BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19904_g1_i1 len=822 path=[895:0-821]

Length=822
                                                                      Score     E

gb|ABZ89182.1|  putative protein                                        214   3e-64   Coffea canephora [robusta coffee]
gb|ADY38789.1|  DNA-binding protein                                     213   2e-63   
ref|XP_004249915.1|  PREDICTED: putative DNA-binding protein ESCA...    203   1e-59   
ref|XP_007035040.1|  AT-hook motif nuclear localized protein 20         200   9e-59   
ref|XP_010024974.1|  PREDICTED: putative DNA-binding protein ESCA...    199   1e-58   
ref|XP_009784464.1|  PREDICTED: putative DNA-binding protein ESCA...    199   2e-58   
emb|CBI35166.3|  unnamed protein product                                196   3e-57   
ref|XP_011029905.1|  PREDICTED: putative DNA-binding protein ESCA...    196   3e-57   
ref|XP_002312579.2|  hypothetical protein POPTR_0008s16440g             196   3e-57   Populus trichocarpa [western balsam poplar]
ref|XP_004302076.1|  PREDICTED: putative DNA-binding protein ESCA...    197   3e-57   
ref|XP_002529315.1|  DNA binding protein, putative                      196   7e-57   Ricinus communis
ref|XP_010262258.1|  PREDICTED: putative DNA-binding protein ESCA...    194   1e-56   
emb|CAN61523.1|  hypothetical protein VITISV_016751                     193   2e-56   Vitis vinifera
ref|XP_002271606.1|  PREDICTED: putative DNA-binding protein ESCA...    194   3e-56   Vitis vinifera
ref|XP_010104063.1|  hypothetical protein L484_008144                   194   6e-56   
ref|XP_006420137.1|  hypothetical protein CICLE_v10005603mg             191   2e-55   
ref|XP_007030480.1|  AT-hook motif nuclear localized protein 20         191   4e-55   
ref|XP_009364460.1|  PREDICTED: putative DNA-binding protein ESCA...    191   6e-55   
ref|XP_010102254.1|  hypothetical protein L484_024535                   190   6e-55   
ref|XP_002521959.1|  DNA binding protein, putative                      191   6e-55   Ricinus communis
ref|XP_006350955.1|  PREDICTED: putative DNA-binding protein ESCA...    190   9e-55   
ref|XP_007145832.1|  hypothetical protein PHAVU_007G271800g             189   1e-54   
ref|XP_008370731.1|  PREDICTED: putative DNA-binding protein ESCA...    189   4e-54   
gb|KCW61537.1|  hypothetical protein EUGRSUZ_H04257                     187   4e-54   
ref|XP_006477506.1|  PREDICTED: putative DNA-binding protein ESCA...    190   4e-54   
ref|XP_006487869.1|  PREDICTED: putative DNA-binding protein ESCA...    188   5e-54   
ref|XP_002284519.1|  PREDICTED: putative DNA-binding protein ESCA...    187   7e-54   Vitis vinifera
ref|XP_006442718.1|  hypothetical protein CICLE_v10023369mg             188   7e-54   
ref|XP_011030530.1|  PREDICTED: putative DNA-binding protein ESCA...    187   1e-53   
ref|XP_009372143.1|  PREDICTED: putative DNA-binding protein ESCA...    187   1e-53   
ref|XP_007144108.1|  hypothetical protein PHAVU_007G129400g             187   2e-53   
ref|XP_002319649.1|  DNA-binding family protein                         186   2e-53   Populus trichocarpa [western balsam poplar]
ref|XP_009611172.1|  PREDICTED: putative DNA-binding protein ESCA...    186   3e-53   
ref|XP_002314642.2|  hypothetical protein POPTR_0010s08500g             186   4e-53   Populus trichocarpa [western balsam poplar]
ref|XP_008388703.1|  PREDICTED: putative DNA-binding protein ESCA...    186   4e-53   
ref|XP_009383960.1|  PREDICTED: putative DNA-binding protein ESCA...    184   5e-53   
gb|KHN01050.1|  Putative DNA-binding protein ESCAROLA                   186   5e-53   
ref|XP_009623613.1|  PREDICTED: putative DNA-binding protein ESCA...    186   5e-53   
ref|XP_011038532.1|  PREDICTED: putative DNA-binding protein ESCA...    184   1e-52   
ref|XP_009373988.1|  PREDICTED: putative DNA-binding protein ESCA...    184   2e-52   
gb|KDP23697.1|  hypothetical protein JCGZ_23530                         184   2e-52   
ref|XP_009757136.1|  PREDICTED: putative DNA-binding protein ESCA...    184   2e-52   
ref|XP_006589299.1|  PREDICTED: putative DNA-binding protein ESCA...    183   6e-52   
ref|XP_006606925.1|  PREDICTED: putative DNA-binding protein ESCA...    185   6e-52   
ref|XP_010274873.1|  PREDICTED: putative DNA-binding protein ESCA...    184   8e-52   
gb|KHN30735.1|  Putative DNA-binding protein ESCAROLA                   182   8e-52   
ref|XP_008456342.1|  PREDICTED: putative DNA-binding protein ESCA...    182   9e-52   
ref|XP_006588553.1|  PREDICTED: putative DNA-binding protein ESCA...    180   9e-52   
ref|XP_008787555.1|  PREDICTED: putative DNA-binding protein ESCA...    183   1e-51   
ref|XP_004139388.1|  PREDICTED: putative DNA-binding protein ESCA...    181   2e-51   
ref|XP_008801301.1|  PREDICTED: putative DNA-binding protein ESCA...    180   3e-51   
ref|XP_010935866.1|  PREDICTED: putative DNA-binding protein ESCA...    181   3e-51   
ref|XP_009394683.1|  PREDICTED: putative DNA-binding protein ESCA...    179   4e-51   
ref|XP_010026866.1|  PREDICTED: putative DNA-binding protein ESCA...    179   1e-50   
ref|XP_008794313.1|  PREDICTED: putative DNA-binding protein ESCA...    179   2e-50   
ref|XP_004296621.1|  PREDICTED: putative DNA-binding protein ESCA...    178   2e-50   
ref|NP_001048546.1|  Os02g0820800                                       177   3e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004954422.1|  PREDICTED: putative DNA-binding protein ESCA...    177   5e-50   
ref|XP_009379018.1|  PREDICTED: putative DNA-binding protein ESCA...    177   6e-50   
ref|XP_004974243.1|  PREDICTED: putative DNA-binding protein ESCA...    176   7e-50   
emb|CDO99189.1|  unnamed protein product                                177   9e-50   
ref|XP_011091221.1|  PREDICTED: putative DNA-binding protein ESCA...    174   2e-49   
ref|XP_007226723.1|  hypothetical protein PRUPE_ppa019745mg             175   3e-49   
ref|XP_008224392.1|  PREDICTED: putative DNA-binding protein ESCA...    175   5e-49   
ref|XP_006606853.1|  PREDICTED: putative DNA-binding protein ESCA...    177   5e-49   
gb|KEH42696.1|  AT hook motif DNA-binding family protein                176   6e-49   
ref|NP_001062524.1|  Os08g0563200                                       172   1e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004497856.1|  PREDICTED: putative DNA-binding protein ESCA...    175   1e-48   
gb|EAZ06834.1|  hypothetical protein OsI_29071                          172   2e-48   Oryza sativa Indica Group [Indian rice]
gb|KEH41146.1|  AT hook motif DNA-binding family protein                175   2e-48   
ref|XP_004495454.1|  PREDICTED: putative DNA-binding protein ESCA...    174   2e-48   
gb|AFW74083.1|  DNA-binding protein                                     172   2e-48   
ref|NP_001150826.1|  DNA-binding protein                                172   3e-48   Zea mays [maize]
dbj|BAK02851.1|  predicted protein                                      173   3e-48   
ref|NP_001151240.1|  DNA-binding protein                                172   3e-48   Zea mays [maize]
ref|XP_010694781.1|  PREDICTED: putative DNA-binding protein ESCA...    173   3e-48   
gb|ABL63119.1|  AT-hook DNA-binding protein                             172   4e-48   Catharanthus roseus [chatas]
tpg|DAA48555.1|  TPA: hypothetical protein ZEAMMB73_420043              172   5e-48   
gb|EMS64253.1|  hypothetical protein TRIUR3_00437                       171   1e-47   
ref|XP_006846339.1|  hypothetical protein AMTR_s00012p00257450          171   1e-47   
ref|XP_003570419.1|  PREDICTED: putative DNA-binding protein ESCA...    171   1e-47   
ref|XP_006827517.1|  hypothetical protein AMTR_s00009p00189120          170   2e-47   
ref|XP_004134419.1|  PREDICTED: putative DNA-binding protein ESCA...    171   2e-47   
ref|XP_008439362.1|  PREDICTED: putative DNA-binding protein ESCA...    171   2e-47   
ref|XP_008218304.1|  PREDICTED: putative DNA-binding protein ESCA...    171   2e-47   
ref|XP_004171657.1|  PREDICTED: putative DNA-binding protein ESCA...    171   3e-47   
ref|XP_008780228.1|  PREDICTED: putative DNA-binding protein ESCA...    169   3e-47   
gb|KGN56888.1|  hypothetical protein Csa_3G141840                       171   3e-47   
gb|EPS65852.1|  hypothetical protein M569_08925                         169   4e-47   
ref|XP_007206474.1|  hypothetical protein PRUPE_ppa018950mg             170   5e-47   
ref|XP_009401827.1|  PREDICTED: putative DNA-binding protein ESCA...    169   5e-47   
ref|XP_008391057.1|  PREDICTED: putative DNA-binding protein ESCA...    169   6e-47   
ref|XP_010918771.1|  PREDICTED: putative DNA-binding protein ESCA...    168   6e-47   
ref|XP_004956262.1|  PREDICTED: putative DNA-binding protein ESCA...    168   8e-47   
ref|XP_009775204.1|  PREDICTED: putative DNA-binding protein ESCA...    168   1e-46   
ref|XP_010257112.1|  PREDICTED: putative DNA-binding protein ESCA...    171   2e-46   
ref|XP_003536146.1|  PREDICTED: putative DNA-binding protein ESCA...    167   3e-46   
ref|XP_007144002.1|  hypothetical protein PHAVU_007G120900g             167   4e-46   
ref|XP_003556450.2|  PREDICTED: putative DNA-binding protein ESCA...    167   4e-46   
ref|XP_006354520.1|  PREDICTED: putative DNA-binding protein ESCA...    167   6e-46   
ref|XP_006851807.1|  hypothetical protein AMTR_s00041p00025000          167   1e-45   
ref|XP_004247701.1|  PREDICTED: putative DNA-binding protein ESCA...    166   1e-45   
ref|XP_002489068.1|  hypothetical protein SORBIDRAFT_0169s002010        163   2e-45   Sorghum bicolor [broomcorn]
ref|XP_010262897.1|  PREDICTED: putative DNA-binding protein ESCA...    167   2e-45   
emb|CDP09863.1|  unnamed protein product                                165   3e-45   
ref|XP_010435119.1|  PREDICTED: putative DNA-binding protein ESCA...    165   3e-45   
ref|XP_010940763.1|  PREDICTED: putative DNA-binding protein ESCA...    166   4e-45   
ref|XP_003576887.1|  PREDICTED: putative DNA-binding protein ESCA...    163   8e-45   
ref|XP_009384565.1|  PREDICTED: putative DNA-binding protein ESCA...    162   1e-44   
emb|CDY12779.1|  BnaC04g28620D                                          163   1e-44   
ref|XP_010276261.1|  PREDICTED: putative DNA-binding protein ESCA...    163   2e-44   
ref|NP_567432.1|  AT-hook motif nuclear-localized protein 20            163   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010440458.1|  PREDICTED: putative DNA-binding protein ESCA...    162   2e-44   
emb|CBI34813.3|  unnamed protein product                                161   2e-44   
ref|XP_003590930.1|  DNA-binding protein                                163   3e-44   
gb|AFK41919.1|  unknown                                                 163   3e-44   
ref|XP_010450033.1|  PREDICTED: putative DNA-binding protein ESCA...    162   4e-44   
ref|XP_009386251.1|  PREDICTED: putative DNA-binding protein ESCA...    163   4e-44   
gb|KDO42746.1|  hypothetical protein CISIN_1g040245mg                   161   4e-44   
ref|XP_009589526.1|  PREDICTED: putative DNA-binding protein ESCA...    164   5e-44   
ref|XP_010527388.1|  PREDICTED: putative DNA-binding protein ESCA...    161   6e-44   
ref|XP_002281296.1|  PREDICTED: putative DNA-binding protein ESCA...    162   7e-44   Vitis vinifera
ref|XP_010277406.1|  PREDICTED: putative DNA-binding protein ESCA...    161   7e-44   
ref|XP_006851806.1|  hypothetical protein AMTR_s00041p00022450          162   7e-44   
ref|XP_010108102.1|  hypothetical protein L484_023188                   161   9e-44   
emb|CDY23160.1|  BnaA04g05990D                                          161   1e-43   
gb|AAM65129.1|  putative DNA-binding protein                            160   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004298711.1|  PREDICTED: putative DNA-binding protein ESCA...    160   2e-43   
ref|XP_002299584.2|  DNA-binding family protein                         160   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_009139507.1|  PREDICTED: putative DNA-binding protein ESCA...    159   3e-43   
gb|ABL63118.1|  AT-hook DNA-binding protein                             159   4e-43   Catharanthus roseus [chatas]
ref|XP_006414705.1|  hypothetical protein EUTSA_v10025929mg             159   4e-43   
ref|XP_002303540.1|  DNA-binding family protein                         160   4e-43   Populus trichocarpa [western balsam poplar]
gb|EYU40549.1|  hypothetical protein MIMGU_mgv1a021038mg                160   4e-43   
ref|XP_011033866.1|  PREDICTED: putative DNA-binding protein ESCA...    160   5e-43   
gb|EYU43510.1|  hypothetical protein MIMGU_mgv1a017700mg                160   5e-43   
ref|XP_002301300.1|  DNA-binding family protein                         159   5e-43   Populus trichocarpa [western balsam poplar]
ref|XP_010096609.1|  hypothetical protein L484_025356                   160   5e-43   
ref|XP_002870310.1|  hypothetical protein ARALYDRAFT_493459             159   6e-43   
ref|XP_011093194.1|  PREDICTED: putative DNA-binding protein ESCA...    159   6e-43   
ref|XP_009123977.1|  PREDICTED: putative DNA-binding protein ESCA...    159   7e-43   
ref|XP_010940981.1|  PREDICTED: putative DNA-binding protein ESCA...    159   7e-43   
gb|KFK22136.1|  hypothetical protein AALP_AAs47043U000100               159   8e-43   
ref|XP_008346594.1|  PREDICTED: putative DNA-binding protein ESCA...    159   8e-43   
ref|XP_008364289.1|  PREDICTED: putative DNA-binding protein ESCA...    159   8e-43   
ref|XP_010053390.1|  PREDICTED: putative DNA-binding protein ESCA...    159   9e-43   
ref|XP_011029110.1|  PREDICTED: putative DNA-binding protein ESCA...    159   9e-43   
ref|XP_011014152.1|  PREDICTED: putative DNA-binding protein ESCA...    159   1e-42   
ref|XP_008373872.1|  PREDICTED: putative DNA-binding protein ESCA...    159   1e-42   
emb|CDY49327.1|  BnaA05g32890D                                          159   1e-42   
ref|XP_008238673.1|  PREDICTED: putative DNA-binding protein ESCA...    159   1e-42   
ref|XP_006601994.1|  PREDICTED: putative DNA-binding protein ESCA...    159   1e-42   
ref|XP_007163438.1|  hypothetical protein PHAVU_001G234600g             158   1e-42   
ref|XP_004511639.1|  PREDICTED: putative DNA-binding protein ESCA...    157   1e-42   
ref|XP_004503162.1|  PREDICTED: putative DNA-binding protein ESCA...    158   2e-42   
emb|CDY64701.1|  BnaCnng44570D                                          158   2e-42   
gb|KEH34733.1|  AT hook motif DNA-binding family protein                158   2e-42   
ref|XP_004495563.1|  PREDICTED: putative DNA-binding protein ESCA...    158   2e-42   
ref|XP_006477312.1|  PREDICTED: putative DNA-binding protein ESCA...    158   2e-42   
ref|XP_011070911.1|  PREDICTED: putative DNA-binding protein ESCA...    156   3e-42   
ref|XP_006440441.1|  hypothetical protein CICLE_v10021296mg             158   3e-42   
ref|XP_007040019.1|  AT-hook DNA-binding family protein                 157   3e-42   
ref|XP_006285829.1|  hypothetical protein CARUB_v10007306mg             157   3e-42   
ref|XP_008804006.1|  PREDICTED: putative DNA-binding protein ESCA...    157   4e-42   
ref|XP_010053890.1|  PREDICTED: putative DNA-binding protein ESCA...    157   4e-42   
emb|CDP00129.1|  unnamed protein product                                157   4e-42   
ref|XP_003516470.1|  PREDICTED: putative DNA-binding protein ESCA...    157   4e-42   
ref|XP_010552065.1|  PREDICTED: putative DNA-binding protein ESCA...    159   5e-42   
ref|XP_010691133.1|  PREDICTED: putative DNA-binding protein ESCA...    158   6e-42   
ref|XP_007052032.1|  AT-hook motif nuclear-localized protein 22         157   6e-42   
emb|CAN75757.1|  hypothetical protein VITISV_028561                     156   7e-42   Vitis vinifera
ref|XP_008777391.1|  PREDICTED: putative DNA-binding protein ESCA...    157   8e-42   
emb|CBI31637.3|  unnamed protein product                                156   8e-42   
ref|XP_003611214.1|  AT-hook DNA-binding protein                        157   9e-42   
ref|XP_004511638.1|  PREDICTED: putative DNA-binding protein ESCA...    156   9e-42   
ref|XP_011034536.1|  PREDICTED: putative DNA-binding protein ESCA...    156   1e-41   
ref|XP_011090893.1|  PREDICTED: putative DNA-binding protein ESCA...    156   1e-41   
dbj|BAJ94293.1|  predicted protein                                      156   1e-41   
ref|XP_004229823.1|  PREDICTED: putative DNA-binding protein ESCA...    155   1e-41   
ref|XP_010658536.1|  PREDICTED: putative DNA-binding protein ESCA...    156   1e-41   
ref|XP_007134900.1|  hypothetical protein PHAVU_010G085300g             156   2e-41   
gb|KDP44918.1|  hypothetical protein JCGZ_01418                         157   2e-41   
ref|XP_008801621.1|  PREDICTED: putative DNA-binding protein ESCA...    156   2e-41   
ref|XP_004510939.1|  PREDICTED: putative DNA-binding protein ESCA...    155   2e-41   
ref|XP_008791267.1|  PREDICTED: putative DNA-binding protein ESCA...    156   2e-41   
ref|XP_002511734.1|  ESC, putative                                      155   2e-41   Ricinus communis
ref|XP_002320066.1|  DNA-binding family protein                         155   2e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006591349.1|  PREDICTED: putative DNA-binding protein ESCA...    155   2e-41   
gb|KEH19036.1|  AT hook motif DNA-binding family protein                155   2e-41   
ref|XP_010934543.1|  PREDICTED: putative DNA-binding protein ESCA...    155   3e-41   
ref|XP_006363711.1|  PREDICTED: putative DNA-binding protein ESCA...    155   3e-41   
ref|XP_006339443.1|  PREDICTED: putative DNA-binding protein ESCA...    155   3e-41   
gb|KDP25577.1|  hypothetical protein JCGZ_20733                         154   3e-41   
ref|XP_006655164.1|  PREDICTED: putative DNA-binding protein ESCA...    155   4e-41   
ref|XP_007155606.1|  hypothetical protein PHAVU_003G216200g             154   4e-41   
ref|XP_002509637.1|  ESC, putative                                      154   4e-41   Ricinus communis
ref|XP_007009270.1|  AT-hook protein of GA feedback 2                   155   5e-41   
ref|XP_010325447.1|  PREDICTED: putative DNA-binding protein ESCA...    154   5e-41   
ref|XP_009613223.1|  PREDICTED: putative DNA-binding protein ESCA...    154   5e-41   
ref|XP_008437165.1|  PREDICTED: putative DNA-binding protein ESCA...    154   5e-41   
gb|EYU30571.1|  hypothetical protein MIMGU_mgv1a010755mg                154   5e-41   
ref|XP_004245690.1|  PREDICTED: putative DNA-binding protein ESCA...    154   6e-41   
ref|XP_010032377.1|  PREDICTED: putative DNA-binding protein ESCA...    155   6e-41   
ref|XP_009613222.1|  PREDICTED: putative DNA-binding protein ESCA...    154   6e-41   
ref|XP_009604907.1|  PREDICTED: putative DNA-binding protein ESCA...    154   6e-41   
ref|XP_004172826.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...    154   6e-41   
ref|XP_004147565.1|  PREDICTED: putative DNA-binding protein ESCA...    154   6e-41   
ref|NP_001141263.1|  hypothetical protein                               154   6e-41   Zea mays [maize]
ref|XP_003568662.1|  PREDICTED: putative DNA-binding protein ESCA...    154   6e-41   
ref|XP_009799054.1|  PREDICTED: putative DNA-binding protein ESCA...    154   7e-41   
ref|XP_006435633.1|  hypothetical protein CICLE_v10032034mg             155   7e-41   
ref|XP_010692273.1|  PREDICTED: putative DNA-binding protein ESCA...    154   9e-41   
ref|XP_002279636.1|  PREDICTED: putative DNA-binding protein ESCA...    154   9e-41   Vitis vinifera
ref|XP_010907805.1|  PREDICTED: putative DNA-binding protein ESCA...    154   1e-40   
ref|XP_010920512.1|  PREDICTED: putative DNA-binding protein ESCA...    154   1e-40   
emb|CDP17786.1|  unnamed protein product                                154   1e-40   
gb|KFK37871.1|  hypothetical protein AALP_AA3G040100                    154   1e-40   
ref|XP_010923237.1|  PREDICTED: putative DNA-binding protein ESCA...    154   1e-40   
gb|KDO85858.1|  hypothetical protein CISIN_1g047830mg                   154   1e-40   
ref|XP_006445233.1|  hypothetical protein CICLE_v10024070mg             153   1e-40   
ref|XP_009379269.1|  PREDICTED: putative DNA-binding protein ESCA...    154   1e-40   
ref|XP_004307477.1|  PREDICTED: putative DNA-binding protein ESCA...    154   2e-40   
ref|XP_011017502.1|  PREDICTED: putative DNA-binding protein ESCA...    153   2e-40   
ref|XP_003516633.1|  PREDICTED: putative DNA-binding protein ESCA...    151   2e-40   
ref|XP_003538721.1|  PREDICTED: putative DNA-binding protein ESCA...    152   2e-40   
ref|XP_010558745.1|  PREDICTED: putative DNA-binding protein ESCA...    152   2e-40   
ref|XP_007158420.1|  hypothetical protein PHAVU_002G151600g             152   2e-40   
ref|XP_009763802.1|  PREDICTED: putative DNA-binding protein ESCA...    152   2e-40   
ref|XP_010092850.1|  hypothetical protein L484_022445                   153   2e-40   
ref|XP_003517441.1|  PREDICTED: putative DNA-binding protein ESCA...    152   2e-40   
ref|XP_009763803.1|  PREDICTED: putative DNA-binding protein ESCA...    152   2e-40   
ref|XP_008803114.1|  PREDICTED: putative DNA-binding protein ESCA...    153   3e-40   
ref|XP_006649829.1|  PREDICTED: putative DNA-binding protein ESCA...    151   3e-40   
gb|EPS64135.1|  hypothetical protein M569_10646                         152   3e-40   
dbj|BAK03205.1|  predicted protein                                      152   4e-40   
ref|XP_009607803.1|  PREDICTED: putative DNA-binding protein ESCA...    152   4e-40   
ref|XP_008785537.1|  PREDICTED: putative DNA-binding protein ESCA...    152   4e-40   
ref|XP_004952401.1|  PREDICTED: putative DNA-binding protein ESCA...    152   4e-40   
gb|KDP28740.1|  hypothetical protein JCGZ_14511                         152   4e-40   
ref|XP_008371927.1|  PREDICTED: putative DNA-binding protein ESCA...    152   4e-40   
ref|XP_003573204.1|  PREDICTED: putative DNA-binding protein ESCA...    152   4e-40   
ref|NP_001049682.1|  Os03g0270000                                       150   4e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004306909.1|  PREDICTED: putative DNA-binding protein ESCA...    152   4e-40   
ref|XP_010433987.1|  PREDICTED: putative DNA-binding protein ESCA...    152   4e-40   
ref|XP_003549894.1|  PREDICTED: putative DNA-binding protein ESCA...    151   5e-40   
ref|NP_001046754.1|  Os02g0448000                                       152   5e-40   Oryza sativa Japonica Group [Japonica rice]
gb|AIV43385.1|  AHL protein                                             150   5e-40   
ref|XP_002451872.1|  hypothetical protein SORBIDRAFT_04g009050          152   6e-40   Sorghum bicolor [broomcorn]
ref|XP_008233653.1|  PREDICTED: putative DNA-binding protein ESCA...    152   6e-40   
ref|NP_001146992.1|  DNA binding protein                                152   6e-40   Zea mays [maize]
ref|XP_011081090.1|  PREDICTED: putative DNA-binding protein ESCA...    151   7e-40   
ref|XP_009384866.1|  PREDICTED: putative DNA-binding protein ESCA...    152   7e-40   
ref|XP_002869805.1|  hypothetical protein ARALYDRAFT_492588             152   7e-40   
ref|XP_002315208.2|  hypothetical protein POPTR_0010s20780g             152   8e-40   Populus trichocarpa [western balsam poplar]
ref|XP_001785561.1|  predicted protein                                  147   8e-40   
ref|XP_003525782.1|  PREDICTED: putative DNA-binding protein ESCA...    150   9e-40   
ref|XP_006576099.1|  PREDICTED: putative DNA-binding protein ESCA...    149   1e-39   
dbj|BAJ98882.1|  predicted protein                                      149   1e-39   
ref|XP_007218339.1|  hypothetical protein PRUPE_ppa008610mg             151   1e-39   
ref|XP_010439279.1|  PREDICTED: putative DNA-binding protein ESCA...    151   1e-39   
ref|XP_009774038.1|  PREDICTED: putative DNA-binding protein ESCA...    151   1e-39   
ref|XP_010497513.1|  PREDICTED: putative DNA-binding protein ESCA...    147   1e-39   
ref|XP_007141404.1|  hypothetical protein PHAVU_008G192600g             150   2e-39   
ref|NP_194012.1|  putative AT-hook DNA-binding family protein           151   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448831.1|  PREDICTED: putative DNA-binding protein ESCA...    151   2e-39   
ref|XP_011002630.1|  PREDICTED: putative DNA-binding protein ESCA...    151   2e-39   
ref|XP_009402315.1|  PREDICTED: putative DNA-binding protein ESCA...    150   2e-39   
ref|XP_009343806.1|  PREDICTED: putative DNA-binding protein ESCA...    150   2e-39   
dbj|BAF02122.1|  putative DNA binding protein                           150   2e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KHN22151.1|  Putative DNA-binding protein ESCAROLA                   147   3e-39   
ref|XP_003521618.1|  PREDICTED: putative DNA-binding protein ESCA...    150   3e-39   
ref|XP_002312113.2|  hypothetical protein POPTR_0008s05890g             150   3e-39   Populus trichocarpa [western balsam poplar]
ref|XP_006363907.1|  PREDICTED: putative DNA-binding protein ESCA...    147   3e-39   
ref|XP_011033055.1|  PREDICTED: putative DNA-binding protein ESCA...    150   4e-39   
gb|ABL63121.1|  AT-hook DNA-binding protein                             149   5e-39   Catharanthus roseus [chatas]
ref|XP_009351431.1|  PREDICTED: putative DNA-binding protein ESCA...    149   5e-39   
ref|XP_008343156.1|  PREDICTED: putative DNA-binding protein ESCA...    149   5e-39   
ref|XP_003539199.1|  PREDICTED: putative DNA-binding protein ESCA...    147   5e-39   
ref|XP_006358367.1|  PREDICTED: putative DNA-binding protein ESCA...    149   6e-39   
gb|ACU24278.1|  unknown                                                 148   6e-39   
ref|XP_003552472.1|  PREDICTED: putative DNA-binding protein ESCA...    148   7e-39   
ref|XP_009405066.1|  PREDICTED: putative DNA-binding protein ESCA...    148   7e-39   
gb|ACU24276.1|  unknown                                                 147   8e-39   
ref|XP_008796294.1|  PREDICTED: putative DNA-binding protein ESCA...    148   9e-39   
ref|XP_009402946.1|  PREDICTED: putative DNA-binding protein ESCA...    149   9e-39   
ref|XP_009409024.1|  PREDICTED: putative DNA-binding protein ESCA...    149   9e-39   
ref|XP_009621304.1|  PREDICTED: putative DNA-binding protein ESCA...    148   9e-39   
ref|XP_009776190.1|  PREDICTED: putative DNA-binding protein ESCA...    147   1e-38   
ref|XP_010324605.1|  PREDICTED: putative DNA-binding protein ESCA...    149   1e-38   
ref|XP_010538771.1|  PREDICTED: putative DNA-binding protein ESCA...    148   1e-38   
ref|XP_010463937.1|  PREDICTED: putative DNA-binding protein ESCA...    148   1e-38   
ref|XP_002882363.1|  hypothetical protein ARALYDRAFT_477713             148   1e-38   
ref|XP_010485835.1|  PREDICTED: putative DNA-binding protein ESCA...    148   1e-38   
ref|XP_010416191.1|  PREDICTED: putative DNA-binding protein ESCA...    148   1e-38   
ref|NP_566232.1|  AT-hook motif nuclear-localized protein               148   1e-38   
gb|EYU29016.1|  hypothetical protein MIMGU_mgv1a023550mg                148   1e-38   
ref|XP_004145056.1|  PREDICTED: putative DNA-binding protein ESCA...    147   1e-38   
ref|XP_010519962.1|  PREDICTED: putative DNA-binding protein ESCA...    148   1e-38   
ref|XP_003534486.1|  PREDICTED: putative DNA-binding protein ESCA...    147   1e-38   
ref|XP_009594477.1|  PREDICTED: putative DNA-binding protein ESCA...    145   1e-38   
ref|XP_006284928.1|  hypothetical protein CARUB_v10006227mg             149   1e-38   
ref|XP_007156666.1|  hypothetical protein PHAVU_002G006900g             147   2e-38   
ref|XP_007211085.1|  hypothetical protein PRUPE_ppa016700mg             145   2e-38   
ref|XP_004229513.1|  PREDICTED: putative DNA-binding protein ESCA...    146   2e-38   
ref|XP_009778295.1|  PREDICTED: putative DNA-binding protein ESCA...    147   2e-38   
ref|XP_009597193.1|  PREDICTED: putative DNA-binding protein ESCA...    147   2e-38   
gb|KDP40294.1|  hypothetical protein JCGZ_02292                         144   2e-38   
ref|XP_004242015.1|  PREDICTED: putative DNA-binding protein ESCA...    145   2e-38   
ref|XP_001763021.1|  predicted protein                                  143   3e-38   
ref|XP_007139682.1|  hypothetical protein PHAVU_008G050100g             146   3e-38   
ref|XP_006413619.1|  hypothetical protein EUTSA_v10025672mg             148   3e-38   
ref|XP_010540129.1|  PREDICTED: putative DNA-binding protein ESCA...    147   3e-38   
ref|XP_002527105.1|  DNA binding protein, putative                      146   3e-38   
ref|XP_008467078.1|  PREDICTED: putative DNA-binding protein ESCA...    146   4e-38   
ref|XP_010523691.1|  PREDICTED: putative DNA-binding protein ESCA...    146   4e-38   
ref|XP_008663461.1|  PREDICTED: putative DNA-binding protein ESCA...    147   4e-38   
ref|XP_011085041.1|  PREDICTED: putative DNA-binding protein ESCA...    146   4e-38   
gb|AFK38460.1|  unknown                                                 145   4e-38   
ref|XP_004509027.1|  PREDICTED: putative DNA-binding protein ESCA...    146   5e-38   
ref|XP_008668970.1|  PREDICTED: putative DNA-binding protein ESCA...    147   5e-38   
gb|AES80473.2|  AT hook motif DNA-binding family protein                145   5e-38   
ref|XP_002524209.1|  ESC, putative                                      147   5e-38   
ref|XP_009788952.1|  PREDICTED: putative DNA-binding protein ESCA...    144   5e-38   
ref|XP_009420779.1|  PREDICTED: putative DNA-binding protein ESCA...    146   5e-38   
ref|XP_009373365.1|  PREDICTED: putative DNA-binding protein ESCA...    144   5e-38   
ref|XP_007043111.1|  AT-hook DNA-binding family protein, putative       146   6e-38   
gb|KCW60423.1|  hypothetical protein EUGRSUZ_H03144                     143   6e-38   
ref|XP_001765845.1|  predicted protein                                  142   6e-38   
tpg|DAA36260.1|  TPA: hypothetical protein ZEAMMB73_652841              147   6e-38   
ref|XP_002279677.2|  PREDICTED: putative DNA-binding protein ESCA...    145   6e-38   
ref|XP_007220373.1|  hypothetical protein PRUPE_ppa018314mg             146   6e-38   
gb|EYU18229.1|  hypothetical protein MIMGU_mgv1a020284mg                144   6e-38   
ref|XP_009411479.1|  PREDICTED: putative DNA-binding protein ESCA...    146   7e-38   
ref|XP_006408178.1|  hypothetical protein EUTSA_v10021166mg             146   7e-38   
gb|AAY86771.1|  putative DNA-binding protein                            146   7e-38   
ref|XP_010102152.1|  hypothetical protein L484_021386                   145   7e-38   
ref|XP_004305833.1|  PREDICTED: putative DNA-binding protein ESCA...    145   7e-38   
emb|CDX98771.1|  BnaA03g45560D                                          146   8e-38   
ref|XP_011074056.1|  PREDICTED: putative DNA-binding protein ESCA...    146   8e-38   
ref|XP_009382863.1|  PREDICTED: putative DNA-binding protein ESCA...    146   9e-38   
ref|XP_004490915.1|  PREDICTED: putative DNA-binding protein ESCA...    146   9e-38   
ref|XP_008229461.1|  PREDICTED: putative DNA-binding protein ESCA...    145   9e-38   
ref|XP_007048865.1|  AT-hook DNA-binding family protein                 144   1e-37   
ref|XP_003624255.1|  AT-hook DNA-binding protein                        145   1e-37   
ref|XP_010269998.1|  PREDICTED: putative DNA-binding protein ESCA...    145   1e-37   
ref|XP_008356452.1|  PREDICTED: putative DNA-binding protein ESCA...    145   1e-37   
ref|XP_010104316.1|  hypothetical protein L484_023266                   144   1e-37   
emb|CDX94128.1|  BnaC07g37620D                                          146   1e-37   
ref|XP_002448423.1|  hypothetical protein SORBIDRAFT_06g026940          145   1e-37   
ref|XP_006647239.1|  PREDICTED: putative DNA-binding protein ESCA...    145   1e-37   
ref|XP_009377422.1|  PREDICTED: putative DNA-binding protein ESCA...    144   2e-37   
ref|XP_004976643.1|  PREDICTED: putative DNA-binding protein ESCA...    145   2e-37   
gb|KFK28863.1|  hypothetical protein AALP_AA7G058200                    145   2e-37   
ref|XP_009137280.1|  PREDICTED: putative DNA-binding protein ESCA...    145   2e-37   
ref|XP_010433825.1|  PREDICTED: putative DNA-binding protein ESCA...    145   2e-37   
gb|KCW71795.1|  hypothetical protein EUGRSUZ_E00284                     144   2e-37   
emb|CDY41289.1|  BnaA01g12500D                                          145   2e-37   
ref|XP_009136213.1|  PREDICTED: putative DNA-binding protein ESCA...    145   2e-37   
emb|CDP09327.1|  unnamed protein product                                144   2e-37   
ref|XP_003558257.1|  PREDICTED: putative DNA-binding protein ESCA...    144   2e-37   
ref|XP_010055327.1|  PREDICTED: putative DNA-binding protein ESCA...    144   2e-37   
ref|XP_009347388.1|  PREDICTED: putative DNA-binding protein ESCA...    144   2e-37   
gb|AFG55091.1|  hypothetical protein 2_10133_02                         140   2e-37   
emb|CDX82978.1|  BnaC01g14280D                                          145   2e-37   
ref|XP_004300243.1|  PREDICTED: putative DNA-binding protein ESCA...    144   2e-37   
ref|XP_008377132.1|  PREDICTED: putative DNA-binding protein ESCA...    144   2e-37   
ref|XP_003524711.1|  PREDICTED: putative DNA-binding protein ESCA...    144   3e-37   
ref|XP_009377073.1|  PREDICTED: putative DNA-binding protein ESCA...    144   3e-37   
ref|XP_010455638.1|  PREDICTED: putative DNA-binding protein ESCA...    145   3e-37   
ref|XP_004492894.1|  PREDICTED: putative DNA-binding protein ESCA...    143   3e-37   
ref|XP_008362336.1|  PREDICTED: putative DNA-binding protein ESCA...    143   3e-37   
ref|XP_009393002.1|  PREDICTED: putative DNA-binding protein ESCA...    144   3e-37   
ref|XP_008380207.1|  PREDICTED: putative DNA-binding protein ESCA...    143   3e-37   
ref|XP_004301614.1|  PREDICTED: putative DNA-binding protein ESCA...    144   3e-37   
ref|XP_008353637.1|  PREDICTED: putative DNA-binding protein ESCA...    142   3e-37   
gb|KDP46909.1|  hypothetical protein JCGZ_10400                         143   3e-37   
ref|XP_008342359.1|  PREDICTED: putative DNA-binding protein ESCA...    142   4e-37   
ref|XP_010065253.1|  PREDICTED: putative DNA-binding protein ESCA...    141   4e-37   
ref|XP_008786310.1|  PREDICTED: putative DNA-binding protein ESCA...    144   4e-37   
ref|XP_008354801.1|  PREDICTED: putative DNA-binding protein ESCA...    144   4e-37   
gb|KDO60958.1|  hypothetical protein CISIN_1g040216mg                   143   4e-37   
ref|XP_009344356.1|  PREDICTED: putative DNA-binding protein ESCA...    144   4e-37   
ref|XP_010554616.1|  PREDICTED: putative DNA-binding protein ESCA...    144   4e-37   
ref|XP_011100032.1|  PREDICTED: putative DNA-binding protein ESCA...    144   5e-37   
ref|NP_001053704.1|  Os04g0590200                                       144   5e-37   
ref|XP_009419257.1|  PREDICTED: putative DNA-binding protein ESCA...    144   5e-37   
ref|XP_009351025.1|  PREDICTED: putative DNA-binding protein ESCA...    144   5e-37   
ref|XP_006299205.1|  hypothetical protein CARUB_v10015351mg             144   5e-37   
ref|XP_007155775.1|  hypothetical protein PHAVU_003G230600g             143   6e-37   
ref|XP_004161914.1|  PREDICTED: putative DNA-binding protein ESCA...    142   6e-37   
ref|XP_011094152.1|  PREDICTED: putative DNA-binding protein ESCA...    142   6e-37   
ref|XP_008461695.1|  PREDICTED: putative DNA-binding protein ESCA...    142   6e-37   
ref|XP_006437176.1|  hypothetical protein CICLE_v10032444mg             142   8e-37   
ref|NP_192942.1|  putative AT-hook DNA-binding family protein           144   8e-37   
gb|EYU40290.1|  hypothetical protein MIMGU_mgv1a019526mg                143   9e-37   
ref|XP_011086333.1|  PREDICTED: putative DNA-binding protein ESCA...    142   9e-37   
ref|XP_008238264.1|  PREDICTED: putative DNA-binding protein ESCA...    142   9e-37   
ref|XP_007210169.1|  hypothetical protein PRUPE_ppa019786mg             142   9e-37   
ref|XP_010913859.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...    143   1e-36   
ref|XP_009356620.1|  PREDICTED: putative DNA-binding protein ESCA...    142   1e-36   
gb|KDP22981.1|  hypothetical protein JCGZ_01738                         143   1e-36   
ref|XP_003571267.1|  PREDICTED: putative DNA-binding protein ESCA...    142   1e-36   
ref|XP_010690586.1|  PREDICTED: putative DNA-binding protein ESCA...    142   1e-36   
ref|XP_008343481.1|  PREDICTED: putative DNA-binding protein ESCA...    144   1e-36   
ref|XP_008373356.1|  PREDICTED: putative DNA-binding protein ESCA...    144   1e-36   
ref|XP_010270573.1|  PREDICTED: putative DNA-binding protein ESCA...    142   1e-36   
emb|CAN83987.1|  hypothetical protein VITISV_032602                     142   1e-36   
ref|XP_002273442.1|  PREDICTED: putative DNA-binding protein ESCA...    142   1e-36   
ref|XP_008232681.1|  PREDICTED: putative DNA-binding protein ESCA...    143   1e-36   
ref|XP_011041154.1|  PREDICTED: putative DNA-binding protein ESCA...    142   1e-36   
gb|KCW77938.1|  hypothetical protein EUGRSUZ_D02188                     142   2e-36   
ref|XP_011034791.1|  PREDICTED: putative DNA-binding protein ESCA...    141   2e-36   
ref|XP_001760962.1|  predicted protein                                  138   2e-36   
ref|XP_010933490.1|  PREDICTED: putative DNA-binding protein ESCA...    142   2e-36   
ref|XP_009336832.1|  PREDICTED: putative DNA-binding protein ESCA...    142   2e-36   
ref|XP_011093448.1|  PREDICTED: putative DNA-binding protein ESCA...    142   2e-36   
ref|XP_008232226.1|  PREDICTED: putative DNA-binding protein ESCA...    142   2e-36   
ref|XP_011018582.1|  PREDICTED: putative DNA-binding protein ESCA...    142   2e-36   
gb|KFK31952.1|  hypothetical protein AALP_AA6G181300                    143   2e-36   
gb|EYU41285.1|  hypothetical protein MIMGU_mgv1a025243mg                142   2e-36   
ref|XP_008375698.1|  PREDICTED: putative DNA-binding protein ESCA...    142   2e-36   
ref|XP_009143141.1|  PREDICTED: putative DNA-binding protein ESCA...    142   2e-36   
ref|XP_007220428.1|  hypothetical protein PRUPE_ppa009347mg             142   2e-36   
ref|XP_004984928.1|  PREDICTED: putative DNA-binding protein ESCA...    141   3e-36   
ref|XP_002874744.1|  hypothetical protein ARALYDRAFT_490024             142   3e-36   
ref|XP_009130966.1|  PREDICTED: putative DNA-binding protein ESCA...    142   3e-36   
ref|XP_002307001.2|  hypothetical protein POPTR_0005s27850g             142   3e-36   
ref|XP_009794976.1|  PREDICTED: putative DNA-binding protein ESCA...    141   3e-36   
ref|XP_006396802.1|  hypothetical protein EUTSA_v10029174mg             142   3e-36   
ref|XP_004147679.1|  PREDICTED: putative DNA-binding protein ESCA...    141   3e-36   
ref|XP_010053603.1|  PREDICTED: putative DNA-binding protein ESCA...    141   3e-36   
emb|CDX78802.1|  BnaA01g08690D                                          141   3e-36   
ref|XP_006368407.1|  DNA-binding family protein                         141   3e-36   
ref|XP_009589802.1|  PREDICTED: putative DNA-binding protein ESCA...    141   3e-36   
gb|ABD65635.1|  hypothetical protein 23.t00073                          141   3e-36   
emb|CDY54780.1|  BnaAnng13510D                                          141   3e-36   
ref|XP_010422173.1|  PREDICTED: putative DNA-binding protein ESCA...    142   3e-36   
ref|XP_008453469.1|  PREDICTED: putative DNA-binding protein ESCA...    141   4e-36   
ref|XP_010645606.1|  PREDICTED: putative DNA-binding protein ESCA...    141   4e-36   
ref|XP_007039519.1|  AT-hook DNA-binding family protein                 141   4e-36   
ref|XP_006436718.1|  hypothetical protein CICLE_v10032253mg             141   4e-36   
ref|XP_009791033.1|  PREDICTED: putative DNA-binding protein ESCA...    140   4e-36   
emb|CDY18931.1|  BnaC04g04190D                                          141   4e-36   
ref|XP_002301896.2|  hypothetical protein POPTR_0002s00560g             141   4e-36   
ref|XP_010917984.1|  PREDICTED: putative DNA-binding protein ESCA...    141   4e-36   
ref|XP_010532413.1|  PREDICTED: putative DNA-binding protein ESCA...    142   4e-36   
ref|XP_010097716.1|  hypothetical protein L484_023857                   141   4e-36   
ref|XP_002281411.1|  PREDICTED: putative DNA-binding protein ESCA...    140   4e-36   
ref|XP_006366237.1|  PREDICTED: putative DNA-binding protein ESCA...    140   4e-36   
ref|XP_010505030.1|  PREDICTED: putative DNA-binding protein ESCA...    140   5e-36   
emb|CDY41211.1|  BnaC08g26470D                                          140   6e-36   
ref|XP_002468116.1|  hypothetical protein SORBIDRAFT_01g039840          140   6e-36   
ref|XP_008788674.1|  PREDICTED: putative DNA-binding protein ESCA...    141   6e-36   
dbj|BAK02723.1|  predicted protein                                      141   7e-36   
gb|EYU41204.1|  hypothetical protein MIMGU_mgv1a017994mg                141   7e-36   
ref|XP_006847733.1|  hypothetical protein AMTR_s00149p00093420          140   7e-36   
ref|XP_010275243.1|  PREDICTED: putative DNA-binding protein ESCA...    140   7e-36   
ref|XP_002519826.1|  ESC, putative                                      140   8e-36   
ref|XP_004160444.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...    140   1e-35   
ref|NP_182067.1|  AT-hook motif nuclear-localized protein 22            140   1e-35   
gb|KFK37336.1|  hypothetical protein AALP_AA4G243300                    140   1e-35   
emb|CDX74739.1|  BnaA05g04850D                                          140   1e-35   
ref|XP_006296351.1|  hypothetical protein CARUB_v10025523mg             140   1e-35   
ref|XP_009762421.1|  PREDICTED: putative DNA-binding protein ESCA...    139   1e-35   
emb|CDP13007.1|  unnamed protein product                                140   1e-35   
ref|XP_002307550.2|  hypothetical protein POPTR_0005s22440g             139   1e-35   
ref|XP_004153985.1|  PREDICTED: putative DNA-binding protein ESCA...    139   1e-35   
ref|XP_004145070.1|  PREDICTED: putative DNA-binding protein ESCA...    139   1e-35   
ref|XP_006397724.1|  hypothetical protein EUTSA_v10001760mg             140   1e-35   
ref|XP_011044786.1|  PREDICTED: putative DNA-binding protein ESCA...    139   1e-35   
ref|XP_002510734.1|  DNA binding protein, putative                      140   1e-35   
ref|XP_002880179.1|  hypothetical protein ARALYDRAFT_903987             140   1e-35   
ref|XP_010266286.1|  PREDICTED: putative DNA-binding protein ESCA...    139   1e-35   
ref|XP_010052700.1|  PREDICTED: putative DNA-binding protein ESCA...    139   1e-35   
gb|AES90815.2|  AT hook motif DNA-binding family protein                140   1e-35   
ref|XP_010063173.1|  PREDICTED: putative DNA-binding protein ESCA...    139   1e-35   
ref|XP_010518160.1|  PREDICTED: putative DNA-binding protein ESCA...    140   1e-35   
ref|XP_003608618.1|  AT-hook DNA-binding protein                        139   1e-35   
ref|XP_010524099.1|  PREDICTED: putative DNA-binding protein ESCA...    139   1e-35   
ref|XP_010508171.1|  PREDICTED: putative DNA-binding protein ESCA...    140   1e-35   
ref|XP_010506485.1|  PREDICTED: putative DNA-binding protein ESCA...    140   1e-35   
gb|EPS65599.1|  hypothetical protein M569_09178                         137   1e-35   
ref|XP_009142337.1|  PREDICTED: putative DNA-binding protein ESCA...    140   2e-35   
emb|CDY27387.1|  BnaC04g50180D                                          140   2e-35   
ref|XP_002969614.1|  hypothetical protein SELMODRAFT_71342              137   2e-35   
emb|CDY37040.1|  BnaA04g26180D                                          140   2e-35   
ref|XP_004137338.1|  PREDICTED: uncharacterized protein LOC101219306    141   2e-35   
ref|XP_010531743.1|  PREDICTED: putative DNA-binding protein ESCA...    138   2e-35   
ref|XP_006289235.1|  hypothetical protein CARUB_v10002691mg             140   2e-35   
gb|KCW70368.1|  hypothetical protein EUGRSUZ_F03609                     139   2e-35   
ref|XP_010063174.1|  PREDICTED: putative DNA-binding protein ESCA...    139   2e-35   
gb|KFK23205.1|  hypothetical protein AALP_AAs54797U000100               139   2e-35   
ref|XP_009372638.1|  PREDICTED: putative DNA-binding protein ESCA...    140   2e-35   
ref|XP_002300879.2|  hypothetical protein POPTR_0002s06030g             138   2e-35   
ref|XP_004243206.1|  PREDICTED: putative DNA-binding protein ESCA...    138   3e-35   
ref|XP_009592710.1|  PREDICTED: putative DNA-binding protein ESCA...    138   3e-35   
ref|XP_011026257.1|  PREDICTED: putative DNA-binding protein ESCA...    138   3e-35   
ref|XP_006348956.1|  PREDICTED: putative DNA-binding protein ESCA...    138   3e-35   
ref|XP_007018654.1|  AT-hook DNA-binding family protein, putative       140   3e-35   
ref|XP_010509635.1|  PREDICTED: putative DNA-binding protein ESCA...    139   3e-35   



