGANNPQEF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  +KK +NR  V +  + W+ASYE    T+KPFP  +PL+EMVD 
Sbjct  101  VNHGLLLWNQTRQQWLANKKPQNRPQVREPSISWNASYESLLGTNKPFPQRVPLAEMVDF  160

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  161  LVDVWEQEGLY  171



>ref|XP_010687981.1| PREDICTED: uncharacterized protein LOC104902025 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=174

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 80/131 (61%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +  GQ+V K S+S+ FW TST D+++   + QRS++SI+  N+S     G+ +  +H +F
Sbjct  43   QCQGQVVEKVSLSDDFWGTSTGDIDNPIGLSQRSISSISTSNVSFHSDLGSASMNSHNDF  102

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W QNR+QW  + K+          +  +A+Y+    + + F  PIPLSEMV+ 
Sbjct  103  VNHGLLLWTQNRIQWIAATKSNEAHQALGPTISLNATYDSLLSSRERFRRPIPLSEMVEF  162

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  163  LVDVWEQEGLY  173



>ref|XP_006483361.1| PREDICTED: uncharacterized protein LOC102620837 isoform X2 [Citrus 
sinensis]
Length=181

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 80/131 (61%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V+K SI E FWS+ST +++++ +  +   +     N  L   +GT      +EF
Sbjct  51   RIQGRTVKKPSILEDFWSSSTCEMDNNVVQSRSLSSISIS-NQPLDPSTGTSGANNPQEF  109

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  +KK +NR  V +  + W+ASYE    T+KPFP  +PL+EMVD 
Sbjct  110  VNHGLLLWNQTRQQWLANKKPQNRPQVREPSISWNASYESLLGTNKPFPQRVPLAEMVDF  169

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  170  LVDVWEQEGLY  180



>ref|XP_010250114.1| PREDICTED: uncharacterized protein LOC104592441 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010250115.1| PREDICTED: uncharacterized protein LOC104592441 isoform X1 [Nelumbo 
nucifera]
Length=195

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 88/132 (67%), Gaps = 3/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V K SISE FWSTST ++++S +  QRS++SI+  N +   + G G+T    EF
Sbjct  65   RIQGRTVNKPSISEDFWSTSTCEMDNSAVQSQRSISSISTLNQAFDPHGGVGSTSNPPEF  124

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSI-LDWDASYECTAETSKPFPCPIPLSEMVD  263
            +N G+L W Q R QW G  K+EN+   ++   L W+A+Y+    T+KPFP PI LSEMVD
Sbjct  125  INHGFLLWTQTRQQWVG--KSENKTQQFREPRLSWNATYDSLLGTNKPFPQPISLSEMVD  182

Query  262  LLVDTWEEDGLY  227
             LVD WE++G+Y
Sbjct  183  FLVDVWEQEGMY  194



>ref|XP_010687980.1| PREDICTED: uncharacterized protein LOC104902025 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=176

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 80/131 (61%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +  GQ+V K S+S+ FW TST D+++   + QRS++SI+  N+S     G+ +  +H +F
Sbjct  45   QCQGQVVEKVSLSDDFWGTSTGDIDNPIGLSQRSISSISTSNVSFHSDLGSASMNSHNDF  104

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W QNR+QW  + K+          +  +A+Y+    + + F  PIPLSEMV+ 
Sbjct  105  VNHGLLLWTQNRIQWIAATKSNEAHQALGPTISLNATYDSLLSSRERFRRPIPLSEMVEF  164

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  165  LVDVWEQEGLY  175



>ref|XP_010687978.1| PREDICTED: uncharacterized protein LOC104902025 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=187

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 80/131 (61%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +  GQ+V K S+S+ FW TST D+++   + QRS++SI+  N+S     G+ +  +H +F
Sbjct  56   QCQGQVVEKVSLSDDFWGTSTGDIDNPIGLSQRSISSISTSNVSFHSDLGSASMNSHNDF  115

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W QNR+QW  + K+          +  +A+Y+    + + F  PIPLSEMV+ 
Sbjct  116  VNHGLLLWTQNRIQWIAATKSNEAHQALGPTISLNATYDSLLSSRERFRRPIPLSEMVEF  175

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  176  LVDVWEQEGLY  186



>ref|XP_010254416.1| PREDICTED: uncharacterized protein LOC104595391 isoform X3 [Nelumbo 
nucifera]
Length=158

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 88/132 (67%), Gaps = 3/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V+K SISE FWSTST ++++S +  QRS++SI+          G G+T    EF
Sbjct  28   RIQGRTVKKPSISEDFWSTSTCEMDNSAVQSQRSISSIST--SYQVDPHGVGSTSNPTEF  85

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W Q R QW G++++ENR + V +  L W+A+Y+    T+KPFP  IPLSEMVD
Sbjct  86   VNHGLLLWNQTRQQWVGNRRSENRTQQVQEPRLSWNATYDSLLGTNKPFPQSIPLSEMVD  145

Query  262  LLVDTWEEDGLY  227
             LVD WE++G+Y
Sbjct  146  FLVDVWEQEGMY  157



>ref|XP_002324297.1| hypothetical protein POPTR_0018s01700g [Populus trichocarpa]
 gb|EEF02862.1| hypothetical protein POPTR_0018s01700g [Populus trichocarpa]
Length=171

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = -2

Query  574  FWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYLWWKQNRLQW  395
            FWSTS  D+E+ST+  Q S++SI+  N  L   S  G+T    EFVN+  L W Q R QW
Sbjct  57   FWSTSAGDMENSTMHSQGSLSSISTLNQQLDP-SNAGSTSNSSEFVNR-LLLWNQTRQQW  114

Query  394  RGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWEEDGLY  227
             G+KKT+NR+ V +  + W+A+YE    ++KPF  P+PL+EMVD LVD WE++GLY
Sbjct  115  LGNKKTQNRKQVREPTISWNATYESLLGSNKPFARPVPLAEMVDFLVDVWEQEGLY  170



>ref|XP_007137021.1| hypothetical protein PHAVU_009G093300g [Phaseolus vulgaris]
 ref|XP_007137025.1| hypothetical protein PHAVU_009G093300g [Phaseolus vulgaris]
 gb|ESW09015.1| hypothetical protein PHAVU_009G093300g [Phaseolus vulgaris]
 gb|ESW09019.1| hypothetical protein PHAVU_009G093300g [Phaseolus vulgaris]
Length=157

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 78/130 (60%), Gaps = 4/130 (3%)
 Frame = -2

Query  616  IHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFV  437
            I GQ + K  ISE FWS+S  +++      Q+S++SI +P+      S +G  I   EFV
Sbjct  31   IKGQAMNKD-ISEDFWSSSALEIDQWAFQSQKSISSIVMPS---DPQSSSGIQIDSPEFV  86

Query  436  NQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
            N G L + Q R  W G +K  N++ V + I+ W+ASYE    T KPFP PIPL EMVD L
Sbjct  87   NDGLLIFNQVRRHWVGKRKPRNKKEVGEHIVSWNASYESLMGTDKPFPRPIPLGEMVDFL  146

Query  256  VDTWEEDGLY  227
            VD WE +GLY
Sbjct  147  VDIWELEGLY  156



>ref|XP_004506940.1| PREDICTED: uncharacterized protein LOC101492460 isoform X1 [Cicer 
arietinum]
Length=172

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 85/146 (58%), Gaps = 21/146 (14%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVN  434
             G  V K S SE FW+TST+D+++S +  Q S++S ++ N ++  +  + N  T  EFVN
Sbjct  30   QGTAVDKPSTSEDFWTTSTHDMDNSAVQSQGSISSTSLTNQAVAPHGSSSNNPT--EFVN  87

Query  433  QGYLWWKQNRLQWRGSKKTENR-----------------RLVWKSILDWDASYECTAETS  305
             G + W Q R +W G+KK+EN+                 +  W  +  W+A+YE    ++
Sbjct  88   HGLILWNQTRQRWVGNKKSENQTKQPREPKLRTYSLCPAKFFW--LCSWNATYESLLTSN  145

Query  304  KPFPCPIPLSEMVDLLVDTWEEDGLY  227
            KPF  PIPL+EMVD LVD WE+DGLY
Sbjct  146  KPFRQPIPLTEMVDFLVDIWEQDGLY  171



>ref|XP_009365419.1| PREDICTED: uncharacterized protein LOC103955265 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009365420.1| PREDICTED: uncharacterized protein LOC103955265 isoform X2 [Pyrus 
x bretschneideri]
Length=156

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 86/125 (69%), Gaps = 2/125 (2%)
 Frame = -2

Query  598  RKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYLW  419
            +K SISE FW+TST+D+++S +  Q S++SI+  N +L  + G+G+  T  EFVN G L 
Sbjct  32   KKPSISEDFWTTSTWDMDNSAVQSQGSISSIST-NQTLDPHGGSGSNSTPSEFVNHGLLL  90

Query  418  WKQNRLQWRGSKKTEN-RRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWE  242
            W Q R +W G+KK+E+  + + +  L  +ASYE    +SKPFP PIPL EMVD LVD WE
Sbjct  91   WNQTRHRWVGNKKSESPSKKIREPKLSLNASYESLLGSSKPFPQPIPLPEMVDFLVDIWE  150

Query  241  EDGLY  227
            ++GLY
Sbjct  151  QEGLY  155



>ref|XP_009365417.1| PREDICTED: uncharacterized protein LOC103955265 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009365418.1| PREDICTED: uncharacterized protein LOC103955265 isoform X1 [Pyrus 
x bretschneideri]
Length=159

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 86/125 (69%), Gaps = 2/125 (2%)
 Frame = -2

Query  598  RKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYLW  419
            +K SISE FW+TST+D+++S +  Q S++SI+  N +L  + G+G+  T  EFVN G L 
Sbjct  35   KKPSISEDFWTTSTWDMDNSAVQSQGSISSIST-NQTLDPHGGSGSNSTPSEFVNHGLLL  93

Query  418  WKQNRLQWRGSKKTEN-RRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWE  242
            W Q R +W G+KK+E+  + + +  L  +ASYE    +SKPFP PIPL EMVD LVD WE
Sbjct  94   WNQTRHRWVGNKKSESPSKKIREPKLSLNASYESLLGSSKPFPQPIPLPEMVDFLVDIWE  153

Query  241  EDGLY  227
            ++GLY
Sbjct  154  QEGLY  158



>ref|XP_007137023.1| hypothetical protein PHAVU_009G093300g [Phaseolus vulgaris]
 gb|ESW09017.1| hypothetical protein PHAVU_009G093300g [Phaseolus vulgaris]
Length=122

