BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19922_g1_i1 len=374 path=[546:0-78 625:79-216 763:217-265
121:266-318 863:319-373]

Length=374
                                                                      Score     E

ref|XP_011028006.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  60.5    2e-08   
ref|XP_004236950.1|  PREDICTED: phosphoenolpyruvate carboxylase 4     62.0    2e-08   
gb|KCW86390.1|  hypothetical protein EUGRSUZ_B03067                   61.6    2e-08   
ref|XP_006366062.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  61.6    2e-08   
ref|XP_010096711.1|  Phosphoenolpyruvate carboxylase 4                61.2    2e-08   
gb|KCW86389.1|  hypothetical protein EUGRSUZ_B03067                   61.6    3e-08   
ref|XP_002524382.1|  conserved hypothetical protein                   61.2    3e-08   Ricinus communis
gb|KHN37814.1|  Phosphoenolpyruvate carboxylase 4                     61.2    3e-08   
ref|NP_001237378.1|  phosphoenolpyruvate carboxylase                  61.2    3e-08   
ref|XP_009615011.1|  PREDICTED: phosphoenolpyruvate carboxylase 4     61.2    3e-08   
ref|XP_007143784.1|  hypothetical protein PHAVU_007G101300g           61.2    3e-08   
gb|ACO48252.1|  phosphoenolpyruvate carboxylase                       61.2    3e-08   Arachis hypogaea [goober]
ref|XP_007046352.1|  Phosphoenolpyruvate carboxylase 4 isoform 2      61.2    4e-08   
ref|XP_009762235.1|  PREDICTED: phosphoenolpyruvate carboxylase 4     61.2    4e-08   
ref|XP_004490284.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  61.2    4e-08   
ref|XP_004490285.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  60.8    4e-08   
gb|KHN24867.1|  Phosphoenolpyruvate carboxylase 4                     60.8    4e-08   
ref|XP_006573282.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  60.8    4e-08   
ref|XP_002314894.2|  hypothetical protein POPTR_0010s14170g           60.8    5e-08   Populus trichocarpa [western balsam poplar]
gb|KCW86392.1|  hypothetical protein EUGRSUZ_B03067                   60.5    6e-08   
ref|XP_011021330.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  60.5    6e-08   
ref|XP_011008773.1|  PREDICTED: phosphoenolpyruvate carboxylase 4     60.5    6e-08   
gb|ABR29877.1|  phosphoenolpyruvate carboxylase                       60.5    6e-08   Ricinus communis
ref|XP_007046351.1|  Phosphoenolpyruvate carboxylase 4 isoform 1      60.5    7e-08   
ref|NP_177043.2|  phosphoenolpyruvate carboxylase 4                   60.1    7e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KDO70133.1|  hypothetical protein CISIN_1g001537mg                 60.1    8e-08   
gb|KHG04079.1|  Phosphoenolpyruvate carboxylase 4 -like protein       60.1    8e-08   
ref|XP_006484388.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  60.1    8e-08   
emb|CDP00553.1|  unnamed protein product                              60.1    9e-08   
ref|XP_006437761.1|  hypothetical protein CICLE_v10030580mg           60.1    9e-08   
gb|KEH17733.1|  phosphoenolpyruvate carboxylase                       60.1    9e-08   
gb|KDP29342.1|  hypothetical protein JCGZ_18263                       60.1    1e-07   
ref|XP_010044308.1|  PREDICTED: phosphoenolpyruvate carboxylase 4     59.7    1e-07   
ref|XP_002893416.1|  ATPPC4                                           59.7    1e-07   
gb|KDO70135.1|  hypothetical protein CISIN_1g001537mg                 59.3    1e-07   
ref|XP_010532405.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  59.7    1e-07   
ref|XP_007153315.1|  hypothetical protein PHAVU_003G024800g           59.7    1e-07   
ref|XP_010532398.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  59.3    1e-07   
ref|XP_010532392.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  59.3    1e-07   
ref|XP_010532410.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  59.3    1e-07   
ref|XP_010648132.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  58.9    2e-07   
emb|CBI27087.3|  unnamed protein product                              58.9    2e-07   
emb|CAN62388.1|  hypothetical protein VITISV_039478                   58.9    2e-07   Vitis vinifera
ref|XP_002888679.1|  ATPPC4                                           58.9    2e-07   
ref|XP_010470857.1|  PREDICTED: phosphoenolpyruvate carboxylase 4     58.9    2e-07   
ref|XP_002280842.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  58.9    2e-07   Vitis vinifera
ref|XP_010681388.1|  PREDICTED: phosphoenolpyruvate carboxylase 4     58.9    2e-07   
ref|XP_010511891.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  58.9    2e-07   
emb|CDY07365.1|  BnaA07g24440D                                        58.5    3e-07   
ref|XP_009105021.1|  PREDICTED: phosphoenolpyruvate carboxylase 4     58.5    3e-07   
gb|KFK41300.1|  hypothetical protein AALP_AA2G112400                  58.5    3e-07   
ref|XP_006391101.1|  hypothetical protein EUTSA_v10018058mg           58.5    3e-07   
emb|CDY16140.1|  BnaA09g28740D                                        58.5    3e-07   
emb|CDY04256.1|  BnaC06g25590D                                        58.5    3e-07   
gb|AAG52040.1|AC011914_10  putative phosphoenolpyruvate carboxyla...  58.5    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007225373.1|  hypothetical protein PRUPE_ppa000806mg           58.2    3e-07   
ref|XP_010262445.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  58.2    4e-07   
ref|XP_006849771.1|  hypothetical protein AMTR_s00024p00252690        58.2    4e-07   
ref|XP_009356036.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  58.2    4e-07   
ref|XP_010477919.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  58.2    4e-07   
ref|XP_010477918.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  58.2    4e-07   
ref|XP_009115343.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  58.2    4e-07   
ref|XP_003591856.1|  Phosphoenolpyruvate carboxylase                  57.8    4e-07   
ref|XP_008339718.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  58.2    4e-07   
emb|CDX85005.1|  BnaC05g20500D                                        58.2    4e-07   
gb|KFK44556.1|  hypothetical protein AALP_AA1G271900                  57.8    4e-07   
ref|XP_010499083.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  57.8    5e-07   
ref|XP_010499082.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  57.8    5e-07   
ref|XP_002312371.2|  hypothetical protein POPTR_0008s11330g           57.8    5e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006301645.1|  hypothetical protein CARUB_v10022089mg           57.8    5e-07   
ref|XP_010265329.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  57.8    5e-07   
ref|XP_008243144.1|  PREDICTED: phosphoenolpyruvate carboxylase 4     57.8    5e-07   
ref|XP_010462902.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  57.4    6e-07   
ref|XP_006415894.1|  hypothetical protein EUTSA_v10006672mg           57.4    6e-07   
ref|XP_009410353.1|  PREDICTED: phosphoenolpyruvate carboxylase 4     57.4    7e-07   
ref|XP_008467198.1|  PREDICTED: phosphoenolpyruvate carboxylase 4     57.4    7e-07   
ref|XP_011070855.1|  PREDICTED: phosphoenolpyruvate carboxylase 4     57.0    8e-07   
ref|XP_004298315.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  57.0    8e-07   
ref|XP_004496214.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  56.6    1e-06   
ref|XP_008389332.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  56.6    1e-06   
ref|XP_004168517.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoenolp...  56.6    1e-06   
ref|XP_010230348.1|  PREDICTED: phosphoenolpyruvate carboxylase 4     56.6    1e-06   
ref|NP_001267491.1|  phosphoenolpyruvate carboxylase 4-like           56.6    1e-06   
gb|KGN51545.1|  hypothetical protein Csa_5G577360                     56.2    1e-06   
ref|XP_006306784.1|  hypothetical protein CARUB_v10008324mg           56.2    2e-06   
ref|XP_004967975.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoenolp...  55.8    2e-06   
gb|ACT54615.1|  phosphoenolpyruvate carboxylase                       55.5    3e-06   Brassica napus [oilseed rape]
ref|XP_008787931.1|  PREDICTED: phosphoenolpyruvate carboxylase 4     55.5    3e-06   
ref|XP_009336648.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  55.1    3e-06   
gb|ACJ83806.1|  unknown                                               53.1    5e-06   Medicago truncatula
gb|KHN07717.1|  Phosphoenolpyruvate carboxylase 4                     54.7    5e-06   
gb|EYU22615.1|  hypothetical protein MIMGU_mgv1a000787mg              54.3    6e-06   
ref|XP_010940018.1|  PREDICTED: phosphoenolpyruvate carboxylase 4...  53.9    9e-06   
ref|XP_002982810.1|  hypothetical protein SELMODRAFT_117085           50.1    9e-05   
ref|XP_002981843.1|  hypothetical protein SELMODRAFT_115610           50.1    9e-05   