>gb|ABZ89182.1| putative protein [Coffea canephora]
 gb|ADZ55300.1| DNA-binding protein [Coffea arabica]
 emb|CDO99972.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 181/211 (86%), Gaps = 6/211 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA+G+D+AESIAQFARRRQRGVCV+SASGTVTNVT
Sbjct  80   SKNKPKPPIFVTRDSPNALRSHVMEVANGSDIAESIAQFARRRQRGVCVLSASGTVTNVT  139

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAVMALHGRFEILSLTGAFLPGP+PPG+TGLTIYLAGGQGQVVGGSVVGSLVA
Sbjct  140  LRQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGATGLTIYLAGGQGQVVGGSVVGSLVA  199

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVMVI STFSNATYERLP+E DEE   AA  +    G      G A    G+GDPS M
Sbjct  200  SGPVMVIASTFSNATYERLPIEEDEEGGGAAQGQLGGNGSPPLGSGGAPQQGGLGDPSSM  259

Query  541  PGVYNLPPNMVA-----SNEAFAWAHGRPPY  618
            P VYNLPPN++      ++EAFAWAHGRPPY
Sbjct  260  P-VYNLPPNLMPNGGQLNHEAFAWAHGRPPY  289



>gb|ADY38789.1| DNA-binding protein [Coffea arabica]
Length=289

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 181/211 (86%), Gaps = 6/211 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA+G+D+AESIAQFARRRQRGVCV+SASGTVTNVT
Sbjct  80   SKNKPKPPIFVTRDSPNALRSHVMEVANGSDIAESIAQFARRRQRGVCVLSASGTVTNVT  139

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAVMALHGRFEILSLTGAFLPGP+PPG+TGLTIYLAGGQGQVVGGSVVGSLVA
Sbjct  140  LRQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGATGLTIYLAGGQGQVVGGSVVGSLVA  199

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVMVI STFSNATYERLP+E DEE   AA  +    G      G A    G+GDPS M
Sbjct  200  SGPVMVIASTFSNATYERLPIEEDEEGGGAAQGQLGGNGSPPLGSGGAPQQGGLGDPSSM  259

Query  541  PGVYNLPPNMVA-----SNEAFAWAHGRPPY  618
            P VY+LPPN++      ++EAFAWAHGRPPY
Sbjct  260  P-VYSLPPNLMPNGGQLNHEAFAWAHGRPPY  289



>ref|XP_004249915.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=294

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 171/222 (77%), Gaps = 17/222 (8%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA+GADVAESIAQFAR+RQRGVCV+SA+GTVTNVT
Sbjct  74   SKNKPKPPIFVTRDSPNALRSHVMEVANGADVAESIAQFARKRQRGVCVLSATGTVTNVT  133

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAVMALHGRFEILSLTGAFLPGP+PPGSTGLTIYLAGGQGQVVGGSVVGSLVA
Sbjct  134  LRQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSLVA  193

Query  361  agPVMVIGSTFSNATYERl-----------plepdeeeaaaataepqlggggspppgmas  507
            +GPVMVI STFSNATYERL             +        +       GGG    G   
Sbjct  194  SGPVMVIASTFSNATYERLPLEEEEEGGGPAAQGQLGGGGGSPPGMGGSGGGQQQQGGGG  253

Query  508  agagmgdpspMPGVYNLPPNMVA-----SNEAFAWAHGRPPY  618
             G G    S MP VYNLPPN++      ++EAF WAHGRPP+
Sbjct  254  GGMGDIPSSNMP-VYNLPPNLLPNGGQMNHEAFGWAHGRPPF  294



>ref|XP_007035040.1| AT-hook motif nuclear localized protein 20 [Theobroma cacao]
 gb|EOY05966.1| AT-hook motif nuclear localized protein 20 [Theobroma cacao]
Length=273

 Score =   200 bits (508),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 172/213 (81%), Gaps = 8/213 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVASG DVAESIAQFARRRQRGVCV+S SG+V NVT
Sbjct  62   SKNKPKPPIFVTRDSPNALRSHVMEVASGTDVAESIAQFARRRQRGVCVLSGSGSVANVT  121

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTGAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVGSL+A
Sbjct  122  LRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLIA  181

Query  361  agPVMVIGSTFSNATYERl--plepdeeeaaaataepqlggggspppgmasagagmgdps  534
            AGPVMVI +TF+NATYERL    + +              G   P  G +    G+ DPS
Sbjct  182  AGPVMVIAATFANATYERLPIEDDEEAGSGGHGGQIQGGAGNSPPAIGSSGPQTGLPDPS  241

Query  535  pMPGVYNLPPNMVAS-----NEAFAWAHGRPPY  618
             +P +YNLPPN++A+     +EA+AWAHGRPPY
Sbjct  242  SLP-IYNLPPNLLANGGQLGHEAYAWAHGRPPY  273



>ref|XP_010024974.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
Length=282

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 172/211 (82%), Gaps = 7/211 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+A+GAD+AES+AQFARRRQRGVCV+S SGTVTNVT
Sbjct  73   SKNKPKPPIFVTRDSPNALRSHVMEIANGADIAESVAQFARRRQRGVCVLSGSGTVTNVT  132

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAVMALHGRFEILSLTGAFLPGP+PPGSTGLTIYLAGGQGQVVGGSVVGSLVA
Sbjct  133  LRQPTAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSLVA  192

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVMVI +TFSNATYER     ++EEA +   +   G       G      GM DPS M
Sbjct  193  SGPVMVIAATFSNATYER-LPLEEDEEAGSGQGQLGSGSPPGIGGGGGQQQGGMADPSSM  251

Query  541  PGVYNLPPNMVA-----SNEAFAWAHGRPPY  618
            P VYNLPPN++      ++EA+ W HGRP Y
Sbjct  252  P-VYNLPPNLLPNGGQLNHEAYGWTHGRPTY  281



>ref|XP_009784464.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009784466.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009784467.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
sylvestris]
Length=296

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 176/223 (79%), Gaps = 18/223 (8%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA+GADVAESIAQFAR+RQRGVCV+SA+GTVTNVT
Sbjct  75   SKNKPKPPIFVTRDSPNALRSHVMEVANGADVAESIAQFARKRQRGVCVLSATGTVTNVT  134

Query  181  LRQPSAPG-AVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslv  357
            LRQPSAPG AVMALHGRFEILSLTGAFLPGP+PPGSTGLTIYLAGGQGQVVGGSVVG LV
Sbjct  135  LRQPSAPGSAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGPLV  194

Query  358  aagPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgd---  528
            A+GPVMVI STFSNATYERLPLE +EE    A      GGGG   P       G      
Sbjct  195  ASGPVMVIASTFSNATYERLPLEEEEEGGGQAAQGQLGGGGGGGSPPGMGGSGGGRAQQG  254

Query  529  --------pspMPGVYNLPPNMVA-----SNEAFAWAHGRPPY  618
                     S MP VYNLPPN++      ++EAFAWAHGRPP+
Sbjct  255  GGGGMGDPSSNMP-VYNLPPNLLPNGGQLNHEAFAWAHGRPPF  296



>emb|CBI35166.3| unnamed protein product [Vitis vinifera]
Length=275

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 167/212 (79%), Gaps = 18/212 (8%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA+G+D+ ESIAQFARRRQRGVCV+SASGTV NVT
Sbjct  76   SKNKPKPPIFVTRDSPNALRSHVMEVANGSDITESIAQFARRRQRGVCVLSASGTVMNVT  135

Query  181  LRQPSAP-GAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslv  357
            LRQPSAP GAVMALHGRFEILSLTGAFLPGP+PPGSTGLTIYLAGGQ QVVGGSVVGSL+
Sbjct  136  LRQPSAPGGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQAQVVGGSVVGSLI  195

Query  358  aagPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpsp  537
            AAGPVMVI +TFSNATYER               + +  G  +        G GM DPS 
Sbjct  196  AAGPVMVIAATFSNATYER-----------LPLEDEEEAGSAAQEQLAGGGGGGMADPSS  244

Query  538  MPGVYNLPPNMVA-----SNEAFAWAHGRPPY  618
            MP VYNLPPN++      +++A+ WAHGR PY
Sbjct  245  MP-VYNLPPNLLPNGGQLNHDAYGWAHGRQPY  275



>ref|XP_011029905.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Populus 
euphratica]
Length=292

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 172/212 (81%), Gaps = 6/212 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+A GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  81   SKNKPKPPIFVTRDSPNALRSHVMEIAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  140

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTGAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVGSLVA
Sbjct  141  LRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVA  200

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVMVI +TF+NATYERLPLE DEE  +    + Q G   SPP   +S           
Sbjct  201  AGPVMVIAATFANATYERLPLEDDEEAGSGGQGQIQSGANNSPPAIGSSGQQAGLPDPSA  260

Query  541  PGVYNLPPNMVAS------NEAFAWAHGRPPY  618
              +YNLPPN++ +      ++A+AWAH RPPY
Sbjct  261  MPIYNLPPNLIPNGAHQLGHDAYAWAHARPPY  292



>ref|XP_002312579.2| hypothetical protein POPTR_0008s16440g, partial [Populus trichocarpa]
 gb|EEE89946.2| hypothetical protein POPTR_0008s16440g, partial [Populus trichocarpa]
Length=291

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 172/212 (81%), Gaps = 6/212 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+A GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  80   SKNKPKPPIFVTRDSPNALRSHVMEIAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  139

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTGAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVGSLVA
Sbjct  140  LRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVA  199

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVMVI +TF+NATYERLPLE D+E  +    + Q G   SPP   +S           
Sbjct  200  AGPVMVIAATFANATYERLPLEDDDEAGSGGQGQIQSGANNSPPAIGSSGQQAGLPDPSA  259

Query  541  PGVYNLPPNMVAS------NEAFAWAHGRPPY  618
              +YNLPPN++ +      ++A+AWAH RPPY
Sbjct  260  MPIYNLPPNLIPNGAHQLGHDAYAWAHARPPY  291



>ref|XP_004302076.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=306

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 180/215 (84%), Gaps = 10/215 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+A+GAD+AES+AQFAR RQRGVCVMS SGTVTNVT
Sbjct  93   SKNKPKPPIFVTRDSPNALRSHVMEIANGADIAESVAQFARARQRGVCVMSGSGTVTNVT  152

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAVMALHGRFEILSLTGAFLPGP+PPG+TG+TIYLAGGQGQVVGGSVVG LVA
Sbjct  153  LRQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGATGMTIYLAGGQGQVVGGSVVGPLVA  212

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVMVI +TFSNATYERLPL+ +E++   A    Q GGGGS PPG+  +        P 
Sbjct  213  SGPVMVIAATFSNATYERLPLDQEEDDQPPAPNSGQPGGGGSSPPGIGGSLGDPNSSMP-  271

Query  541  PGVYNLPPNMVA------SNEAFA-WAH--GRPPY  618
            PGVYNLPP++V       S+EA++ WAH  GRPP+
Sbjct  272  PGVYNLPPSLVPNGGGQLSHEAYSNWAHGGGRPPF  306



>ref|XP_002529315.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF33084.1| DNA binding protein, putative [Ricinus communis]
Length=301

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 173/211 (82%), Gaps = 5/211 (2%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EV  GADVAE +AQFARRRQRGVCV+S SG+V NVT
Sbjct  90   SKNKPKPPIFVTRDSPNALRSHVMEVVGGADVAECVAQFARRRQRGVCVLSGSGSVANVT  149