 Score =   107 bits (267),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = -2

Query  586  ISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYLWWKQN  407
            ISE FWS+S  +++      Q+S++SI +P+      S +G  I   EFVN G L + Q 
Sbjct  5    ISEDFWSSSALEIDQWAFQSQKSISSIVMPS---DPQSSSGIQIDSPEFVNDGLLIFNQV  61

Query  406  RLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWEEDGLY  227
            R  W G +K  N++ V + I+ W+ASYE    T KPFP PIPL EMVD LVD WE +GLY
Sbjct  62   RRHWVGKRKPRNKKEVGEHIVSWNASYESLMGTDKPFPRPIPLGEMVDFLVDIWELEGLY  121



>ref|XP_006483360.1| PREDICTED: uncharacterized protein LOC102620837 isoform X1 [Citrus 
sinensis]
Length=205

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 80/131 (61%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V+K SI E FWS+ST +++++ +  +   +     N  L   +GT      +EF
Sbjct  75   RIQGRTVKKPSILEDFWSSSTCEMDNNVVQSRSLSSISIS-NQPLDPSTGTSGANNPQEF  133

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW  +KK +NR  V +  + W+ASYE    T+KPFP  +PL+EMVD 
Sbjct  134  VNHGLLLWNQTRQQWLANKKPQNRPQVREPSISWNASYESLLGTNKPFPQRVPLAEMVDF  193

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  194  LVDVWEQEGLY  204



>gb|KHN22446.1| hypothetical protein glysoja_024955 [Glycine soja]
Length=213

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 83/130 (64%), Gaps = 4/130 (3%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVN  434
             G+  +K S SE FW TST+D+++S +  Q S++S +I N +   + G+ N     EFVN
Sbjct  86   QGKAAKKPSTSEDFWITSTHDMDNSAVQSQGSISSASITNQAADPHGGSCNPT---EFVN  142

Query  433  QGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
             G + W Q R  W G+K+++N+   + +  L W+A+YE    ++KPFP  IPL+EMVD L
Sbjct  143  HGLILWNQTRQGWIGNKRSKNQTEQLREPKLSWNATYESLLGSNKPFPQHIPLAEMVDFL  202

Query  256  VDTWEEDGLY  227
            VD WE++GLY
Sbjct  203  VDIWEQEGLY  212



>ref|XP_010254415.1| PREDICTED: uncharacterized protein LOC104595391 isoform X2 [Nelumbo 
nucifera]
Length=172

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 88/132 (67%), Gaps = 3/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V+K SISE FWSTST ++++S +  QRS++SI+          G G+T    EF
Sbjct  42   RIQGRTVKKPSISEDFWSTSTCEMDNSAVQSQRSISSIS--TSYQVDPHGVGSTSNPTEF  99

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W Q R QW G++++ENR + V +  L W+A+Y+    T+KPFP  IPLSEMVD
Sbjct  100  VNHGLLLWNQTRQQWVGNRRSENRTQQVQEPRLSWNATYDSLLGTNKPFPQSIPLSEMVD  159

Query  262  LLVDTWEEDGLY  227
             LVD WE++G+Y
Sbjct  160  FLVDVWEQEGMY  171



>ref|XP_011012182.1| PREDICTED: uncharacterized protein LOC105116490 isoform X2 [Populus 
euphratica]
Length=159

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 89/134 (66%), Gaps = 3/134 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNL--SLTQYSGTGNTITHE  446
            K+  + V+K SISE FW+TST D++ S +  Q S++SI+I N   +L Q+ G+G+     
Sbjct  25   KVKCETVKKPSISEDFWTTSTCDMDYSAVQSQGSISSISIANQNQTLDQHGGSGSINDVS  84

Query  445  EFVNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEM  269
            EFVN G L W Q R  W G+K++ N  +L  +  L+W+A+YE    ++KPFP  IPL+EM
Sbjct  85   EFVNHGLLLWNQTRHCWVGNKRSGNEEQLPQEPKLNWNATYESLLGSNKPFPQQIPLTEM  144

Query  268  VDLLVDTWEEDGLY  227
            VD LVD WE++G+Y
Sbjct  145  VDFLVDIWEQEGMY  158



>ref|XP_011012181.1| PREDICTED: uncharacterized protein LOC105116490 isoform X1 [Populus 
euphratica]
Length=162

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 89/134 (66%), Gaps = 3/134 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNL--SLTQYSGTGNTITHE  446
            K+  + V+K SISE FW+TST D++ S +  Q S++SI+I N   +L Q+ G+G+     
Sbjct  28   KVKCETVKKPSISEDFWTTSTCDMDYSAVQSQGSISSISIANQNQTLDQHGGSGSINDVS  87

Query  445  EFVNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEM  269
            EFVN G L W Q R  W G+K++ N  +L  +  L+W+A+YE    ++KPFP  IPL+EM
Sbjct  88   EFVNHGLLLWNQTRHCWVGNKRSGNEEQLPQEPKLNWNATYESLLGSNKPFPQQIPLTEM  147

Query  268  VDLLVDTWEEDGLY  227
            VD LVD WE++G+Y
Sbjct  148  VDFLVDIWEQEGMY  161



>ref|XP_010254414.1| PREDICTED: uncharacterized protein LOC104595391 isoform X1 [Nelumbo 
nucifera]
Length=195

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 88/132 (67%), Gaps = 3/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V+K SISE FWSTST ++++S +  QRS++SI+          G G+T    EF
Sbjct  65   RIQGRTVKKPSISEDFWSTSTCEMDNSAVQSQRSISSIS--TSYQVDPHGVGSTSNPTEF  122

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W Q R QW G++++ENR + V +  L W+A+Y+    T+KPFP  IPLSEMVD
Sbjct  123  VNHGLLLWNQTRQQWVGNRRSENRTQQVQEPRLSWNATYDSLLGTNKPFPQSIPLSEMVD  182

Query  262  LLVDTWEEDGLY  227
             LVD WE++G+Y
Sbjct  183  FLVDVWEQEGMY  194



>ref|XP_010063461.1| PREDICTED: uncharacterized protein LOC104450556 isoform X1 [Eucalyptus 
grandis]
Length=155

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 84/128 (66%), Gaps = 3/128 (2%)
 Frame = -2

Query  607  QLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQG  428
            Q V++ S SE FWS++T+D++ S +  Q SM+SI+    +L+ + GT +  T  EFVN G
Sbjct  29   QRVKRPSKSEDFWSSTTFDMDHSAVHSQGSMSSISTSQ-TLSAHVGTSSGGT-PEFVNHG  86

Query  427  YLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVD  251
             L W Q R QW G+KK ENR + V +  L W+A+YE    ++K F   +PL+EMVD LVD
Sbjct  87   LLLWNQTRQQWIGNKKDENRPKQVLEPRLSWNATYESLLGSNKRFAQRVPLAEMVDFLVD  146

Query  250  TWEEDGLY  227
             WE++G+Y
Sbjct  147  IWEQEGMY  154



>ref|XP_003604393.1| hypothetical protein MTR_4g010330 [Medicago truncatula]
 gb|AES86590.1| DUF4050 family protein [Medicago truncatula]
Length=288

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 86/145 (59%), Gaps = 21/145 (14%)
 Frame = -2

Query  610  GQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQ  431
            G+ V K S SE FW+TST+D+++S +  Q S++S ++ N ++  ++ + N  +  EFVN 
Sbjct  147  GKAVDKPSTSEDFWTTSTHDMDNSAVQSQGSISSTSLTNQAVAAHASSSNNPS--EFVNH  204

Query  430  GYLWWKQNRLQWRGSKKTENR-----------------RLVWKSILDWDASYECTAETSK  302
            G + W Q R +W G+KK ENR                 +  W  +  W+A+YE    ++K
Sbjct  205  GLILWNQTRQRWVGNKKPENRTQQLREPKLRTYFQCLAKFFW--LCSWNATYESLLTSNK  262

Query  301  PFPCPIPLSEMVDLLVDTWEEDGLY  227
            PF  PIPL+EMVD LVD WE+DGLY
Sbjct  263  PFRQPIPLAEMVDFLVDIWEQDGLY  287



>ref|XP_010539506.1| PREDICTED: uncharacterized protein LOC104813566 isoform X2 [Tarenaya 
hassleriana]
Length=151

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 82/128 (64%), Gaps = 1/128 (1%)
 Frame = -2

Query  607  QLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQG  428
            + V++ S+ E FWS ST+D+++ST   Q S++SI+  N +    +G  ++    EFVN G
Sbjct  23   RAVKRPSLLEDFWSASTFDMDNSTFPSQGSISSISASNQNFDSQAGARSSRFPTEFVNDG  82

Query  427  YLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVD  251
             L W Q R +W G ++ +NR     +  L+W+ SY+    ++KPFP P+PLSEMV+ LVD
Sbjct  83   LLLWNQTRERWVGKERHDNRVNHNREPKLNWNPSYDSLLGSNKPFPQPLPLSEMVEFLVD  142

Query  250  TWEEDGLY  227
             WE++GLY
Sbjct  143  IWEQEGLY  150



>ref|XP_006601152.1| PREDICTED: uncharacterized protein LOC100818696 isoform X3 [Glycine 
max]
Length=140

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 83/132 (63%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPN-LSLTQYSGTGNTITHEE  443
            +  GQ V K   SE FWS+ST++L+ S    QRS++SI +PN  S +Q SG G+     E
Sbjct  9    RTQGQTVSKVDGSEDFWSSSTFELDHSAAHSQRSISSIGMPNNPSDSQCSG-GSQSGAPE  67

Query  442  FVNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            FVN G L W Q R QW G+K++E+   + +  +  +A+Y+     +KP+P  IPL EM+D
Sbjct  68   FVNHGLLLWNQIRQQWVGNKRSESIAEIQEPRISSNANYDNLLGNNKPYPQRIPLREMID  127

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  128  FLVDIWEQEGLY  139



>ref|XP_010532171.1| PREDICTED: uncharacterized protein LOC104808233 isoform X1 [Tarenaya 
hassleriana]
Length=159

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 79/127 (62%), Gaps = 2/127 (2%)
 Frame = -2

Query  601  VRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQ-YSGTGNTITHEEFVNQGY  425
            V+K S SE FWSTST+D+++ST   Q S++SI   N +     +G+ N+    EFVN G 
Sbjct  32   VKKPSGSEDFWSTSTFDMDNSTFPSQGSISSIGTSNHNFADSQAGSRNSNAPTEFVNHGL  91