>ref|XP_011028006.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Populus euphratica]
Length=327

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 42/97 (43%), Gaps = 47/97 (48%)
 Frame = -3

Query  291  CMICPFNISWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMH  112
            C    F  SWMGGDR GNPNV +KV                                   
Sbjct  256  CTPIKFG-SWMGGDRDGNPNVTAKV-----------------------------------  279

Query  111  CVNLLHFFFQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
                       T+DVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  -----------TRDVSLLSRWMAIDLYIREVDSLRFE  305



>ref|XP_004236950.1| PREDICTED: phosphoenolpyruvate carboxylase 4 [Solanum lycopersicum]
Length=1050

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 38/89 (43%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL VREVDSLRFE
Sbjct  280  ---TKDVSLLSRWMAIDLYVREVDSLRFE  305



>gb|KCW86390.1| hypothetical protein EUGRSUZ_B03067 [Eucalyptus grandis]
 gb|KCW86391.1| hypothetical protein EUGRSUZ_B03067 [Eucalyptus grandis]
Length=674

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TKDVSLLSRWMAIDLYIREVDSLRFE  305



>ref|XP_006366062.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Solanum tuberosum]
Length=1050

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 38/89 (43%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL VREVDSLRFE
Sbjct  280  ---TKDVSLLSRWMAIDLYVREVDSLRFE  305



>ref|XP_010096711.1| Phosphoenolpyruvate carboxylase 4 [Morus notabilis]
 gb|EXB65563.1| Phosphoenolpyruvate carboxylase 4 [Morus notabilis]
Length=500

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV SKV                                           
Sbjct  263  SWMGGDRDGNPNVTSKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TRDVSLLSRWMAIDLYIREVDSLRFE  305



>gb|KCW86389.1| hypothetical protein EUGRSUZ_B03067 [Eucalyptus grandis]
Length=991

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 42/97 (43%), Gaps = 47/97 (48%)
 Frame = -3

Query  291  CMICPFNISWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMH  112
            C    F  SWMGGDR GNPNV +KV                                   
Sbjct  256  CTPIKFG-SWMGGDRDGNPNVTAKV-----------------------------------  279

Query  111  CVNLLHFFFQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
                       TKDVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  -----------TKDVSLLSRWMAIDLYIREVDSLRFE  305