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTGAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVGSL+A
Sbjct  150  LRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLIA  209

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVMVI +TF+NATYERLPLE DEE A+A     Q G   SPPP  ++           
Sbjct  210  AGPVMVIAATFANATYERLPLEDDEEAASAGQGHIQGGSNNSPPPIGSTGQQPGLPDPSA  269

Query  541  PGVYNLPPNMVAS-----NEAFAWAHGRPPY  618
              VYNLPPN++ +     ++A+AWAHGRPPY
Sbjct  270  LPVYNLPPNLIPNGGQLGHDAYAWAHGRPPY  300



>ref|XP_010262258.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=255

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 167/214 (78%), Gaps = 9/214 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GADVAES+AQFARRRQRGVCV+S SG V NVT
Sbjct  43   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGAVANVT  102

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTGAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVG+LVA
Sbjct  103  LRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLVA  162

Query  361  agPVMVIGSTFSNATYER---lplepdeeeaaaataepqlggggspppgmasagagmgdp  531
            AGPVMVI +TF+NATYER      E +             G         A   +G+ DP
Sbjct  163  AGPVMVIAATFANATYERLPLEEEEDEAGSGGQGQLAGGAGSSPPAIGSSAQQQSGLPDP  222

Query  532  spMPGVYNLPPNMVA-----SNEAFAWAHGRPPY  618
            S +P +YNLPPN++      +++AFAWAH RPP+
Sbjct  223  SSLP-IYNLPPNLIPNGGQLNHDAFAWAHARPPF  255



>emb|CAN61523.1| hypothetical protein VITISV_016751 [Vitis vinifera]
Length=259

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 166/217 (76%), Gaps = 12/217 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA+G+D+ ESIAQFARRRQRGVCV+SASGTV NVT
Sbjct  44   SKNKPKPPIFVTRDSPNALRSHVMEVANGSDITESIAQFARRRQRGVCVLSASGTVMNVT  103

Query  181  LRQPSAP-GAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslv  357
            LRQPSAP GAVMALHGRFEILSLTGAFLPGP+PPGSTGLTIYLAGGQ QVVGGSVVGSL+
Sbjct  104  LRQPSAPGGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQAQVVGGSVVGSLI  163

Query  358  aagPVMVIGSTFSNATYER-----lplepdeeeaaaataepqlggggspppgmasagagm  522
            AAGPVMVI +TFSNATYER             +   A      G             AGM
Sbjct  164  AAGPVMVIAATFSNATYERLPLEDEEEAGSAAQEQLAGGGGGGGSPPGIGGSGGQQQAGM  223

Query  523  gdpspMPGVYNLPPNMVA-----SNEAFAWAHGRPPY  618
             DPS MP VYNLPPN++      +++A+ WAHGR PY
Sbjct  224  ADPSSMP-VYNLPPNLLPNGGQLNHDAYGWAHGRQPY  259



>ref|XP_002271606.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=291

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 166/217 (76%), Gaps = 12/217 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA+G+D+ ESIAQFARRRQRGVCV+SASGTV NVT
Sbjct  76   SKNKPKPPIFVTRDSPNALRSHVMEVANGSDITESIAQFARRRQRGVCVLSASGTVMNVT  135

Query  181  LRQPSAP-GAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslv  357
            LRQPSAP GAVMALHGRFEILSLTGAFLPGP+PPGSTGLTIYLAGGQ QVVGGSVVGSL+
Sbjct  136  LRQPSAPGGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQAQVVGGSVVGSLI  195

Query  358  aagPVMVIGSTFSNATYER-----lplepdeeeaaaataepqlggggspppgmasagagm  522
            AAGPVMVI +TFSNATYER             +   A      G             AGM
Sbjct  196  AAGPVMVIAATFSNATYERLPLEDEEEAGSAAQEQLAGGGGGGGSPPGIGGSGGQQQAGM  255

Query  523  gdpspMPGVYNLPPNMVA-----SNEAFAWAHGRPPY  618
             DPS MP VYNLPPN++      +++A+ WAHGR PY
Sbjct  256  ADPSSMP-VYNLPPNLLPNGGQLNHDAYGWAHGRQPY  291



>ref|XP_010104063.1| hypothetical protein L484_008144 [Morus notabilis]
 gb|EXB98164.1| hypothetical protein L484_008144 [Morus notabilis]
Length=340

 Score =   194 bits (494),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 171/217 (79%), Gaps = 11/217 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  124  SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  183

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAV+ALHGRFEILSLTGAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVGSLVA
Sbjct  184  LRQPSAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVA  243

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVMVI +TF+NATYERLPL+ DEE  +        GG G  P  +     G   P  +
Sbjct  244  AGPVMVIAATFANATYERLPLDDDEEAGSGGGGHGGGGGSGGSPNAIGGGPGGQLHPPGL  303

Query  541  PG-----VYNLPPNMVAS------NEAFAWAHGRPPY  618
            P      VYNLPPN+V +      +E +AW H RPPY
Sbjct  304  PDPSALPVYNLPPNLVPNGGHQLGHEPYAWTHARPPY  340



>ref|XP_006420137.1| hypothetical protein CICLE_v10005603mg [Citrus clementina]
 gb|ESR33377.1| hypothetical protein CICLE_v10005603mg [Citrus clementina]
Length=276

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 167/215 (78%), Gaps = 9/215 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN+LRSHV+EVA GADVAES+A FARRRQRGVCV+S SG+V NVT
Sbjct  61   SKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVALFARRRQRGVCVLSGSGSVANVT  120

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTGAFLPGPSPPGSTGLT+YLAGGQGQVVGGSVVG LVA
Sbjct  121  LRQPAAPGAVVALHGRFEILSLTGAFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGQLVA  180

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaata-epqlggggspppgmasagagmgdpsp  537
            AGPVMVI +TF+NATYERLPLE DEE        +       +         +G    + 
Sbjct  181  AGPVMVIAATFANATYERLPLEDDEEVTGTQGQIQSTGAAANNNNSPPQIGSSGQPSSAG  240

Query  538  MPG----VYNLPPNMVAS----NEAFAWAHGRPPY  618
            +P      YNLPPN++ +    +EA+AWAH RPPY
Sbjct  241  LPDPSSLTYNLPPNLIPNGGQLHEAYAWAHARPPY  275



>ref|XP_007030480.1| AT-hook motif nuclear localized protein 20 [Theobroma cacao]
 gb|EOY10982.1| AT-hook motif nuclear localized protein 20 [Theobroma cacao]
Length=297

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 167/220 (76%), Gaps = 14/220 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKN+PKPPIFVTRDSPNALRSHV+E+A+G+DVAE++A FARRRQRGVCV+S SGTVTNVT
Sbjct  77   SKNRPKPPIFVTRDSPNALRSHVMEIANGSDVAETLAHFARRRQRGVCVLSGSGTVTNVT  136

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAVMALHGRFEILSLTGAFLPGP+PPGSTGLTIYLAGGQGQVVGG VVGSLVA
Sbjct  137  LRQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGIVVGSLVA  196

Query  361  agPVMVIGSTFSNATYER--------lplepdeeeaaaataepqlggggspppgmasaga  516
            +GPVM+I +TFSNATYER               +      +     G GS   G    G 
Sbjct  197  SGPVMIIAATFSNATYERLPLEEEEEGVSGAQGQLGGGGGSGGSPPGIGSGSGGHQQGGI  256

Query  517  gmgdpspMPGVYNLPPNMVA-----SNEAFAWAH-GRPPY  618
            G  D S +P   NLPPN+V      S+EA+AWAH GRPPY
Sbjct  257  GGADGSGLPVYNNLPPNLVPNGGQLSHEAYAWAHGGRPPY  296



>ref|XP_009364460.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=299

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 168/216 (78%), Gaps = 12/216 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E++SGAD+A+S+AQFARRRQRGVCVMS SGTV NVT
Sbjct  86   SKNKPKPPIFVTRDSPNALRSHVMEISSGADIADSVAQFARRRQRGVCVMSGSGTVINVT  145

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAVMALHGRFEILSLTGAFLPGP+ PGSTGLTIYLAGGQGQVVGGSVVG LVA
Sbjct  146  LRQPSAPGAVMALHGRFEILSLTGAFLPGPALPGSTGLTIYLAGGQGQVVGGSVVGPLVA  205

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVMVI +TFSNATYER  L  +EEE             G         G GMGDP+ +
Sbjct  206  SGPVMVIAATFSNATYER--LPLEEEEEQTGGGTSSGTAAGGAGSPPGIGGGGMGDPAAL  263

Query  541  PGVYNLPPNMVAS-----NEAF-AWAH----GRPPY  618
             GVYNLP NM+ +       A+ +WAH    GRPP+
Sbjct  264  AGVYNLPSNMLPNLSLDQQAAYSSWAHGQGGGRPPF  299



>ref|XP_010102254.1| hypothetical protein L484_024535 [Morus notabilis]
 gb|EXB93197.1| hypothetical protein L484_024535 [Morus notabilis]
Length=292

 Score =   190 bits (483),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 171/216 (79%), Gaps = 11/216 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+A+GAD+A+S+AQFARRRQRGVCV+S SGTV NVT
Sbjct  78   SKNKPKPPIFVTRDSPNALRSHVMEIANGADIADSVAQFARRRQRGVCVLSGSGTVANVT  137

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAP AV+ALHGRFEILSLTGAFLPGPSPPGSTGLTIYLAGGQGQVVGGSVVG LVA
Sbjct  138  LRQPSAPSAVVALHGRFEILSLTGAFLPGPSPPGSTGLTIYLAGGQGQVVGGSVVGPLVA  197

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVMVI +TFSNATYERLPLE +EE     ++    G GG    G    G      S M
Sbjct  198  AGPVMVIAATFSNATYERLPLEEEEEGGVGGSSPGIGGSGGHQSGGGGGGGMQEPVSSGM  257

Query  541  PGVYNLPPNMVAS--------NEAFAWAH--GRPPY  618
            P VYNL PN++++        ++AF W H  GRPPY
Sbjct  258  P-VYNLAPNLLSNGAAGQLSHDQAFPWPHGGGRPPY  292



>ref|XP_002521959.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF40363.1| DNA binding protein, putative [Ricinus communis]
Length=299

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 169/213 (79%), Gaps = 7/213 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNAL+SHV+E+A+G+D+AES+A FAR++QRGVCV+S SG VTNVT
Sbjct  87   SKNKPKPPIFVTRDSPNALKSHVMEIANGSDIAESLACFARKKQRGVCVLSGSGMVTNVT  146

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            L+QPSAPGAVMALHGRFEILSLTGAFLPGP+PPG+TGLTIYLAGGQGQVVGGSVVGSL A
Sbjct  147  LKQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGATGLTIYLAGGQGQVVGGSVVGSLTA  206

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
             GPVMVI +TFSNATYERLPLE +EE  +        GGGGS   G   +G      +  
Sbjct  207  TGPVMVIAATFSNATYERLPLEEEEEGGSGGGQGQLGGGGGSSEGGGGGSGGIGEPGASA  266

Query  541  PGVYNLPPNMVASN------EAFAWAH-GRPPY  618
            P  YNLPPN+   N      +A+ WAH GRPPY
Sbjct  267  PPGYNLPPNLQVPNGGQLNLDAYGWAHGGRPPY  299



>ref|XP_006350955.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=297

 Score =   190 bits (483),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 137/138 (99%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA+GADVAESIAQFAR+RQRGVCV+SA+GTVTNVT
Sbjct  74   SKNKPKPPIFVTRDSPNALRSHVMEVANGADVAESIAQFARKRQRGVCVLSATGTVTNVT  133

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAVMALHGRFEILSLTGAFLPGP+PPGSTGLTIYLAGGQGQVVGGSVVGSLVA
Sbjct  134  LRQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSLVA  193

Query  361  agPVMVIGSTFSNATYER  414
            +GPVMVI STFSNATYER
Sbjct  194  SGPVMVIASTFSNATYER  211



>ref|XP_007145832.1| hypothetical protein PHAVU_007G271800g [Phaseolus vulgaris]
 gb|ESW17826.1| hypothetical protein PHAVU_007G271800g [Phaseolus vulgaris]
Length=268

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 174/223 (78%), Gaps = 18/223 (8%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN+LRSHV+EVA GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  47   SKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  106

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTGAFLPGP+PPG+TGLT+YLAGGQGQVVGGSVVG LVA
Sbjct  107  LRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGATGLTVYLAGGQGQVVGGSVVGPLVA  166

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVM+I +TF+NATYER     +E+E     +       G  PPG+   G G G  S +
Sbjct  167  AGPVMIIAATFANATYER-LPLEEEDEDGGGGSVQGGSTLGGSPPGIGGGGGGDGGGSHL  225

Query  541  PG---------VYNLPPNMVAS------NEAFAWA--HGRPPY  618
            PG         +YNLPPN++++      +EAFAWA  HGRPPY
Sbjct  226  PGGIPDPSSLPLYNLPPNLLSNGGGQVGHEAFAWAHGHGRPPY  268



>ref|XP_008370731.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=304

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 171/221 (77%), Gaps = 17/221 (8%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+++GAD+A S+AQFARRRQRGVCVMS SGTVTNVT
Sbjct  86   SKNKPKPPIFVTRDSPNALRSHVMEISNGADIANSVAQFARRRQRGVCVMSGSGTVTNVT  145

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAVMALHGRFEILSLTGAFLPGP+PPGSTG+TIYLAGGQGQVVGGSVVG LVA
Sbjct  146  LRQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGMTIYLAGGQGQVVGGSVVGPLVA  205

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVMVI +TF+NATYER  L  +EEE  A          G         G GMGDP+ +
Sbjct  206  SGPVMVIAATFTNATYER--LPLEEEEEQAGGGTSSGTAAGGAGSPPGIGGGGMGDPAAL  263

Query  541  PGVYNLPPNMVAS----------NEAF-AWAH----GRPPY  618
             GVYN PPN++++            A+ +WAH    GRPP+
Sbjct  264  AGVYNFPPNLLSNGGQTQLSHDQQAAYSSWAHGQGGGRPPF  304



>gb|KCW61537.1| hypothetical protein EUGRSUZ_H04257, partial [Eucalyptus grandis]
Length=272

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+A+GAD+AES+AQFARRRQRGVCV+S SGTVTNVT
Sbjct  73   SKNKPKPPIFVTRDSPNALRSHVMEIANGADIAESVAQFARRRQRGVCVLSGSGTVTNVT  132

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAVMALHGRFEILSLTGAFLPGP+PPGSTGLTIYLAGGQGQVVGGSVVGSLVA
Sbjct  133  LRQPTAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSLVA  192

Query  361  agPVMVIGSTFSNATYER  414
            +GPVMVI +TFSNATYER
Sbjct  193  SGPVMVIAATFSNATYER  210



>ref|XP_006477506.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 ref|XP_006489611.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
Length=350

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 167/215 (78%), Gaps = 9/215 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN+LRSHV+EVA GADVAES+A FARRRQRGVCV+S SG+V NVT
Sbjct  135  SKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVALFARRRQRGVCVLSGSGSVANVT  194

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTGAFLPGPSPPGSTGLT+YLAGGQGQVVGGSVVG LVA
Sbjct  195  LRQPAAPGAVVALHGRFEILSLTGAFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGQLVA  254

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaata-epqlggggspppgmasagagmgdpsp  537
            AGPVMVI +TF+NATYERLPLE DEE        +       +         +G    + 
Sbjct  255  AGPVMVIAATFANATYERLPLEDDEEVTGTQGQIQSTGAATNNNNSPPQIGSSGQPPSAG  314

Query  538  MPG----VYNLPPNMVAS----NEAFAWAHGRPPY  618
            +P      YNLPPN++ +    +EA+AWAH RPPY
Sbjct  315  LPDPSSLTYNLPPNLIPNGGQLHEAYAWAHARPPY  349



>ref|XP_006487869.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|KDO35907.1| hypothetical protein CISIN_1g022331mg [Citrus sinensis]
Length=299

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 172/217 (79%), Gaps = 11/217 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNAL+SHV+E+A+GADVAE++A FARRRQRGVCV+S SGTVTNVT
Sbjct  83   SKNKPKPPIFVTRDSPNALKSHVMEIANGADVAETLANFARRRQRGVCVLSGSGTVTNVT  142

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPS P AVMA+HGRFEILSLTGAFLPGP+PPGSTGLTIYLAGGQGQVVGGSVVGSLVA
Sbjct  143  LRQPSDPSAVMAIHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSLVA  202

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVMVI +TFSNATYERLPL+ +EE  A A      GGGG         G   G    +
Sbjct  203  SGPVMVIAATFSNATYERLPLDEEEEGGAGAQGPLGGGGGGGSGSSGGGGGGAGGGGGGI  262

Query  541  P-----GVY-NLPPNMVA-----SNEAFAWAHGRPPY  618
                  GVY NLPPN+VA     S+EA+ WAHGRP +
Sbjct  263  GDPSGMGVYNNLPPNLVANGGQLSHEAYGWAHGRPAF  299



>ref|XP_002284519.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=260

 Score =   187 bits (474),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 163/211 (77%), Gaps = 12/211 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA G DVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  57   SKNKPKPPIFVTRDSPNALRSHVMEVAGGHDVAESVAQFARRRQRGVCVLSGSGSVANVT  116

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTGAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVGSLVA
Sbjct  117  LRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVA  176

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPV+VI +TF+NATYER                      GSPP   +S G        +
Sbjct  177  AGPVIVIAATFANATYER------LPLEEEEEGGQAPPPSGSPPAIGSSGGQHHSGLPEL  230

Query  541  PGVYNLPPNMVA-----SNEAFAWAHGRPPY  618
            P +YNLPPN++      S++ ++WAH RPPY
Sbjct  231  P-IYNLPPNLLPNGGQLSHDPYSWAHARPPY  260



>ref|XP_006442718.1| hypothetical protein CICLE_v10023369mg [Citrus clementina]
 gb|ESR55958.1| hypothetical protein CICLE_v10023369mg [Citrus clementina]
Length=299

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 172/217 (79%), Gaps = 11/217 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNAL+SHV+E+A+GADVAE++A FARRRQRGVCV+S SGTVTNVT
Sbjct  83   SKNKPKPPIFVTRDSPNALKSHVMEIANGADVAETLANFARRRQRGVCVLSGSGTVTNVT  142

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPS P A+MA+HGRFEILSLTGAFLPGP+PPGSTGLTIYLAGGQGQVVGGSVVGSLVA
Sbjct  143  LRQPSDPSAIMAIHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSLVA  202

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVMVI +TFSNATYERLPL+ +EE  A A      GGGG         G   G    +
Sbjct  203  SGPVMVIAATFSNATYERLPLDEEEEGGAGAQGPLGGGGGGGSGSSGGGGGGAGGGGGGI  262

Query  541  P-----GVY-NLPPNMVA-----SNEAFAWAHGRPPY  618
                  GVY NLPPN+VA     S+EA+ WAHGRP +
Sbjct  263  GDPSGMGVYNNLPPNLVANGGQLSHEAYGWAHGRPAF  299



>ref|XP_011030530.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Populus 
euphratica]
Length=289

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 170/213 (80%), Gaps = 8/213 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+A GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  78   SKNKPKPPIFVTRDSPNALRSHVMEIAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  137

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTGAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVGSL+A
Sbjct  138  LRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLIA  197

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVMVI +TF+NATYERLPLE DEE  +      Q G   SPP   +S           
Sbjct  198  AGPVMVIAATFANATYERLPLEDDEEAGSGGQGHLQSGANNSPPAIGSSGQQSGLPDPSS  257

Query  541  PGVYNLPPNMVAS------NEAFAWAH-GRPPY  618
              VY LPPN++ S      +EA+AWAH  RPPY
Sbjct  258  MPVY-LPPNLMQSGAQQLGHEAYAWAHAARPPY  289



>ref|XP_009372143.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=305

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 168/222 (76%), Gaps = 18/222 (8%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+++GAD+A S+AQFARRRQRGVCVMS SGTVTNVT
Sbjct  86   SKNKPKPPIFVTRDSPNALRSHVMEISNGADIANSVAQFARRRQRGVCVMSGSGTVTNVT  145

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAVMALHGRFEILSLTGAFLPGP+PPGSTG+TIYLAGGQGQVVGGSVVG LVA
Sbjct  146  LRQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGMTIYLAGGQGQVVGGSVVGPLVA  205

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVMVI +TF+NATYER  L  +EEE  A          G         G GMGDP+ +
Sbjct  206  SGPVMVIAATFTNATYER--LPLEEEEEQAGGGTSSGTAAGGAGSPPGIGGGGMGDPAAL  263

Query  541  PGVYNLPPNMVASNEA------------FAWAH----GRPPY  618
             GVYN PPN++ +                +WAH    GRPP+
Sbjct  264  AGVYNFPPNLLPNGGGQTQLSHDQQAAYSSWAHGQGGGRPPF  305



>ref|XP_007144108.1| hypothetical protein PHAVU_007G129400g, partial [Phaseolus vulgaris]
 gb|ESW16102.1| hypothetical protein PHAVU_007G129400g, partial [Phaseolus vulgaris]
Length=310

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 170/212 (80%), Gaps = 7/212 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+  GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  100  SKNKPKPPIFVTRDSPNALRSHVMEITGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  159

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTG FLPGP+PPGSTGLT+YLAGGQGQV+GGSVVG LVA
Sbjct  160  LRQPAAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVLGGSVVGPLVA  219

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlgg---ggspppgmasagagmgdp  531
             GPVMVI +TF+NATYERLPL+ D+E  ++A A    G     G    G      GM DP
Sbjct  220  TGPVMVIAATFANATYERLPLDEDDEGPSSAAAVQGGGSPPPLGIGSGGGVQLQGGMPDP  279

Query  532  spMPGVYNLPPNMVA---SNEAFAWAHGRPPY  618
            S +P +YNLPPN+      +EA AWAHGR P+
Sbjct  280  SSLP-LYNLPPNVGGGQVGHEALAWAHGRTPF  310



>ref|XP_002319649.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE95572.1| DNA-binding family protein [Populus trichocarpa]
Length=284

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 163/209 (78%), Gaps = 8/209 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNAL+SHV+E+ASG+D+AE++A FAR+RQRGVCV+S SG VTNVT
Sbjct  81   SKNKPKPPIFVTRDSPNALKSHVMEIASGSDIAENLACFARKRQRGVCVLSGSGMVTNVT  140

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            L+QPSA GAVMALHGRFEILSLTGAFLPGP+PPG+TGLTIYLAGGQGQVVGGSVVGSLVA
Sbjct  141  LKQPSASGAVMALHGRFEILSLTGAFLPGPAPPGATGLTIYLAGGQGQVVGGSVVGSLVA  200

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVMVI +TFSNATYER       E+    +   Q   GG    G  + G      + M
Sbjct  201  SGPVMVIAATFSNATYER----LPLEDEEEGSGGAQGQLGGGNGSGEGNGGGMGDPATSM  256

Query  541  PGVYNLP---PNMVASNEAFAWAHGRPPY  618
            P VY LP   PN   ++E + WAHGRPPY
Sbjct  257  P-VYQLPNMVPNGQLNHEGYGWAHGRPPY  284



>ref|XP_009611172.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=286

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 180/213 (85%), Gaps = 7/213 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKN+PK PIFVTRDSPN LRSHV+EVA+GADVAESIAQFAR+RQRGVCV+SASGTVTNVT
Sbjct  74   SKNRPKSPIFVTRDSPNTLRSHVMEVANGADVAESIAQFARKRQRGVCVLSASGTVTNVT  133

Query  181  LRQPSAPG-AVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslv  357
            LRQPSAPG AVMALHGRFEILSLTGAFLPGP+PPGSTGLTIYLAGGQGQVVGG VVGSLV
Sbjct  134  LRQPSAPGTAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGIVVGSLV  193

Query  358  aagPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpsp  537
            A+GPVMVI STFSNATYERLPLE +EE   AA A+ QLGG GSPPP     G G    S 
Sbjct  194  ASGPVMVIASTFSNATYERLPLEEEEEGGGAAAAQGQLGGSGSPPPPPQQGGMGEIPSSN  253

Query  538  MPGVYNLPPNMVA------SNEAFAWAHGRPPY  618
            M  VYNLPPN++       ++EAFAW HGRPPY
Sbjct  254  MQTVYNLPPNLLPNNGGQLNHEAFAWPHGRPPY  286



>ref|XP_002314642.2| hypothetical protein POPTR_0010s08500g [Populus trichocarpa]
 gb|EEF00813.2| hypothetical protein POPTR_0010s08500g [Populus trichocarpa]
Length=289

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 167/213 (78%), Gaps = 22/213 (10%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+A GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  92   SKNKPKPPIFVTRDSPNALRSHVMEIAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  151

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTGAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVGSL+A
Sbjct  152  LRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLIA  211

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVMVI +TF+NATYER                      GS   G +   AG+ DPS M
Sbjct  212  AGPVMVIAATFANATYER-------------LPLEDDEEAGSGAIGSSGQQAGLPDPSSM  258

Query  541  PGVYNLPPNMVAS------NEAFAWAH-GRPPY  618
            P VY LPPN++ S      ++A+AWAH  RPPY
Sbjct  259  P-VY-LPPNLMQSGAQQLGHDAYAWAHAARPPY  289



>ref|XP_008388703.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=304

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 167/221 (76%), Gaps = 17/221 (8%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E++SGAD+A+S+AQFARRRQRGVCVMS SGTV NVT
Sbjct  86   SKNKPKPPIFVTRDSPNALRSHVMEISSGADIADSVAQFARRRQRGVCVMSGSGTVINVT  145

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAVMALHGRFEIL LTGAFLPGP+ PGSTGLTIYLAGGQGQVVGGSVVG LVA
Sbjct  146  LRQPSAPGAVMALHGRFEILYLTGAFLPGPALPGSTGLTIYLAGGQGQVVGGSVVGPLVA  205

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVMVI +TFSNATYER  L  +EEE             G         G GMGDP+ +
Sbjct  206  SGPVMVIAATFSNATYER--LPLEEEEEQTGGGTSSGTAAGGAGSPPGIGGGGMGDPAAL  263

Query  541  PGVYNLPPNMVAS----------NEAF-AWAH----GRPPY  618
             G+YNLP NM+ +            A+ +WAH    GRPP+
Sbjct  264  AGIYNLPSNMLPNGGQAQLSLDQQAAYSSWAHGQGGGRPPF  304



>ref|XP_009383960.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=257

 Score =   184 bits (468),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 166/213 (78%), Gaps = 7/213 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPP+FVTRDSPNALRSHV+EVA G+D+AESIAQFARRRQRGVCV+S +GTV+NV 
Sbjct  45   SKNKPKPPVFVTRDSPNALRSHVMEVAGGSDIAESIAQFARRRQRGVCVLSCAGTVSNVA  104

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAV+ALHGRFEILSLTG FLPGPSPPG+TGLT+YLAGGQGQVVGGSVVGSL+A
Sbjct  105  LRQPSAPGAVVALHGRFEILSLTGTFLPGPSPPGTTGLTVYLAGGQGQVVGGSVVGSLIA  164

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVMVI STF+NATYERLPLE  +E        P+   GG  P    ++G G       
Sbjct  165  AGPVMVIASTFANATYERLPLEEGDEIPGGGGGIPEHLPGGLAPLMPGASGPGRLPDPSA  224

Query  541  PGVYNLPPNMVAS-------NEAFAWAHGRPPY  618
              +YNLPP+M          +EAF WAH R P+
Sbjct  225  LPIYNLPPHMAHDEVGGQLGHEAFGWAHARAPF  257



>gb|KHN01050.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=295

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 168/214 (79%), Gaps = 9/214 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN LRSHV+EV  GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  83   SKNKPKPPIFVTRDSPNTLRSHVMEVTGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  142

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAV+ALHGRFEILSLTG FLPGP+PPGSTGLT+YL GGQGQ+VGGSVVGSLVA
Sbjct  143  LRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLTGGQGQIVGGSVVGSLVA  202

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggg-----gspppgmasagagmg  525
            AGPVMVI +TF+NATYERLPL+ D+E  ++A      G       G    G      GM 
Sbjct  203  AGPVMVIAATFANATYERLPLDEDDEGPSSAAGAQGGGSSPPPPLGIGSSGGGQLQGGMP  262

Query  526  dpspMPGVYNLPPN---MVASNEAFAWAHGRPPY  618
            DPS MP +YNLPPN       +EA AWAHGR P+
Sbjct  263  DPSSMP-LYNLPPNGGVGQVGHEALAWAHGRAPF  295



>ref|XP_009623613.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
 ref|XP_009623614.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=297

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 136/139 (98%), Gaps = 1/139 (1%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA+GADVAESIAQFAR+RQRGVCV+SA+GTVTNVT
Sbjct  75   SKNKPKPPIFVTRDSPNALRSHVMEVANGADVAESIAQFARKRQRGVCVLSATGTVTNVT  134

Query  181  LRQPSAPG-AVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslv  357
            LRQPSAPG AVMALHGRFEILSLTGAFLPGP+PPGSTGLTIYLAGGQGQVVGGSVVG LV
Sbjct  135  LRQPSAPGSAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGPLV  194

Query  358  aagPVMVIGSTFSNATYER  414
            A+GPVMVI STFSNATYER
Sbjct  195  ASGPVMVIASTFSNATYER  213



>ref|XP_011038532.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=284

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 163/209 (78%), Gaps = 8/209 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNAL+SHV+E+A+G+D+AE++A FAR+RQRGVCV+S SG VTNVT
Sbjct  81   SKNKPKPPIFVTRDSPNALKSHVMEIANGSDIAENLACFARKRQRGVCVLSGSGMVTNVT  140

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            L+QPSA GAVMALHGRFEILSLTGAFLPGP+PPG+TGLTIYLAGGQGQVVGGSVVGSLVA
Sbjct  141  LKQPSASGAVMALHGRFEILSLTGAFLPGPAPPGATGLTIYLAGGQGQVVGGSVVGSLVA  200

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVM+I +TFSNATYER       E+    +   Q   GG    G  + G      + M
Sbjct  201  SGPVMIIAATFSNATYER----LPLEDEEEGSGGAQGQLGGGNGSGEGNGGGMGDPATSM  256

Query  541  PGVYNLP---PNMVASNEAFAWAHGRPPY  618
            P VY LP   PN   ++E + WAHGRPPY
Sbjct  257  P-VYQLPNMVPNGQLNHEGYGWAHGRPPY  284