Query  424  LWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDT  248
              W Q R  W G K+ +N      +  L+W+ASY+    ++KPFP  +PLSEMVD LVD 
Sbjct  92   RLWNQTREHWVGKKRPDNPLNHNQEPKLNWNASYDSLLGSNKPFPQAVPLSEMVDFLVDI  151

Query  247  WEEDGLY  227
            WE++GLY
Sbjct  152  WEQEGLY  158



>gb|ABK26133.1| unknown [Picea sitchensis]
Length=172

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 82/131 (63%), Gaps = 1/131 (1%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+ G+ ++  S SE FWS+ST ++++ST+  QRS++SI+  N +    +   N   + EF
Sbjct  42   KVQGRSLKGPSFSEDFWSSSTNEMDNSTVQSQRSVSSISASNQNSDSRAANTNA-NNTEF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN   + W + R QW G +   + R + + +L W+ +YE    T++PFP  IPLSEMV+ 
Sbjct  101  VNHALILWNEMRQQWVGDRPRNHTRQLREPVLSWNTTYESLLGTNRPFPQLIPLSEMVEF  160

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  161  LVDVWEQEGLY  171



>ref|XP_008364553.1| PREDICTED: uncharacterized protein LOC103428234 isoform X1 [Malus 
domestica]
Length=310

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 87/125 (70%), Gaps = 2/125 (2%)
 Frame = -2

Query  598  RKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYLW  419
            +K SISE FW+TST+D+++S +  Q S++SI+  N +L  + G+G+  T  EFVN G L 
Sbjct  186  KKPSISEDFWTTSTWDMDNSAVQSQGSISSIST-NQTLDPHGGSGSNSTPSEFVNHGLLL  244

Query  418  WKQNRLQWRGSKKTEN-RRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWE  242
            W Q R +W G+KK+E+  + + +  L W+ASYE    +SKPFP PIPL EMVD LVD WE
Sbjct  245  WNQTRHRWVGNKKSESPSKKIREPKLSWNASYESLLGSSKPFPQPIPLPEMVDFLVDIWE  304

Query  241  EDGLY  227
            ++GLY
Sbjct  305  QEGLY  309



>ref|XP_011017767.1| PREDICTED: uncharacterized protein LOC105121001 isoform X2 [Populus 
euphratica]
Length=172

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 91/132 (69%), Gaps = 4/132 (3%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V K SIS  FWS+ST DL++ST+  QRS++SI++ N +L   S TG+  T+ EF
Sbjct  43   RIQGRAVNKPSISNDFWSSSTCDLDNSTVQSQRSISSISVSNHNLG--SSTGSLSTNNEF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W+Q RL+W GS  + N+ +  W+S L W+A+ E    +  PFP PIPLSE+VD
Sbjct  101  VNHGLLLWEQRRLRWVGSGTSGNQNQRRWESRLSWNAT-EVLLGSRNPFPRPIPLSEVVD  159

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  160  FLVDVWEQEGLY  171



>ref|XP_009785326.1| PREDICTED: uncharacterized protein LOC104233601 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009785327.1| PREDICTED: uncharacterized protein LOC104233601 isoform X2 [Nicotiana 
sylvestris]
Length=107

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = -2

Query  487  LTQYSGTGNTITHEEFVNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAET  308
            L Q+ GTG+   + EFVNQGYL W Q+RLQW  SKK ENR +V + +L+W+ SYE    T
Sbjct  21   LAQHGGTGSASNNNEFVNQGYLLWNQSRLQWLASKKPENR-IVEEPMLNWNVSYESLFGT  79

Query  307  SKPFPCPIPLSEMVDLLVDTWEEDGLY  227
            +K FP PIPLS+MVD L D WE +GLY
Sbjct  80   NKRFPQPIPLSDMVDFLADIWEHEGLY  106



>ref|XP_011017766.1| PREDICTED: uncharacterized protein LOC105121001 isoform X1 [Populus 
euphratica]
Length=191

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 91/132 (69%), Gaps = 4/132 (3%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V K SIS  FWS+ST DL++ST+  QRS++SI++ N +L   S TG+  T+ EF
Sbjct  62   RIQGRAVNKPSISNDFWSSSTCDLDNSTVQSQRSISSISVSNHNLG--SSTGSLSTNNEF  119

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W+Q RL+W GS  + N+ +  W+S L W+A+ E    +  PFP PIPLSE+VD
Sbjct  120  VNHGLLLWEQRRLRWVGSGTSGNQNQRRWESRLSWNAT-EVLLGSRNPFPRPIPLSEVVD  178

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  179  FLVDVWEQEGLY  190



>ref|XP_003571413.1| PREDICTED: uncharacterized protein LOC100833399 isoform X2 [Brachypodium 
distachyon]
Length=173

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 84/132 (64%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G+ ++  ++S  +WSTS  ++E+S +  QRS++SI+    S  Q+ G G++   +EF
Sbjct  42   KIQGRSIKHRTLSGDYWSTSPPEMENSALQSQRSVSSISTAAQSSDQH-GAGSSSNPKEF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRL-VWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VNQG L W Q R QW G++   ++R    +  + W+A+YE    ++K F  PIPL EMVD
Sbjct  101  VNQGLLLWNQTRQQWVGNRMLHSQRQKTREPKIGWNATYESLLGSTKAFARPIPLGEMVD  160

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  161  FLVDGWEQEGLY  172



>ref|XP_003550180.1| PREDICTED: uncharacterized protein LOC100818696 isoform X1 [Glycine 
max]
Length=176

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 83/132 (63%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPN-LSLTQYSGTGNTITHEE  443
            +  GQ V K   SE FWS+ST++L+ S    QRS++SI +PN  S +Q SG G+     E
Sbjct  45   RTQGQTVSKVDGSEDFWSSSTFELDHSAAHSQRSISSIGMPNNPSDSQCSG-GSQSGAPE  103

Query  442  FVNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            FVN G L W Q R QW G+K++E+   + +  +  +A+Y+     +KP+P  IPL EM+D
Sbjct  104  FVNHGLLLWNQIRQQWVGNKRSESIAEIQEPRISSNANYDNLLGNNKPYPQRIPLREMID  163

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  164  FLVDIWEQEGLY  175



>ref|XP_004287308.1| PREDICTED: uncharacterized protein LOC101293626 [Fragaria vesca 
subsp. vesca]
Length=177

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 91/134 (68%), Gaps = 3/134 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            KI G+ V+K  +S+ FWS+STYDL++S +  QRS++SI+  + +L Q S  G+T +  +F
Sbjct  43   KIQGRAVKKPGLSDDFWSSSTYDLDNSALQSQRSISSISTLHQTLLQGSSIGSTSSQPDF  102

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWK-SILDWDASYE--CTAETSKPFPCPIPLSEM  269
            VNQG + W Q RL+W GS K +N  L  + S L W+++YE     +  +PFP  +PLSEM
Sbjct  103  VNQGLVLWNQTRLEWTGSGKPKNEALRSRESRLSWNSTYERLVGPKQRQPFPQRVPLSEM  162

Query  268  VDLLVDTWEEDGLY  227
            ++ LV+ WE++GLY
Sbjct  163  IEFLVEVWEQEGLY  176



>ref|XP_002325222.1| hypothetical protein POPTR_0018s13080g [Populus trichocarpa]
 gb|ABK95403.1| unknown [Populus trichocarpa]
 gb|EEF03787.1| hypothetical protein POPTR_0018s13080g [Populus trichocarpa]
Length=172

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 91/132 (69%), Gaps = 4/132 (3%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V K SIS  FWS+ST DL++ST+  QRS++SI++ N +L   S TG+  ++ EF
Sbjct  43   RIQGRAVNKPSISNEFWSSSTCDLDNSTVQSQRSISSISVSNHNLG--SSTGSMSSNNEF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G L W+Q RL+W GS  + N+ +  W+S L W+A+ E    +  PFP PIPLSE+VD
Sbjct  101  VNHGLLLWQQRRLRWVGSGTSGNQNQRRWESRLSWNAT-EGLQGSRNPFPRPIPLSEIVD  159

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  160  FLVDVWEQEGLY  171



>ref|XP_010648667.1| PREDICTED: uncharacterized protein LOC100254371 isoform X5 [Vitis 
vinifera]
Length=181

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 84/138 (61%), Gaps = 8/138 (6%)
 Frame = -2

Query  616  IHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFV  437
            I G+   + S  E FWSTST ++++S +  Q S++SI+  N +   +S  G+T    EFV
Sbjct  43   IQGRTAMRPSPVEDFWSTSTGEMDNSAVQSQGSISSISTSNQTFDPHSNAGSTSNPPEFV  102

Query  436  NQGYLWWKQNRLQWRGSKKTENRRLVWKSIL--------DWDASYECTAETSKPFPCPIP  281
            N G L W Q R QW G++K++NR+ V +  +         W+A+YE    T+KP P PIP
Sbjct  103  NHGLLLWNQTRQQWIGNQKSQNRKQVQEPRIRSETSIDHGWNATYESLLGTNKPLPQPIP  162

Query  280  LSEMVDLLVDTWEEDGLY  227
            L EMVD LVD WE++GLY
Sbjct  163  LPEMVDFLVDVWEQEGLY  180



>ref|XP_010648665.1| PREDICTED: uncharacterized protein LOC100254371 isoform X3 [Vitis 
vinifera]
Length=190

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 84/138 (61%), Gaps = 8/138 (6%)
 Frame = -2

Query  616  IHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFV  437
            I G+   + S  E FWSTST ++++S +  Q S++SI+  N +   +S  G+T    EFV
Sbjct  52   IQGRTAMRPSPVEDFWSTSTGEMDNSAVQSQGSISSISTSNQTFDPHSNAGSTSNPPEFV  111

Query  436  NQGYLWWKQNRLQWRGSKKTENRRLVWKSIL--------DWDASYECTAETSKPFPCPIP  281
            N G L W Q R QW G++K++NR+ V +  +         W+A+YE    T+KP P PIP
Sbjct  112  NHGLLLWNQTRQQWIGNQKSQNRKQVQEPRIRSETSIDHGWNATYESLLGTNKPLPQPIP  171

Query  280  LSEMVDLLVDTWEEDGLY  227
            L EMVD LVD WE++GLY
Sbjct  172  LPEMVDFLVDVWEQEGLY  189



>ref|XP_006595165.1| PREDICTED: uncharacterized protein LOC100802439 isoform X2 [Glycine 
max]
Length=156