>ref|XP_002524382.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37993.1| conserved hypothetical protein [Ricinus communis]
Length=986

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 43/97 (44%), Gaps = 47/97 (48%)
 Frame = -3

Query  291  CMICPFNISWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMH  112
            CM   F  SWMGGDR GNPNV +KV                                   
Sbjct  190  CMPIRFG-SWMGGDRDGNPNVTAKV-----------------------------------  213

Query  111  CVNLLHFFFQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
                       T+DVSLLSRWMAVDL +REVDSLRFE
Sbjct  214  -----------TRDVSLLSRWMAVDLYIREVDSLRFE  239



>gb|KHN37814.1| Phosphoenolpyruvate carboxylase 4 [Glycine soja]
Length=1032

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TKDVSLLSRWMAIDLYIREVDSLRFE  305



>ref|NP_001237378.1| phosphoenolpyruvate carboxylase [Glycine max]
 gb|AAS67005.1| Phosphoenolpyruvate carboxylase [Glycine max]
Length=1032

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TKDVSLLSRWMAIDLYIREVDSLRFE  305



>ref|XP_009615011.1| PREDICTED: phosphoenolpyruvate carboxylase 4 [Nicotiana tomentosiformis]
Length=1047

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL VRE+DSLRFE
Sbjct  280  ---TKDVSLLSRWMAIDLYVREIDSLRFE  305



>ref|XP_007143784.1| hypothetical protein PHAVU_007G101300g [Phaseolus vulgaris]
 gb|ESW15778.1| hypothetical protein PHAVU_007G101300g [Phaseolus vulgaris]
Length=1118

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  345  SWMGGDRDGNPNVTAKV-------------------------------------------  361

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL +REVDSLRFE
Sbjct  362  ---TKDVSLLSRWMAIDLYIREVDSLRFE  387



>gb|ACO48252.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=1036

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  264  SWMGGDRDGNPNVTAKV-------------------------------------------  280

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL +REVDSLRFE
Sbjct  281  ---TKDVSLLSRWMAIDLYIREVDSLRFE  306



>ref|XP_007046352.1| Phosphoenolpyruvate carboxylase 4 isoform 2 [Theobroma cacao]
 gb|EOY02184.1| Phosphoenolpyruvate carboxylase 4 isoform 2 [Theobroma cacao]
Length=968

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  165  SWMGGDRDGNPNVTAKV-------------------------------------------  181

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +REVDSLRFE
Sbjct  182  ---TRDVSLLSRWMAIDLYIREVDSLRFE  207



>ref|XP_009762235.1| PREDICTED: phosphoenolpyruvate carboxylase 4 [Nicotiana sylvestris]
Length=1045

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL VRE+DSLRFE
Sbjct  280  ---TKDVSLLSRWMAIDLYVREIDSLRFE  305



>ref|XP_004490284.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like isoform X1 
[Cicer arietinum]
Length=1056

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  265  SWMGGDRDGNPNVTAKV-------------------------------------------  281

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL +REVDSLRFE
Sbjct  282  ---TKDVSLLSRWMAIDLYIREVDSLRFE  307



>ref|XP_004490285.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like isoform X2 
[Cicer arietinum]
Length=1054

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TKDVSLLSRWMAIDLYIREVDSLRFE  305



>gb|KHN24867.1| Phosphoenolpyruvate carboxylase 4 [Glycine soja]
Length=1045

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 39/89 (44%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  252  SWMGGDRDGNPNVTAKV-------------------------------------------  268

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL +REVD LRFE
Sbjct  269  ---TKDVSLLSRWMAIDLYIREVDGLRFE  294



>ref|XP_006573282.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Glycine max]
Length=1056

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 39/89 (44%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL +REVD LRFE
Sbjct  280  ---TKDVSLLSRWMAIDLYIREVDGLRFE  305



>ref|XP_002314894.2| hypothetical protein POPTR_0010s14170g [Populus trichocarpa]
 gb|EEF01065.2| hypothetical protein POPTR_0010s14170g [Populus trichocarpa]
Length=1060

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TRDVSLLSRWMAIDLYIREVDSLRFE  305



>gb|KCW86392.1| hypothetical protein EUGRSUZ_B03067 [Eucalyptus grandis]
Length=932

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  136  SWMGGDRDGNPNVTAKV-------------------------------------------  152

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL +REVDSLRFE
Sbjct  153  ---TKDVSLLSRWMAIDLYIREVDSLRFE  178



>ref|XP_011021330.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Populus euphratica]
 ref|XP_011021339.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Populus euphratica]
Length=1061

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 42/94 (45%), Gaps = 47/94 (50%)
 Frame = -3

Query  279  PFNI-SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVN  103
            P N  SWMGGDR GNPNV +KV                                      
Sbjct  258  PINFGSWMGGDRDGNPNVTAKV--------------------------------------  279

Query  102  LLHFFFQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
                    T+DVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  --------TRDVSLLSRWMAIDLYIREVDSLRFE  305



>ref|XP_011008773.1| PREDICTED: phosphoenolpyruvate carboxylase 4 [Populus euphratica]
Length=1061

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TRDVSLLSRWMAIDLYIREVDSLRFE  305



>gb|ABR29877.1| phosphoenolpyruvate carboxylase [Ricinus communis]
Length=1052

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMAVDL +REVDSLRFE
Sbjct  280  ---TRDVSLLSRWMAVDLYIREVDSLRFE  305



>ref|XP_007046351.1| Phosphoenolpyruvate carboxylase 4 isoform 1 [Theobroma cacao]
 gb|EOY02183.1| Phosphoenolpyruvate carboxylase 4 isoform 1 [Theobroma cacao]
Length=1060