>ref|XP_009373988.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=305

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 167/222 (75%), Gaps = 18/222 (8%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+++GAD+A S+AQFARRRQRGVCVMS SGTVTNVT
Sbjct  86   SKNKPKPPIFVTRDSPNALRSHVMEISNGADIANSVAQFARRRQRGVCVMSGSGTVTNVT  145

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP APGAVMALHGRFEILSLTGAFLPGP+PPGSTG+TIYLAGGQGQVVGGSVVG LVA
Sbjct  146  LRQPFAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGMTIYLAGGQGQVVGGSVVGPLVA  205

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVMVI +TF+NATYER  L  +EEE  A          G         G GMGDP+ +
Sbjct  206  SGPVMVIAATFTNATYER--LPLEEEEEQAGGGTSSGTAAGGAGSPPGIGGGGMGDPAAL  263

Query  541  PGVYNLPPNMVASNEA------------FAWAH----GRPPY  618
             GVYN PPN++ +                +WAH    GRPP+
Sbjct  264  AGVYNFPPNLLPNGGGQTQLSHDQQAAYSSWAHGQGGGRPPF  305



>gb|KDP23697.1| hypothetical protein JCGZ_23530 [Jatropha curcas]
Length=285

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 166/211 (79%), Gaps = 11/211 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNAL+SHV+E+A+G+DVAES+A FAR+RQRGVCV+S SG VTNVT
Sbjct  81   SKNKPKPPIFVTRDSPNALKSHVMEIANGSDVAESLASFARKRQRGVCVLSGSGMVTNVT  140

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            L+QPSAPGAVMALHGRFEILSLTGAFLPGP+PPG+TGLTIYLAGGQGQVVGGSVVGSLVA
Sbjct  141  LKQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGATGLTIYLAGGQGQVVGGSVVGSLVA  200

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVMVI +TFSNATYERLPLE +EE  + A  +   G GG    G           +P 
Sbjct  201  SGPVMVIAATFSNATYERLPLEEEEEGGSGAQGQIGGGSGGGGGEGSGGGMGDPATSTP-  259

Query  541  PGVYNLPPNMVASN-----EAFAWAHGRPPY  618
               YNLPPNMV +      E F W   RPPY
Sbjct  260  --AYNLPPNMVPNGGQLNLEGFGW---RPPY  285



>ref|XP_009757136.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=286

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 178/213 (84%), Gaps = 7/213 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIF+TRDSPNALRSH++EVA+GADVAESIAQFAR+RQRGVCV+SASGTVTNVT
Sbjct  74   SKNKPKPPIFMTRDSPNALRSHIMEVANGADVAESIAQFARKRQRGVCVLSASGTVTNVT  133

Query  181  LRQPSAPG-AVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslv  357
            LRQPS PG AVMALHGRFEILSLTGAFLPGP+PPGST LTIYLAGGQGQVVGG VVGSLV
Sbjct  134  LRQPSVPGTAVMALHGRFEILSLTGAFLPGPAPPGSTDLTIYLAGGQGQVVGGRVVGSLV  193

Query  358  aagPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpsp  537
            A+GPVMVI STFSNATYERLPLE +EE   AA A+ QLGG GSPPP     G G    S 
Sbjct  194  ASGPVMVIASTFSNATYERLPLEEEEEGGGAAAAQGQLGGSGSPPPPPQQDGMGDIPSSN  253

Query  538  MPGVYNLPPNMVA------SNEAFAWAHGRPPY  618
            M  VYNLPPN++       ++EAF W HGRP Y
Sbjct  254  MQTVYNLPPNLLPNNGGQLNHEAFLWPHGRPSY  286



>ref|XP_006589299.1| PREDICTED: putative DNA-binding protein ESCAROLA-like, partial 
[Glycine max]
Length=316

 Score =   183 bits (465),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 170/215 (79%), Gaps = 10/215 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+  GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  103  SKNKPKPPIFVTRDSPNALRSHVMEITGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  162

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAV+ALHGRFEILSLTG FLPGP+PPGSTGLT+YLAGGQGQVVGGSVVGSLVA
Sbjct  163  LRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVA  222

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggg-----gspppgmasagagmg  525
            AGPVMVI +TF+NATYERLPL+ D+E  ++       GG      G    G      G+ 
Sbjct  223  AGPVMVIAATFANATYERLPLDEDDEGPSSMVGAQGGGGSPPLPLGIGSSGGGQLQGGIP  282

Query  526  dpspMPGVYNLPPNMVA----SNEAFAWAHGRPPY  618
            DPS +P +YNLPPN        +EA AWAHGR P+
Sbjct  283  DPSSLP-LYNLPPNGGGGGQVGHEALAWAHGRAPF  316



>ref|XP_006606925.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=385

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 168/214 (79%), Gaps = 9/214 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN LRSHV+EV  GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  173  SKNKPKPPIFVTRDSPNTLRSHVMEVTGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  232

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAV+ALHGRFEILSLTG FLPGP+PPGSTGLT+YL GGQGQ+VGGSVVGSLVA
Sbjct  233  LRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLTGGQGQIVGGSVVGSLVA  292

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggg-----gspppgmasagagmg  525
            AGPVMVI +TF+NATYERLPL+ D+E  ++A      G       G    G      GM 
Sbjct  293  AGPVMVIAATFANATYERLPLDEDDEGPSSAAGAQGGGSSPPPPLGIGSSGGGQLQGGMP  352

Query  526  dpspMPGVYNLPPN---MVASNEAFAWAHGRPPY  618
            DPS MP +YNLPPN       +EA AWAHGR P+
Sbjct  353  DPSSMP-LYNLPPNGGVGQVGHEALAWAHGRAPF  385



>ref|XP_010274873.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Nelumbo 
nucifera]
Length=352

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 162/214 (76%), Gaps = 9/214 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+A GADVA+ +AQFARRRQRGVCV+S SG V N+T
Sbjct  140  SKNKPKPPIFVTRDSPNALRSHVMEIAGGADVADCVAQFARRRQRGVCVLSGSGAVANIT  199

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTGAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVG+L+A
Sbjct  200  LRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLIA  259

Query  361  agPVMVIGSTFSNATYER---lplepdeeeaaaataepqlggggspppgmasagagmgdp  531
            AGPVMVI +TF+ AT+ER      E                   +          G+ DP
Sbjct  260  AGPVMVIAATFATATFERLPLDEEEEAGSGGQGQLPGGAGSSPPAIGSSSGQQQPGLPDP  319

Query  532  spMPGVYNLPPNMVA-----SNEAFAWAHGRPPY  618
            S +P V+NLPPN++      +++AFAWAH RPP+
Sbjct  320  SSLP-VFNLPPNLLPNAGQLNHDAFAWAHARPPF  352



>gb|KHN30735.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=290

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 168/215 (78%), Gaps = 10/215 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN LRSHV+E+  GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  77   SKNKPKPPIFVTRDSPNTLRSHVMEITGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  136

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAV+ALHGRFEILSLTG FLPGP+PPGSTGLT+YLAGGQGQVVGGSVVGSLVA
Sbjct  137  LRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVA  196

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggs-----pppgmasagagmg  525
            AGPVMVI +TF+NATYERLPL+ D+E  ++       GG           G      G+ 
Sbjct  197  AGPVMVIAATFANATYERLPLDEDDEGPSSMVGAQGGGGSPPLPLGIGSSGGGQLQGGIP  256

Query  526  dpspMPGVYNLPPNMVA----SNEAFAWAHGRPPY  618
            DPS +P +YNLPPN        +EA AWAHGR P+
Sbjct  257  DPSSLP-LYNLPPNGGGGGQVGHEALAWAHGRAPF  290



>ref|XP_008456342.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=293

 Score =   182 bits (462),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 166/215 (77%), Gaps = 9/215 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNAL+SHV+E+++GAD+AES+AQFARRRQRGV V+S SGTVTNVT
Sbjct  79   SKNKPKPPIFVTRDSPNALKSHVMEISNGADIAESVAQFARRRQRGVSVLSGSGTVTNVT  138

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAV+AL GRFEILSLTG FLPGP+PPGSTGLTIYLAGGQGQVVGGSVVG L A
Sbjct  139  LRQPSAPGAVLALQGRFEILSLTGTFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGPLTA  198

Query  361  agPVMVIGSTFSNATYERl-plepdeeeaaaataepqlggggspppgmasagagmgdpsp  537
            AGPVMVI +TFSNATYERL   E +E     A      GGG          G   GDPS 
Sbjct  199  AGPVMVIAATFSNATYERLPLEEEEEGGGVGAQGHTSAGGGAGDSSPQGIGGGVGGDPSA  258

Query  538  MPGVYNLPPNMVA-------SNEAFAWAH-GRPPY  618
            M  +YNLPPN++        + EA++WAH GRP +
Sbjct  259  MTPLYNLPPNLLPNGGGGQMNQEAYSWAHGGRPSF  293



>ref|XP_006588553.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=230

 Score =   180 bits (457),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN+LRSHV+EVA GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  50   SKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  109

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAV+ALHGRFEILSLTGAFLPGP+PPG+TGLT+YLAGGQGQVVGGSVVGSLVA
Sbjct  110  LRQPSAPGAVVALHGRFEILSLTGAFLPGPAPPGATGLTVYLAGGQGQVVGGSVVGSLVA  169

Query  361  agPVMVIGSTFSNATYER  414
            AGPVMVI +TF+NATYER
Sbjct  170  AGPVMVIAATFANATYER  187



>ref|XP_008787555.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=349

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 166/214 (78%), Gaps = 9/214 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GADVA++IAQFARRRQRGVCV+S +GTV N  
Sbjct  137  SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAQFARRRQRGVCVLSGAGTVANAA  196

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTG FLPGPSPPGSTGLT+YLAGGQGQVVGGSVVGSL+A
Sbjct  197  LRQPAAPGAVVALHGRFEILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGSLIA  256

Query  361  agPVMVIGSTFSNATYER---lplepdeeeaaaataepqlggggspppgmasagagmgdp  531
            AGPVMV+ STF+NATYER      E +EE          L GG  P         G+ DP
Sbjct  257  AGPVMVVASTFANATYERLPLEEEEEEEEGVPGEGGPGPLPGGSLPGMAGGGGPGGLPDP  316

Query  532  spMPGVYNLPPNMVAS-----NEAFAWAHGRPPY  618
            S +P ++NLPPN+  +     ++AFAW H RPPY
Sbjct  317  SSLP-IFNLPPNLALNGAQFGHDAFAWTHARPPY  349



>ref|XP_004139388.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 ref|XP_004156496.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 gb|KGN60776.1| hypothetical protein Csa_2G010120 [Cucumis sativus]
Length=293

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 171/215 (80%), Gaps = 9/215 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNAL+SHV+E+++GAD+AES+AQFARRRQRGV V+S SGTVTNVT
Sbjct  79   SKNKPKPPIFVTRDSPNALKSHVMEISNGADIAESVAQFARRRQRGVSVLSGSGTVTNVT  138

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAV+AL GRFEILSLTG FLPGP+PPGSTGLTIYLAGGQGQVVGGSVVG L A
Sbjct  139  LRQPSAPGAVLALQGRFEILSLTGTFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGPLTA  198

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasa-gagmgdpsp  537
            AGPVMVI +TFSNATYERLPLE +EE            GGG    G     G G+GDPS 
Sbjct  199  AGPVMVIAATFSNATYERLPLEEEEEGGGVGAQGHTSAGGGGAGDGSPQGIGGGVGDPSA  258

Query  538  MPGVYNLPPNMVA-------SNEAFAWAH-GRPPY  618
            M  +YNLPPN++        + EA++WAH GRP +
Sbjct  259  MTPLYNLPPNLLPNGGGGQLNQEAYSWAHGGRPSF  293



>ref|XP_008801301.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=255

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 171/213 (80%), Gaps = 8/213 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GAD+AE IAQFARRRQRGVCV+S +G V NVT
Sbjct  44   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADIAECIAQFARRRQRGVCVLSGTGAVANVT  103

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+AL GRFEILSLTG FLPGP+PPGS+GLT+YLAGGQGQVVGGSVVGSLVA
Sbjct  104  LRQPAAPGAVVALRGRFEILSLTGTFLPGPAPPGSSGLTVYLAGGQGQVVGGSVVGSLVA  163

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggsppp--gmasagagmgdps  534
            +G VMV+ +TF+NATYERLPLE + EE      E   G  G   P     + GAG+ DPS
Sbjct  164  SGSVMVVAATFANATYERLPLEEEVEEEEEEEEEEGPGSSGGQLPCRPPTAMGAGLADPS  223

Query  535  pMPGVYNLPPNMVAS-----NEAFAWAHGRPPY  618
             +P +YN PPN++ +     ++AFAWAH RPPY
Sbjct  224  SLP-IYNFPPNLLPNGAQLVHDAFAWAHARPPY  255



>ref|XP_010935866.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=314

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 165/214 (77%), Gaps = 9/214 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GADVA++IA F+RRRQRGVCV+S +GTV NV 
Sbjct  102  SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAHFSRRRQRGVCVLSGAGTVANVA  161

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTG FLPGPSPPGSTGLT+YLAGGQGQVVGGSVVGSL+A
Sbjct  162  LRQPAAPGAVVALHGRFEILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGSLIA  221

Query  361  agPVMVIGSTFSNATYER---lplepdeeeaaaataepqlggggspppgmasagagmgdp  531
            AGPVMV+ STF+NATYER      + +EE          L G   P         G+ DP
Sbjct  222  AGPVMVVASTFANATYERLPLEGGDHEEEGGPGEGGPGPLPGESVPGMAGGGGPGGLPDP  281

Query  532  spMPGVYNLPPNMV-----ASNEAFAWAHGRPPY  618
            S +P ++NLPPN+        ++AFAWAH RPPY
Sbjct  282  SALP-MFNLPPNLALGGAQLGHDAFAWAHARPPY  314



>ref|XP_009394683.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=266

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 162/212 (76%), Gaps = 11/212 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GAD+AESIA FARR+QRGVCV+S SGTV NVT
Sbjct  60   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADIAESIAHFARRKQRGVCVLSGSGTVANVT  119

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ALHGRFEILSLTG FLPGPSPPG+TGLT+YLAGGQGQVVGGSVVGSL+A
Sbjct  120  LRQPASPGAVVALHGRFEILSLTGTFLPGPSPPGTTGLTVYLAGGQGQVVGGSVVGSLIA  179

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AG VMV+ STF+NATYER       EEA  +               +     G+ DPS +
Sbjct  180  AGTVMVLASTFANATYER----LPLEEAEESVGGGLPVQLHGGVASLMPGAGGLPDPSAL  235

Query  541  PGVYNLPPNMVAS------NEAFAWAHGRPPY  618
            P +YNLPPN+  +      ++AF WAH R P+
Sbjct  236  P-IYNLPPNLAHNGGGQMGHDAFEWAHARAPF  266



>ref|XP_010026866.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Eucalyptus 
grandis]
Length=303

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 165/217 (76%), Gaps = 11/217 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN+++SHV+EVASGADVAE +AQFARRRQRGVCV+S SGTV NVT
Sbjct  87   SKNKPKPPIFVTRDSPNSMKSHVMEVASGADVAECLAQFARRRQRGVCVLSGSGTVANVT  146

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTG FLPGPSPPGSTGLT+YLAGGQGQVVGGSVVGSLVA
Sbjct  147  LRQPAAPGAVVALHGRFEILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGSLVA  206

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVMVIG+TF+NATYERLPL+ +E+   A         G    P  A +         +
Sbjct  207  AGPVMVIGATFANATYERLPLDEEEDGNTANGGGQGQLSGSGGSPPTAVSNGNNQSQQGL  266

Query  541  PG------VYNLPP----NMVASN-EAFAWAHGRPPY  618
                    +YNLPP    N   +N +A AW H RPP+
Sbjct  267  AADPSTLLLYNLPPSFHVNGTHTNQDAHAWTHVRPPF  303



>ref|XP_008794313.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=294

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 160/208 (77%), Gaps = 14/208 (7%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIF+TRDSPNALRSHV+EVA GADVAE IAQFARRRQRGVCV+S +G V +V 
Sbjct  99   SKNKPKPPIFITRDSPNALRSHVMEVAGGADVAECIAQFARRRQRGVCVLSGTGAVADVA  158

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+A GAV+ALHGRFEILSLTGAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVGSL+A
Sbjct  159  LRQPAAAGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLLA  218

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPV V+ +TF+NATYERLPL+ +EE             G   P   +            
Sbjct  219  AGPVTVVAATFANATYERLPLDDEEEGGGQLPGGSPTAIGAGLPDPSSFP----------  268

Query  541  PGVYNLPPNMVA--SNEAFAWAHGRPPY  618
              +YNLP N++A   ++AFAWAH RPPY
Sbjct  269  --IYNLPANLLAQLGHDAFAWAHVRPPY  294



>ref|XP_004296621.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=277

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 169/218 (78%), Gaps = 13/218 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN+LRSHV+EVA GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  61   SKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  120

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSL+GAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVGSLVA
Sbjct  121  LRQPAAPGAVVALHGRFEILSLSGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVA  180

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasag-------ag  519
            AGPVMV+ +TF+NATYERLPLE D+E A+        G   +                  
Sbjct  181  AGPVMVVAATFANATYERLPLEEDDEAASVGGGHGASGSSPTGVGSSGGPQVLPPGHGGQ  240

Query  520  mgdpspMPGVYNLPPNMVAS-----NEAFAWAHGRPPY  618
            + DPS +P +Y LPPN++ +     ++A+ W H R PY
Sbjct  241  LPDPSSLP-LYGLPPNLIPNGGPLGHDAYPWPHSRAPY  277



>ref|NP_001048546.1| Os02g0820800 [Oryza sativa Japonica Group]
 dbj|BAD22878.1| DNA-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAD23110.1| DNA-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF10460.1| Os02g0820800 [Oryza sativa Japonica Group]
 gb|EAY88054.1| hypothetical protein OsI_09483 [Oryza sativa Indica Group]
Length=266

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GADVA++IAQF+RRRQRGVCV+S +GTV NV 
Sbjct  67   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAQFSRRRQRGVCVLSGAGTVANVA  126

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAV+ALHGRFEILSLTG FLPGP+PPGSTGLT+YLAGGQGQVVGGSVVGSL+A
Sbjct  127  LRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLIA  186

Query  361  agPVMVIGSTFSNATYER  414
            AGPVMVI STF+NATYER
Sbjct  187  AGPVMVIASTFANATYER  204



>ref|XP_004954422.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=274

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GADVA++IAQF+RRRQRGVCV+S +GTV NV 
Sbjct  77   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAQFSRRRQRGVCVLSGAGTVANVA  136

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAV+ALHGRFEILSLTG FLPGP+PPGSTGLT+YLAGGQGQVVGGSVVGSL+A
Sbjct  137  LRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLIA  196

Query  361  agPVMVIGSTFSNATYER  414
            AGPVMVI STF+NATYER
Sbjct  197  AGPVMVIASTFANATYER  214



>ref|XP_009379018.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=288

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 174/227 (77%), Gaps = 21/227 (9%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN+LRSHV+EVA GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  62   SKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  121

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSL+GAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVGSLVA
Sbjct  122  LRQPAAPGAVVALHGRFEILSLSGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVA  181

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgd----  528
            AGPVMV+ +TF+NATYERLPLE DEE   +         GGSP  G +S           
Sbjct  182  AGPVMVVAATFANATYERLPLEEDEEGGGSGGGGGGHNNGGSPTGGGSSGAQLGSGGHQQ  241

Query  529  -------pspMPGVY--NLPPNMVAS-------NEAFA-WAHGRPPY  618
                    S +P +Y  +LPPN++ +       +EA+A WAH RPP+
Sbjct  242  QQQLPDPSSGLPNIYSHHLPPNLIPNGGHGHLGHEAYANWAHSRPPF  288



>ref|XP_004974243.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Setaria italica]
 ref|XP_004974244.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Setaria italica]
 ref|XP_004974245.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X3 [Setaria italica]
 ref|XP_004974246.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X4 [Setaria italica]
Length=260

 Score =   176 bits (447),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 158/217 (73%), Gaps = 17/217 (8%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GADVAESIA FARRRQRGVCV+S +GTVT+V 
Sbjct  47   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESIAHFARRRQRGVCVLSGAGTVTDVA  106

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+AL GRFEILSLTG FLPGP+PPGSTGLT+YLAGGQGQVVGGSVVG+L A
Sbjct  107  LRQPAAPGAVVALRGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLTA  166

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVMVI STF+NATYER        + A   +  Q       P G      GM DPS M
Sbjct  167  AGPVMVIASTFANATYER-----LPLDEAEEESAGQAAQLPPGPGGGPPLMGGMADPSAM  221

Query  541  PGVYNLPPNMVA------------SNEAFAWAHGRPP  615
            P    +PPN++              ++  AWAH RPP
Sbjct  222  PMFGGVPPNLMPGGGGASGAGLQLGHDGLAWAHARPP  258



>emb|CDO99189.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   177 bits (448),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA G+DVAESIAQFAR+RQRGVCV+S SG+V NVT
Sbjct  88   SKNKPKPPIFVTRDSPNALRSHVMEVAGGSDVAESIAQFARKRQRGVCVLSGSGSVANVT  147

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTGAFLPGP+PPG+TGLT+YLAGGQGQVVGGSVVGSLVA
Sbjct  148  LRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGATGLTVYLAGGQGQVVGGSVVGSLVA  207

Query  361  agPVMVIGSTFSNATYER  414
            AGPV+VI +TF+NATYER
Sbjct  208  AGPVLVIAATFANATYER  225



>ref|XP_011091221.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=241

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+A G DVAESIAQFARRRQRGVCV+S +G+V NVT
Sbjct  27   SKNKPKPPIFVTRDSPNALRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGSVANVT  86

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            +RQP+APGA +ALHGRFEILSLTGAFLPGP+PPG+TGLT+YLAGGQGQVVGGSVVG LVA
Sbjct  87   IRQPAAPGAAVALHGRFEILSLTGAFLPGPAPPGATGLTVYLAGGQGQVVGGSVVGPLVA  146

Query  361  agPVMVIGSTFSNATYER  414
            AGPVMVI +TF+NATYER
Sbjct  147  AGPVMVIAATFANATYER  164



>ref|XP_007226723.1| hypothetical protein PRUPE_ppa019745mg [Prunus persica]
 gb|EMJ27922.1| hypothetical protein PRUPE_ppa019745mg [Prunus persica]
Length=285

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 165/228 (72%), Gaps = 24/228 (11%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN+LRSHV+EVA GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  60   SKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  119

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+AL GRFEILSL+GAFLPGP+PPGSTGLT+YLA G GQVVGGSVVGSLVA
Sbjct  120  LRQPAAPGAVVALQGRFEILSLSGAFLPGPAPPGSTGLTVYLAAGNGQVVGGSVVGSLVA  179

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaa-------------taepqlggggspppgm  501
            AGPVMV+ +TF+NATYERLPLE DEE   +              TA    G         
Sbjct  180  AGPVMVVAATFANATYERLPLEEDEEGGGSGGGGHNNGGSGNSPTAGGSSGAQLGSGGHQ  239

Query  502  asagagmgdpspMPGVY--NLPPNMVAS-------NEAFAWAHGRPPY  618
                        +P +Y  +LPPN++ +       +EA+AWA  RPPY
Sbjct  240  HQQQLPDPSSGGLPNIYSHHLPPNLIPNGGHGQLGHEAYAWA--RPPY  285



>ref|XP_008224392.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=285

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 164/228 (72%), Gaps = 24/228 (11%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN+LRSHV+EVA GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  60   SKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  119

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+AL GRFEILSL+GAFLPGP+PPGSTGLT+YLA G GQVVGGSVVGSLVA
Sbjct  120  LRQPAAPGAVVALQGRFEILSLSGAFLPGPAPPGSTGLTVYLAAGNGQVVGGSVVGSLVA  179

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaa-------------taepqlggggspppgm  501
            AGPVMV+ +TF+NATYERLPLE DEE   +              T     G         
Sbjct  180  AGPVMVVAATFANATYERLPLEEDEEGGGSGGGGHNNGGSGNSPTGGGSSGAQLGSGGHQ  239

Query  502  asagagmgdpspMPGVY--NLPPNMVAS-------NEAFAWAHGRPPY  618
                        +P +Y  +LPPN++ +       +EA+AWA  RPPY
Sbjct  240  HQQLLPDPSSGGLPNIYSHHLPPNLIPNGGHGQLGHEAYAWA--RPPY  285



>ref|XP_006606853.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=366

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN+LRSHV+EVA GADVAES+AQFARRRQRGVCV+S SG V NVT
Sbjct  146  SKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGAVANVT  205

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAV+ALHGRFEILSLTG FLPGP+PPG+TGLT+YL GGQGQVVGGSVVGSLVA
Sbjct  206  LRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGATGLTVYLGGGQGQVVGGSVVGSLVA  265

Query  361  agPVMVIGSTFSNATYER  414
            AGPVMVI +TF+NATYER
Sbjct  266  AGPVMVIAATFANATYER  283



>gb|KEH42696.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=322

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKN+PKPPIFVTRDSPNAL+SHV+EVA GAD+AES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  103  SKNRPKPPIFVTRDSPNALKSHVMEVAGGADIAESVAQFARRRQRGVCVLSGSGSVANVT  162

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAV+ALHGRFEILSLTG FLPGP+PPGSTGLT+YLAGGQGQVVGG VVG+LVA
Sbjct  163  LRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGCVVGTLVA  222

Query  361  agPVMVIGSTFSNATYER  414
             GPVM+I +TF+NATYER
Sbjct  223  VGPVMLIAATFTNATYER  240



>ref|NP_001062524.1| Os08g0563200 [Oryza sativa Japonica Group]
 dbj|BAD09624.1| putative SAP1 protein [Oryza sativa Japonica Group]
 dbj|BAF24438.1| Os08g0563200 [Oryza sativa Japonica Group]
 dbj|BAG98967.1| unnamed protein product [Oryza sativa Japonica Group]
Length=235

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GADVAESIA FARRRQRGVCV+S +GTVT+V 
Sbjct  44   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESIAHFARRRQRGVCVLSGAGTVTDVA  103

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+AP AV+AL GRFEILSLTG FLPGP+PPGSTGLT+YLAGGQGQVVGGSVVG+L A
Sbjct  104  LRQPAAPSAVVALRGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLTA  163

Query  361  agPVMVIGSTFSNATYER  414
            AGPVMVI STF+NATYER
Sbjct  164  AGPVMVIASTFANATYER  181



>ref|XP_004497856.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=333

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN+L+SHV+EVA GADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  100  SKNKPKPPIFVTRDSPNSLKSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVT  159

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+ PGAV+ALHGRFEILSLTGAFLPGP+PPG+TGLT+YL+GGQGQVVGGSVVGSL+A
Sbjct  160  LRQPAVPGAVVALHGRFEILSLTGAFLPGPAPPGATGLTVYLSGGQGQVVGGSVVGSLIA  219

Query  361  agPVMVIGSTFSNATYER  414
            AGPVMVI +TF+NATYER
Sbjct  220  AGPVMVIAATFANATYER  237



>gb|EAZ06834.1| hypothetical protein OsI_29071 [Oryza sativa Indica Group]
Length=236

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GADVAESIA FARRRQRGVCV+S +GTVT+V 
Sbjct  46   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESIAHFARRRQRGVCVLSGAGTVTDVA  105

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+AP AV+AL GRFEILSLTG FLPGP+PPGSTGLT+YLAGGQGQVVGGSVVG+L A
Sbjct  106  LRQPAAPSAVVALRGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLTA  165

Query  361  agPVMVIGSTFSNATYER  414
            AGPVMVI STF+NATYER
Sbjct  166  AGPVMVIASTFANATYER  183



>gb|KEH41146.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=359

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN+L+SHV+EV+SGADVAES+AQFARRRQRGVCV+S SG+V NVT
Sbjct  135  SKNKPKPPIFVTRDSPNSLKSHVMEVSSGADVAESVAQFARRRQRGVCVLSGSGSVANVT  194

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRF+ILSLTGAFLPGP+PPG+TGLT+YLAGGQGQVVGGSVVG L+A
Sbjct  195  LRQPAAPGAVVALHGRFDILSLTGAFLPGPAPPGATGLTVYLAGGQGQVVGGSVVGPLIA  254

Query  361  agPVMVIGSTFSNATYER  414
            AGPVMVI +TF+NATYER
Sbjct  255  AGPVMVIAATFANATYER  272



>ref|XP_004495454.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=338

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKN+PKPPIFVTRDSPNAL+SHV+EVA GAD+AES+AQFAR+RQRGVCV+S SG+V NVT
Sbjct  115  SKNRPKPPIFVTRDSPNALKSHVMEVAGGADIAESVAQFARKRQRGVCVLSGSGSVANVT  174

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAV+ALHGRFEILSLTG FLPGP+PPGSTGLT+YLAGGQGQVVGG VVG+LVA
Sbjct  175  LRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGCVVGTLVA  234

Query  361  agPVMVIGSTFSNATYER  414
             GPVM+I +TF+NATYER
Sbjct  235  VGPVMLISATFTNATYER  252



>gb|AFW74083.1| DNA-binding protein [Zea mays]
Length=245

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 159/208 (76%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPPIFVTRDSPNALRSHV+EVA GADVA++IAQF+RRRQRGVCV+S +GTV NV L
Sbjct  45   KNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAQFSRRRQRGVCVLSGAGTVANVAL  104

Query  184  RQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslvaa  363
            RQPSAP AV+AL GRFEILSLTG FLPGP+PPGSTGLT+YLAGGQGQVVGGSVVG+L+AA
Sbjct  105  RQPSAPTAVVALRGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLIAA  164

Query  364  gPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspMP  543
            GPVMVI STF+NATYERLPLE ++E  A   A               +  + +       
Sbjct  165  GPVMVIASTFANATYERLPLEEEDEGPAPPMASGGGADPLMGGGLGIADPSALP------  218

Query  544  GVYNLPPN--MVASNEAF-AWAHGRPPY  618
             ++NLPP+   +   + F +WAH RPPY
Sbjct  219  -MFNLPPSNGQLGGGDGFPSWAHPRPPY  245



>ref|NP_001150826.1| DNA-binding protein [Zea mays]
 gb|ACG40573.1| DNA-binding protein [Zea mays]
Length=245

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 156/208 (75%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPPIFVTRDSPNALRSHV+EVA GADVA++IAQF+RRRQRGVCV+S +GTV NV L
Sbjct  45   KNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAQFSRRRQRGVCVLSGAGTVANVAL  104