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 82/130 (63%), Gaps = 4/130 (3%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVN  434
             G+  +K S SE FW TST+D+++S +  Q S++S +I N +   + G+ N     EFVN
Sbjct  29   QGKAAKKPSTSEDFWITSTHDMDNSAVQSQGSISSASITNQAADPHGGSCNPT---EFVN  85

Query  433  QGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
             G + W Q R  W G+K+++N+   + +  L W+A+YE    ++KPFP  I L+EMV+ L
Sbjct  86   HGLILWNQTRQAWIGNKRSKNQTEQLREPKLSWNATYESLLGSNKPFPQHISLAEMVEFL  145

Query  256  VDTWEEDGLY  227
            VD WE++GLY
Sbjct  146  VDIWEQEGLY  155



>ref|XP_010476619.1| PREDICTED: uncharacterized protein LOC104755850 isoform X1 [Camelina 
sativa]
Length=154

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 79/127 (62%), Gaps = 6/127 (5%)
 Frame = -2

Query  601  VRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYL  422
            ++K S+SE FWSTST D+++ T   Q S++S    N +   +SG  NT    EFVNQG L
Sbjct  31   IKKPSVSEDFWSTSTVDMDNITFPSQGSLSS----NQTFDSHSGARNTNAPPEFVNQGLL  86

Query  421  WWKQNRLQWRGSKKTEN-RRLVWKSILDWDA-SYECTAETSKPFPCPIPLSEMVDLLVDT  248
             W Q R +W G  K  N R     + L+W+A SY+    ++K FP PIPL+EMVD LVD 
Sbjct  87   LWNQTRERWVGKDKPTNPRDRNHGAKLNWNAASYDNLLGSNKLFPQPIPLTEMVDFLVDI  146

Query  247  WEEDGLY  227
            WE++GLY
Sbjct  147  WEQEGLY  153



>ref|XP_010497045.1| PREDICTED: uncharacterized protein LOC104774078 isoform X1 [Camelina 
sativa]
 ref|XP_010497054.1| PREDICTED: uncharacterized protein LOC104774084 isoform X1 [Camelina 
sativa]
 ref|XP_010497056.1| PREDICTED: uncharacterized protein LOC104774084 isoform X1 [Camelina 
sativa]
 ref|XP_010497059.1| PREDICTED: uncharacterized protein LOC104774084 isoform X1 [Camelina 
sativa]
 ref|XP_010497079.1| PREDICTED: uncharacterized protein LOC104774109 isoform X1 [Camelina 
sativa]
Length=154

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 6/127 (5%)
 Frame = -2

Query  601  VRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYL  422
            ++K S+SE FWSTST D+++ST   Q S++S    N +   +SG  NT    EFVNQG L
Sbjct  31   IKKPSVSEDFWSTSTVDMDNSTFPSQGSLSS----NQTFDSHSGARNTNAPPEFVNQGLL  86

Query  421  WWKQNRLQWRGSKKTENR-RLVWKSILDWDA-SYECTAETSKPFPCPIPLSEMVDLLVDT  248
             W Q R +W G +K  N       + L+W+A SY+    ++K FP PIPL+EMVD LVD 
Sbjct  87   LWNQTRERWVGKEKPTNPPDRNHGAKLNWNAASYDNLLGSNKLFPQPIPLTEMVDFLVDI  146

Query  247  WEEDGLY  227
            WE++GLY
Sbjct  147  WEQEGLY  153



>ref|XP_010322715.1| PREDICTED: uncharacterized protein LOC101261629 isoform X2 [Solanum 
lycopersicum]
Length=173

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 82/131 (63%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+  + +RK+S+ + FWS+S  ++E+ST   QRS++SI+  N +L  +S +G T +  EF
Sbjct  42   KVPSKRLRKTSLRDDFWSSSACEMENSTFPSQRSISSISTSNPALDPHSNSGTTSSTSEF  101

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW G+K  +    V +  L  D +Y     T+K FP PIPL EMVD 
Sbjct  102  VNHGLLLWNQTRQQWCGNKTPQKGASVREPKLSSDTNYVTLLGTNKLFPQPIPLPEMVDF  161

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  162  LVDVWEQEGLY  172



>ref|XP_010539505.1| PREDICTED: uncharacterized protein LOC104813566 isoform X1 [Tarenaya 
hassleriana]
Length=166

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 83/145 (57%), Gaps = 20/145 (14%)
 Frame = -2

Query  607  QLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQG  428
            + V++ S+ E FWS ST+D+++ST   Q S++SI+  N +    +G  ++    EFVN G
Sbjct  23   RAVKRPSLLEDFWSASTFDMDNSTFPSQGSISSISASNQNFDSQAGARSSRFPTEFVNDG  82

Query  427  YLWWKQNRLQWRGSKKTENR------------------RLVWKSILDWDASYECTAETSK  302
             L W Q R +W G ++ +NR                  +L W  I  W+ SY+    ++K
Sbjct  83   LLLWNQTRERWVGKERHDNRVNHNREPKLKALVVSAMAKLCW--ICSWNPSYDSLLGSNK  140

Query  301  PFPCPIPLSEMVDLLVDTWEEDGLY  227
            PFP P+PLSEMV+ LVD WE++GLY
Sbjct  141  PFPQPLPLSEMVEFLVDIWEQEGLY  165



>ref|XP_006596105.1| PREDICTED: uncharacterized protein LOC100793281 [Glycine max]
Length=169

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 77/131 (59%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +  GQ V K   SE FWS+ST+ L+ S    QRS++SI +PN      S  G+     EF
Sbjct  38   RTQGQTVTKVDGSEDFWSSSTFKLDHSAAHSQRSISSIGMPNNPSDPQSSGGSQTGPPEF  97

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W   R QW G+K++E+   + +  +  +A+YE     +KPFP  IP+ EM++ 
Sbjct  98   VNHGLLLWNHIRQQWIGNKRSESITEIQEPRISSNATYENLLGNNKPFPQRIPMKEMINF  157

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  158  LVDIWEQEGLY  168



>ref|XP_010648663.1| PREDICTED: uncharacterized protein LOC100254371 isoform X1 [Vitis 
vinifera]
Length=215

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 84/138 (61%), Gaps = 8/138 (6%)
 Frame = -2

Query  616  IHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFV  437
            I G+   + S  E FWSTST ++++S +  Q S++SI+  N +   +S  G+T    EFV
Sbjct  77   IQGRTAMRPSPVEDFWSTSTGEMDNSAVQSQGSISSISTSNQTFDPHSNAGSTSNPPEFV  136

Query  436  NQGYLWWKQNRLQWRGSKKTENRRLVWKSIL--------DWDASYECTAETSKPFPCPIP  281
            N G L W Q R QW G++K++NR+ V +  +         W+A+YE    T+KP P PIP
Sbjct  137  NHGLLLWNQTRQQWIGNQKSQNRKQVQEPRIRSETSIDHGWNATYESLLGTNKPLPQPIP  196

Query  280  LSEMVDLLVDTWEEDGLY  227
            L EMVD LVD WE++GLY
Sbjct  197  LPEMVDFLVDVWEQEGLY  214



>gb|KHN44177.1| hypothetical protein glysoja_031838 [Glycine soja]
Length=170

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 82/130 (63%), Gaps = 4/130 (3%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVN  434
             G+  +K S SE FW TST+D+++S +  Q S++S +I N +   + G+ N     EFVN
Sbjct  43   QGKAAKKPSTSEDFWITSTHDMDNSAVQSQGSISSASITNQAADPHGGSCNPT---EFVN  99

Query  433  QGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
             G + W Q R  W G+K+++N+   + +  L W+A+YE    ++KPFP  I L+EMV+ L
Sbjct  100  HGLILWNQTRQAWIGNKRSKNQTEQLREPKLSWNATYESLLGSNKPFPQHISLAEMVEFL  159

Query  256  VDTWEEDGLY  227
            VD WE++GLY
Sbjct  160  VDIWEQEGLY  169



>ref|XP_006601151.1| PREDICTED: uncharacterized protein LOC100818696 isoform X2 [Glycine 
max]
Length=208

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 83/132 (63%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPN-LSLTQYSGTGNTITHEE  443
            +  GQ V K   SE FWS+ST++L+ S    QRS++SI +PN  S +Q SG G+     E
Sbjct  77   RTQGQTVSKVDGSEDFWSSSTFELDHSAAHSQRSISSIGMPNNPSDSQCSG-GSQSGAPE  135

Query  442  FVNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            FVN G L W Q R QW G+K++E+   + +  +  +A+Y+     +KP+P  IPL EM+D
Sbjct  136  FVNHGLLLWNQIRQQWVGNKRSESIAEIQEPRISSNANYDNLLGNNKPYPQRIPLREMID  195

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  196  FLVDIWEQEGLY  207



>ref|XP_003542117.1| PREDICTED: uncharacterized protein LOC100802439 isoform X1 [Glycine 
max]
Length=193

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 83/132 (63%), Gaps = 4/132 (3%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +  G+  +K S SE FW TST+D+++S +  Q S++S +I N +   + G+ N     EF
Sbjct  64   RKQGKAAKKPSTSEDFWITSTHDMDNSAVQSQGSISSASITNQAADPHGGSCNPT---EF  120

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VN G + W Q R  W G+K+++N+   + +  L W+A+YE    ++KPFP  I L+EMV+
Sbjct  121  VNHGLILWNQTRQAWIGNKRSKNQTEQLREPKLSWNATYESLLGSNKPFPQHISLAEMVE  180

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  181  FLVDIWEQEGLY  192



>ref|XP_004241775.1| PREDICTED: uncharacterized protein LOC101261629 isoform X1 [Solanum 
lycopersicum]
Length=207

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 82/131 (63%), Gaps = 0/131 (0%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            K+  + +RK+S+ + FWS+S  ++E+ST   QRS++SI+  N +L  +S +G T +  EF
Sbjct  76   KVPSKRLRKTSLRDDFWSSSACEMENSTFPSQRSISSISTSNPALDPHSNSGTTSSTSEF  135

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W Q R QW G+K  +    V +  L  D +Y     T+K FP PIPL EMVD 
Sbjct  136  VNHGLLLWNQTRQQWCGNKTPQKGASVREPKLSSDTNYVTLLGTNKLFPQPIPLPEMVDF  195