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TRDVSLLSRWMAIDLYIREVDSLRFE  305



>ref|NP_177043.2| phosphoenolpyruvate carboxylase 4 [Arabidopsis thaliana]
 sp|Q8GVE8.1|CAPP4_ARATH RecName: Full=Phosphoenolpyruvate carboxylase 4; Short=AtPPC4; 
Short=PEPC 4; Short=PEPCase 4 [Arabidopsis thaliana]
 emb|CAD58727.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
 gb|AEE34835.1| phosphoenolpyruvate carboxylase 4 [Arabidopsis thaliana]
Length=1032

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 42/97 (43%), Gaps = 47/97 (48%)
 Frame = -3

Query  291  CMICPFNISWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMH  112
            C    F  SWMGGDR GNPNV +KV                                   
Sbjct  256  CTPMKFG-SWMGGDRDGNPNVTAKV-----------------------------------  279

Query  111  CVNLLHFFFQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
                       TK+VSLLSRWMA+DL +REVDSLRFE
Sbjct  280  -----------TKEVSLLSRWMAIDLYIREVDSLRFE  305



>gb|KDO70133.1| hypothetical protein CISIN_1g001537mg [Citrus sinensis]
 gb|KDO70134.1| hypothetical protein CISIN_1g001537mg [Citrus sinensis]
Length=1057

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TRDVSLLSRWMAIDLYIREVDSLRFE  305



>gb|KHG04079.1| Phosphoenolpyruvate carboxylase 4 -like protein [Gossypium arboreum]
Length=1104

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +RE+DSLRFE
Sbjct  280  ---TRDVSLLSRWMAIDLYIREIDSLRFE  305



>ref|XP_006484388.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Citrus sinensis]
Length=1057

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TRDVSLLSRWMAIDLYIREVDSLRFE  305



>emb|CDP00553.1| unnamed protein product [Coffea canephora]
Length=1061

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  264  SWMGGDRDGNPNVTAKV-------------------------------------------  280

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL VREVD+LRFE
Sbjct  281  ---TKDVSLLSRWMAIDLYVREVDNLRFE  306



>ref|XP_006437761.1| hypothetical protein CICLE_v10030580mg [Citrus clementina]
 gb|ESR51001.1| hypothetical protein CICLE_v10030580mg [Citrus clementina]
Length=1057

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TRDVSLLSRWMAIDLYIREVDSLRFE  305



>gb|KEH17733.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=1051

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 39/89 (44%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA DL +REVDSLRFE
Sbjct  280  ---TKDVSLLSRWMATDLYIREVDSLRFE  305



>gb|KDP29342.1| hypothetical protein JCGZ_18263 [Jatropha curcas]
Length=1056

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV SKV                                           
Sbjct  263  SWMGGDRDGNPNVTSKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TRDVSLLSRWMAMDLYIREVDSLRFE  305



>ref|XP_010044308.1| PREDICTED: phosphoenolpyruvate carboxylase 4 [Eucalyptus grandis]
 gb|KCW86388.1| hypothetical protein EUGRSUZ_B03067 [Eucalyptus grandis]
Length=1059

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TKDVSLLSRWMAIDLYIREVDSLRFE  305



>ref|XP_002893416.1| ATPPC4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69675.1| ATPPC4 [Arabidopsis lyrata subsp. lyrata]
Length=1061

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 41/89 (46%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNVK+KV                                           
Sbjct  263  SWMGGDRDGNPNVKAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSL+SRWMA+DL +RE+DSLRFE
Sbjct  280  ---TKEVSLMSRWMAIDLYIREIDSLRFE  305



>gb|KDO70135.1| hypothetical protein CISIN_1g001537mg [Citrus sinensis]
Length=743

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TRDVSLLSRWMAIDLYIREVDSLRFE  305



>ref|XP_010532405.1| PREDICTED: phosphoenolpyruvate carboxylase 4 isoform X3 [Tarenaya 
hassleriana]
Length=1053

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 42/97 (43%), Gaps = 47/97 (48%)
 Frame = -3

Query  291  CMICPFNISWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMH  112
            C    F  SWMGGDR GNPNV +KV                                   
Sbjct  256  CTPIKFG-SWMGGDRDGNPNVTAKV-----------------------------------  279

Query  111  CVNLLHFFFQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
                       T+DVSL+SRWMA+DL +REVDSLRFE
Sbjct  280  -----------TRDVSLMSRWMAIDLYIREVDSLRFE  305



>ref|XP_007153315.1| hypothetical protein PHAVU_003G024800g [Phaseolus vulgaris]
 gb|ESW25309.1| hypothetical protein PHAVU_003G024800g [Phaseolus vulgaris]
Length=1055

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               +KDVSLLSRWMA+DL VREVDSL+FE
Sbjct  280  ---SKDVSLLSRWMAIDLYVREVDSLKFE  305



>ref|XP_010532398.1| PREDICTED: phosphoenolpyruvate carboxylase 4 isoform X2 [Tarenaya 
hassleriana]
Length=1061

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 42/97 (43%), Gaps = 47/97 (48%)
 Frame = -3

Query  291  CMICPFNISWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMH  112
            C    F  SWMGGDR GNPNV +KV                                   
Sbjct  256  CTPIKFG-SWMGGDRDGNPNVTAKV-----------------------------------  279

Query  111  CVNLLHFFFQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
                       T+DVSL+SRWMA+DL +REVDSLRFE
Sbjct  280  -----------TRDVSLMSRWMAIDLYIREVDSLRFE  305