Query  184  RQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslvaa  363
            RQPSAP AV+AL GRFEILSLTG FLPGP+P GSTGLT+YLAGGQGQVVGGSVVG+L+AA
Sbjct  105  RQPSAPTAVVALRGRFEILSLTGTFLPGPAPXGSTGLTVYLAGGQGQVVGGSVVGTLIAA  164

Query  364  gPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspMP  543
            GPVMVI STF+NATYER                      G     +   G G+ DPS +P
Sbjct  165  GPVMVIASTFANATYER------LPLEEEDEGPAPPMASGGGADPLMGGGLGIADPSALP  218

Query  544  GVYNLPPN--MVASNEAF-AWAHGRPPY  618
             ++NLPP+   +   + F +WAH RPPY
Sbjct  219  -MFNLPPSNGQLGGGDGFPSWAHPRPPY  245



>dbj|BAK02851.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=287

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 157/210 (75%), Gaps = 7/210 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GADVAESIA F+RRRQRGVCV+S +GTV +V 
Sbjct  81   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESIAHFSRRRQRGVCVLSGAGTVADVA  140

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+AL GRFEILSLTG FLPGPSPPGSTGLT+YLAGGQGQVVGGSVVG+L A
Sbjct  141  LRQPAAPGAVVALRGRFEILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGALTA  200

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVMVI STF+NATYERLPL+  EE+     A      G         AG       PM
Sbjct  201  AGPVMVIASTFANATYERLPLDDAEEDHQLEAARRHGAPGSGVALPPMMAGDPSAPGMPM  260

Query  541  PGVYNLPPNMVASNEAFA---W-AHGRPPY  618
               Y +PPN++      A   W AH RPPY
Sbjct  261  ---YGVPPNLMPGGGGHAAPEWAAHARPPY  287



>ref|NP_001151240.1| DNA-binding protein [Zea mays]
 ref|XP_008677349.1| PREDICTED: DNA-binding protein isoform X1 [Zea mays]
 gb|ACG42099.1| DNA-binding protein [Zea mays]
 gb|AFW61669.1| DNA-binding protein [Zea mays]
Length=265

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GADVAESIA FARRRQRGVCV+S +GTVT+V 
Sbjct  48   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESIAHFARRRQRGVCVLSGAGTVTDVA  107

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+AL GRFEILS+TG FLPGP+PPGSTGLT+YLAGGQGQVVGGSVVG+L+A
Sbjct  108  LRQPTAPGAVVALRGRFEILSITGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLIA  167

Query  361  agPVMVIGSTFSNATYER  414
            AGPVMV+ STF+NATYER
Sbjct  168  AGPVMVMASTFANATYER  185



>ref|XP_010694781.1| PREDICTED: putative DNA-binding protein ESCAROLA [Beta vulgaris 
subsp. vulgaris]
Length=301

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 161/227 (71%), Gaps = 22/227 (10%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPPIFVTRDSPNALRSHV+EVA GADVA+SIA FARRRQRGVCV+SA+G VT VT+
Sbjct  75   KNKPKPPIFVTRDSPNALRSHVMEVAGGADVADSIANFARRRQRGVCVISAAGAVTGVTI  134

Query  184  RQPSA-PGA--VMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgsl  354
            RQPSA PG   V+ALHGRFEILSLTGAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVG L
Sbjct  135  RQPSAGPGGATVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGPL  194

Query  355  vaagPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdps  534
            +AAGPVMVI +TFSNATYERLPLE  E+E             G                 
Sbjct  195  IAAGPVMVIAATFSNATYERLPLEDQEDEQPGQVGGASGSPPGHQQQQQQQQQQQQHSMG  254

Query  535  pMP----GVYNLPPNMVA--------------SNEAFAWAH-GRPPY  618
              P    G+YNLPPN++               S+EA+ W H GRPP+
Sbjct  255  GDPSSALGMYNLPPNLLPNGGGSSGGGGGGQISHEAYGWNHGGRPPF  301



>gb|ABL63119.1| AT-hook DNA-binding protein, partial [Catharanthus roseus]
Length=256

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHVLEV+ G+DVAESIA FAR+RQRGVCV+S SG+V NVT
Sbjct  34   SKNKPKPPIFVTRDSPNALRSHVLEVSGGSDVAESIAVFARKRQRGVCVLSGSGSVANVT  93

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSL+GAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVGSLVA
Sbjct  94   LRQPAAPGAVVALHGRFEILSLSGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVA  153

Query  361  agPVMVIGSTFSNATYER  414
            AGPV++I +TF+NATYER
Sbjct  154  AGPVLIIAATFANATYER  171



>tpg|DAA48555.1| TPA: hypothetical protein ZEAMMB73_420043 [Zea mays]
 tpg|DAA48556.1| TPA: hypothetical protein ZEAMMB73_420043 [Zea mays]
 tpg|DAA48557.1| TPA: hypothetical protein ZEAMMB73_420043 [Zea mays]
 tpg|DAA48558.1| TPA: hypothetical protein ZEAMMB73_420043 [Zea mays]
Length=269

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GADVAESIA FARRRQRGVCV+S +GTV +V 
Sbjct  49   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESIAHFARRRQRGVCVLSGAGTVADVA  108

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+AL GRFEILSLTG FLPGP+PPGSTGLT+YLAGGQGQVVGGSVVG+L A
Sbjct  109  LRQPAAPGAVVALRGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLTA  168

Query  361  agPVMVIGSTFSNATYER  414
            AGPVMV+ STF+NATYER
Sbjct  169  AGPVMVMASTFANATYER  186



>gb|EMS64253.1| hypothetical protein TRIUR3_00437 [Triticum urartu]
Length=285

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 155/210 (74%), Gaps = 6/210 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GADVAESIA F+RRRQRGVCV+  +GTV +V 
Sbjct  78   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESIAHFSRRRQRGVCVLRGAGTVADVA  137

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPGAV+AL GRFEILSLTG FLPGPSPPGSTGLT+YLAGGQGQVVGGSVVG+L A
Sbjct  138  LRQPSAPGAVVALRGRFEILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGALTA  197

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVMVI STF+NATYER     D EE        +  G       +    AG    + M
Sbjct  198  AGPVMVIASTFANATYER-LPLDDAEEDHHQLEAARRHGAPGAGAPLPPMMAGDPSAAGM  256

Query  541  PGVYNLPPNMVASNEAFA---W-AHGRPPY  618
            P +Y +PPN++      A   W AH RPPY
Sbjct  257  P-MYGVPPNLMPGGGGHAAPEWAAHARPPY  285



>ref|XP_006846339.1| hypothetical protein AMTR_s00012p00257450 [Amborella trichopoda]
 gb|ERN08014.1| hypothetical protein AMTR_s00012p00257450 [Amborella trichopoda]
Length=284

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPPI +TR+SPNALRSHVLEVA GADVAES+A FARRRQRGVCV+S SG V NVTL
Sbjct  80   KNKPKPPIIITRESPNALRSHVLEVAGGADVAESVAAFARRRQRGVCVLSGSGVVANVTL  139

Query  184  RQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslvaa  363
            RQP+APGAV+ LHGRFEILSL+GAFLP PSPP +TGLT+YLAGGQGQVVGGSVVG+LVA+
Sbjct  140  RQPAAPGAVVTLHGRFEILSLSGAFLPAPSPPAATGLTVYLAGGQGQVVGGSVVGALVAS  199

Query  364  gPVMVIGSTFSNATYER  414
            GPVMVI +TFSNATYER
Sbjct  200  GPVMVIAATFSNATYER  216



>ref|XP_003570419.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=261

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 130/139 (94%), Gaps = 1/139 (1%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GADVA++IA F+RRRQRGVCV+S +GTV NV 
Sbjct  56   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAHFSRRRQRGVCVLSGAGTVANVA  115

Query  181  LRQPSAP-GAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslv  357
            LRQPSAP GAV+ALHGRFEILSLTG FLPGP+PPGSTGLT+YLAGGQGQVVGGSVVG+L 
Sbjct  116  LRQPSAPGGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGALT  175

Query  358  aagPVMVIGSTFSNATYER  414
            AAGPVMVI STF+NATYER
Sbjct  176  AAGPVMVIASTFANATYER  194



>ref|XP_006827517.1| hypothetical protein AMTR_s00009p00189120 [Amborella trichopoda]
 gb|ERM94933.1| hypothetical protein AMTR_s00009p00189120 [Amborella trichopoda]
Length=262

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDSPNALRSHV+EVASG+DVAES+A FARRRQRGVCV+S SG V NVT
Sbjct  90   SKNKPKPPIIITRDSPNALRSHVMEVASGSDVAESVAAFARRRQRGVCVLSGSGVVANVT  149

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGA++ LHGRFEILSL+GAFLPGP+PPG+TGLT+YLAGGQGQVVGG VVG+LVA
Sbjct  150  LRQPAAPGAIVTLHGRFEILSLSGAFLPGPAPPGATGLTVYLAGGQGQVVGGCVVGALVA  209

Query  361  agPVMVIGSTFSNATYER  414
            +GPVMV+ +TF+NATYER
Sbjct  210  SGPVMVVAATFANATYER  227



>ref|XP_004134419.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
Length=300

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRS+VLEVA+G+DVA+SIAQFAR+RQRGVCV+SA+G V NVT
Sbjct  90   SKNKPKPPIFVTRDSPNALRSYVLEVAAGSDVADSIAQFARKRQRGVCVLSATGLVANVT  149

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APG+VM L GRFEILSLTGAFLPGP+PPGSTGLT+YL+GGQGQVVGGSVVGSLVA
Sbjct  150  LRQPAAPGSVMPLQGRFEILSLTGAFLPGPAPPGSTGLTVYLSGGQGQVVGGSVVGSLVA  209

Query  361  agPVMVIGSTFSNATYER  414
            AGP+MVI +TF+NATYER
Sbjct  210  AGPIMVIAATFANATYER  227



>ref|XP_008439362.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Cucumis 
melo]
Length=293

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRS+VLEVA+G+DVA+SIAQFAR+RQRGVCV+SA+G V NVT
Sbjct  83   SKNKPKPPIFVTRDSPNALRSYVLEVAAGSDVADSIAQFARKRQRGVCVLSATGLVANVT  142

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APG+VM L GRFEILSLTGAFLPGP+PPGSTGLT+YL+GGQGQVVGGSVVGSLVA
Sbjct  143  LRQPAAPGSVMPLQGRFEILSLTGAFLPGPAPPGSTGLTVYLSGGQGQVVGGSVVGSLVA  202

Query  361  agPVMVIGSTFSNATYER  414
            AGP+MVI +TF+NATYER
Sbjct  203  AGPIMVIAATFANATYER  220



>ref|XP_008218304.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=304

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 165/221 (75%), Gaps = 17/221 (8%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+++GAD+A+S+A+FAR RQRGVCV+S SGTVTNVT
Sbjct  86   SKNKPKPPIFVTRDSPNALRSHVMEISNGADIADSVARFARTRQRGVCVLSGSGTVTNVT  145

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            +RQ S  G+VMALHGRFEILSLTGAFLPGP+PPGSTG+TIYLAG QGQVVGGSVVG LVA
Sbjct  146  IRQTSPAGSVMALHGRFEILSLTGAFLPGPAPPGSTGMTIYLAGVQGQVVGGSVVGPLVA  205

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVMVI +TFSNATYERLPLE +EE     + +   G G  P  G +  G G       
Sbjct  206  SGPVMVIAATFSNATYERLPLEEEEEVGGNNSGQAAGGAGSPPGIGGSGGGMGDPSMGV-  264

Query  541  PGVYNLPPNMVASNEAFA-----------WAH----GRPPY  618
             GVYNL PNM+ +    A           WAH    GRPP+
Sbjct  265  -GVYNLQPNMLPNGGGQALSHDQGAAYSSWAHGQGGGRPPF  304



>ref|XP_004171657.1| PREDICTED: putative DNA-binding protein ESCAROLA-like, partial 
[Cucumis sativus]
Length=297

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRS+VLEVA+G+DVA+SIAQFAR+RQRGVCV+SA+G V NVT
Sbjct  87   SKNKPKPPIFVTRDSPNALRSYVLEVAAGSDVADSIAQFARKRQRGVCVLSATGLVANVT  146

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APG+VM L GRFEILSLTGAFLPGP+PPGSTGLT+YL+GGQGQVVGGSVVGSLVA
Sbjct  147  LRQPAAPGSVMPLQGRFEILSLTGAFLPGPAPPGSTGLTVYLSGGQGQVVGGSVVGSLVA  206

Query  361  agPVMVIGSTFSNATYER  414
            AGP+MVI +TF+NATYER
Sbjct  207  AGPIMVIAATFANATYER  224



>ref|XP_008780228.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=268

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 157/205 (77%), Gaps = 14/205 (7%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIF+TRDSPNAL SHV+EV  GADVA++IAQFARRRQRGVCV+S +G V NV 
Sbjct  76   SKNKPKPPIFITRDSPNALHSHVMEVQGGADVADAIAQFARRRQRGVCVLSGAGIVANVA  135

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPG+V+ALHGRFEILSLTG FLPGPSPPGSTGLT+YLAGGQGQVVGGSVVGSL+A
Sbjct  136  LRQPSAPGSVVALHGRFEILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGSLIA  195

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVMV+ STF+NATYER                 QL GG +      +   G+ DPS +
Sbjct  196  AGPVMVVASTFANATYER-------LPLEEEEGPGQLPGGSALGMAGGTGPGGLPDPSAL  248

Query  541  PGVYNLPPNMVASNEAFAWAHGRPP  615
            P ++NL       ++AFAWAH RPP
Sbjct  249  P-IFNL------GHDAFAWAHARPP  266



>gb|KGN56888.1| hypothetical protein Csa_3G141840 [Cucumis sativus]
Length=303

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRS+VLEVA+G+DVA+SIAQFAR+RQRGVCV+SA+G V NVT
Sbjct  93   SKNKPKPPIFVTRDSPNALRSYVLEVAAGSDVADSIAQFARKRQRGVCVLSATGLVANVT  152

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APG+VM L GRFEILSLTGAFLPGP+PPGSTGLT+YL+GGQGQVVGGSVVGSLVA
Sbjct  153  LRQPAAPGSVMPLQGRFEILSLTGAFLPGPAPPGSTGLTVYLSGGQGQVVGGSVVGSLVA  212

Query  361  agPVMVIGSTFSNATYER  414
            AGP+MVI +TF+NATYER
Sbjct  213  AGPIMVIAATFANATYER  230



>gb|EPS65852.1| hypothetical protein M569_08925, partial [Genlisea aurea]
Length=268

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHVLEV+ G+D+AE IA ++RRRQRGVCV+SA+GTVTNV 
Sbjct  76   SKNKPKPPIFVTRDSPNALRSHVLEVSGGSDIAECIAHYSRRRQRGVCVLSANGTVTNVK  135

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            +RQPSAPG+VMALHG FEILSLTG+FLPGP+PPGSTGLT+YLA G+G+VVGG+VVGSL+A
Sbjct  136  IRQPSAPGSVMALHGSFEILSLTGSFLPGPAPPGSTGLTVYLAAGRGEVVGGTVVGSLIA  195

Query  361  agPVMVIGSTFSNATYER  414
             G VMVI STF+NATYER
Sbjct  196  VGQVMVIASTFANATYER  213



>ref|XP_007206474.1| hypothetical protein PRUPE_ppa018950mg [Prunus persica]
 gb|EMJ07673.1| hypothetical protein PRUPE_ppa018950mg [Prunus persica]
Length=305

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+++GAD+A+S+A+FAR RQRGVCV+S SGTVTNVT
Sbjct  87   SKNKPKPPIFVTRDSPNALRSHVMEISNGADIADSVARFARTRQRGVCVLSGSGTVTNVT  146

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            +RQ S  G+VMALHGRFEILSLTGAFLPGP+PPGSTG+TIYLAG QGQVVGGSVVG LVA
Sbjct  147  IRQASPAGSVMALHGRFEILSLTGAFLPGPAPPGSTGMTIYLAGVQGQVVGGSVVGPLVA  206

Query  361  agPVMVIGSTFSNATYER  414
            +GPVMVI +TFSNATYER
Sbjct  207  SGPVMVIAATFSNATYER  224



>ref|XP_009401827.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=270

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 163/210 (78%), Gaps = 18/210 (9%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIF+TRDSPNALRSHV+EVA+GADVA+ IAQFARRRQ GV V+S +G V NVT
Sbjct  72   SKNKPKPPIFITRDSPNALRSHVMEVAAGADVADCIAQFARRRQCGVSVLSGAGAVANVT  131

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APG+V+ALHGRFEILSLTG FLPGP+PPG++GL +YLAGGQGQVVGG+VVGSL+A
Sbjct  132  LRQPAAPGSVVALHGRFEILSLTGTFLPGPAPPGTSGLAVYLAGGQGQVVGGTVVGSLIA  191

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
             GPVMV+ +TF+ ATYERLPLE ++E A A    P    GG P P + +           
Sbjct  192  TGPVMVVAATFATATYERLPLEEEDEAAGANAGLPSSLTGGLPDPSLLN-----------  240

Query  541  PGVYNLPPNMVAS-----NEAFAWAHGRPP  615
              +Y+LPPN++ +     ++A AWAH RPP
Sbjct  241  --MYSLPPNLMPNGGQLGHDALAWAHARPP  268



>ref|XP_008391057.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=281

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFV RDSPN+LRSHV+EVASG DVAES+AQFARRRQRG+C++S SG+V NVT
Sbjct  61   SKNKPKPPIFVXRDSPNSLRSHVMEVASGTDVAESVAQFARRRQRGMCILSGSGSVANVT  120

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ LHGRFEILSL+GAFLPGP+PPG TGLT+YLAGGQGQVVGGSV+GSLVA
Sbjct  121  LRQPAAPGAVVXLHGRFEILSLSGAFLPGPAPPGFTGLTVYLAGGQGQVVGGSVMGSLVA  180

Query  361  agPVMVIGSTFSNATYER  414
            AGPVMV  +TF+NATYER
Sbjct  181  AGPVMVXAATFANATYER  198



>ref|XP_010918771.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
 ref|XP_010918772.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=248

 Score =   168 bits (426),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 162/211 (77%), Gaps = 10/211 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN+LRSHV+EVA GAD+A+ IAQFARRRQRGVCV+S +G V NVT
Sbjct  43   SKNKPKPPIFVTRDSPNSLRSHVMEVAGGADIADCIAQFARRRQRGVCVLSGTGAVANVT  102

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+AP AV+ALHGRFEILSLTG FLPGP+PPGS+GLT+YLAGGQGQVVGGSVVGSLVA
Sbjct  103  LRQPAAPAAVVALHGRFEILSLTGTFLPGPAPPGSSGLTVYLAGGQGQVVGGSVVGSLVA  162

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVMV+ +TF+NATYERLPLE +EEE              SP                 
Sbjct  163  AGPVMVVAATFANATYERLPLEEEEEEEEGPGGSAGHLPCRSPAAMGTGFPDPSSLS---  219

Query  541  PGVYNLPPNMVAS-----NEAFAWAHGRPPY  618
              +YNLPPN++ +     ++AFAWAH RPPY
Sbjct  220  --IYNLPPNLLPNGAQLVHDAFAWAHARPPY  248



>ref|XP_004956262.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=256

 Score =   168 bits (426),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA GADVAESIA+FARRRQRGVCV+S +GTV +V 
Sbjct  49   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESIARFARRRQRGVCVLSGAGTVADVA  108

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+AL G FEILSLTG FLPGPSPPG+TGLT+YLAGGQGQVVGG VVGSL A
Sbjct  109  LRQPAAPGAVVALRGLFEILSLTGTFLPGPSPPGATGLTVYLAGGQGQVVGGIVVGSLTA  168

Query  361  agPVMVIGSTFSNATYER  414
            AGPVMV+ STF+NATYER
Sbjct  169  AGPVMVMASTFANATYER  186



>ref|XP_009775204.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=265

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 161/217 (74%), Gaps = 12/217 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA G DVA+SIAQFARRRQRGVCV+S +G+V NVT
Sbjct  50   SKNKPKPPIFVTRDSPNALRSHVMEVAGGTDVADSIAQFARRRQRGVCVLSGNGSVANVT  109

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPSAPG V+ L GRFEILSLTGAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVG LV+
Sbjct  110  LRQPSAPG-VVVLQGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGPLVS  168

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVM+I +TFSNATYERLPLE ++         P   G   P  G +           +
Sbjct  169  AGPVMIIAATFSNATYERLPLEEEDGGGDGCGQSPVPAGNSPPALGSSGERQQQQQQHEL  228

Query  541  PG-----VYNLPPNMVA-----SNEAFA-WAHGRPPY  618
            P      +YN  PN++      +++A+A WA  RPPY
Sbjct  229  PDPTSLPIYNFTPNLLPNGGQLNHDAYANWATPRPPY  265



>ref|XP_010257112.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=395

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TR+SPNALRSHVLE++SG+DVAESIA FARRRQRGVCV+S SG VTNVT
Sbjct  188  SKNKPKPPIIITRESPNALRSHVLEISSGSDVAESIATFARRRQRGVCVLSGSGIVTNVT  247

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV++LHGRFEILSL+GAFLP PSPPG+TGLT+YL+GGQGQVVGGSVVG+LVA
Sbjct  248  LRQPAAPGAVVSLHGRFEILSLSGAFLPAPSPPGATGLTVYLSGGQGQVVGGSVVGALVA  307

Query  361  agPVMVIGSTFSNATYER  414
            +GPVMVI +TF+NATYER
Sbjct  308  SGPVMVIAATFTNATYER  325



>ref|XP_003536146.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=280

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            S+NKPKPPIFVTRDSPNALRSHV+E+A GAD+A+ +AQFARRRQRGV ++S SGTV NV 
Sbjct  71   SRNKPKPPIFVTRDSPNALRSHVMEIAVGADIADCVAQFARRRQRGVSILSGSGTVVNVN  130

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAVMALHGRF+ILSLTG+FLPGPSPPG+TGLTIYLAGGQGQ+VGG VVG LVA
Sbjct  131  LRQPTAPGAVMALHGRFDILSLTGSFLPGPSPPGATGLTIYLAGGQGQIVGGGVVGPLVA  190

Query  361  agPVMVIGSTFSNATYER  414
            AGPV+V+ +TFSNATYER
Sbjct  191  AGPVLVMAATFSNATYER  208



>ref|XP_007144002.1| hypothetical protein PHAVU_007G120900g [Phaseolus vulgaris]
 gb|ESW15996.1| hypothetical protein PHAVU_007G120900g [Phaseolus vulgaris]
Length=278

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+ASGAD+ + + QFARRRQRGV ++S SG V NVT
Sbjct  72   SKNKPKPPIFVTRDSPNALRSHVMEIASGADITDCVLQFARRRQRGVSILSGSGAVVNVT  131

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAVMALHGRF+ILSLTG+FLPGPSPPG+TGLTIYLAGGQGQ+VGG VVG LVA
Sbjct  132  LRQPTAPGAVMALHGRFDILSLTGSFLPGPSPPGATGLTIYLAGGQGQIVGGGVVGPLVA  191

Query  361  agPVMVIGSTFSNATYER  414
            AGPV+++ +TFSNATYER
Sbjct  192  AGPVLIMAATFSNATYER  209



>ref|XP_003556450.2| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=277

 Score =   167 bits (422),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+E+A+GAD+A+ +AQFARR QRGV ++S SGTV NVT
Sbjct  70   SKNKPKPPIFVTRDSPNALRSHVMEIAAGADIADCVAQFARRLQRGVSILSGSGTVVNVT  129

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            +RQP+APGAVMALHGRF+ILSLTG+FLPGPSPPG+TGLTIYLAGGQG VVGG VVG L+A
Sbjct  130  IRQPTAPGAVMALHGRFDILSLTGSFLPGPSPPGATGLTIYLAGGQGHVVGGGVVGPLLA  189

Query  361  agPVMVIGSTFSNATYER  414
            AGPV+++ +TFSNATYER
Sbjct  190  AGPVLLMAATFSNATYER  207



>ref|XP_006354520.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=285

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 163/220 (74%), Gaps = 16/220 (7%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EVA G DVA+ IAQFARRRQRGVCV+S +G+V NVT
Sbjct  68   SKNKPKPPIFVTRDSPNALRSHVMEVAGGTDVADCIAQFARRRQRGVCVLSGNGSVANVT  127

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPS+PGA++ L GRFEILSLTGAFLPGP+PPGST LT+YLAGGQGQVVGGS+VG L+A
Sbjct  128  LRQPSSPGAIV-LQGRFEILSLTGAFLPGPAPPGSTRLTVYLAGGQGQVVGGSIVGPLIA  186

Query  361  agPVMVIGSTFSNATYER---------lplepdeeeaaaataepqlggggspppgmasag  513
            AGPVM+I +TFSNATYER             P + +  A  + P LG     P       
Sbjct  187  AGPVMIIAATFSNATYERLPLEEEEEVGGDRPSQSQVPAENSPPTLGSSDGRPQQQHQQQ  246

Query  514  agmgdpspMPGVYNLPPNMVA-----SNEAFAWAHGRPPY  618
              + DPS +P +YN  PN++      +++A+AWA+ RPPY
Sbjct  247  HELPDPSSLP-IYNFTPNLLPNGGQLNHDAYAWANPRPPY  285



>ref|XP_006851807.1| hypothetical protein AMTR_s00041p00025000 [Amborella trichopoda]
 gb|ERN13274.1| hypothetical protein AMTR_s00041p00025000 [Amborella trichopoda]
Length=307

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 160/213 (75%), Gaps = 7/213 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TR+S NALR+HV+EVASG DV ES+A FARRRQRGVC++S SGTVTNVT
Sbjct  95   SKNKPKPPIIITRESANALRAHVMEVASGCDVGESVANFARRRQRGVCILSGSGTVTNVT  154

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGA++ LHGRFEILSL+G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG+LVA
Sbjct  155  LRQPAAPGAIVTLHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALVA  214

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++F NA YERLPL+ DE     A      G G       + + +G       
Sbjct  215  SGPVIIMAASFGNAAYERLPLDEDEGALQVAGGGGGGGMGSPGGGSQSQSQSGPQQLLSD  274

Query  541  PGV---YNLPPNMVAS----NEAFAWAHGRPPY  618
            P     ++LPPN++ S     +A++WA GRPPY
Sbjct  275  PNAPLFHSLPPNLLNSVQLPPDAYSWATGRPPY  307



>ref|XP_004247701.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=286

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 160/218 (73%), Gaps = 14/218 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSH++EVA G DVA+ IAQFARRRQRGVCV+S +G+V NVT
Sbjct  71   SKNKPKPPIFVTRDSPNALRSHIMEVAGGTDVADCIAQFARRRQRGVCVLSGNGSVANVT  130

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQPS+PGAV+ L GRFEILSLTGAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVG L+A
Sbjct  131  LRQPSSPGAVV-LQGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGPLIA  189

Query  361  agPVMVIGSTFSNATYER-------lplepdeeeaaaataepqlggggspppgmasagag  519
            AGPVM+I +TFSNATYER            +  ++   T       G +           
Sbjct  190  AGPVMIIAATFSNATYERLPLEEEEEVGGDNPSQSQVLTGNSPPTLGSNDGRPQQHQQHE  249

Query  520  mgdpspMPGVYNLPPNMVA-----SNEAFAWAHGRPPY  618
            + DPS +P +YN  PN++      +++A+AW + RPPY
Sbjct  250  LHDPSSLP-IYNFTPNILPNGGQLNHDAYAWTNPRPPY  286



>ref|XP_002489068.1| hypothetical protein SORBIDRAFT_0169s002010 [Sorghum bicolor]
 gb|EES20328.1| hypothetical protein SORBIDRAFT_0169s002010 [Sorghum bicolor]
Length=199

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +1

Query  7    NKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTLR  186
            NKP PPIFVTRDSPNALRSHV+EVA GADVA++IAQF+RRRQRGVCV+S +GTV NV LR
Sbjct  1    NKPNPPIFVTRDSPNALRSHVMEVAGGADVADAIAQFSRRRQRGVCVLSGAGTVANVALR  60

Query  187  QPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslvaag  366
            QPSAP AV+ALHGRFEILSLTG FLPGP+PPGSTGLT+YLAGGQGQVVGGSVVG+L+AAG
Sbjct  61   QPSAPTAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLIAAG  120

Query  367  PVMVIGSTFSNATY  408
            PVMVI STF+NATY
Sbjct  121  PVMVIASTFANATY  134



>ref|XP_010262897.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=360

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 157/208 (75%), Gaps = 5/208 (2%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TR+SPNALRSHVLE++SG+DV ESIA FARRRQRGVCV+S SG VTNVT
Sbjct  152  SKNKPKPPIIITRESPNALRSHVLEISSGSDVVESIATFARRRQRGVCVLSGSGVVTNVT  211

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+A GAV+ LHGRFEILSL+GAFLP PSPPG++GLT+YLAGGQGQVVGGSVVG+L+A
Sbjct  212  LRQPAASGAVITLHGRFEILSLSGAFLPAPSPPGASGLTVYLAGGQGQVVGGSVVGALMA  271

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVMVI +TF+NATYER     DE        +   G         AS    + DPS +
Sbjct  272  SGPVMVIAATFANATYER-LPIKDEPAGEGMQLQQTSGVNSGTSGISASQSHVLPDPSSL  330

Query  541  PGVYNLPPNMVASNE---AFAWAHGRPP  615
            P +YNLPPN++ + +      WA  RPP
Sbjct  331  P-IYNLPPNLLTNGQMPHDVFWAPPRPP  357



>emb|CDP09863.1| unnamed protein product [Coffea canephora]
Length=291

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 154/210 (73%), Gaps = 9/210 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ES+A FARRRQRGVC+MS +GTVTNVT
Sbjct  87   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMESVANFARRRQRGVCIMSGTGTVTNVT  146

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL G+FLP P+PP +T LTIYLAGGQGQVVGGSVVG+L+A
Sbjct  147  LRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPAATTLTIYLAGGQGQVVGGSVVGALMA  206

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPL+ DE             G              M D    
Sbjct  207  SGPVVIMAASFSNAAYERLPLDEDESSLQMQGGSLGSPGAVGGQQQQQQQQQLMAD----  262

Query  541  PGVYNLPPNMVAS----NEAFAWAHGRPPY  618
            P ++++PPN+  S    NEA+ WA GRPP+
Sbjct  263  PSLFSMPPNLFNSVQLPNEAY-WATGRPPF  291



>ref|XP_010435119.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=283

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 155/212 (73%), Gaps = 10/212 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHVLE++ G+DVA++IA F+RRRQRGVCV+S +G+V NVT
Sbjct  76   SKNKPKPPIFVTRDSPNALRSHVLEISDGSDVADTIAHFSRRRQRGVCVLSGTGSVANVT  135