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  196  LVDVWEQEGLY  206



>gb|KEH32117.1| DUF4050 family protein [Medicago truncatula]
Length=199

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 86/159 (54%), Gaps = 28/159 (18%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I GQ +RK + S+GFWS+S  DL++STI  QRS++S++  N  L Q +G     T  EF
Sbjct  40   RIQGQTMRKPTTSDGFWSSSPCDLDNSTIQSQRSISSVSTLNQILYQSNGASTPGTEPEF  99

Query  439  VNQGYLWWKQNRLQWRG-------------SKKTENRRLVWKSILDW-------------  338
            VNQG   W ++RLQW G             S+   +R  V   + ++             
Sbjct  100  VNQGLHLWNESRLQWVGRGLSEKQNQQKQESRLNSSRPFVLSCLSEFLPCEWLINHCVCC  159

Query  337  --DASYECTAETSKPFPCPIPLSEMVDLLVDTWEEDGLY  227
              +A+YE    T +PFP  +PLSEMV+ LVD WE +G+Y
Sbjct  160  SRNATYESLLGTRQPFPKSVPLSEMVEFLVDVWEREGMY  198



>ref|XP_004241696.1| PREDICTED: uncharacterized protein LOC101263220 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010322669.1| PREDICTED: uncharacterized protein LOC101263220 isoform X2 [Solanum 
lycopersicum]
Length=157

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 76/134 (57%), Gaps = 1/134 (1%)
 Frame = -2

Query  625  ESKIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHE  446
            E K    LV K+ +S  FWSTST D+++ +    +   S    +       G  NT  H 
Sbjct  23   EKKHLDHLVHKAKLSADFWSTSTGDMDNYSAAQSQGSISSISTSTQAPDAHGAANTNNHS  82

Query  445  EFVNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEM  269
            EFVN G++ W Q R QW G K  E + + + +  L W+A+Y+    ++KPFP  IPL+EM
Sbjct  83   EFVNHGFIRWNQIRQQWVGRKSPEKQPKQLLEPKLSWNATYDSLLGSNKPFPKRIPLAEM  142

Query  268  VDLLVDTWEEDGLY  227
            VD LVD WE++G+Y
Sbjct  143  VDFLVDVWEQEGMY  156



>ref|XP_010459057.1| PREDICTED: uncharacterized protein LOC104740221 isoform X1 [Camelina 
sativa]
 ref|XP_010459058.1| PREDICTED: uncharacterized protein LOC104740221 isoform X1 [Camelina 
sativa]
 ref|XP_010459059.1| PREDICTED: uncharacterized protein LOC104740221 isoform X1 [Camelina 
sativa]
Length=154

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 80/129 (62%), Gaps = 10/129 (8%)
 Frame = -2

Query  601  VRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYL  422
            ++K S+SE FWSTST D+++ T   Q S++S    N +   +SG  NT    EFVNQG L
Sbjct  31   IKKPSVSEDFWSTSTVDMDNITFPSQGSLSS----NQTFDSHSGARNTNAPPEFVNQGLL  86

Query  421  WWKQNRLQWRGSKKTEN---RRLVWKSILDWDA-SYECTAETSKPFPCPIPLSEMVDLLV  254
             W Q R +W G +K  N   R    K  L+W+A SY+    ++K FP PIPL+EMVD LV
Sbjct  87   LWNQTRERWVGKEKPTNLPDRNQGAK--LNWNAASYDNLLGSNKLFPQPIPLTEMVDFLV  144

Query  253  DTWEEDGLY  227
            D WE++GLY
Sbjct  145  DVWEQEGLY  153



>ref|XP_010322666.1| PREDICTED: uncharacterized protein LOC101263220 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322667.1| PREDICTED: uncharacterized protein LOC101263220 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322668.1| PREDICTED: uncharacterized protein LOC101263220 isoform X1 [Solanum 
lycopersicum]
Length=160

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 76/134 (57%), Gaps = 1/134 (1%)
 Frame = -2

Query  625  ESKIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHE  446
            E K    LV K+ +S  FWSTST D+++ +    +   S    +       G  NT  H 
Sbjct  26   EKKHLDHLVHKAKLSADFWSTSTGDMDNYSAAQSQGSISSISTSTQAPDAHGAANTNNHS  85

Query  445  EFVNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEM  269
            EFVN G++ W Q R QW G K  E + + + +  L W+A+Y+    ++KPFP  IPL+EM
Sbjct  86   EFVNHGFIRWNQIRQQWVGRKSPEKQPKQLLEPKLSWNATYDSLLGSNKPFPKRIPLAEM  145

Query  268  VDLLVDTWEEDGLY  227
            VD LVD WE++G+Y
Sbjct  146  VDFLVDVWEQEGMY  159



>ref|XP_006356214.1| PREDICTED: uncharacterized protein LOC102596461 isoform X3 [Solanum 
tuberosum]
Length=157

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 1/134 (1%)
 Frame = -2

Query  625  ESKIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHE  446
            E K    LV K+ +S  FW+TST D+++ +    +   S    +       G  NT  H 
Sbjct  23   EKKHLDHLVHKAKLSADFWTTSTRDMDNYSAAQSQGSISSISTSTQTPDAHGAANTNNHS  82

Query  445  EFVNQGYLWWKQNRLQWRGSKKTEN-RRLVWKSILDWDASYECTAETSKPFPCPIPLSEM  269
            EFVN G++ W Q R QW G K  E  ++ + +  L W+A+Y+    ++KPFP  IPL+EM
Sbjct  83   EFVNHGFIRWNQIRQQWVGRKNPEKQQKQLLEPKLSWNATYDSLLGSNKPFPKRIPLAEM  142

Query  268  VDLLVDTWEEDGLY  227
            VD LVD WE++G+Y
Sbjct  143  VDFLVDVWEQEGMY  156



>ref|XP_006356212.1| PREDICTED: uncharacterized protein LOC102596461 isoform X1 [Solanum 
tuberosum]
 ref|XP_006356213.1| PREDICTED: uncharacterized protein LOC102596461 isoform X2 [Solanum 
tuberosum]
Length=160

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 1/134 (1%)
 Frame = -2

Query  625  ESKIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHE  446
            E K    LV K+ +S  FW+TST D+++ +    +   S    +       G  NT  H 
Sbjct  26   EKKHLDHLVHKAKLSADFWTTSTRDMDNYSAAQSQGSISSISTSTQTPDAHGAANTNNHS  85

Query  445  EFVNQGYLWWKQNRLQWRGSKKTEN-RRLVWKSILDWDASYECTAETSKPFPCPIPLSEM  269
            EFVN G++ W Q R QW G K  E  ++ + +  L W+A+Y+    ++KPFP  IPL+EM
Sbjct  86   EFVNHGFIRWNQIRQQWVGRKNPEKQQKQLLEPKLSWNATYDSLLGSNKPFPKRIPLAEM  145

Query  268  VDLLVDTWEEDGLY  227
            VD LVD WE++G+Y
Sbjct  146  VDFLVDVWEQEGMY  159



>ref|XP_009148922.1| PREDICTED: uncharacterized protein LOC103872326 isoform X1 [Brassica 
rapa]
Length=152

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 77/129 (60%), Gaps = 5/129 (4%)
 Frame = -2

Query  610  GQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQ  431
             Q V+K S+SE  WSTST D+++ T   Q    SI+  N +    S   N+    EFVNQ
Sbjct  27   AQTVKKPSVSEDLWSTSTVDMDNITFPSQGG--SISSSNQTFDSQSAARNSNPPHEFVNQ  84

Query  430  GYLWWKQNRLQWRGSKKTENRRLVWKSILDWD-ASYECTAETSKPFPCPIPLSEMVDLLV  254
            G L W Q R +W G ++  NR     S ++W+ ASY+    ++K FP PIPLSEMVD LV
Sbjct  85   GILLWNQTRERWVGKERASNRNR--GSKINWNTASYDSLLGSNKLFPQPIPLSEMVDFLV  142

Query  253  DTWEEDGLY  227
            + WE+DGLY
Sbjct  143  EVWEQDGLY  151



>ref|XP_009364027.1| PREDICTED: uncharacterized protein LOC103953940 [Pyrus x bretschneideri]
Length=180

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 88/143 (62%), Gaps = 19/143 (13%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHE-E  443
            +I G+ V+K  IS+ FWS+STYDL++S +  QRS++SI+  N +    S  G++++ + +
Sbjct  44   RIQGRSVKKPGISDEFWSSSTYDLDNSAVQSQRSVSSISASNQTPNYGSVAGSSMSSQSD  103

Query  442  FVNQGYLWWKQNRLQWRGS--------KKTENRRLVWKSILDWDASYE---CTAETSKPF  296
            FVN G + W QNRL+W GS        K  ENR       + W+A+YE    T +   P+
Sbjct  104  FVNNGLVLWNQNRLEWIGSGNPRNQIPKSRENR-------VSWNATYERLVGTKQRQSPY  156

Query  295  PCPIPLSEMVDLLVDTWEEDGLY  227
               IPLS+M++ LV+ WE++GLY
Sbjct  157  TQRIPLSDMIEFLVEVWEQEGLY  179



>ref|XP_010691147.1| PREDICTED: uncharacterized protein LOC104904564 isoform X5 [Beta 
vulgaris subsp. vulgaris]
Length=154

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 78/130 (60%), Gaps = 4/130 (3%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVN  434
             GQ  R  SIS  +W+TS  D+++S +  Q S++SI   N S+   SG  ++    E+VN
Sbjct  27   RGQTRRVPSISRDYWTTSVCDMDNSAMQSQGSLSSI---NASIDTPSGVSSSNPPSEYVN  83

Query  433  QGYLWWKQNRLQWRGSKKTENRR-LVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
             G L W Q R +W  +K   N+R  V    + W+A+YE    ++KPF  P+PL+EMVD L
Sbjct  84   HGLLLWNQTRQRWVDNKNQSNKRHQVRDPKISWNATYESLLGSNKPFSQPVPLAEMVDFL  143

Query  256  VDTWEEDGLY  227
            VD WE++G+Y
Sbjct  144  VDIWEQEGMY  153



>ref|XP_002453499.1| hypothetical protein SORBIDRAFT_04g006900 [Sorghum bicolor]
 gb|EES06475.1| hypothetical protein SORBIDRAFT_04g006900 [Sorghum bicolor]
Length=173

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 86/132 (65%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V++ ++S+ FWS+S +++E+S +  + SM+SI+       Q++ +G++ +  +F
Sbjct  42   RIQGRSVKRHNLSDDFWSSSPHEMENSALQSRHSMSSISTAAQPNDQHA-SGSSSSPNDF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VNQG L W Q R  W G ++  ++ +   +  +  +A+YE    +SKPFP PIPL EMVD
Sbjct  101  VNQGLLLWHQTRQHWIGKRRRNSQGQQSQEPKISGNATYESLLGSSKPFPQPIPLGEMVD  160