>ref|XP_010532392.1| PREDICTED: phosphoenolpyruvate carboxylase 4 isoform X1 [Tarenaya 
hassleriana]
Length=1062

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 42/97 (43%), Gaps = 47/97 (48%)
 Frame = -3

Query  291  CMICPFNISWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMH  112
            C    F  SWMGGDR GNPNV +KV                                   
Sbjct  256  CTPIKFG-SWMGGDRDGNPNVTAKV-----------------------------------  279

Query  111  CVNLLHFFFQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
                       T+DVSL+SRWMA+DL +REVDSLRFE
Sbjct  280  -----------TRDVSLMSRWMAIDLYIREVDSLRFE  305



>ref|XP_010532410.1| PREDICTED: phosphoenolpyruvate carboxylase 4 isoform X4 [Tarenaya 
hassleriana]
Length=874

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  75   SWMGGDRDGNPNVTAKV-------------------------------------------  91

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSL+SRWMA+DL +REVDSLRFE
Sbjct  92   ---TRDVSLMSRWMAIDLYIREVDSLRFE  117



>ref|XP_010648132.1| PREDICTED: phosphoenolpyruvate carboxylase 4 isoform X2 [Vitis 
vinifera]
Length=1017

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 42/97 (43%), Gaps = 47/97 (48%)
 Frame = -3

Query  291  CMICPFNISWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMH  112
            C    F  SWMGGDR GNPNV +                                     
Sbjct  256  CTPIKFG-SWMGGDRDGNPNVTA-------------------------------------  277

Query  111  CVNLLHFFFQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
                     +VT+DVSLLSRWMA+DL +REVDSLRFE
Sbjct  278  ---------EVTRDVSLLSRWMAIDLYIREVDSLRFE  305



>emb|CBI27087.3| unnamed protein product [Vitis vinifera]
Length=987

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +                                             
Sbjct  263  SWMGGDRDGNPNVTA---------------------------------------------  277

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
             +VT+DVSLLSRWMA+DL +REVDSLRFE
Sbjct  278  -EVTRDVSLLSRWMAIDLYIREVDSLRFE  305



>emb|CAN62388.1| hypothetical protein VITISV_039478 [Vitis vinifera]
Length=1069

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +                                             
Sbjct  263  SWMGGDRDGNPNVTA---------------------------------------------  277

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
             +VT+DVSLLSRWMA+DL +REVDSLRFE
Sbjct  278  -EVTRDVSLLSRWMAIDLYIREVDSLRFE  305



>ref|XP_002888679.1| ATPPC4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64938.1| ATPPC4 [Arabidopsis lyrata subsp. lyrata]
Length=1032

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TKEVSLLSRWMAIDLYIREVDSLRFE  305



>ref|XP_010470857.1| PREDICTED: phosphoenolpyruvate carboxylase 4 [Camelina sativa]
Length=1040

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TKEVSLLSRWMAIDLYIREVDSLRFE  305



>ref|XP_002280842.1| PREDICTED: phosphoenolpyruvate carboxylase 4 isoform X1 [Vitis 
vinifera]
Length=1061

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +                                             
Sbjct  263  SWMGGDRDGNPNVTA---------------------------------------------  277

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
             +VT+DVSLLSRWMA+DL +REVDSLRFE
Sbjct  278  -EVTRDVSLLSRWMAIDLYIREVDSLRFE  305



>ref|XP_010681388.1| PREDICTED: phosphoenolpyruvate carboxylase 4 [Beta vulgaris subsp. 
vulgaris]
Length=1034

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 39/89 (44%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  262  SWMGGDRDGNPNVTAKV-------------------------------------------  278

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMAVDL +REVD LRFE
Sbjct  279  ---TRDVSLLSRWMAVDLYIREVDGLRFE  304



>ref|XP_010511891.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Camelina sativa]
Length=1034

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TKEVSLLSRWMAIDLYIREVDSLRFE  305



>emb|CDY07365.1| BnaA07g24440D [Brassica napus]
Length=1038

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TKEVSLLSRWMAIDLYIREVDSLRFE  305



>ref|XP_009105021.1| PREDICTED: phosphoenolpyruvate carboxylase 4 [Brassica rapa]
Length=1038

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TKEVSLLSRWMAIDLYIREVDSLRFE  305



>gb|KFK41300.1| hypothetical protein AALP_AA2G112400 [Arabis alpina]
Length=1038

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TKEVSLLSRWMAIDLYMREVDSLRFE  305



>ref|XP_006391101.1| hypothetical protein EUTSA_v10018058mg [Eutrema salsugineum]
 gb|ESQ28387.1| hypothetical protein EUTSA_v10018058mg [Eutrema salsugineum]
Length=1032

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSLLSRWMA+D+ +REVDSLRFE
Sbjct  280  ---TKEVSLLSRWMAIDMYIREVDSLRFE  305



>emb|CDY16140.1| BnaA09g28740D [Brassica napus]
Length=1137

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  346  SWMGGDRDGNPNVTAKV-------------------------------------------  362

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSL+SRWMA+DL +RE+DSLRFE
Sbjct  363  ---TKEVSLMSRWMAIDLYIREIDSLRFE  388



>emb|CDY04256.1| BnaC06g25590D [Brassica napus]
Length=1038

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TKEVSLLSRWMAIDLYIREVDSLRFE  305



>gb|AAG52040.1|AC011914_10 putative phosphoenolpyruvate carboxylase; 69384-74546 [Arabidopsis 
thaliana]
Length=981

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  244  SWMGGDRDGNPNVTAKV-------------------------------------------  260