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQ + PG V++L GRFEILSLTGAFLPGPSPPGSTGLT+YLAG QGQVVGGSVVG L+A
Sbjct  136  LRQAATPGGVVSLQGRFEILSLTGAFLPGPSPPGSTGLTVYLAGVQGQVVGGSVVGPLLA  195

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
             G VMVI +TFSNATYERLP+E +E+   +                +       G     
Sbjct  196  IGSVMVIAATFSNATYERLPMEEEEDGGGSRPIHGGGDSPPGMGSSLPDPSVMAGSG---  252

Query  541  PGVYNLPPNMVAS------NEAFAWAHGRPPY  618
            PG YN+PP+++ +      +E + W H RPPY
Sbjct  253  PG-YNMPPHLIPNGAGQLGHEPYTWVHARPPY  283



>ref|XP_010940763.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=355

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 156/205 (76%), Gaps = 14/205 (7%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN+L SHV+EVA GADVA+SIAQFARRRQRGVCV+S +G V NV 
Sbjct  163  SKNKPKPPIFVTRDSPNSLHSHVMEVAGGADVADSIAQFARRRQRGVCVLSGAGVVANVG  222

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHGRFEILSLTG FLPGPSPPGSTGLT+YLAGGQGQVVGGSVVG L+A
Sbjct  223  LRQPAAPGAVVALHGRFEILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGPLIA  282

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AG VMV+ STF+NA+YER                 QL GG +      S   G+ DPS +
Sbjct  283  AGSVMVVASTFANASYER-------LPLEEEEGPGQLPGGSALGMAGGSGHGGLPDPSAL  335

Query  541  PGVYNLPPNMVASNEAFAWAHGRPP  615
            P ++NL       ++AFAWAH RPP
Sbjct  336  P-IFNL------GHDAFAWAHARPP  353



>ref|XP_003576887.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=262

 Score =   163 bits (413),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRSHV+EV+SGAD+A+SIA F+RRRQRGVCV+S +G V +V 
Sbjct  44   SKNKPKPPIFVTRDSPNALRSHVMEVSSGADIADSIAHFSRRRQRGVCVLSGAGAVADVA  103

Query  181  LRQPSAP-GAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslv  357
            LRQP+AP GAV+AL GRFEILSLTG FLPGPSPPGSTGLT+YLAGGQGQVVGGSVVG+L 
Sbjct  104  LRQPAAPGGAVVALRGRFEILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGTLT  163

Query  358  aagPVMVIGSTFSNATYER  414
            AAGPVMVI STF+NATYER
Sbjct  164  AAGPVMVIASTFANATYER  182



>ref|XP_009384565.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384566.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=237

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 149/212 (70%), Gaps = 23/212 (11%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPK PIF+TRDSPN LRSHV+EVA GADVAE IAQFARRRQ GV V+S  GTV NVT
Sbjct  43   SKNKPKAPIFITRDSPNVLRSHVMEVAGGADVAECIAQFARRRQCGVSVLSGVGTVANVT  102

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ +HGRFEILSLTG FLPGP+ PGSTGLT+YLAG Q QV+GGSVVGSL+A
Sbjct  103  LRQPAAPGAVVTMHGRFEILSLTGTFLPGPALPGSTGLTVYLAGEQCQVLGGSVVGSLLA  162

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
             GPVMV+ +TF NATYERLPLE +EE               S                  
Sbjct  163  TGPVMVVATTFGNATYERLPLEGEEEVEEEEAGSGGGLLDPSLLS---------------  207

Query  541  PGVYNLPPNMVA-----SNEAFAWAHG-RPPY  618
              +YNLPPN++      +++A A AH  RPPY
Sbjct  208  --MYNLPPNLIPDGGQLAHDAIARAHARRPPY  237



>emb|CDY12779.1| BnaC04g28620D [Brassica napus]
Length=282

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 157/212 (74%), Gaps = 7/212 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPK P+FVTRDSPNAL SHV+E++ G+DVA++IA F+RRRQRGVCV+S +G+V NVT
Sbjct  72   SKNKPKAPVFVTRDSPNALHSHVMEISDGSDVADTIAHFSRRRQRGVCVISGTGSVANVT  131

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQ +APG V++L GRFEILSLTGAFLPGP+PPGSTGLT+YLAG QGQV+GGSVVG LVA
Sbjct  132  LRQAAAPGGVVSLQGRFEILSLTGAFLPGPAPPGSTGLTVYLAGVQGQVLGGSVVGPLVA  191

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
             G VMVI +TFSNATYERLP+E +E+    A    +   GG   P    +          
Sbjct  192  IGSVMVIAATFSNATYERLPIEDEEDGGGGAVGGSRQIHGGGDSPPGIGSSLPDPSGMAG  251

Query  541  PGVYNLPPNMVAS------NEAFAWAHGRPPY  618
            PG YNLPP+++ +      +E + W H RPPY
Sbjct  252  PG-YNLPPHLIPNGAGQLGHEPYNWVHARPPY  282



>ref|XP_010276261.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=295

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 153/209 (73%), Gaps = 3/209 (1%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A+G DV ES+A FARRRQRGVC++S SGTVTNVT
Sbjct  87   SKNKPKPPIIITRDSANALRTHVMEIANGCDVGESVATFARRRQRGVCILSGSGTVTNVT  146

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+ PGA++ LHGRFEILSL+G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG+LVA
Sbjct  147  LRQPATPGAIVTLHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALVA  206

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++F NA YERLPLE +E      +  P    G             +     M
Sbjct  207  SGPVVIMAASFGNAAYERLPLEDEEPPLPMQSGGPLGSPGMVDQQQQQQQQQQLLPDPNM  266

Query  541  PGVYNLPPNMVASNEAFA---WAHGRPPY  618
            P  + LPPN++   +  A   WA GRPP+
Sbjct  267  PLFHGLPPNLLTPCQLPAEAYWATGRPPF  295



>ref|NP_567432.1| AT-hook motif nuclear-localized protein 20 [Arabidopsis thaliana]
 dbj|BAC43296.1| unknown protein [Arabidopsis thaliana]
 gb|AAP21231.1| At4g14465 [Arabidopsis thaliana]
 dbj|BAE99903.1| hypothetical protein [Arabidopsis thaliana]
 tpd|FAA00291.1| TPA: AT-hook motif nuclear localized protein 20 [Arabidopsis 
thaliana]
 gb|AEE83448.1| AT-hook motif nuclear-localized protein 20 [Arabidopsis thaliana]
Length=281

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 155/212 (73%), Gaps = 12/212 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPK PIFVTRDSPNALRSHVLE++ G+DVA++IA F+RRRQRGVCV+S +G+V NVT
Sbjct  76   SKNKPKAPIFVTRDSPNALRSHVLEISDGSDVADTIAHFSRRRQRGVCVLSGTGSVANVT  135

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQ +APG V++L GRFEILSLTGAFLPGPSPPGSTGLT+YLAG QGQVVGGSVVG L+A
Sbjct  136  LRQAAAPGGVVSLQGRFEILSLTGAFLPGPSPPGSTGLTVYLAGVQGQVVGGSVVGPLLA  195

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
             G VMVI +TFSNATYERLP+E +E+   +                +       G     
Sbjct  196  IGSVMVIAATFSNATYERLPMEEEEDGGGSRQIHGGGDSPPRIGSNLPDLSGMAG-----  250

Query  541  PGVYNLPPNMVAS------NEAFAWAHGRPPY  618
            PG YN+PP+++ +      +E + W H RPPY
Sbjct  251  PG-YNMPPHLIPNGAGQLGHEPYTWVHARPPY  281



>ref|XP_010440458.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=283

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 155/212 (73%), Gaps = 10/212 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPK PIFVTRDSPNALRSHVLE++ G+DVA++IA F+RRRQRGVCV+S +G+V NVT
Sbjct  76   SKNKPKAPIFVTRDSPNALRSHVLEISDGSDVADTIAHFSRRRQRGVCVLSGTGSVANVT  135

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQ +APG V++L GRFEILSLTGAFLPGPSPPGSTGLT+YLAG QGQVVGGSVVG L+A
Sbjct  136  LRQAAAPGGVVSLQGRFEILSLTGAFLPGPSPPGSTGLTVYLAGVQGQVVGGSVVGPLLA  195

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
             G VMVI +TFSNATYERLP+E +E+   +                +       G     
Sbjct  196  IGSVMVIAATFSNATYERLPMEEEEDGGGSRPIHGGGDSPPGIGNSLPDPSVMAGSG---  252

Query  541  PGVYNLPPNMVAS------NEAFAWAHGRPPY  618
            PG YN+PP+++ +      +E + W H RPPY
Sbjct  253  PG-YNMPPHLIPNGAGQLGHEPYTWVHARPPY  283



>emb|CBI34813.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 154/210 (73%), Gaps = 11/210 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ES+A FARRRQRGVC+MS +GTVTNVT
Sbjct  38   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  97

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL+G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG L+A
Sbjct  98   LRQPASPGAIVTLHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGQLLA  157

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPLE ++             GG    P    A          
Sbjct  158  SGPVVIMAASFSNAAYERLPLEEEDPALPMPGGSLGSPGGQPQQPQQLLADPNA------  211

Query  541  PGVYNLPPNMVAS----NEAFAWAHGRPPY  618
            P  + LPPN++ S     EA+ WA GRPPY
Sbjct  212  PLFHGLPPNLLNSIQLPAEAY-WATGRPPY  240



>ref|XP_003590930.1| DNA-binding protein [Medicago truncatula]
 gb|AES61181.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=305

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIF+TRDSPNALRSHV+EVA+G D+++SI QFAR+RQRG+C++SASGTV NV+
Sbjct  83   SKNKPKPPIFITRDSPNALRSHVMEVATGTDISDSIVQFARKRQRGICILSASGTVVNVS  142

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+ PGAV+AL GRF+ILSLTG+ LPGPSPPG+TGLTIYL+GGQGQVVGG VVG LVA
Sbjct  143  LRQPTGPGAVVALPGRFDILSLTGSVLPGPSPPGATGLTIYLSGGQGQVVGGGVVGPLVA  202

Query  361  agPVMVIGSTFSNATYER  414
            AGPVM++ +TFSNATYER
Sbjct  203  AGPVMLMAATFSNATYER  220



>gb|AFK41919.1| unknown [Medicago truncatula]
Length=305

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIF+TRDSPNALRSHV+EVA+G D+++SI QFAR+RQRG+C++SASGTV NV+
Sbjct  83   SKNKPKPPIFITRDSPNALRSHVMEVATGTDISDSIVQFARKRQRGICILSASGTVVNVS  142

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+ PGAV+AL GRF+ILSLTG+ LPGPSPPG+TGLTIYL+GGQGQVVGG VVG LVA
Sbjct  143  LRQPTGPGAVVALPGRFDILSLTGSVLPGPSPPGATGLTIYLSGGQGQVVGGGVVGPLVA  202

Query  361  agPVMVIGSTFSNATYER  414
            AGPVM++ +TFSNATYER
Sbjct  203  AGPVMLMAATFSNATYER  220



>ref|XP_010450033.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=283

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 154/212 (73%), Gaps = 10/212 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPK PIFVTRDSPNALRSHVLE++ G+DVA++IA F+RRRQRGVCV+S +G+V NVT
Sbjct  76   SKNKPKAPIFVTRDSPNALRSHVLEISDGSDVADTIAHFSRRRQRGVCVLSGTGSVANVT  135

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQ S PG V++L GRFEILSLTGAFLPGPSPPGSTGLT+YLAG QGQVVGGSVVG L+A
Sbjct  136  LRQASTPGGVVSLQGRFEILSLTGAFLPGPSPPGSTGLTVYLAGVQGQVVGGSVVGPLLA  195

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
             G VMVI +TFSNATYERLP+E +E+   +                +       G     
Sbjct  196  IGSVMVIAATFSNATYERLPMEEEEDGGGSRPIHGGGDSPPGIGNSLPDPSVMAGSG---  252

Query  541  PGVYNLPPNMVAS------NEAFAWAHGRPPY  618
            PG YN+PP+++ +      +E + W H RPPY
Sbjct  253  PG-YNMPPHLIPNGAGQLGHEPYTWVHARPPY  283



>ref|XP_009386251.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 156/214 (73%), Gaps = 10/214 (5%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPPIFVTRDSP+ALRSHV+EV+ GADVA+SIAQFARRRQR VCV+S SGTV NV L
Sbjct  105  KNKPKPPIFVTRDSPSALRSHVMEVSGGADVADSIAQFARRRQRAVCVLSGSGTVVNVAL  164

Query  184  RQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgl--tIYlaggqgqvvggsvvgslv  357
            RQP+APGA +AL GRFEILS+TG FLPGP P        T+YLAGGQGQVVGGSVVG L+
Sbjct  165  RQPAAPGAAVALRGRFEILSVTGTFLPGPGPSPPGSTGLTVYLAGGQGQVVGGSVVGPLI  224

Query  358  aagPVMVIGSTFSNATYERlplepdeee--aaaataepqlggggspppgmasagagmgdp  531
            AAGPVMV+ STF+NATYERLPL  +EEE   +   A  QL GG            G+ D 
Sbjct  225  AAGPVMVMASTFANATYERLPLVQEEEEGPDSGGGATGQLPGGEPQLMAGGGGSGGLPDH  284

Query  532  spMPGVYNLPPNMVAS-----NEAFAWAHGRPPY  618
            S +P + NLPPN+  +     +E F WAH R P+
Sbjct  285  SALP-ILNLPPNLAPNVAHVGHEPFGWAHARAPF  317



>gb|KDO42746.1| hypothetical protein CISIN_1g040245mg, partial [Citrus sinensis]
Length=271

 Score =   161 bits (408),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 145/215 (67%), Gaps = 28/215 (13%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN+LRSHV+EVA GADVAES+A FARRRQRGVCV+S SG+V NVT
Sbjct  75   SKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVALFARRRQRGVCVLSGSGSVANVT  134

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ALHG   +                   T+YLAGGQGQVVGGSVVG LVA
Sbjct  135  LRQPAAPGAVVALHGSTGL-------------------TVYLAGGQGQVVGGSVVGQLVA  175

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaata-epqlggggspppgmasagagmgdpsp  537
            AGPVMVI +TF+NATYERLPLE DEE        +       +         +G    + 
Sbjct  176  AGPVMVIAATFANATYERLPLEDDEEVTGTQGQIQSTGAATNNNNSPPQIGSSGQPPSAG  235

Query  538  MPG----VYNLPPNMVAS----NEAFAWAHGRPPY  618
            +P      YNLPPN++ +    +EA+AWAH RPPY
Sbjct  236  LPDPSSLTYNLPPNLIPNGGQLHEAYAWAHARPPY  270



>ref|XP_009589526.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=379

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 167/217 (77%), Gaps = 12/217 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPN+LRSHV+EVA G DVA+SIAQFARRRQRGVCV+S +G+V NVT
Sbjct  164  SKNKPKPPIFVTRDSPNSLRSHVMEVAGGTDVADSIAQFARRRQRGVCVLSGNGSVANVT  223

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQ SAPGAV+ L GRFEILSLTGAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVG LVA
Sbjct  224  LRQSSAPGAVV-LQGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGPLVA  282

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            AGPVM+I +TFSNATYE+LPLE +E+     + + Q+  G SPP   +S          +
Sbjct  283  AGPVMIIAATFSNATYEKLPLEEEEDGGGDGSGQSQVPAGNSPPALGSSGERQPQQQHEL  342

Query  541  PG-----VYNLPPNMVA-----SNEAFA-WAHGRPPY  618
            P      +YN  PN++      +++A+A WA  RPPY
Sbjct  343  PDPTSLPIYNFTPNLLPNGGQLNHDAYANWATPRPPY  379



>ref|XP_010527388.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=265

 Score =   161 bits (407),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNALRS+V+E+  G+DVA+ IA F+RRRQRGVCV+S +G+V NVT
Sbjct  69   SKNKPKPPIFVTRDSPNALRSNVMEITGGSDVADVIANFSRRRQRGVCVLSGTGSVANVT  128

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APG V+ALHGRF+ILSLTGAFLPGP+PPGSTGLT+YLAGGQGQVVGGSVVG LVA
Sbjct  129  LRQPTAPGGVVALHGRFDILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGPLVA  188

Query  361  agPVMVIGSTFSNATYER  414
            AG VMVI +TFSNATYER
Sbjct  189  AGSVMVIAATFSNATYER  206



>ref|XP_002281296.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=302

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 152/213 (71%), Gaps = 8/213 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ES+A FARRRQRGVC+MS +GTVTNVT
Sbjct  91   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  150

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL+G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG L+A
Sbjct  151  LRQPASPGAIVTLHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGQLLA  210

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPLE ++             GG                    
Sbjct  211  SGPVVIMAASFSNAAYERLPLEEEDPALPMPGGSLGSPGGVGQHQPPQQQPQQPQQLLAD  270

Query  541  PGV---YNLPPNMVAS----NEAFAWAHGRPPY  618
            P     + LPPN++ S     EA+ WA GRPPY
Sbjct  271  PNAPLFHGLPPNLLNSIQLPAEAY-WATGRPPY  302



>ref|XP_010277406.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=282

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 155/208 (75%), Gaps = 3/208 (1%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TR+S N+LR+HV+E+A+G DV ES+A FARRRQRGVC++S SGTVTNVT
Sbjct  76   SKNKPKPPIIITRESANSLRAHVMEIANGCDVGESVATFARRRQRGVCILSGSGTVTNVT  135

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGA++ LHGRFEILSL+G+FLP P+PP +TGLTIYL+GGQGQVVGGSVVG+LVA
Sbjct  136  LRQPAAPGAIVTLHGRFEILSLSGSFLPPPAPPAATGLTIYLSGGQGQVVGGSVVGALVA  195

Query  361  agPVMVIGSTFSNATYERlplepdeeea--aaataepqlggggspppgmasagagmgdps  534
            +GPV+++ ++FSNA YERLPLE ++      +       G  G            +    
Sbjct  196  SGPVVIMAASFSNAAYERLPLEDEDPSLPIQSGGPLGSPGMVGQQQNQPQQQQQQLLPDP  255

Query  535  pMPGVYNLPPNMVASNEAFAWAHGRPPY  618
              P  + LPPN++A  EAF WA  RPP+
Sbjct  256  NNPLFHGLPPNLLAPAEAF-WATARPPF  282



>ref|XP_006851806.1| hypothetical protein AMTR_s00041p00022450 [Amborella trichopoda]
 gb|ERN13273.1| hypothetical protein AMTR_s00041p00022450 [Amborella trichopoda]
Length=303

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 151/210 (72%), Gaps = 4/210 (2%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKP+PPI +TRDS NALRSHV+EVASG D+ ES+A +ARRRQRGVC++S SGTVTNVT
Sbjct  94   SKNKPRPPIIITRDSANALRSHVMEVASGCDIVESVANYARRRQRGVCILSGSGTVTNVT  153

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGA++ LHGRFEILSL+G+FLP P PP +TGLTIYLAGGQGQVVGG+VVG+L+A
Sbjct  154  LRQPAAPGAIVTLHGRFEILSLSGSFLPPPGPPAATGLTIYLAGGQGQVVGGTVVGALLA  213

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++F NA +ERLPL+ DE            G   SP          M      
Sbjct  214  SGPVIIMAASFGNAAFERLPLDEDEAVLQFPGGGGMGGSQSSPEAQSQPQQQQMLGDPNG  273

Query  541  PGVYNLPPNMVASN----EAFAWAHGRPPY  618
               + L PN   S+    EA+ WA GRPPY
Sbjct  274  ALFHGLLPNFTNSSQLPPEAYGWAGGRPPY  303



>ref|XP_010108102.1| hypothetical protein L484_023188 [Morus notabilis]
 gb|EXC17834.1| hypothetical protein L484_023188 [Morus notabilis]
Length=302

 Score =   161 bits (408),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 155/215 (72%), Gaps = 10/215 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ES++ FARRRQRGVC+MS +GTVTNVT
Sbjct  89   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVSTFARRRQRGVCIMSGTGTVTNVT  148

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  149  LRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLIA  208

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+V+ ++FSNA YERLPLE D++            G  +         A     +  
Sbjct  209  SGPVVVMAASFSNAAYERLPLEEDDQTQLPLQGGGGGVGSPTGGQQQQIMAAAAAAEAAN  268

Query  541  PG-----VYNLPPNMVAS----NEAFAWAHGRPPY  618
             G      + LPPN++ S     EA+ WA GRPPY
Sbjct  269  SGGAPTLFHGLPPNLLNSIQMPAEAY-WASGRPPY  302



>emb|CDY23160.1| BnaA04g05990D [Brassica napus]
Length=279

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 158/212 (75%), Gaps = 10/212 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPK P+FVTRDSPNAL SHV+E++ G+DVA++IA F+RRRQRGVCV+S +G+V NVT
Sbjct  72   SKNKPKAPVFVTRDSPNALHSHVMEISDGSDVADTIAHFSRRRQRGVCVISGTGSVANVT  131

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQ +APG V++L GRFEILSLTGAFLPGP+PPGSTGLT+YLAG QGQV+GGSVVG LVA
Sbjct  132  LRQAAAPGGVVSLQGRFEILSLTGAFLPGPAPPGSTGLTVYLAGVQGQVLGGSVVGPLVA  191

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
             G VMVI +TFSNATYERLP+E +E+     + +   GG   P  G +            
Sbjct  192  IGSVMVIAATFSNATYERLPIEDEEDGGGGGSRQIHGGGDSPPGIGSSLPDPSGMAG---  248

Query  541  PGVYNLPPNMVAS------NEAFAWAHGRPPY  618
            PG YNLPP+++ +      +E F W H RPPY
Sbjct  249  PG-YNLPPHLIPNGAGQLGHEPFNWVHARPPY  279



>gb|AAM65129.1| putative DNA-binding protein [Arabidopsis thaliana]
Length=281

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 154/212 (73%), Gaps = 12/212 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPK PIFVTRDSPNALRSHVLE++ G+DVA++IA F+RRRQRGVCV+S +G+V NV 
Sbjct  76   SKNKPKAPIFVTRDSPNALRSHVLEISDGSDVADTIAHFSRRRQRGVCVLSGTGSVANVX  135

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQ +APG V++L GRFEILSLTGAFLPGPSPPGSTGLT+YLAG QGQVVGGSVVG L+A
Sbjct  136  LRQAAAPGGVVSLQGRFEILSLTGAFLPGPSPPGSTGLTVYLAGVQGQVVGGSVVGPLLA  195

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
             G VMVI +TFSNATYERLP+E +E+   +                +       G     
Sbjct  196  IGSVMVIAATFSNATYERLPMEEEEDGGGSRQIHGGGDSPPRIGSNLPDLSGMAG-----  250

Query  541  PGVYNLPPNMVAS------NEAFAWAHGRPPY  618
            PG YN+PP+++ +      +E + W H RPPY
Sbjct  251  PG-YNMPPHLIPNGAGQLGHEPYTWVHARPPY  281



>ref|XP_004298711.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=309

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 153/214 (71%), Gaps = 8/214 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ES+A FARRRQRGVC+MS +GTVTNVT
Sbjct  96   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  155

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+ PG+V+ LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  156  LRQPATPGSVVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLLA  215

Query  361  agPVMVIGSTFSNATYERlplepdeeea----aaataepqlggggspppgmasagagmgd  528
            +GPV+++ ++FSNA YERLPLE DE        +  +   +G                  
Sbjct  216  SGPVVIMAASFSNAAYERLPLEEDEGSMPMPGGSMGSPTAVGQQQHQQQQQQQQLLAEAA  275

Query  529  pspMPGVYNLPPNMVAS----NEAFAWAHGRPPY  618
             +  P  + LPPN++ S     EA  WA GRPP+
Sbjct  276  NTNAPLFHGLPPNLLNSMQLPAEAAYWATGRPPF  309



>ref|XP_002299584.2| DNA-binding family protein [Populus trichocarpa]
 gb|EEE84389.2| DNA-binding family protein [Populus trichocarpa]
Length=302

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 154/210 (73%), Gaps = 6/210 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+H++EVA G D+ ES+A FARRRQRGVC+MS +GTVTNVT
Sbjct  95   SKNKPKPPIIITRDSANALRTHLMEVADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  154

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG+L A
Sbjct  155  LRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLTA  214

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPLE ++ +           GG             M + +  
Sbjct  215  SGPVVIMAASFSNAAYERLPLEEEDPQMPMQGGGMGSPGGVGQQQQQPQQHQVMAEQNAQ  274

Query  541  PGVYNLPPNMVAS----NEAFAWAHGRPPY  618
               + LPPN++ S     EA+ WA GRPPY
Sbjct  275  L-FHGLPPNLLNSIQLPAEAY-WATGRPPY  302



>ref|XP_009139507.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Brassica 
rapa]
 ref|XP_009139508.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Brassica 
rapa]
Length=279

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 158/212 (75%), Gaps = 10/212 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPK P+FVTRDSPNAL SHV+E++ G+DVA++IA F+RRRQRGVCV+S +G+V NVT
Sbjct  72   SKNKPKAPVFVTRDSPNALHSHVMEISDGSDVADTIAHFSRRRQRGVCVISGTGSVANVT  131

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQ +APG V++L GRFEILSLTGAFLPGP+PPGSTGLT+YLAG QGQV+GGSVVG LVA
Sbjct  132  LRQAAAPGGVVSLQGRFEILSLTGAFLPGPAPPGSTGLTVYLAGVQGQVLGGSVVGPLVA  191

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
             G VMVI +TFSNATYERLP+E +E+     + +   GG   P  G +            
Sbjct  192  IGSVMVIAATFSNATYERLPIEDEEDGGGGGSRQIHGGGDSPPGIGSSLPDPSGMAG---  248

Query  541  PGVYNLPPNMVAS------NEAFAWAHGRPPY  618
            PG YNLPP+++ +      +E + W H RPPY
Sbjct  249  PG-YNLPPHLIPNGAGQLGHEPYNWVHARPPY  279



>gb|ABL63118.1| AT-hook DNA-binding protein [Catharanthus roseus]
Length=293

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ES+A FARRRQRGVC+MS SGTVTNVT
Sbjct  73   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMESVATFARRRQRGVCIMSGSGTVTNVT  132

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL G+FLP P+PP +T LTIYLAGGQGQVVGGSVVG+L+A
Sbjct  133  LRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPAATSLTIYLAGGQGQVVGGSVVGALLA  192

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  193  SGPVVIMAASFSNAAYER  210



>ref|XP_006414705.1| hypothetical protein EUTSA_v10025929mg [Eutrema salsugineum]
 gb|ESQ56158.1| hypothetical protein EUTSA_v10025929mg [Eutrema salsugineum]
Length=283

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 153/212 (72%), Gaps = 6/212 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPK PIFVTRDSPNALRSHV+E++ G+DVA++IA F+RRRQRGVCV+S +G+V NVT
Sbjct  72   SKNKPKAPIFVTRDSPNALRSHVMEISDGSDVADTIAHFSRRRQRGVCVLSGTGSVANVT  131

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQ +APG V++L GRFEILSLTGAFLPGP+PPGSTGLT+YLAG QGQVVGGSVVGSLVA
Sbjct  132  LRQAAAPGGVVSLQGRFEILSLTGAFLPGPAPPGSTGLTVYLAGVQGQVVGGSVVGSLVA  191

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
             G VMVI +TFSNATYERLP+E + +  +           G        A +        
Sbjct  192  IGSVMVIAATFSNATYERLPMEEENDGGSGGGDGGSRQIHGGGDSPPGIATSLPDPVGMA  251

Query  541  PGVYNLPPNMVAS------NEAFAWAHGRPPY  618
               YN+P +++ +      +E + W H RPPY
Sbjct  252  GPGYNIPQHLIPNGAGQLGHEPYTWVHARPPY  283



>ref|XP_002303540.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE78519.1| DNA-binding family protein [Populus trichocarpa]
Length=303

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 154/210 (73%), Gaps = 6/210 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+H++EVA G D+ ES+A FARRRQRGVC+MS +GTVTNVT
Sbjct  96   SKNKPKPPIIITRDSANALRTHLMEVADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  155

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG+L A
Sbjct  156  LRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLTA  215

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPLE ++ +      E    G              M + +  
Sbjct  216  SGPVVIMAASFSNAAYERLPLEEEDPQMPMQGGEMGSPGAVGQQQQQPQQQQVMAEQNAQ  275

Query  541  PGVYNLPPNMVAS----NEAFAWAHGRPPY  618
               + LPPN++ S     EA+ WA GRPPY
Sbjct  276  L-FHGLPPNLLNSIQLPAEAY-WATGRPPY  303



>gb|EYU40549.1| hypothetical protein MIMGU_mgv1a021038mg [Erythranthe guttata]
Length=310

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 156/217 (72%), Gaps = 12/217 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+EV+ G D+ +S+A FARRRQRGVCVMS +G VTNVT
Sbjct  95   SKNKPKPPIIITRDSANALRTHVMEVSDGCDIMDSVASFARRRQRGVCVMSGTGNVTNVT  154

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAVM LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQV+GGSVVG L+A
Sbjct  155  LRQPAAPGAVMTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVLGGSVVGQLLA  214

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPLE DE  A         G      P     G+G    +  
Sbjct  215  SGPVIIMAASFSNAAYERLPLEEDENAAINNNNNQVPGSSSLGSPPGGLGGSGQPPQNHQ  274

Query  541  ------PGVYN-LPPNMVAS----NEAFAWAHGRPPY  618
                  P ++  +PPN+  S    NEAF WA GRPP+
Sbjct  275  QQVLADPSLFQGMPPNLFNSIQMPNEAF-WATGRPPF  310



>ref|XP_011033866.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=303

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 154/210 (73%), Gaps = 6/210 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+H++EVA G D+ ES+A FARRRQRGVC+MS +GTVTNVT
Sbjct  96   SKNKPKPPIIITRDSANALRTHLMEVADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  155

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG+L A
Sbjct  156  LRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLTA  215

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPLE ++ +      E    G              M + +  
Sbjct  216  SGPVVIMAASFSNAAYERLPLEEEDPQMPMQGGEMGSPGAVGQQQQQPQQQQVMAEQNAQ  275

Query  541  PGVYNLPPNMVAS----NEAFAWAHGRPPY  618
               + LPPN++ S     EA+ WA GRPPY
Sbjct  276  L-FHGLPPNLLNSIQLPAEAY-WATGRPPY  303



>gb|EYU43510.1| hypothetical protein MIMGU_mgv1a017700mg [Erythranthe guttata]
Length=309