Query  262  LLVDTWEEDGLY  227
             LV +WE++GLY
Sbjct  161  FLVVSWEQEGLY  172



>ref|XP_008681282.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=177

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 85/132 (64%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V++ ++S+ FWS+S +++E+S +  + SM+SI+       Q++ +G++ +  EF
Sbjct  46   RIQGRSVKRHNLSDDFWSSSPHEMENSALQSRHSMSSISTAAQPNDQHA-SGSSSSPNEF  104

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VNQG L W Q R QW G ++  ++ +      +  +A+YE    +SKPFP PIPL EMV 
Sbjct  105  VNQGLLLWHQTRQQWIGKRRHNSQGQQSQGPKISCNATYESLLGSSKPFPQPIPLGEMVG  164

Query  262  LLVDTWEEDGLY  227
             LV +WE++GLY
Sbjct  165  FLVISWEQEGLY  176



>ref|XP_004501332.1| PREDICTED: uncharacterized protein LOC101496661 isoform X1 [Cicer 
arietinum]
Length=190

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 74/130 (57%), Gaps = 1/130 (1%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNL-SLTQYSGTGNTITHEEFV  437
              Q + K + SE FWS+S  +L+      QRS++SI + N  S    S  G      EFV
Sbjct  60   QAQNMNKDNRSEDFWSSSAIELDHGANQSQRSVSSIAMSNHPSSDPQSSEGIQTDPPEFV  119

Query  436  NQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
            N G L W Q R QW G++++E +    +  + W+A+YE    TSKPFP  IPL EMVD L
Sbjct  120  NHGLLLWNQTRQQWVGNRRSERQTQAGEPKISWNATYESLLGTSKPFPQHIPLGEMVDFL  179

Query  256  VDTWEEDGLY  227
            VD WE +G+Y
Sbjct  180  VDIWELEGMY  189



>ref|NP_001142741.1| hypothetical protein [Zea mays]
 gb|ACG26328.1| hypothetical protein [Zea mays]
 gb|ACN34847.1| unknown [Zea mays]
 gb|AFW66151.1| hypothetical protein ZEAMMB73_306186 [Zea mays]
Length=173

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 85/132 (64%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V++ ++S+ FWS+S +++E+S +  + SM+SI+       Q+  +G + +  EF
Sbjct  42   RIQGRSVKRRNVSDDFWSSSPHEMENSALQSRHSMSSISTAAQPNDQHV-SGTSSSPNEF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VNQG L W Q R QW G+++  ++ +   +  +  +A+YE    +SKPFP P PL EMVD
Sbjct  101  VNQGLLLWHQTRQQWIGNRRLNSQGQQSQEPKISCNATYESLLGSSKPFPQPTPLGEMVD  160

Query  262  LLVDTWEEDGLY  227
             LV +WE++GLY
Sbjct  161  FLVVSWEQEGLY  172



>ref|XP_006306126.1| hypothetical protein CARUB_v10011587mg [Capsella rubella]
 gb|EOA39024.1| hypothetical protein CARUB_v10011587mg [Capsella rubella]
Length=258

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 80/127 (63%), Gaps = 6/127 (5%)
 Frame = -2

Query  601  VRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYL  422
            ++K S+SE FWSTST D++++T   Q S++S    N +   +SG  NT    EFVNQG L
Sbjct  135  IKKPSVSEDFWSTSTVDMDNNTFPSQGSLSS----NQTFDSHSGARNTNAPPEFVNQGLL  190

Query  421  WWKQNRLQWRGSKKTENRRLVWKSI-LDWDA-SYECTAETSKPFPCPIPLSEMVDLLVDT  248
             W Q R +W G +KT N     +    +W+A SY+    ++K FP PIPL+EMVD LVD 
Sbjct  191  LWNQTRERWVGKEKTTNLPDRNQGANFNWNAASYDSLLGSNKLFPQPIPLTEMVDFLVDI  250

Query  247  WEEDGLY  227
            WE++GLY
Sbjct  251  WEQEGLY  257



>ref|XP_008681284.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
 gb|ACG42492.1| hypothetical protein [Zea mays]
 gb|AFW70690.1| hypothetical protein ZEAMMB73_591362 [Zea mays]
Length=173

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 85/132 (64%), Gaps = 2/132 (2%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+ V++ ++S+ FWS+S +++E+S +  + SM+SI+       Q++ +G++ +  EF
Sbjct  42   RIQGRSVKRHNLSDDFWSSSPHEMENSALQSRHSMSSISTAAQPNDQHA-SGSSSSPNEF  100

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            VNQG L W Q R QW G ++  ++ +      +  +A+YE    +SKPFP PIPL EMV 
Sbjct  101  VNQGLLLWHQTRQQWIGKRRHNSQGQQSQGPKISCNATYESLLGSSKPFPQPIPLGEMVG  160

Query  262  LLVDTWEEDGLY  227
             LV +WE++GLY
Sbjct  161  FLVISWEQEGLY  172



>ref|XP_004501333.1| PREDICTED: uncharacterized protein LOC101496661 isoform X2 [Cicer 
arietinum]
Length=176

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 74/130 (57%), Gaps = 1/130 (1%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNL-SLTQYSGTGNTITHEEFV  437
              Q + K + SE FWS+S  +L+      QRS++SI + N  S    S  G      EFV
Sbjct  46   QAQNMNKDNRSEDFWSSSAIELDHGANQSQRSVSSIAMSNHPSSDPQSSEGIQTDPPEFV  105

Query  436  NQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
            N G L W Q R QW G++++E +    +  + W+A+YE    TSKPFP  IPL EMVD L
Sbjct  106  NHGLLLWNQTRQQWVGNRRSERQTQAGEPKISWNATYESLLGTSKPFPQHIPLGEMVDFL  165

Query  256  VDTWEEDGLY  227
            VD WE +G+Y
Sbjct  166  VDIWELEGMY  175



>ref|XP_011081379.1| PREDICTED: uncharacterized protein LOC105164424 isoform X1 [Sesamum 
indicum]
Length=179

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 79/130 (61%), Gaps = 2/130 (2%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVN  434
            +G    K S+SE FW+TST ++E+S +    S++S T   + +    G G +    EFVN
Sbjct  50   YGWKTSKGSLSEDFWTTSTVEMENSALQSHGSISS-TSTLMQVQDAYGAGCSSKPSEFVN  108

Query  433  QGYLWWKQNRLQWRGSKKTENRR-LVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
             G + W Q R +W G+KK ENR   + +  L W+A+Y+    ++KPF  PIPL EMVD L
Sbjct  109  HGLILWNQTRQKWTGNKKPENRADELLEPRLSWNATYDSLLSSNKPFRQPIPLGEMVDFL  168

Query  256  VDTWEEDGLY  227
            VD WE++G+Y
Sbjct  169  VDIWEQEGMY  178



>emb|CDX80504.1| BnaC07g29400D [Brassica napus]
Length=172

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 81/132 (61%), Gaps = 4/132 (3%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLES-STIMPQRSMTSITIPNLSLTQYSGTGNTITHEE  443
            +I G+LV+K S+S+ FWSTST D+++ ST+  QRS++SI+    +    +   ++    E
Sbjct  43   RIQGRLVKKPSVSDDFWSTSTCDMDNNSTMQSQRSVSSIS---FTNNTATSASSSSNPNE  99

Query  442  FVNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            FVN G   W Q R QW  S  ++ +  V +  + W+A+YE     +K F  PIPL EMVD
Sbjct  100  FVNTGLNLWNQTRQQWLASGSSQTKAKVREPTISWNATYESLLGVNKRFSRPIPLPEMVD  159

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  160  FLVDVWEQEGLY  171



>ref|XP_006416916.1| hypothetical protein EUTSA_v10009002mg [Eutrema salsugineum]
 ref|XP_006416917.1| hypothetical protein EUTSA_v10009002mg [Eutrema salsugineum]
 ref|XP_006416919.1| hypothetical protein EUTSA_v10009002mg [Eutrema salsugineum]
 gb|ESQ35269.1| hypothetical protein EUTSA_v10009002mg [Eutrema salsugineum]
 gb|ESQ35270.1| hypothetical protein EUTSA_v10009002mg [Eutrema salsugineum]
 gb|ESQ35272.1| hypothetical protein EUTSA_v10009002mg [Eutrema salsugineum]
Length=152

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 80/132 (61%), Gaps = 10/132 (8%)
 Frame = -2

Query  610  GQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQ  431
             Q + K S+SE FWSTST D++++T   Q S++S    N +    SG  N+    EFVNQ
Sbjct  26   AQTITKPSVSEDFWSTSTIDMDNTTFPSQGSISS----NQTFDSQSGARNSNAPPEFVNQ  81

Query  430  GYLWWKQNRLQWRGSKKTEN---RRLVWKSILDWDA-SYECTAETSKPFPCPIPLSEMVD  263
            G L W Q R +W G ++  N   R    K  L+W+A SY+    ++K FP PIPL+EMVD
Sbjct  82   GLLLWNQTRERWVGKERLNNPPDRNQGAK--LNWNAASYDSLLGSNKLFPQPIPLTEMVD  139

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  140  FLVDIWEQEGLY  151



>gb|KHG26267.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Gossypium 
arboreum]
Length=152

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 88/146 (60%), Gaps = 18/146 (12%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            ++ GQ VRK+ ISE FW+TS  D+++S    Q S++SI++ N SL  +   GN  +  EF
Sbjct  9    EVPGQTVRKTCISEDFWTTSACDMDNSAAQSQGSISSISVINQSLDPH---GNANSPSEF  65

Query  439  VNQGYLWWKQNRLQWRGSKKTENR-RLVWKSILD--------------WDASYECTAETS  305
            VN G L W + R QW G+KK+ENR + V +  L               W+A+YE     +
Sbjct  66   VNHGLLLWNRTRQQWIGNKKSENRPQKVREPKLSTYGLSMVNPFWPCSWNATYESLLGNN  125

Query  304  KPFPCPIPLSEMVDLLVDTWEEDGLY  227
            KPFP PIPL EM+D LVD WE++GLY
Sbjct  126  KPFPQPIPLPEMIDFLVDIWEQEGLY  151



>ref|XP_010691145.1| PREDICTED: uncharacterized protein LOC104904564 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=183