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSLLSRWMA+DL +REVDSLRFE
Sbjct  261  ---TKEVSLLSRWMAIDLYIREVDSLRFE  286



>ref|XP_007225373.1| hypothetical protein PRUPE_ppa000806mg [Prunus persica]
 gb|EMJ26572.1| hypothetical protein PRUPE_ppa000806mg [Prunus persica]
Length=998

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 41/97 (42%), Gaps = 47/97 (48%)
 Frame = -3

Query  291  CMICPFNISWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMH  112
            C    F  SWMGGDR GNPNV +KV                                   
Sbjct  259  CTPIKFG-SWMGGDRDGNPNVTAKV-----------------------------------  282

Query  111  CVNLLHFFFQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
                       TKDVSLLSRWMA+DL +REVD L+FE
Sbjct  283  -----------TKDVSLLSRWMAIDLYIREVDHLKFE  308



>ref|XP_010262445.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Nelumbo nucifera]
Length=1063

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLS+WMA+DL +REVDSLRFE
Sbjct  280  ---TRDVSLLSQWMAIDLYIREVDSLRFE  305



>ref|XP_006849771.1| hypothetical protein AMTR_s00024p00252690 [Amborella trichopoda]
 gb|ERN11352.1| hypothetical protein AMTR_s00024p00252690 [Amborella trichopoda]
Length=1085

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 38/89 (43%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV SKV                                           
Sbjct  272  SWMGGDRDGNPNVTSKV-------------------------------------------  288

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVS LSRWMA DL +RE+DSLRFE
Sbjct  289  ---TRDVSFLSRWMAADLYIREIDSLRFE  314



>ref|XP_009356036.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Pyrus x bretschneideri]
Length=1041

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 42/97 (43%), Gaps = 47/97 (48%)
 Frame = -3

Query  291  CMICPFNISWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMH  112
            C    F  SWMGGDR GNPNV +KV                                   
Sbjct  259  CTPIKFG-SWMGGDRDGNPNVTAKV-----------------------------------  282

Query  111  CVNLLHFFFQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
                       TKDVSLLSRWMA+DL VRE+D+L+FE
Sbjct  283  -----------TKDVSLLSRWMAIDLYVRELDNLKFE  308



>ref|XP_010477919.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like isoform X2 
[Camelina sativa]
Length=1052

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSL+SRWMA+DL +RE+DSLRFE
Sbjct  280  ---TKEVSLMSRWMAIDLYIREIDSLRFE  305



>ref|XP_010477918.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like isoform X1 
[Camelina sativa]
Length=1053

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSL+SRWMA+DL +RE+DSLRFE
Sbjct  280  ---TKEVSLMSRWMAIDLYIREIDSLRFE  305



>ref|XP_009115343.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Brassica rapa]
Length=1054

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSL+SRWMA+DL +RE+DSLRFE
Sbjct  280  ---TKEVSLMSRWMAIDLYIREIDSLRFE  305



>ref|XP_003591856.1| Phosphoenolpyruvate carboxylase [Medicago truncatula]
 gb|AES62107.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=643

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 41/97 (42%), Gaps = 47/97 (48%)
 Frame = -3

Query  291  CMICPFNISWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMH  112
            C    F  +WMGGDR GNPNV +KV                                   
Sbjct  245  CTPIKFG-TWMGGDRDGNPNVTAKV-----------------------------------  268

Query  111  CVNLLHFFFQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
                       TK VSLLSRWMA+DL +REVDSLRFE
Sbjct  269  -----------TKAVSLLSRWMAIDLYIREVDSLRFE  294



>ref|XP_008339718.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Malus domestica]
Length=1041

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 42/97 (43%), Gaps = 47/97 (48%)
 Frame = -3

Query  291  CMICPFNISWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMH  112
            C    F  SWMGGDR GNPNV +KV                                   
Sbjct  259  CTPIKFG-SWMGGDRDGNPNVTAKV-----------------------------------  282

Query  111  CVNLLHFFFQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
                       TKDVSLLSRWMA+DL VRE+D+L+FE
Sbjct  283  -----------TKDVSLLSRWMAIDLYVRELDNLKFE  308



>emb|CDX85005.1| BnaC05g20500D [Brassica napus]
Length=1054

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSL+SRWMA+DL +RE+DSLRFE
Sbjct  280  ---TKEVSLMSRWMAIDLYIREIDSLRFE  305



>gb|KFK44556.1| hypothetical protein AALP_AA1G271900 [Arabis alpina]
Length=1049

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSL+SRWMA+DL +RE+DSLRFE
Sbjct  280  ---TKEVSLMSRWMAIDLYIREIDSLRFE  305



>ref|XP_010499083.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like isoform X2 
[Camelina sativa]
Length=1052

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSL+SRWMA+DL +RE+DSLRFE
Sbjct  280  ---TKEVSLMSRWMAIDLYIREIDSLRFE  305



>ref|XP_010499082.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like isoform X1 
[Camelina sativa]
Length=1053

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSL+SRWMA+DL +RE+DSLRFE
Sbjct  280  ---TKEVSLMSRWMAIDLYIREIDSLRFE  305



>ref|XP_002312371.2| hypothetical protein POPTR_0008s11330g [Populus trichocarpa]
 gb|EEE89738.2| hypothetical protein POPTR_0008s11330g [Populus trichocarpa]
Length=1023

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 39/89 (44%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +RE DSLRFE
Sbjct  280  ---TRDVSLLSRWMAIDLYIREADSLRFE  305



>ref|XP_006301645.1| hypothetical protein CARUB_v10022089mg [Capsella rubella]
 gb|EOA34543.1| hypothetical protein CARUB_v10022089mg [Capsella rubella]
Length=1033