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 156/217 (72%), Gaps = 12/217 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+EV+ G D+ +S+A FARRRQRGVCVMS +G VTNVT
Sbjct  94   SKNKPKPPIIITRDSANALRTHVMEVSDGCDIMDSVASFARRRQRGVCVMSGTGNVTNVT  153

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAVM LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQV+GGSVVG L+A
Sbjct  154  LRQPAAPGAVMTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVLGGSVVGQLLA  213

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPLE DE  A         G      P     G+G    +  
Sbjct  214  SGPVIIMAASFSNAAYERLPLEEDENAAINNNNNQVPGSSSLGSPPGGLGGSGQPPQNHQ  273

Query  541  ------PGVYN-LPPNMVAS----NEAFAWAHGRPPY  618
                  P ++  +PPN+  S    NEAF WA GRPP+
Sbjct  274  QQVLADPSLFQGMPPNLFNSIQMPNEAF-WATGRPPF  309



>ref|XP_002301300.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE80573.1| DNA-binding family protein [Populus trichocarpa]
Length=298

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDSPNALRSHV+E+A+G D+ ES++ FARRRQRGVC++SA+GTVTNVT
Sbjct  89   SKNKPKPPIIITRDSPNALRSHVMEIATGCDIMESVSTFARRRQRGVCILSATGTVTNVT  148

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            L+QP++PGAV+ LHGRFEILSL+G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG L+A
Sbjct  149  LKQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLLA  208

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  209  SGPVVIMAASFGNAAYER  226



>ref|XP_010096609.1| hypothetical protein L484_025356 [Morus notabilis]
 gb|EXB65277.1| hypothetical protein L484_025356 [Morus notabilis]
Length=309

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPPI +T++SPNALRSHVLE++SG+D+ ESIA FA+RR RGV V+S SG VTNVTL
Sbjct  88   KNKPKPPIVITKESPNALRSHVLEISSGSDIVESIAAFAQRRHRGVSVLSGSGIVTNVTL  147

Query  184  RQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslvaa  363
            RQP+APG V+ LHGRFEILSL+GAFLP PSPPG+TGLT+YL+GGQGQVVGG+V G+LVA+
Sbjct  148  RQPAAPGGVLTLHGRFEILSLSGAFLPSPSPPGATGLTVYLSGGQGQVVGGAVAGALVAS  207

Query  364  gPVMVIGSTFSNATYER  414
            GPV+VIG+TF+NATYER
Sbjct  208  GPVIVIGATFTNATYER  224



>ref|XP_002870310.1| hypothetical protein ARALYDRAFT_493459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46569.1| hypothetical protein ARALYDRAFT_493459 [Arabidopsis lyrata subsp. 
lyrata]
Length=273

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPK PIFVTRDSPNALRSHVLE++ G+DVAE+IA F+RRRQRGVCV+S +G+V NVT
Sbjct  76   SKNKPKAPIFVTRDSPNALRSHVLEISDGSDVAETIAHFSRRRQRGVCVLSGTGSVANVT  135

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQ +APG V++L GRFEILSLTGAFLPGPSPPGSTGLT+YLAG QGQVVGGSVVG L+A
Sbjct  136  LRQAAAPGGVVSLQGRFEILSLTGAFLPGPSPPGSTGLTVYLAGVQGQVVGGSVVGPLLA  195

Query  361  agPVMVIGSTFSNATYER  414
             G VMVI +TFSNATYER
Sbjct  196  IGSVMVIAATFSNATYER  213



>ref|XP_011093194.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=297

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+EVA+G D+ ES++ FA RRQRGVC++S SGTVTNVT
Sbjct  94   SKNKPKPPIIITRDSANALRSHVMEVANGCDIQESVSNFATRRQRGVCILSGSGTVTNVT  153

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ LHGRFEILSL+G+FLP P+PP ++ LTIYLAG QGQVVGG+VVG L+A
Sbjct  154  LRQPAAPGAVLTLHGRFEILSLSGSFLPPPAPPAASSLTIYLAGAQGQVVGGTVVGPLLA  213

Query  361  agPVMVIGSTFSNATYER  414
            +GPVM++ ++F NA YER
Sbjct  214  SGPVMIMAASFGNAAYER  231



>ref|XP_009123977.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=314

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 129/146 (88%), Gaps = 8/146 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNAL+SHV+E+ASG DV E++A FARRRQRG+C++S +GTV NVT
Sbjct  91   SKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANVT  150

Query  181  LRQPSA------PG--AVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvgg  336
            LRQPSA      PG  AV+AL GRFEILSLTG+FLPGP+PPGSTGLTIYLA GQGQ+VGG
Sbjct  151  LRQPSAATVPVPPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLASGQGQIVGG  210

Query  337  svvgslvaagPVMVIGSTFSNATYER  414
            SVVG L+AAGPVM+I +TFSNATYER
Sbjct  211  SVVGPLMAAGPVMLIAATFSNATYER  236



>ref|XP_010940981.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=317

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 160/213 (75%), Gaps = 8/213 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+A G D+AES+A FARRRQRGVC++S SGTVTNVT
Sbjct  106  SKNKPKPPIIITRDSANALRSHVMEIAGGCDIAESVATFARRRQRGVCILSGSGTVTNVT  165

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHG FEILSL+G+FLP P+PP +TGLT+YLAGGQGQVVGGSVVG+L+A
Sbjct  166  LRQPASPGAVVTLHGCFEILSLSGSFLPPPAPPAATGLTVYLAGGQGQVVGGSVVGALIA  225

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPL  +E    +   E     G SPP         + DP+  
Sbjct  226  SGPVVIMAASFSNAAYERLPLGEEEPLPVSGALESPGVVGQSPPQQQQQQPQQLPDPNQP  285

Query  541  PGVYNLPPNMVASN-----EAFAWA--HGRPPY  618
               + LPPN+V +N     EA+ WA   GRPPY
Sbjct  286  L-FHGLPPNLVLNNVQLPAEAYGWATGGGRPPY  317



>gb|KFK22136.1| hypothetical protein AALP_AAs47043U000100 [Arabis alpina]
Length=285

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 163/212 (77%), Gaps = 8/212 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPK PIFVTRDSPNALRSHV+E++ G+DVA++IA F+RRRQRGVCV+S +GTV NVT
Sbjct  76   SKNKPKAPIFVTRDSPNALRSHVMEISDGSDVADTIAHFSRRRQRGVCVLSGTGTVANVT  135

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQ +APG V++L GRFEILSLTGAFLPGP+PPGSTGLT+YLAG QGQVVGGSVVG LVA
Sbjct  136  LRQAAAPGGVVSLQGRFEILSLTGAFLPGPAPPGSTGLTVYLAGVQGQVVGGSVVGPLVA  195

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
             G VMVI +TFSNATYERLP+E +E+      + P  GGG   PPG+  + A     +  
Sbjct  196  IGSVMVIAATFSNATYERLPMEEEEDGGGGDGSRPIHGGGDHSPPGIGGSLADPSVMAG-  254

Query  541  PGVYNLPPNMVAS------NEAFAWAHGRPPY  618
            PG YN+P +++ +      +E + W H RPPY
Sbjct  255  PG-YNIPQHLMPNGSGQLGHEPYTWVHARPPY  285



>ref|XP_008346594.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=310

 Score =   159 bits (402),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 152/219 (69%), Gaps = 13/219 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ES+A FARRRQRGVC+MS +GTVTNVT
Sbjct  92   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  151

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PG+++ LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG+L A
Sbjct  152  LRQPASPGSIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLTA  211

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPLE DE +           G  S                 +
Sbjct  212  SGPVVIMAASFSNAAYERLPLEEDEGQLPMQGGGGGSLGSPSGVGHQNQQQQQQQQQQQL  271

Query  541  ---------PGVYNLPPNMVAS----NEAFAWAHGRPPY  618
                     P  + LPPN++ S     EA  WA GRPP+
Sbjct  272  MAEAANSNPPLFHGLPPNLLNSMQLPAEAAYWATGRPPF  310



>ref|XP_008364289.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=308

 Score =   159 bits (402),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+A G D+ ES+A FARRRQRGVC+MS +GTVTNVT
Sbjct  92   SKNKPKPPIIITRDSANALRSHVMEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  151

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PG+V+ LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  152  LRQPASPGSVVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLIA  211

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  212  SGPVVIMAASFSNAAYER  229



>ref|XP_010053390.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW77667.1| hypothetical protein EUGRSUZ_D01968 [Eucalyptus grandis]
Length=303

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 152/214 (71%), Gaps = 9/214 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ES+A FARRRQRGVC+MS SGTVTNVT
Sbjct  91   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCIMSGSGTVTNVT  150

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  151  LRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLIA  210

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPLE D+             G G                   
Sbjct  211  SGPVVIMAASFSNAAYERLPLEEDDAGIQVQGGSMGSPGSGVGGQTPQQQQQPPPQLLGD  270

Query  541  PG----VYNLPPNMVAS----NEAFAWAHGRPPY  618
            P      + LPPN++ S    +EA+ W+  RPPY
Sbjct  271  PNNAGLFHGLPPNLLNSIQMPSEAY-WSGARPPY  303



>ref|XP_011029110.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=302

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 154/210 (73%), Gaps = 6/210 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+H++EVA G D+ ES+A FARRRQRGVC+MS +GTVTNVT
Sbjct  95   SKNKPKPPIIITRDSANALRTHLMEVADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  154

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG L A
Sbjct  155  LRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGPLTA  214

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPLE ++ +           GG             M +P+  
Sbjct  215  SGPVVIMAASFSNAAYERLPLEEEDPQMPMQGGGMGSPGGVGQQQQQPQQHQVMAEPNAQ  274

Query  541  PGVYNLPPNMVAS----NEAFAWAHGRPPY  618
               + LPPN++ S     EA+ WA GRPPY
Sbjct  275  -LFHGLPPNLLNSIQLPAEAY-WATGRPPY  302



>ref|XP_011014152.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=302

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 152/210 (72%), Gaps = 6/210 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+H++EVA G D+ ES+A FARRRQRGVC+MS +GTVTNVT
Sbjct  95   SKNKPKPPIIITRDSANALRTHLMEVADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  154

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG L A
Sbjct  155  LRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGPLTA  214

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPLE ++ +            G             M + +  
Sbjct  215  SGPVVIMAASFSNAAYERLPLEEEDPQMPMQGGGMGSPEGVGQQQQQPQQHQVMAEQNAQ  274

Query  541  PGVYNLPPNMVAS----NEAFAWAHGRPPY  618
               + LPPN++ S     EA+ WA GRPPY
Sbjct  275  L-FHGLPPNLLNSIQLPAEAY-WATGRPPY  302



>ref|XP_008373872.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=310

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 152/219 (69%), Gaps = 13/219 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ES+A FARRRQRGVC+MS +GTVTNVT
Sbjct  92   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  151

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PG+++ LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG+L A
Sbjct  152  LRQPASPGSIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLXA  211

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPLE DE +           G  S                 +
Sbjct  212  SGPVVIMAASFSNAAYERLPLEEDEGQLPMQGGGGGSLGSPSGVGHQNQQQQQQQQQQQL  271

Query  541  ---------PGVYNLPPNMVAS----NEAFAWAHGRPPY  618
                     P  + LPPN++ S     EA  WA GRPP+
Sbjct  272  MAEAANSNPPLFHGLPPNLLNSMQLPAEAAYWATGRPPF  310



>emb|CDY49327.1| BnaA05g32890D [Brassica napus]
Length=314

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 129/146 (88%), Gaps = 8/146 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNAL+SHV+E+ASG DV E++A FARRRQRG+C++S +GTV NVT
Sbjct  91   SKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANVT  150

Query  181  LRQPSA---PG-----AVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvgg  336
            LRQPSA   PG     AV+AL GRFEILSLTG+FLPGP+PPGSTGLTIYLA GQGQ+VGG
Sbjct  151  LRQPSAATVPGPPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLASGQGQIVGG  210

Query  337  svvgslvaagPVMVIGSTFSNATYER  414
            SVVG L+AAGPVM+I +TFSNATYER
Sbjct  211  SVVGPLMAAGPVMLIAATFSNATYER  236



>ref|XP_008238673.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=309

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 152/220 (69%), Gaps = 14/220 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ES+A FARRRQRGVC+MS +GTVTNVT
Sbjct  90   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  149

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            +RQP++PG+++ LHGRFEILSL G+FLP P+PP +TGLTIYLAGG GQVVGGSVVG+L+A
Sbjct  150  IRQPASPGSIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGGGQVVGGSVVGTLIA  209

Query  361  agPVMVIGSTFSNATYERlplepdeee----------aaaataepqlggggspppgmasa  510
            +GPV+++ ++FSNA YERLPLE DE +            + +                  
Sbjct  210  SGPVVIMAASFSNAAYERLPLEEDEGQLPMQGGGGGSLGSPSGVGHQQQQQHQQQQQQQQ  269

Query  511  gagmgdpspMPGVYNLPPNMVAS----NEAFAWAHGRPPY  618
                   +  P  + LPPN++ S     EA  WA GRPPY
Sbjct  270  LLAEAANTNAPLFHGLPPNLLNSMQLPAEAAYWATGRPPY  309



>ref|XP_006601994.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=302

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 155/210 (74%), Gaps = 6/210 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +T++SPNALRSHVLE+ASG+DVAESIA FA RR RGV V+S SG V NVT
Sbjct  91   SKNKPKPPIVITKESPNALRSHVLEIASGSDVAESIAAFANRRHRGVSVLSGSGIVANVT  150

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+AP  V+ LHGRFEILSL+GAFLP PSP G+TGLT+YLAGGQGQVVGG+V GSLVA
Sbjct  151  LRQPAAPAGVITLHGRFEILSLSGAFLPSPSPSGATGLTVYLAGGQGQVVGGNVAGSLVA  210

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPVMVI +TF+NATYERLPLE D+ E      + Q                G+G+   M
Sbjct  211  SGPVMVIAATFANATYERLPLEDDQGEEEMQVQQQQQQQQQQQQQQQQQQSQGLGEQVSM  270

Query  541  PGVYNLPPNMVAS-----NEAFAWAHGRPP  615
            P +YNLPPN++ +     ++ F  A  RPP
Sbjct  271  P-MYNLPPNLLHNGQNMPHDVFWGAPPRPP  299



>ref|XP_007163438.1| hypothetical protein PHAVU_001G234600g [Phaseolus vulgaris]
 gb|ESW35432.1| hypothetical protein PHAVU_001G234600g [Phaseolus vulgaris]
Length=287

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPPI +T++SPNALRSHVLE+ASG+DVAESIA FA RR RGV V+S SG VTNVTL
Sbjct  83   KNKPKPPIVITKESPNALRSHVLEIASGSDVAESIAAFANRRHRGVSVLSGSGIVTNVTL  142

Query  184  RQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslvaa  363
            RQP+AP  V+ LHGRFEILSL+GAFLP PSPPG+TGL++YLAGGQGQVVGG+V GSLVA+
Sbjct  143  RQPAAPTGVITLHGRFEILSLSGAFLPSPSPPGATGLSVYLAGGQGQVVGGTVAGSLVAS  202

Query  364  gPVMVIGSTFSNATYER  414
            GPVMVI +TF+NATYER
Sbjct  203  GPVMVIAATFANATYER  219



>ref|XP_004511639.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Cicer arietinum]
Length=241

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NAL++HV+EVA G D+ ES+  FARRRQRGVC+MS +GTVTNVT
Sbjct  28   SKNKPKPPIIITRDSANALKTHVMEVADGCDIVESVNNFARRRQRGVCIMSGTGTVTNVT  87

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  88   LRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALIA  147

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  148  SGPVVIMSASFSNAAYER  165



>ref|XP_004503162.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=308

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +T++SPNALRSHVLE+ SG+DVAESIA FA RR RGV V+S SG V NVT
Sbjct  82   SKNKPKPPIVITKESPNALRSHVLEIISGSDVAESIAAFANRRHRGVSVLSGSGIVANVT  141

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APG V+ LHGRFEILSL+GAFLP PSPPG+TGLT+YLAGGQGQVVGGSV GSL+A
Sbjct  142  LRQPAAPGGVITLHGRFEILSLSGAFLPSPSPPGATGLTVYLAGGQGQVVGGSVAGSLIA  201

Query  361  agPVMVIGSTFSNATYER  414
            +GPVMVI +TF+NATYER
Sbjct  202  SGPVMVIAATFANATYER  219



>emb|CDY64701.1| BnaCnng44570D [Brassica napus]
Length=311

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 130/146 (89%), Gaps = 8/146 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNAL+SHV+E+ASG DV E++A FARRRQRG+C++S +GTV NVT
Sbjct  88   SKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANVT  147

Query  181  LRQPSA---PG-----AVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvgg  336
            LRQPSA   PG     AV+AL GRFEILSLTG+FLPGP+PPGSTGLTIYLAGGQGQ+VGG
Sbjct  148  LRQPSAATVPGPPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLAGGQGQIVGG  207

Query  337  svvgslvaagPVMVIGSTFSNATYER  414
            SVVG L+AAGPVM+I +TFSNATYER
Sbjct  208  SVVGPLMAAGPVMLIAATFSNATYER  233



>gb|KEH34733.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=313

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPPI +T++SPNALRSHVLE++SG+DVAESIA FA RR RGV V+S SG V NVTL
Sbjct  89   KNKPKPPIVITKESPNALRSHVLEISSGSDVAESIATFANRRHRGVSVLSGSGIVANVTL  148

Query  184  RQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslvaa  363
            RQP+APG V+ LHGRFEILSL+GAFLP PSP G+TGLT+YLAGGQGQVVGGSV G LVA+
Sbjct  149  RQPAAPGGVITLHGRFEILSLSGAFLPPPSPAGATGLTVYLAGGQGQVVGGSVAGPLVAS  208

Query  364  gPVMVIGSTFSNATYER  414
            GPVMVI +TF+NATYER
Sbjct  209  GPVMVIAATFANATYER  225



>ref|XP_004495563.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=303

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIF+TRDSPNALRSHV+EV++G+D+++ I QFAR+RQRG+C++SA+GTV NV+
Sbjct  87   SKNKPKPPIFITRDSPNALRSHVMEVSTGSDISDCILQFARKRQRGICILSATGTVLNVS  146

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+ PGAV+ L GRF+ILSLTG+ LPGPSPPG+TGLTIYL+GGQGQVVGG VVGSLVA
Sbjct  147  LRQPTTPGAVVVLSGRFDILSLTGSVLPGPSPPGATGLTIYLSGGQGQVVGGGVVGSLVA  206

Query  361  agPVMVIGSTFSNATYER  414
            AGPVM++ +TFSNATYER
Sbjct  207  AGPVMLMAATFSNATYER  224



>ref|XP_006477312.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|KDO63720.1| hypothetical protein CISIN_1g021751mg [Citrus sinensis]
Length=308

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ES+A FARRRQRGVC++S +GTVTNVT
Sbjct  93   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCILSGTGTVTNVT  152

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA+++LHGRFEILSL+G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+L+ 
Sbjct  153  LRQPASPGAIVSLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLMT  212

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  213  SGPVVIMAASFSNAAYER  230



>ref|XP_011070911.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=255

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E++ G D+ + +A FARRRQRGVC+MS +G+VTNVT
Sbjct  83   SKNKPKPPIIITRDSANALRTHVMEISDGCDIMDGVANFARRRQRGVCIMSGTGSVTNVT  142

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQV+GGSVVG L+A
Sbjct  143  LRQPAAPGAVVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVLGGSVVGQLLA  202

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  203  SGPVIIMAASFSNAAYER  220



>ref|XP_006440441.1| hypothetical protein CICLE_v10021296mg [Citrus clementina]
 gb|ESR53681.1| hypothetical protein CICLE_v10021296mg [Citrus clementina]
Length=308

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ES+A FARRRQRGVC++S +GTVTNVT
Sbjct  93   SKNKPKPPIIITRDSANALRTHVMEIADGCDIVESVATFARRRQRGVCILSGTGTVTNVT  152

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA+++LHGRFEILSL+G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+L+ 
Sbjct  153  LRQPASPGAIVSLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLMT  212

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  213  SGPVVIMAASFSNAAYER  230



>ref|XP_007040019.1| AT-hook DNA-binding family protein [Theobroma cacao]
 gb|EOY24520.1| AT-hook DNA-binding family protein [Theobroma cacao]
Length=302

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 152/210 (72%), Gaps = 7/210 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+  G D+ ES+A FARRRQRGVC+MS +GTVTNVT
Sbjct  96   SKNKPKPPIIITRDSANALRTHVMEIGDGCDIVESVATFARRRQRGVCIMSGTGTVTNVT  155

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++ GA++ LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG+L+ 
Sbjct  156  LRQPASAGAIVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLIC  215

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPLE +E+      A    G  G                +  
Sbjct  216  SGPVVIMAASFSNAAYERLPLEEEEQLPMQGGAIGSPGAIGGQQQQQQQQQVLAESNA--  273

Query  541  PGVYNLPPNMVAS----NEAFAWAHGRPPY  618
            P  + LPPN++ S     EAF WA GRPP+
Sbjct  274  PLFHGLPPNLLNSIQLPTEAF-WATGRPPF  302



>ref|XP_006285829.1| hypothetical protein CARUB_v10007306mg [Capsella rubella]
 gb|EOA18727.1| hypothetical protein CARUB_v10007306mg [Capsella rubella]
Length=284

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 152/212 (72%), Gaps = 9/212 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPK PIFVTRDSPNALRSHVLE++ G+DVAE+IA F+RRRQRGVCV+S +G+V NVT
Sbjct  76   SKNKPKAPIFVTRDSPNALRSHVLEISDGSDVAETIAHFSRRRQRGVCVLSGTGSVANVT  135

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQ +A G V++L GRFEILSLTGAFLPGPSPPGSTGLT+YLAG QGQVVGGSVVG L+A
Sbjct  136  LRQAAAAGGVVSLQGRFEILSLTGAFLPGPSPPGSTGLTVYLAGVQGQVVGGSVVGPLLA  195

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
             G VMVI +TFSNATYERLP+E +E+   +   +            +       G     
Sbjct  196  IGSVMVIAATFSNATYERLPMEEEEDGGGSRQVQGGGDSPPGIGSSLPDPPGMAGTG---  252

Query  541  PGVYNLPPNMVAS------NEAFAWAHGRPPY  618
            PG    PP+++ +      +E + W H RPPY
Sbjct  253  PGYNMAPPHLIPNGAGQLGHEPYTWVHARPPY  284



>ref|XP_008804006.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=314

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 156/212 (74%), Gaps = 7/212 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +T+DS NALRSHV+E+A+G D+AE++A FARRRQRGVC++S SGTVTNVT
Sbjct  104  SKNKPKPPIIITKDSANALRSHVMEIAAGCDIAETVATFARRRQRGVCILSGSGTVTNVT  163

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHG FEILSL+G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  164  LRQPASPGAVVTLHGCFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALIA  223

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YER     +EE           G  G  PP +             
Sbjct  224  SGPVVIMAASFSNAAYER-LPLDEEEPVPVPGPLDSPGLVGDSPPPLQQQQPQQLLDPNT  282

Query  541  PGVYNLPPNMVAS----NEAFAWA--HGRPPY  618
            P ++ LPPN++ +     EA++WA   GRPPY
Sbjct  283  PLLHGLPPNLLNNIQLPAEAYSWATGGGRPPY  314



>ref|XP_010053890.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW78264.1| hypothetical protein EUGRSUZ_D02447 [Eucalyptus grandis]
Length=304

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDSPNALRSHV+EVASGAD+ ES++ FARRRQRGVC++S SGTVTNV 
Sbjct  96   SKNKPKPPIIITRDSPNALRSHVVEVASGADIVESMSTFARRRQRGVCILSGSGTVTNVA  155

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL+G+ LP P+PP  +GLT+YLAGGQGQVVGG+V G L+A
Sbjct  156  LRQPASPGAVVTLHGRFEILSLSGSILPPPAPPALSGLTVYLAGGQGQVVGGNVAGPLMA  215

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  216  SGPVVIMAASFGNAAYER  233



>emb|CDP00129.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPPI +T++SPNALRSHVLE++SG DVAE IA FA+RR RGV V+S SG VTNVTL
Sbjct  132  KNKPKPPIVITKESPNALRSHVLEISSGNDVAECIAAFAQRRHRGVSVLSGSGIVTNVTL  191

Query  184  RQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslvaa  363
            RQP+APG V+ LHGRFEILSL+GAFLP PSPPG+TGLT+YLAGGQGQVVGG+VVG L+A+
Sbjct  192  RQPAAPGGVITLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGTVVGPLMAS  251

Query  364  gPVMVIGSTFSNATYER  414
            GPVMVI +TF+NATYER
Sbjct  252  GPVMVIAATFTNATYER  268



>ref|XP_003516470.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=288

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+A+G D+ ESI  FARRRQRGVCV+S SGTVTNVT
Sbjct  76   SKNKPKPPIIITRDSANALRSHVMEIANGCDIMESITAFARRRQRGVCVLSGSGTVTNVT  135

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL+G+FLP P+PP ++GL IYLAGGQGQVVGGSVVG LVA
Sbjct  136  LRQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLAIYLAGGQGQVVGGSVVGPLVA  195

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  196  SGPVVIMAASFGNAAYER  213



>ref|XP_010552065.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=368

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPP+ VTRDSPNALRSHV+E++ G+D+A+ IA F+RRRQRGVCV+S +G+V+N+T
Sbjct  158  SKNKPKPPVIVTRDSPNALRSHVMEISGGSDIADVIADFSRRRQRGVCVLSGTGSVSNIT  217

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APG V+ALHGRF+ILSLTGAFLPGP+PPGSTGLT+YLAG QGQVVGGSVVG LVA
Sbjct  218  LRQPAAPGGVVALHGRFDILSLTGAFLPGPAPPGSTGLTVYLAGVQGQVVGGSVVGQLVA  277

Query  361  agPVMVIGSTFSNATYER  414
            AG VM++ +TFSNATYE+
Sbjct  278  AGSVMIVAATFSNATYEK  295



>ref|XP_010691133.1| PREDICTED: putative DNA-binding protein ESCAROLA [Beta vulgaris 
subsp. vulgaris]
Length=351

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPPI +T++SPNALRSHVLEV SGAD+A+S+A FA+RR RGV V+S SG VTNVTL
Sbjct  107  KNKPKPPIVITKESPNALRSHVLEVTSGADIADSLATFAQRRHRGVSVLSGSGIVTNVTL  166

Query  184  RQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslvaa  363
            RQP+APG V+ LHGRFEILSL+GAFLP PSPPG+TGLT+YLAGGQGQVVGGSVVG L+A+
Sbjct  167  RQPAAPGGVVTLHGRFEILSLSGAFLPSPSPPGATGLTVYLAGGQGQVVGGSVVGPLIAS  226

Query  364  gPVMVIGSTFSNATYER  414
            GPV+VI +TFSNATYER
Sbjct  227  GPVLVIAATFSNATYER  243



>ref|XP_007052032.1| AT-hook motif nuclear-localized protein 22 [Theobroma cacao]
 gb|EOX96189.1| AT-hook motif nuclear-localized protein 22 [Theobroma cacao]
Length=326

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+A+G D+ ESI+ FARRRQRGVC++S SGTVTNVT
Sbjct  113  SKNKPKPPIIITRDSANALRSHVMEIANGCDIMESISTFARRRQRGVCILSGSGTVTNVT  172

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP APGAV+ LHGRFEILSL+G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG LVA
Sbjct  173  LRQPGAPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLVA  232

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  233  SGPVVIMAASFGNAAYER  250



>emb|CAN75757.1| hypothetical protein VITISV_028561 [Vitis vinifera]
Length=293

 Score =   156 bits (395),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +T++SPNALRSHVLE++SG+D+AESIA FA+RR RGV V+SASG V NVT
Sbjct  85   SKNKPKPPIVITKESPNALRSHVLEISSGSDIAESIANFAQRRHRGVSVLSASGIVNNVT  144

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APG V+ L GRFEILSL+GAFLP PSPPG+TGLT+YLAGGQGQVVGGSVVG+L+A
Sbjct  145  LRQPAAPGGVITLQGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGSVVGALMA  204

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+VI +TFSNAT+ER
Sbjct  205  SGPVIVIAATFSNATFER  222



>ref|XP_008777391.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=317

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 125/139 (90%), Gaps = 1/139 (1%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TR+SPNALRSHVLE+ASG D+ ++IA FARRRQRGV ++S SG VT+VT
Sbjct  90   SKNKPKPPIIITRESPNALRSHVLEIASGTDIMDAIAVFARRRQRGVSILSGSGVVTDVT  149

Query  181  LRQPSA-PGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslv  357
            LRQP+A PGAV+ LHGRFEILSL+GAFLP PSPPG+TGLT+YLAGGQGQV GG VVG LV
Sbjct  150  LRQPAAPPGAVVTLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVAGGKVVGELV  209

Query  358  aagPVMVIGSTFSNATYER  414
            A+GPVMVI +TF+NATYER
Sbjct  210  ASGPVMVIAATFTNATYER  228



>emb|CBI31637.3| unnamed protein product [Vitis vinifera]
Length=300

 Score =   156 bits (395),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +T++SPNALRSHVLE++SG+D+AESIA FA+RR RGV V+SASG V NVT
Sbjct  92   SKNKPKPPIVITKESPNALRSHVLEISSGSDIAESIANFAQRRHRGVSVLSASGIVNNVT  151

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APG V+ L GRFEILSL+GAFLP PSPPG+TGLT+YLAGGQGQVVGGSVVG+L+A
Sbjct  152  LRQPAAPGGVITLQGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGSVVGALMA  211

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+VI +TFSNAT+ER
Sbjct  212  SGPVIVIAATFSNATFER  229



>ref|XP_003611214.1| AT-hook DNA-binding protein [Medicago truncatula]
 gb|AES94172.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=325

 Score =   157 bits (396),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NAL++HV+EVA G DV ES+  FARRRQRGVC+MS +GTVTNVT
Sbjct  109  SKNKPKPPIIITRDSANALKTHVMEVADGCDVVESVNNFARRRQRGVCIMSGTGTVTNVT  168

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  169  LRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALIA  228

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  229  SGPVVIMSASFSNAAYER  246



>ref|XP_004511638.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Cicer arietinum]
Length=312

 Score =   156 bits (395),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NAL++HV+EVA G D+ ES+  FARRRQRGVC+MS +GTVTNVT
Sbjct  99   SKNKPKPPIIITRDSANALKTHVMEVADGCDIVESVNNFARRRQRGVCIMSGTGTVTNVT  158

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  159  LRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALIA  218

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  219  SGPVVIMSASFSNAAYER  236