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 78/130 (60%), Gaps = 4/130 (3%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVN  434
             GQ  R  SIS  +W+TS  D+++S +  Q S++SI   N S+   SG  ++    E+VN
Sbjct  56   RGQTRRVPSISRDYWTTSVCDMDNSAMQSQGSLSSI---NASIDTPSGVSSSNPPSEYVN  112

Query  433  QGYLWWKQNRLQWRGSKKTENRR-LVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLL  257
             G L W Q R +W  +K   N+R  V    + W+A+YE    ++KPF  P+PL+EMVD L
Sbjct  113  HGLLLWNQTRQRWVDNKNQSNKRHQVRDPKISWNATYESLLGSNKPFSQPVPLAEMVDFL  172

Query  256  VDTWEEDGLY  227
            VD WE++G+Y
Sbjct  173  VDIWEQEGMY  182



>ref|XP_010101263.1| hypothetical protein L484_011627 [Morus notabilis]
 gb|EXB88198.1| hypothetical protein L484_011627 [Morus notabilis]
Length=168

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 16/132 (12%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMP-QRSMTSITIPNLSLTQYSGTGNTITHEE  443
            +I GQ V++SS SE  WSTST ++E+  +   QRS++S+T              T +H  
Sbjct  51   RIQGQPVKRSSFSEDLWSTSTIEMENGGLQSSQRSISSLT--------------TSSHAP  96

Query  442  FVNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
              N   L W Q R QW G+K ++N+  + +  + W+A+YE    T KPFP PIPLSEM+D
Sbjct  97   DPN-SLLLWNQTRQQWLGNKSSQNKMQIREPRISWNATYESLLGTLKPFPQPIPLSEMID  155

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  156  FLVDIWEQEGLY  167



>ref|XP_010687979.1| PREDICTED: uncharacterized protein LOC104902025 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=180

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 76/131 (58%), Gaps = 7/131 (5%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +  GQ+V K S+S+ FW TST D+++   + QRS++SI+  N+S     G+ +  +H +F
Sbjct  56   QCQGQVVEKVSLSDDFWGTSTGDIDNPIGLSQRSISSISTSNVSFHSDLGSASMNSHNDF  115

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G L W QNR+QW  + K+          +   +S E        F  PIPLSEMV+ 
Sbjct  116  VNHGLLLWTQNRIQWIAATKSNEAHQALGPTISLLSSRE-------RFRRPIPLSEMVEF  168

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  169  LVDVWEQEGLY  179



>ref|XP_009151062.1| PREDICTED: uncharacterized protein LOC103874397 [Brassica rapa]
 ref|XP_009151063.1| PREDICTED: uncharacterized protein LOC103874397 [Brassica rapa]
 emb|CDX88174.1| BnaA06g27650D [Brassica napus]
Length=172

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 80/132 (61%), Gaps = 4/132 (3%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLES-STIMPQRSMTSITIPNLSLTQYSGTGNTITHEE  443
            +I G+LV+K S+S+ FWSTST D+++ ST+  QRS++SI+    +    +   ++    E
Sbjct  43   RIQGRLVKKPSVSDDFWSTSTCDMDNNSTMQSQRSVSSIS---FTNNTATSASSSSNPNE  99

Query  442  FVNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVD  263
            FVN G   W Q R QW  S  +  +  V +  + W+A+YE     +K F  PIPL EMVD
Sbjct  100  FVNTGLNLWNQTRQQWLASGSSRTKAKVREPTISWNATYESLLGVNKRFSRPIPLPEMVD  159

Query  262  LLVDTWEEDGLY  227
             LVD WE++GLY
Sbjct  160  FLVDVWEQEGLY  171



>ref|XP_006647041.1| PREDICTED: uncharacterized protein LOC102708405 isoform X1 [Oryza 
brachyantha]
 ref|XP_006647042.1| PREDICTED: uncharacterized protein LOC102708405 isoform X2 [Oryza 
brachyantha]
Length=109

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 70/109 (64%), Gaps = 2/109 (2%)
 Frame = -2

Query  550  LESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYLWWKQNRLQWRGSKKTEN  371
            +E+S +  QRSM+SI+    S  Q+ G G++    EFVNQG L W Q R QW G+++  +
Sbjct  1    MENSAMQSQRSMSSISTAAQSSDQH-GAGSSTNTNEFVNQGLLLWNQTRQQWVGNRRHNS  59

Query  370  RRLVWKS-ILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWEEDGLY  227
            +R   +   + W+A+YE    ++KPFP  IPL EMVD LVD WE++GLY
Sbjct  60   QRQQPREPKISWNATYESLLGSTKPFPQAIPLGEMVDFLVDGWEQEGLY  108



>ref|XP_010503415.1| PREDICTED: uncharacterized protein LOC104780604 isoform X1 [Camelina 
sativa]
Length=163

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 79/128 (62%), Gaps = 4/128 (3%)
 Frame = -2

Query  607  QLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQG  428
            +L   S  SE FW+ +T D+ES+    Q S++SI+  NL++       ++    EFVN G
Sbjct  38   ELRNPSVASEDFWTNTTLDMESNA---QGSVSSISTTNLTVDSQGCGSSSNEPAEFVNHG  94

Query  427  YLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVD  251
             + W Q R QW G K+++NR R+V + IL+ + +YE    ++K FP PIPL EMV  LV+
Sbjct  95   LVQWNQTRQQWLGDKRSKNRKRVVKEPILNENVTYESLLGSNKRFPRPIPLDEMVQFLVE  154

Query  250  TWEEDGLY  227
             WEE+GLY
Sbjct  155  VWEEEGLY  162



>ref|XP_010503422.1| PREDICTED: uncharacterized protein LOC104780604 isoform X2 [Camelina 
sativa]
Length=162

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 79/128 (62%), Gaps = 4/128 (3%)
 Frame = -2

Query  607  QLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQG  428
            +L   S  SE FW+ +T D+ES+    Q S++SI+  NL++       ++    EFVN G
Sbjct  37   ELRNPSVASEDFWTNTTLDMESNA---QGSVSSISTTNLTVDSQGCGSSSNEPAEFVNHG  93

Query  427  YLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVD  251
             + W Q R QW G K+++NR R+V + IL+ + +YE    ++K FP PIPL EMV  LV+
Sbjct  94   LVQWNQTRQQWLGDKRSKNRKRVVKEPILNENVTYESLLGSNKRFPRPIPLDEMVQFLVE  153

Query  250  TWEEDGLY  227
             WEE+GLY
Sbjct  154  VWEEEGLY  161



>ref|XP_004498738.1| PREDICTED: uncharacterized protein LOC101513384 isoform X4 [Cicer 
arietinum]
 ref|XP_004498739.1| PREDICTED: uncharacterized protein LOC101513384 isoform X5 [Cicer 
arietinum]
Length=140

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 79/125 (63%), Gaps = 6/125 (5%)
 Frame = -2

Query  595  KSSISEGFWSTSTYDLESSTIMPQRSMTS--ITIPNLSLTQYSGTGNTITHEEFVNQGYL  422
            K+  S  FWS+ST++ + S    QRS++S  IT+ NLS  Q S +    +  EFVNQG L
Sbjct  19   KNDGSSDFWSSSTFEKDHSAAQSQRSVSSSGITMINLSDPQTSAS----STPEFVNQGLL  74

Query  421  WWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWE  242
             W Q R QW G+K+ E++ +V +  +  +A+Y+     +KPFP PIPL EM+  LVD WE
Sbjct  75   LWNQIRQQWSGNKRCESQTVVREPRISSNATYDDLLGNNKPFPQPIPLREMIYFLVDIWE  134

Query  241  EDGLY  227
            ++GLY
Sbjct  135  QEGLY  139



>ref|XP_010487414.1| PREDICTED: uncharacterized protein LOC104765411 isoform X1 [Camelina 
sativa]
Length=162

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 78/128 (61%), Gaps = 4/128 (3%)
 Frame = -2

Query  607  QLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQG  428
            +L   S  SE FW+ +T D+ES+    Q S++SI+  NL++       ++    EFVN G
Sbjct  37   ELRNPSVASEDFWTNTTLDMESNA---QGSVSSISTTNLTVDSQGCGSSSNEPAEFVNHG  93

Query  427  YLWWKQNRLQWRGSKKTENRRLVWKS-ILDWDASYECTAETSKPFPCPIPLSEMVDLLVD  251
             + W Q R QW G KK++NR+ V K  IL+ + +YE    ++K FP PIPL EMV  LV+
Sbjct  94   LVQWNQTRQQWLGDKKSKNRKRVDKEPILNENVTYESLLGSNKRFPRPIPLDEMVQFLVE  153

Query  250  TWEEDGLY  227
             WEE+GLY
Sbjct  154  VWEEEGLY  161



>ref|XP_006582954.1| PREDICTED: uncharacterized protein LOC547651 isoform X2 [Glycine 
max]
 ref|XP_006582955.1| PREDICTED: uncharacterized protein LOC547651 isoform X3 [Glycine 
max]
 ref|XP_006582956.1| PREDICTED: uncharacterized protein LOC547651 isoform X4 [Glycine 
max]
 ref|XP_006582957.1| PREDICTED: uncharacterized protein LOC547651 isoform X5 [Glycine 
max]
 gb|KHN01334.1| hypothetical protein glysoja_009540 [Glycine soja]
Length=111

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = -2

Query  550  LESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHE-EFVNQGYLWWKQNRLQWRGSKKTE  374
            +++S +  Q S++S ++ N ++  ++G+  + T+  EFVN G + W Q R +W G+KK E
Sbjct  1    MDNSAVQSQGSISSASLTNQAVVLHAGSSKSSTNPTEFVNHGVILWNQTRQRWVGNKKLE  60

Query  373  NR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWEEDGLY  227
            NR + + +  L+W+A+YE    ++KPF  PIPL+EMVD LVD WE+DGLY
Sbjct  61   NRTQQLREPKLNWNATYESLLGSNKPFHQPIPLAEMVDFLVDIWEQDGLY  110



>ref|NP_001046223.2| Os02g0201000 [Oryza sativa Japonica Group]
 gb|EAZ22131.1| hypothetical protein OsJ_05793 [Oryza sativa Japonica Group]
 dbj|BAF08137.2| Os02g0201000 [Oryza sativa Japonica Group]
Length=109

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 70/109 (64%), Gaps = 2/109 (2%)
 Frame = -2