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSLLSRWMA+D+ +REVDSLRFE
Sbjct  280  ---TKEVSLLSRWMAIDMYIREVDSLRFE  305



>ref|XP_010265329.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Nelumbo nucifera]
Length=1069

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLS+WMA+DL +RE+DSLRFE
Sbjct  280  ---TRDVSLLSQWMAIDLYIREIDSLRFE  305



>ref|XP_008243144.1| PREDICTED: phosphoenolpyruvate carboxylase 4 [Prunus mume]
Length=1044

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 39/89 (44%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  266  SWMGGDRDGNPNVTAKV-------------------------------------------  282

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWMA+DL +REVD L+FE
Sbjct  283  ---TKDVSLLSRWMAIDLYIREVDHLKFE  308



>ref|XP_010462902.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Camelina sativa]
Length=915

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSL+SRWMA+DL +RE+DSLRFE
Sbjct  280  ---TKEVSLMSRWMAIDLYIREIDSLRFE  305



>ref|XP_006415894.1| hypothetical protein EUTSA_v10006672mg [Eutrema salsugineum]
 gb|ESQ34247.1| hypothetical protein EUTSA_v10006672mg [Eutrema salsugineum]
Length=1009

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSL+SRWMA+DL +RE+DSLRFE
Sbjct  280  ---TKEVSLMSRWMAIDLYIREIDSLRFE  305



>ref|XP_009410353.1| PREDICTED: phosphoenolpyruvate carboxylase 4 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410361.1| PREDICTED: phosphoenolpyruvate carboxylase 4 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410368.1| PREDICTED: phosphoenolpyruvate carboxylase 4 [Musa acuminata 
subsp. malaccensis]
Length=1063

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 39/89 (44%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA DL +REVD+LRFE
Sbjct  280  ---TRDVSLLSRWMAFDLYIREVDNLRFE  305



>ref|XP_008467198.1| PREDICTED: phosphoenolpyruvate carboxylase 4 [Cucumis melo]
Length=1049

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +RE+DSL+FE
Sbjct  280  ---TRDVSLLSRWMAIDLYIRELDSLQFE  305



>ref|XP_011070855.1| PREDICTED: phosphoenolpyruvate carboxylase 4 [Sesamum indicum]
Length=1060

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +REVD+LRFE
Sbjct  280  ---TRDVSLLSRWMAMDLYMREVDNLRFE  305



>ref|XP_004298315.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Fragaria vesca 
subsp. vesca]
Length=1043

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 38/89 (43%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLSRWM +DL +REVDSL FE
Sbjct  280  ---TKDVSLLSRWMTIDLYIREVDSLSFE  305



>ref|XP_004496214.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Cicer arietinum]
Length=1043

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 39/89 (44%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            +WMGGDR GNPNV +KV                                           
Sbjct  263  TWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK VSLLSRWMA+DL +REVDSLRFE
Sbjct  280  ---TKAVSLLSRWMAIDLYIREVDSLRFE  305



>ref|XP_008389332.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Malus domestica]
Length=1041

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 42/97 (43%), Gaps = 47/97 (48%)
 Frame = -3

Query  291  CMICPFNISWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMH  112
            C    F  SWMGGDR GNPNV +KV                                   
Sbjct  259  CTPIKFG-SWMGGDRDGNPNVTAKV-----------------------------------  282

Query  111  CVNLLHFFFQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
                       TKDVSLLS+WMA+DL +RE+D+L+FE
Sbjct  283  -----------TKDVSLLSKWMAIDLYIRELDNLKFE  308



>ref|XP_004168517.1| PREDICTED: LOW QUALITY PROTEIN: phosphoenolpyruvate carboxylase 
4-like [Cucumis sativus]
Length=1077

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +RE+DSL+FE
Sbjct  280  ---TRDVSLLSRWMAIDLYIRELDSLQFE  305



>ref|XP_010230348.1| PREDICTED: phosphoenolpyruvate carboxylase 4 [Brachypodium distachyon]
Length=1044

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 39/89 (44%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +RE+DSL FE
Sbjct  280  ---TRDVSLLSRWMAIDLYIRELDSLSFE  305



>ref|NP_001267491.1| phosphoenolpyruvate carboxylase 4-like [Cucumis sativus]
 gb|AFS33792.1| phosphoenolpyruvate carboxylase protein [Cucumis sativus]
Length=1077

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +RE+DSL+FE
Sbjct  280  ---TRDVSLLSRWMAIDLYIRELDSLQFE  305



>gb|KGN51545.1| hypothetical protein Csa_5G577360 [Cucumis sativus]
Length=1061

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL +RE+DSL+FE
Sbjct  280  ---TRDVSLLSRWMAIDLYIRELDSLQFE  305



>ref|XP_006306784.1| hypothetical protein CARUB_v10008324mg [Capsella rubella]
 gb|EOA39682.1| hypothetical protein CARUB_v10008324mg [Capsella rubella]
Length=813

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/89 (37%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNP+V +KV                                           
Sbjct  263  SWMGGDRDGNPSVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSL+SRWMA+DL +RE+DSLRFE
Sbjct  280  ---TKEVSLMSRWMAIDLYIREIDSLRFE  305



>ref|XP_004967975.1| PREDICTED: LOW QUALITY PROTEIN: phosphoenolpyruvate carboxylase 
4-like [Setaria italica]
Length=1041

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 41/97 (42%), Gaps = 47/97 (48%)
 Frame = -3