Query  550  LESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQGYLWWKQNRLQWRGSKKTEN  371
            +E+S +  QRSM+SI+    S  Q+ G G++    EFVNQG L W Q R QW G+++  +
Sbjct  1    MENSAMQSQRSMSSISTAAQSSDQH-GAGSSTNPNEFVNQGLLLWNQTRQQWVGNRRHNS  59

Query  370  RRLVWKS-ILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWEEDGLY  227
            +R   +   + W+A+YE    ++KPFP  IPL EMVD LVD WE++GLY
Sbjct  60   QRQQPREPKISWNATYESLLGSTKPFPQAIPLGEMVDFLVDGWEQEGLY  108



>ref|XP_010487415.1| PREDICTED: uncharacterized protein LOC104765411 isoform X2 [Camelina 
sativa]
Length=161

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 78/128 (61%), Gaps = 4/128 (3%)
 Frame = -2

Query  607  QLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQG  428
            +L   S  SE FW+ +T D+ES+    Q S++SI+  NL++       ++    EFVN G
Sbjct  36   ELRNPSVASEDFWTNTTLDMESNA---QGSVSSISTTNLTVDSQGCGSSSNEPAEFVNHG  92

Query  427  YLWWKQNRLQWRGSKKTENRRLVWKS-ILDWDASYECTAETSKPFPCPIPLSEMVDLLVD  251
             + W Q R QW G KK++NR+ V K  IL+ + +YE    ++K FP PIPL EMV  LV+
Sbjct  93   LVQWNQTRQQWLGDKKSKNRKRVDKEPILNENVTYESLLGSNKRFPRPIPLDEMVQFLVE  152

Query  250  TWEEDGLY  227
             WEE+GLY
Sbjct  153  VWEEEGLY  160



>ref|XP_004498737.1| PREDICTED: uncharacterized protein LOC101513384 isoform X3 [Cicer 
arietinum]
Length=159

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 79/125 (63%), Gaps = 6/125 (5%)
 Frame = -2

Query  595  KSSISEGFWSTSTYDLESSTIMPQRSMTS--ITIPNLSLTQYSGTGNTITHEEFVNQGYL  422
            K+  S  FWS+ST++ + S    QRS++S  IT+ NLS  Q S +    +  EFVNQG L
Sbjct  38   KNDGSSDFWSSSTFEKDHSAAQSQRSVSSSGITMINLSDPQTSAS----STPEFVNQGLL  93

Query  421  WWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWE  242
             W Q R QW G+K+ E++ +V +  +  +A+Y+     +KPFP PIPL EM+  LVD WE
Sbjct  94   LWNQIRQQWSGNKRCESQTVVREPRISSNATYDDLLGNNKPFPQPIPLREMIYFLVDIWE  153

Query  241  EDGLY  227
            ++GLY
Sbjct  154  QEGLY  158



>ref|XP_004498736.1| PREDICTED: uncharacterized protein LOC101513384 isoform X2 [Cicer 
arietinum]
Length=160

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 79/125 (63%), Gaps = 6/125 (5%)
 Frame = -2

Query  595  KSSISEGFWSTSTYDLESSTIMPQRSMTS--ITIPNLSLTQYSGTGNTITHEEFVNQGYL  422
            K+  S  FWS+ST++ + S    QRS++S  IT+ NLS  Q S +    +  EFVNQG L
Sbjct  39   KNDGSSDFWSSSTFEKDHSAAQSQRSVSSSGITMINLSDPQTSAS----STPEFVNQGLL  94

Query  421  WWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWE  242
             W Q R QW G+K+ E++ +V +  +  +A+Y+     +KPFP PIPL EM+  LVD WE
Sbjct  95   LWNQIRQQWSGNKRCESQTVVREPRISSNATYDDLLGNNKPFPQPIPLREMIYFLVDIWE  154

Query  241  EDGLY  227
            ++GLY
Sbjct  155  QEGLY  159



>ref|XP_010421387.1| PREDICTED: uncharacterized protein LOC104706860 isoform X1 [Camelina 
sativa]
Length=161

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 84/131 (64%), Gaps = 4/131 (3%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+LV+K S+S+GFWSTST ++++ST+  QRS++SI+  N + T  S +  T    EF
Sbjct  34   RIQGRLVKKPSVSDGFWSTSTCEMDNSTLQSQRSISSISFTNNTSTSASTSNPT----EF  89

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G   W Q R QW  +  ++ +  + +  + W+A+YE     +K F  PIPL EMVD 
Sbjct  90   VNNGLNHWNQTRQQWLANGTSQKKAKLREPTISWNATYESLLGMNKRFSRPIPLPEMVDF  149

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  150  LVDVWEQEGLY  160



>ref|XP_004498735.1| PREDICTED: uncharacterized protein LOC101513384 isoform X1 [Cicer 
arietinum]
Length=169

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 79/125 (63%), Gaps = 6/125 (5%)
 Frame = -2

Query  595  KSSISEGFWSTSTYDLESSTIMPQRSMTS--ITIPNLSLTQYSGTGNTITHEEFVNQGYL  422
            K+  S  FWS+ST++ + S    QRS++S  IT+ NLS  Q S +    +  EFVNQG L
Sbjct  48   KNDGSSDFWSSSTFEKDHSAAQSQRSVSSSGITMINLSDPQTSAS----STPEFVNQGLL  103

Query  421  WWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVDTWE  242
             W Q R QW G+K+ E++ +V +  +  +A+Y+     +KPFP PIPL EM+  LVD WE
Sbjct  104  LWNQIRQQWSGNKRCESQTVVREPRISSNATYDDLLGNNKPFPQPIPLREMIYFLVDIWE  163

Query  241  EDGLY  227
            ++GLY
Sbjct  164  QEGLY  168



>ref|XP_010465567.1| PREDICTED: uncharacterized protein LOC104745892 isoform X2 [Camelina 
sativa]
Length=160

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 79/128 (62%), Gaps = 4/128 (3%)
 Frame = -2

Query  607  QLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQG  428
            +L   S  SE FW+ +T D+ES+ +    S++SI+  NL++       ++    EFVN G
Sbjct  35   ELRNPSVASEDFWTNTTLDMESNAL---GSVSSISTTNLTVDSQGCGSSSNEPAEFVNHG  91

Query  427  YLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVD  251
             + W Q R QW G K+++NR R+V + IL+ + +YE    ++K FP PIPL EMV  LV+
Sbjct  92   LVQWNQTRQQWLGDKRSKNRKRVVQEPILNENVTYESLLGSNKRFPRPIPLDEMVQFLVE  151

Query  250  TWEEDGLY  227
             WEE+GLY
Sbjct  152  VWEEEGLY  159



>ref|XP_010465565.1| PREDICTED: uncharacterized protein LOC104745892 isoform X1 [Camelina 
sativa]
Length=161

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 79/128 (62%), Gaps = 4/128 (3%)
 Frame = -2

Query  607  QLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVNQG  428
            +L   S  SE FW+ +T D+ES+ +    S++SI+  NL++       ++    EFVN G
Sbjct  36   ELRNPSVASEDFWTNTTLDMESNAL---GSVSSISTTNLTVDSQGCGSSSNEPAEFVNHG  92

Query  427  YLWWKQNRLQWRGSKKTENR-RLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDLLVD  251
             + W Q R QW G K+++NR R+V + IL+ + +YE    ++K FP PIPL EMV  LV+
Sbjct  93   LVQWNQTRQQWLGDKRSKNRKRVVQEPILNENVTYESLLGSNKRFPRPIPLDEMVQFLVE  152

Query  250  TWEEDGLY  227
             WEE+GLY
Sbjct  153  VWEEEGLY  160



>ref|XP_010454863.1| PREDICTED: uncharacterized protein LOC104736557 isoform X2 [Camelina 
sativa]
Length=169

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 84/131 (64%), Gaps = 4/131 (3%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+LV+K S+S+GFWSTST ++++ST+  QRS++SI+  N + T  S +  T    EF
Sbjct  42   RIQGRLVKKPSVSDGFWSTSTCEMDNSTLQSQRSISSISFTNNTSTSASTSNPT----EF  97

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G   W Q R QW  +  ++ +  + +  + W+A+YE     +K F  PIPL EMVD 
Sbjct  98   VNNGLNHWNQTRQQWLANGTSQKKAKLREPTISWNATYESLLGMNKRFSRPIPLPEMVDF  157

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  158  LVDVWEQEGLY  168



>ref|XP_010421388.1| PREDICTED: uncharacterized protein LOC104706860 isoform X2 [Camelina 
sativa]
Length=169

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 84/131 (64%), Gaps = 4/131 (3%)
 Frame = -2

Query  619  KIHGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEF  440
            +I G+LV+K S+S+GFWSTST ++++ST+  QRS++SI+  N + T  S +  T    EF
Sbjct  42   RIQGRLVKKPSVSDGFWSTSTCEMDNSTLQSQRSISSISFTNNTSTSASTSNPT----EF  97

Query  439  VNQGYLWWKQNRLQWRGSKKTENRRLVWKSILDWDASYECTAETSKPFPCPIPLSEMVDL  260
            VN G   W Q R QW  +  ++ +  + +  + W+A+YE     +K F  PIPL EMVD 
Sbjct  98   VNNGLNHWNQTRQQWLANGTSQKKAKLREPTISWNATYESLLGMNKRFSRPIPLPEMVDF  157

Query  259  LVDTWEEDGLY  227
            LVD WE++GLY
Sbjct  158  LVDVWEQEGLY  168



>ref|XP_010691143.1| PREDICTED: uncharacterized protein LOC104904564 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=192

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 81/139 (58%), Gaps = 13/139 (9%)
 Frame = -2

Query  613  HGQLVRKSSISEGFWSTSTYDLESSTIMPQRSMTSITIPNLSLTQYSGTGNTITHEEFVN  434
             GQ  R  SIS  +W+TS  D+++S +  Q S++SI   N S+   SG  ++    E+VN
Sbjct  56   RGQTRRVPSISRDYWTTSVCDMDNSAMQSQGSLSSI---NASIDTPSGVSSSNPPSEYVN  112

Query  433  QGYLWWKQNRLQWRGSKKTENRRLVWK----SILD------WDASYECTAETSKPFPCPI  284
             G L W Q R +W  +K   N+R   +    SILD      W+A+YE    ++KPF  P+
Sbjct  113  HGLLLWNQTRQRWVDNKNQSNKRHQVRDPKISILDSFWPCSWNATYESLLGSNKPFSQPV  172

Query  283  PLSEMVDLLVDTWEEDGLY  227
            PL+EMVD LVD WE++G+Y
Sbjct  173  PLAEMVDFLVDIWEQEGMY  191



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2266477593358