Query  291  CMICPFNISWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMH  112
            C    F  SWMGGDR GNPNV +KV                                   
Sbjct  256  CTPIKFG-SWMGGDRDGNPNVTAKV-----------------------------------  279

Query  111  CVNLLHFFFQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
                       T+DVSLLSRWMA+DL +RE+D+L FE
Sbjct  280  -----------TRDVSLLSRWMAIDLYIRELDNLSFE  305



>gb|ACT54615.1| phosphoenolpyruvate carboxylase [Brassica napus]
Length=1051

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 33/89 (37%), Positives = 39/89 (44%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TK+VSL+SRWMA+DL +RE+ SLRFE
Sbjct  280  ---TKEVSLMSRWMAIDLYIREIGSLRFE  305



>ref|XP_008787931.1| PREDICTED: phosphoenolpyruvate carboxylase 4 [Phoenix dactylifera]
Length=1052

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 39/89 (44%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA +L +REVD+LRFE
Sbjct  280  ---TRDVSLLSRWMATELYIREVDNLRFE  305



>ref|XP_009336648.1| PREDICTED: phosphoenolpyruvate carboxylase 4-like [Pyrus x bretschneideri]
Length=1041

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 33/89 (37%), Positives = 40/89 (45%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  266  SWMGGDRDGNPNVTAKV-------------------------------------------  282

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               TKDVSLLS+WMA+DL +RE+D+L+FE
Sbjct  283  ---TKDVSLLSKWMAIDLYIRELDNLKFE  308



>gb|ACJ83806.1| unknown [Medicago truncatula]
Length=240

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 37/87 (43%), Gaps = 46/87 (53%)
 Frame = -3

Query  261  MGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFFFQ  82
            MGGDR GNPNV +KV                                             
Sbjct  1    MGGDRDGNPNVTAKV---------------------------------------------  15

Query  81   VTKDVSLLSRWMAVDLCVREVDSLRFE  1
             TK VSLLSRWMA+DL +REVDSLRFE
Sbjct  16   -TKAVSLLSRWMAIDLYIREVDSLRFE  41



>gb|KHN07717.1| Phosphoenolpyruvate carboxylase 4 [Glycine soja]
Length=780

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  84  QVTKDVSLLSRWMAVDLCVREVDSLRFE  1
           QVTKDVSLLSRWMA+DL +REVD LRFE
Sbjct  52  QVTKDVSLLSRWMAIDLYIREVDGLRFE  79



>gb|EYU22615.1| hypothetical protein MIMGU_mgv1a000787mg [Erythranthe guttata]
Length=986

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 39/89 (44%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNPNV +KV                                           
Sbjct  263  SWMGGDRDGNPNVTAKV-------------------------------------------  279

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
               T+DVSLLSRWMA+DL + EVD+LRFE
Sbjct  280  ---TRDVSLLSRWMAIDLYLGEVDNLRFE  305



>ref|XP_010940018.1| PREDICTED: phosphoenolpyruvate carboxylase 4 isoform X1 [Elaeis 
guineensis]
Length=786

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 38/87 (44%), Gaps = 46/87 (53%)
 Frame = -3

Query  261  MGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFFFQ  82
            MGGDR GNPNV +KV                                             
Sbjct  1    MGGDRDGNPNVTAKV---------------------------------------------  15

Query  81   VTKDVSLLSRWMAVDLCVREVDSLRFE  1
             T+DVSLLSRWMAVDL +REVD+LRFE
Sbjct  16   -TRDVSLLSRWMAVDLYIREVDNLRFE  41



>ref|XP_002982810.1| hypothetical protein SELMODRAFT_117085 [Selaginella moellendorffii]
 gb|EFJ16055.1| hypothetical protein SELMODRAFT_117085 [Selaginella moellendorffii]
Length=1020

 Score = 50.1 bits (118),  Expect(2) = 9e-05, Method: Composition-based stats.
 Identities = 31/89 (35%), Positives = 37/89 (42%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNP+V +K                                            
Sbjct  259  SWMGGDRDGNPHVTAK--------------------------------------------  274

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
              VT+DV  L+RW+A DL +REVDSLRFE
Sbjct  275  --VTRDVCYLARWIAADLYLREVDSLRFE  301


 Score = 22.3 bits (46),  Expect(2) = 9e-05, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = -1

Query  374  YLRRVSNALKK  342
            YLRR+S ALKK
Sbjct  232  YLRRISTALKK  242



>ref|XP_002981843.1| hypothetical protein SELMODRAFT_115610 [Selaginella moellendorffii]
 gb|EFJ16936.1| hypothetical protein SELMODRAFT_115610 [Selaginella moellendorffii]
Length=975

 Score = 50.1 bits (118),  Expect(2) = 9e-05, Method: Composition-based stats.
 Identities = 31/89 (35%), Positives = 37/89 (42%), Gaps = 46/89 (52%)
 Frame = -3

Query  267  SWMGGDRYGNPNVKSKVIsem*ccsssmkSTLEEEFFFI*KVGRAPFLSSMHCVNLLHFF  88
            SWMGGDR GNP+V +K                                            
Sbjct  243  SWMGGDRDGNPHVTAK--------------------------------------------  258

Query  87   FQVTKDVSLLSRWMAVDLCVREVDSLRFE  1
              VT+DV  L+RW+A DL +REVDSLRFE
Sbjct  259  --VTRDVCYLARWIAADLYLREVDSLRFE  285


 Score = 22.3 bits (46),  Expect(2) = 9e-05, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = -1

Query  374  YLRRVSNALKK  342
            YLRR+S ALKK
Sbjct  216  YLRRISTALKK  226



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510693543822