>ref|XP_011034536.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=300

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+ASG D+ ES++ FARRRQRGVC++S +GTVTNVT
Sbjct  88   SKNKPKPPIIITRDSANALRSHVMEIASGCDIMESVSTFARRRQRGVCILSGTGTVTNVT  147

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            L+QP++PGAV+ LHGRFEILSL+G+FLP P+PP ++GLT+YLAGGQGQV+GGSV G L+A
Sbjct  148  LKQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTVYLAGGQGQVIGGSVAGPLLA  207

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+V+ ++F NA YER
Sbjct  208  SGPVVVMAASFGNAAYER  225



>ref|XP_011090893.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=307

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+EVA+G D+ ESI+ FA RRQRGVC++S +GTVTNVT
Sbjct  100  SKNKPKPPIIITRDSANALRSHVMEVANGCDIQESISTFATRRQRGVCILSGNGTVTNVT  159

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ LHGRFEILSL+G+FLP P+PP ++ LTIYLAGGQGQV+GG+VVG L+A
Sbjct  160  LRQPAAPGAVVTLHGRFEILSLSGSFLPPPAPPAASALTIYLAGGQGQVMGGTVVGPLLA  219

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  220  SGPVVIMAASFGNAAYER  237



>dbj|BAJ94293.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=322

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 124/139 (89%), Gaps = 1/139 (1%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TR+SPN LRSHVLE+ASGAD+ E++A FARRRQRGV V+S SG V NVT
Sbjct  102  SKNKPKPPIIITRESPNTLRSHVLEIASGADIMEAVATFARRRQRGVSVLSGSGVVGNVT  161

Query  181  LRQPSA-PGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslv  357
            LRQP+A PG+V+ LHGRFEILSL+GAFLP P PPG+TGL +YLAGGQGQVVGG+V+G LV
Sbjct  162  LRQPAAPPGSVVTLHGRFEILSLSGAFLPSPCPPGATGLAVYLAGGQGQVVGGTVIGELV  221

Query  358  aagPVMVIGSTFSNATYER  414
            A+GPVMV+ +TFSNATYER
Sbjct  222  ASGPVMVVAATFSNATYER  240



>ref|XP_004229823.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=302

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+A+G D+ ESI+ FA RRQRGVC++SASGTVTNVT
Sbjct  93   SKNKPKPPIIITRDSANALRSHVMEIATGCDIQESISNFATRRQRGVCILSASGTVTNVT  152

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            +RQP++PGAV+ LHGRFEILSL+G++LP P+PP ++GLTIYLAGGQGQVVGGSVVG L A
Sbjct  153  IRQPASPGAVVTLHGRFEILSLSGSYLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLNA  212

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  213  SGPVVIMAASFGNAAYER  230



>ref|XP_010658536.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=327

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +T++SPNALRSHVLE++SG+D+AESIA FA+RR RGV V+SASG V NVT
Sbjct  119  SKNKPKPPIVITKESPNALRSHVLEISSGSDIAESIANFAQRRHRGVSVLSASGIVNNVT  178

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APG V+ L GRFEILSL+GAFLP PSPPG+TGLT+YLAGGQGQVVGGSVVG+L+A
Sbjct  179  LRQPAAPGGVITLQGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGSVVGALMA  238

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+VI +TFSNAT+ER
Sbjct  239  SGPVIVIAATFSNATFER  256



>ref|XP_007134900.1| hypothetical protein PHAVU_010G085300g [Phaseolus vulgaris]
 gb|ESW06894.1| hypothetical protein PHAVU_010G085300g [Phaseolus vulgaris]
Length=310

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+A+G D+ ES+  FARRRQRGVCV+S SGTVTNVT
Sbjct  96   SKNKPKPPIIITRDSANALRSHVMEIANGCDIMESVTAFARRRQRGVCVLSGSGTVTNVT  155

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL+G+FLP P+PP ++GL IYLAGGQGQVVGGSVVG L+A
Sbjct  156  LRQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLAIYLAGGQGQVVGGSVVGPLLA  215

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  216  SGPVVIMAASFGNAAYER  233



>gb|KDP44918.1| hypothetical protein JCGZ_01418 [Jatropha curcas]
Length=341

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPP+ +T++SPN+LRSHVLE++SG+D+AESI+ FA+RR RGV ++S SG VTNVT
Sbjct  117  SKNKPKPPVVITKESPNSLRSHVLEISSGSDIAESISNFAQRRHRGVSILSGSGIVTNVT  176

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APG V+ LHGRFEILSL+G+FLP PSPPG+TGLT+YLAGGQGQVVGG+VVG LVA
Sbjct  177  LRQPAAPGGVITLHGRFEILSLSGSFLPAPSPPGATGLTVYLAGGQGQVVGGTVVGQLVA  236

Query  361  agPVMVIGSTFSNATYER  414
            AGPVMVI +TFSNAT+ER
Sbjct  237  AGPVMVIAATFSNATFER  254



>ref|XP_008801621.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
 ref|XP_008801622.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
 ref|XP_008801623.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=320

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPPI +TR+SPNALRSHVLE+ASG D+ +++A FARRRQRGV ++S SG VTNVTL
Sbjct  100  KNKPKPPIIITRESPNALRSHVLEIASGTDIMDAVAVFARRRQRGVSILSGSGVVTNVTL  159

Query  184  RQPSA-PGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            RQP+A PGAV+ LHGRFEILSL+GAFLP PSPPG++GLT+YLAGGQGQVVGGSVVG LVA
Sbjct  160  RQPAAPPGAVVTLHGRFEILSLSGAFLPPPSPPGASGLTVYLAGGQGQVVGGSVVGELVA  219

Query  361  agPVMVIGSTFSNATYER  414
            +GPVMVI +TF+NATYER
Sbjct  220  SGPVMVIAATFTNATYER  237



>ref|XP_004510939.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=305

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+EVA+G D+ ES+  FARRRQRGVC++S SGTVTNVT
Sbjct  94   SKNKPKPPIIITRDSANALRSHVMEVANGCDIMESVTVFARRRQRGVCILSGSGTVTNVT  153

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL+G+FLP P+PP ++GL IYLAGGQGQVVGGSVVG L+A
Sbjct  154  LRQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLAIYLAGGQGQVVGGSVVGPLLA  213

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  214  SGPVVIMAASFGNAAYER  231



>ref|XP_008791267.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=322

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKN+PKPPI +TRDS NALRSHV+E+A G D+AES++ FARRRQRGVC++  SGTVTNVT
Sbjct  105  SKNRPKPPIIITRDSANALRSHVMEIAGGCDIAESVSTFARRRQRGVCILGGSGTVTNVT  164

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PG+V+ALHGRFEILSL+G+FLP P+PP +TGLTIYLAGGQGQVVGGSV+G+L+A
Sbjct  165  LRQPASPGSVVALHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVLGALIA  224

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  225  SGPVVIMAASFGNAVYER  242



>ref|XP_002511734.1| ESC, putative [Ricinus communis]
 gb|EEF50403.1| ESC, putative [Ricinus communis]
Length=299

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+A+G+D+ ES++ FARRRQRGVC++S +GTVTNVT
Sbjct  92   SKNKPKPPIIITRDSANALRSHVMEIANGSDIMESVSTFARRRQRGVCILSGTGTVTNVT  151

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL+G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG L+A
Sbjct  152  LRQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLLA  211

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  212  SGPVVIMAASFGNAAYER  229



>ref|XP_002320066.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE98381.1| DNA-binding family protein [Populus trichocarpa]
Length=300

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+A+G+D+ ES++ FARRRQRGVC++S +GTVTNVT
Sbjct  88   SKNKPKPPIIITRDSANALRSHVMEIATGSDIMESVSTFARRRQRGVCILSGTGTVTNVT  147

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            L+QP++PGAV+ LHGRFEILSL+G+FLP P+PP ++GLT+YLAGGQGQV+GGSV G L+A
Sbjct  148  LKQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTVYLAGGQGQVIGGSVAGPLLA  207

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+V+ ++F NA YER
Sbjct  208  SGPVVVMAASFGNAAYER  225



>ref|XP_006591349.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=289

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPPI +T++SPNALRSHVLE+ SG+DVAESIA FA RR RGV V+S SG V NVTL
Sbjct  86   KNKPKPPIVITKESPNALRSHVLEITSGSDVAESIAAFANRRHRGVSVLSGSGIVANVTL  145

Query  184  RQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslvaa  363
            RQP+AP  V+ LHGRFEILSL+GAFLP PSPPG+TGLT+YLAGGQGQVVGG+V GSLVA+
Sbjct  146  RQPAAPAGVITLHGRFEILSLSGAFLPSPSPPGATGLTVYLAGGQGQVVGGTVAGSLVAS  205

Query  364  gPVMVIGSTFSNATYER  414
            GPVMVI +TF+NATYER
Sbjct  206  GPVMVIAATFANATYER  222



>gb|KEH19036.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=308

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+EVA+G D+ ES+  FARRRQRGVC++S SGTVTNVT
Sbjct  95   SKNKPKPPIIITRDSANALRSHVMEVANGCDIMESVTVFARRRQRGVCILSGSGTVTNVT  154

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL+G+FLP P+PP ++GL IYLAGGQGQVVGGSVVG L+A
Sbjct  155  LRQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLAIYLAGGQGQVVGGSVVGPLLA  214

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  215  SGPVVIMAASFGNAAYER  232



>ref|XP_010934543.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=319

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+ASG D+A+S+A FAR RQRGVC++  SGTVTNVT
Sbjct  108  SKNKPKPPIIITRDSANALRSHVMEIASGCDIADSVATFARHRQRGVCILGGSGTVTNVT  167

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+ PG+V+ALHGRFEILSL+G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  168  LRQPATPGSVVALHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALIA  227

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  228  SGPVVIMAASFGNAVYER  245



>ref|XP_006363711.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=293

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 153/211 (73%), Gaps = 6/211 (3%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ESI+ FARRRQRGVC+MS +G VTNV 
Sbjct  84   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMESISNFARRRQRGVCIMSGTGIVTNVN  143

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  144  LRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPTTSGLTIYLAGGQGQVVGGSVVGALMA  203

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPLE D +             G  P       G         
Sbjct  204  SGPVVIMSASFSNAAYERLPLEEDNQNHPLPVVPGGGSLGSPPGNIGGQGGQQQQQMMAD  263

Query  541  PGVYN-LPPNMVAS----NEAFAWAHGRPPY  618
            P +++ +PPN++ S    +E + WA GRPP+
Sbjct  264  PSLFHGMPPNLLNSIQLPSEPY-WATGRPPF  293



>ref|XP_006339443.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=308

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+ASG D+ ESI+ FA RRQRGVC++S SGTVTNVT
Sbjct  99   SKNKPKPPIIITRDSANALRSHVMEIASGCDIQESISNFATRRQRGVCILSGSGTVTNVT  158

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            +RQP++PGAV+ LHGRFEILSL+G++LP P+PP ++GLTIYLAGGQGQVVGGSVVG L A
Sbjct  159  IRQPTSPGAVVTLHGRFEILSLSGSYLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLNA  218

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  219  SGPVVIMAASFGNAAYER  236



>gb|KDP25577.1| hypothetical protein JCGZ_20733 [Jatropha curcas]
Length=295

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+H++EVA G D+ ES+A FARRRQRGV +MS +GTVTNVT
Sbjct  89   SKNKPKPPIIITRDSANALRTHLMEVADGCDIVESVATFARRRQRGVSIMSGTGTVTNVT  148

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG+L A
Sbjct  149  LRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLTA  208

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  209  SGPVVIMAASFSNAAYER  226



>ref|XP_006655164.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Oryza 
brachyantha]
Length=303

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPPI +TR+SPNALRSHVLE+A GAD+ E++  FARRRQRGV V+S SG V NVTL
Sbjct  98   KNKPKPPIIITRESPNALRSHVLEIAGGADIMEAVTTFARRRQRGVSVLSGSGVVANVTL  157

Query  184  RQPSA-PGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            RQP+A PGAV  LHGRFEILSL+GAFLP P PPG+TGL +YLAGGQGQVVGG+VVG L+A
Sbjct  158  RQPAAPPGAVATLHGRFEILSLSGAFLPSPCPPGATGLAVYLAGGQGQVVGGTVVGELLA  217

Query  361  agPVMVIGSTFSNATYER  414
            +GPVMVI +TFSNATYER
Sbjct  218  SGPVMVIAATFSNATYER  235



>ref|XP_007155606.1| hypothetical protein PHAVU_003G216200g [Phaseolus vulgaris]
 gb|ESW27600.1| hypothetical protein PHAVU_003G216200g [Phaseolus vulgaris]
Length=284

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 152/210 (72%), Gaps = 9/210 (4%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NA+R+H++EVA G D+ ES+++FAR+RQRGVC+MS +GTVTNVT
Sbjct  80   SKNKPKPPIIITRDSANAMRTHMMEVADGCDIVESVSEFARKRQRGVCIMSGTGTVTNVT  139

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++ GAV+ LHGRFEILSL+G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+LVA
Sbjct  140  LRQPASSGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLVA  199

Query  361  agPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdpspM  540
            +GPV+++ ++FSNA YERLPLE ++             G           G         
Sbjct  200  SGPVVIMSASFSNAAYERLPLEDEDPSLQMQGGSIGSPGASGVGQSQLLGGGDAAA----  255

Query  541  PGVYNLPPNMVAS----NEAFAWAHGRPPY  618
            P  + LPPN++ S    +E F WA  RPP+
Sbjct  256  PLFHGLPPNLLNSVQMPSEPF-WASNRPPF  284



>ref|XP_002509637.1| ESC, putative [Ricinus communis]
 gb|EEF51024.1| ESC, putative [Ricinus communis]
Length=298

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+H++EVA G D+ ES+A FARRRQRGV +MS +GTVTNVT
Sbjct  91   SKNKPKPPIIITRDSANALRTHLMEVADGCDIVESVATFARRRQRGVSIMSGTGTVTNVT  150

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  151  LRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLIA  210

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  211  SGPVVIMAASFSNAAYER  228



>ref|XP_007009270.1| AT-hook protein of GA feedback 2 [Theobroma cacao]
 gb|EOY18080.1| AT-hook protein of GA feedback 2 [Theobroma cacao]
Length=339

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +T++SPN+LRSHVLE+ SG+D+AE IA FA+RR RGV V+S SG VTNVT
Sbjct  114  SKNKPKPPIVITKESPNSLRSHVLEITSGSDIAECIANFAQRRHRGVSVLSGSGIVTNVT  173

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APG V+ LHGRFEILSL+GAFLP PSPPG+TGLT+YLAGGQGQVVGGSV+G+L+A
Sbjct  174  LRQPAAPGGVITLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGSVIGALIA  233

Query  361  agPVMVIGSTFSNATYER  414
            +GPVMVI +TF+NA YER
Sbjct  234  SGPVMVIAATFTNAVYER  251



>ref|XP_010325447.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Solanum 
lycopersicum]
Length=289

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ESI+ FARRRQRGVC+MS +G VTNV 
Sbjct  83   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMESISNFARRRQRGVCIMSGTGVVTNVN  142

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  143  LRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALMA  202

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  203  SGPVVIMSASFSNAAYER  220



>ref|XP_009613223.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
tomentosiformis]
Length=296

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ESI+ FARRRQRGVC+MS +G VTNV 
Sbjct  87   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMESISNFARRRQRGVCIMSGTGIVTNVN  146

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  147  LRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALMA  206

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  207  SGPVVIMAASFSNAAYER  224



>ref|XP_008437165.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=303

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+EV  G D+ +S+A FARRRQRGVC+MS +GTVTNVT
Sbjct  78   SKNKPKPPIIITRDSANALRTHVIEVTDGCDIVDSVATFARRRQRGVCIMSGTGTVTNVT  137

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP +T LTIYLAGGQGQVVGGSVVG+L+A
Sbjct  138  LRQPASPGAIINLHGRFEILSLAGSFLPPPAPPAATTLTIYLAGGQGQVVGGSVVGTLIA  197

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  198  SGPVVIMAASFSNAAYER  215



>gb|EYU30571.1| hypothetical protein MIMGU_mgv1a010755mg [Erythranthe guttata]
Length=302

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+EVA+G DV +SI+ FA RRQRGVC++S +GTVTNVT
Sbjct  100  SKNKPKPPIIITRDSANALRSHVMEVANGCDVQDSISTFATRRQRGVCILSGTGTVTNVT  159

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APG+V+ LHGRFEILSL+G+FLP P+PP ++GLTIYLAG QGQVVGG+VVG L+A
Sbjct  160  LRQPAAPGSVLTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGAQGQVVGGAVVGPLLA  219

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  220  SGPVVIMAASFGNAAYER  237



>ref|XP_004245690.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Solanum 
lycopersicum]
Length=292

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ESI+ FARRRQRGVC+MS +G VTNV 
Sbjct  86   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMESISNFARRRQRGVCIMSGTGVVTNVN  145

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  146  LRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALMA  205

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  206  SGPVVIMSASFSNAAYER  223



>ref|XP_010032377.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 ref|XP_010032378.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 ref|XP_010032379.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW51782.1| hypothetical protein EUGRSUZ_J01233 [Eucalyptus grandis]
Length=345

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKP+PPI VT++SPN+LRSH+LE++SG+D+AESIA FA+RR RGV V+S SG VTNVTL
Sbjct  121  KNKPRPPIVVTKESPNSLRSHILEISSGSDIAESIANFAQRRHRGVSVLSGSGIVTNVTL  180

Query  184  RQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslvaa  363
            RQP+APG V+AL GRFEILSL GAFLP PSPPG+TGLT+YL+GGQGQVVGG+ VG LVA+
Sbjct  181  RQPTAPGGVIALQGRFEILSLNGAFLPAPSPPGATGLTVYLSGGQGQVVGGTAVGPLVAS  240

Query  364  gPVMVIGSTFSNATYER  414
            GPVMV+ +TFSNATYE+
Sbjct  241  GPVMVVAATFSNATYEQ  257



>ref|XP_009613222.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
tomentosiformis]
Length=299

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ ESI+ FARRRQRGVC+MS +G VTNV 
Sbjct  90   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMESISNFARRRQRGVCIMSGTGIVTNVN  149

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  150  LRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALMA  209

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  210  SGPVVIMAASFSNAAYER  227



>ref|XP_009604907.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=304

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+ASG D+ ESI+ FA RRQRGVC++S SGTVTNVT
Sbjct  97   SKNKPKPPIIITRDSANALRSHVMEIASGCDIQESISTFATRRQRGVCILSGSGTVTNVT  156

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            +RQP++PGAV+ LHGRFEILSL+G++LP P+PP ++GLTIYLAGGQGQVVGGSVVG L A
Sbjct  157  IRQPASPGAVVTLHGRFEILSLSGSYLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLNA  216

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  217  SGPVVIMAASFGNAAYER  234



>ref|XP_004172826.1| PREDICTED: LOW QUALITY PROTEIN: putative DNA-binding protein 
ESCAROLA-like [Cucumis sativus]
 gb|KGN50183.1| hypothetical protein Csa_5G157420 [Cucumis sativus]
Length=303

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+EV  G D+ +S+A FARRRQRGVC+MS +GTVTNVT
Sbjct  78   SKNKPKPPIIITRDSANALRTHVIEVTDGCDIVDSVATFARRRQRGVCIMSGTGTVTNVT  137

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP +T LTIYLAGGQGQVVGGSVVG+L+A
Sbjct  138  LRQPASPGAIVNLHGRFEILSLAGSFLPPPAPPAATTLTIYLAGGQGQVVGGSVVGTLIA  197

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  198  SGPVVIMAASFSNAAYER  215



>ref|XP_004147565.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
Length=303

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+EV  G D+ +S+A FARRRQRGVC+MS +GTVTNVT
Sbjct  78   SKNKPKPPIIITRDSANALRTHVIEVTDGCDIVDSVATFARRRQRGVCIMSGTGTVTNVT  137

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP +T LTIYLAGGQGQVVGGSVVG+L+A
Sbjct  138  LRQPASPGAIVNLHGRFEILSLAGSFLPPPAPPAATTLTIYLAGGQGQVVGGSVVGTLIA  197

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  198  SGPVVIMAASFSNAAYER  215



>ref|NP_001141263.1| hypothetical protein [Zea mays]
 gb|ACF85898.1| unknown [Zea mays]
 gb|ACF88117.1| unknown [Zea mays]
 gb|AFW71087.1| hypothetical protein ZEAMMB73_730676 [Zea mays]
Length=309

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS N LR+HV+EVASG D++ESI  FARRRQRGVCV+S +GTVTNVT
Sbjct  104  SKNKPKPPIIITRDSANTLRTHVMEVASGCDISESITAFARRRQRGVCVLSGAGTVTNVT  163

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++ GAV+ALHGRFEILSL+G+FLP P+PP +TGLT+YLAGGQGQVVGGSVVG+L A
Sbjct  164  LRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALTA  223

Query  361  agPVMVIGSTFSNATYER  414
            AGPV+++ ++F+NA YER
Sbjct  224  AGPVVIMAASFANAVYER  241



>ref|XP_003568662.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=321

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPPI +TR+SPN LRSHVLE+ASGAD+ +++A FARRRQRGV V+S SG V NVTL
Sbjct  99   KNKPKPPIIITRESPNTLRSHVLEIASGADIMDAVATFARRRQRGVSVLSGSGVVGNVTL  158

Query  184  RQPSA-PGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            RQP+A PGAV+ LHGRFEILSL+GAFLP P PPG+TGL +YLAGGQGQVVGG+VVG LVA
Sbjct  159  RQPAAPPGAVVTLHGRFEILSLSGAFLPSPCPPGATGLAVYLAGGQGQVVGGTVVGELVA  218

Query  361  agPVMVIGSTFSNATYER  414
            +GP+MV+ +TFSNATYER
Sbjct  219  SGPIMVVAATFSNATYER  236



>ref|XP_009799054.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009799060.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
sylvestris]
Length=304

 Score =   154 bits (389),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+ASG D+ ESI+ FA RRQRGVC++S SGTVTNVT
Sbjct  97   SKNKPKPPIIITRDSANALRSHVMEIASGCDIQESISTFATRRQRGVCILSGSGTVTNVT  156

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            +RQP++PGAV+ LHGRFEILSL+G++LP P+PP ++GLTIYLAGGQGQVVGGSVVG L A
Sbjct  157  IRQPASPGAVVTLHGRFEILSLSGSYLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLNA  216

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  217  SGPVVIMAASFGNAAYER  234



>ref|XP_006435633.1| hypothetical protein CICLE_v10032034mg [Citrus clementina]
 ref|XP_006486403.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|ESR48873.1| hypothetical protein CICLE_v10032034mg [Citrus clementina]
Length=338

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +T++SPN+LRSHVLE+ SG D+ ESIA FA+RR RGV ++S SG VTNV+
Sbjct  113  SKNKPKPPIVITKESPNSLRSHVLEITSGTDIVESIANFAQRRHRGVSILSGSGIVTNVS  172

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APG ++ LHGRFEILSL+GAFLP PSPPG+TGLT+YLAGGQGQVVGG+V+G+L+A
Sbjct  173  LRQPAAPGGLITLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGTVMGALMA  232

Query  361  agPVMVIGSTFSNATYER  414
            +GPVMVI +TF+NATYER
Sbjct  233  SGPVMVIAATFTNATYER  250



>ref|XP_010692273.1| PREDICTED: putative DNA-binding protein ESCAROLA [Beta vulgaris 
subsp. vulgaris]
Length=334

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+EVA+G D+ ESI  FARRRQRGVC+++ +GTV NVT
Sbjct  116  SKNKPKPPIIITRDSANALRSHVMEVANGCDIMESITNFARRRQRGVCILNGTGTVANVT  175

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP APGAV+ LHGRFEILSL+G+FLP P+PP ++GLTIYLAGGQGQVVGG VVG L+A
Sbjct  176  LRQPGAPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGGVVGPLLA  235

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+V+ ++F NA YER
Sbjct  236  SGPVVVMAASFGNAAYER  253



>ref|XP_002279636.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
 emb|CAN81187.1| hypothetical protein VITISV_029906 [Vitis vinifera]
 emb|CBI38865.3| unnamed protein product [Vitis vinifera]
Length=300

 Score =   154 bits (388),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+A+G D+ +S+  FARRRQRG+C++S SGTVTNVT
Sbjct  91   SKNKPKPPIIITRDSANALRSHVMEIATGCDIMDSLNTFARRRQRGICILSGSGTVTNVT  150

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL+G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG L+A
Sbjct  151  LRQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLLA  210

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  211  SGPVVIMAASFGNAAYER  228



>ref|XP_010907805.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=318

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 125/139 (90%), Gaps = 1/139 (1%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TR+SPNALRSHVLE+ASG D+ ++IA FARRRQRGV ++S SG VT+VT
Sbjct  90   SKNKPKPPIIITRESPNALRSHVLEIASGTDIMDAIAVFARRRQRGVSILSGSGVVTDVT  149

Query  181  LRQPSA-PGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslv  357
            LRQP+A PGAV+ LHGRFEILSL+GAFLP PSPPG+TGLT+YLAGGQGQVVGG V+G LV
Sbjct  150  LRQPAAPPGAVVTLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGRVMGELV  209

Query  358  aagPVMVIGSTFSNATYER  414
            A+GPVMVI +TF+NA YER
Sbjct  210  ASGPVMVIAATFTNAIYER  228



>ref|XP_010920512.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=320

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 154/218 (71%), Gaps = 14/218 (6%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPPI +TR+SPN+LRSHVLE+ASG D+ +++A FARRRQRGV ++S SG VTNVTL
Sbjct  100  KNKPKPPIIITRESPNSLRSHVLEIASGTDIMDAVAVFARRRQRGVSILSGSGVVTNVTL  159

Query  184  RQPSA-PGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            RQP+A PGAV+ LHGRFEILSL+GAFLP PSPPG++GLT+YLAGGQGQVVGGSVVG LVA
Sbjct  160  RQPAAPPGAVVTLHGRFEILSLSGAFLPPPSPPGASGLTVYLAGGQGQVVGGSVVGELVA  219

Query  361  agPVMVIGSTFSNATYER------lplepdeeeaaaataepqlggggspppgmasagagm  522
            +GPVMVI +TF+NAT+ER       P        +         G         S G   
Sbjct  220  SGPVMVIAATFTNATFERLPLGDEEPEVAAAPPGSEGMPLQPSPGANGVSSSQQSHGGMG  279

Query  523  gdpspMPGVYNLPPNMVASNE-------AFAWAHGRPP  615
             DPS MP +YNLPPN++ + +       A+A A  RPP
Sbjct  280  TDPSSMPPLYNLPPNLLPNGQLPHDVFGAWASAAPRPP  317



>emb|CDP17786.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+ASG D+ ES++ FA RRQRGVC++S +GTV NVT
Sbjct  99   SKNKPKPPIIITRDSANALRSHVMEIASGCDIQESVSNFATRRQRGVCILSGNGTVNNVT  158

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+APGAV+ LHGRFEILSL+G+FLP P+P  ++GLTIYLAGGQGQVVGGSVVG L+A
Sbjct  159  LRQPAAPGAVVTLHGRFEILSLSGSFLPPPAPAAASGLTIYLAGGQGQVVGGSVVGPLLA  218

Query  361  agPVMVIGSTFSNATYER  414
            AGPV+++ ++F NA YER
Sbjct  219  AGPVVIMAASFGNAAYER  236



>gb|KFK37871.1| hypothetical protein AALP_AA3G040100 [Arabis alpina]
Length=312

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 127/145 (88%), Gaps = 7/145 (5%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNAL+SHV+E+ASG DV E++A FARRRQRG+C++S +GTV NVT
Sbjct  88   SKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANVT  147

Query  181  LRQPSA-------PGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggs  339
            LRQPS          AV+AL GRFEILSLTG+FLPGP+PPGSTGLTIYLAGGQGQVVGGS
Sbjct  148  LRQPSTAAAAAPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLAGGQGQVVGGS  207

Query  340  vvgslvaagPVMVIGSTFSNATYER  414
            VVG L+AAGPVM+I +TFSNATYER
Sbjct  208  VVGPLMAAGPVMLIAATFSNATYER  232



>ref|XP_010923237.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=312

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 165/220 (75%), Gaps = 15/220 (7%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TR+SPNALRSHVLE+ASG D+ ++IA FARRRQRG+ ++S SG VTNVT
Sbjct  91   SKNKPKPPIIITRESPNALRSHVLEIASGTDIMDAIAVFARRRQRGISILSGSGVVTNVT  150

Query  181  LRQPSA-PGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslv  357
            LRQP+A PGAV+ LHGRFEILSL+GAFLP PSPPG+TGLT+YLAGGQGQVVGGSVVG LV
Sbjct  151  LRQPAAPPGAVVTLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGSVVGELV  210

Query  358  aagPVMVIGSTFSNATYERlplepdeeeaa---------aataepqlggggspppgmasa  510
            A+G VMVI +TF+NA YERLPL  +E EA          AA  +   GG GS     +  
Sbjct  211  ASGQVMVIAATFTNAIYERLPLGDEEAEATAPPGGGEGMAALQQSPPGGNGSASQQTSHV  270

Query  511  gagmgdpspMPGVYNLPPNMVA----SNEAF-AWAHGRPP  615
            G+   DPS MP +YNLPPN++     ++E F AWA   PP
Sbjct  271  GSAAVDPSLMPPLYNLPPNLLPNGQMTHEVFGAWAPRPPP  310



>gb|KDO85858.1| hypothetical protein CISIN_1g047830mg [Citrus sinensis]
Length=313

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+A+G D+ +S++ FARRRQRG+C++S +GTVTNVT
Sbjct  97   SKNKPKPPIIITRDSANALRSHVMEIANGCDIMDSVSNFARRRQRGICILSGTGTVTNVT  156

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG LVA
Sbjct  157  LRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLVA  216

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  217  SGPVVIMAASFGNAAYER  234



>ref|XP_006445233.1| hypothetical protein CICLE_v10024070mg [Citrus clementina]
 ref|XP_006490941.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|ESR58473.1| hypothetical protein CICLE_v10024070mg [Citrus clementina]
Length=313

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+A+G D+ +S++ FARRRQRG+C++S +GTVTNVT
Sbjct  97   SKNKPKPPIIITRDSANALRSHVMEIANGCDIMDSVSNFARRRQRGICILSGTGTVTNVT  156

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG LVA
Sbjct  157  LRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLVA  216

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  217  SGPVVIMAASFGNAAYER  234



>ref|XP_009379269.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=320

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNK KPPI +TRDS NALRSHV+EVA+G D+ ES++ FARRRQRGVC++S SGTVTNVT
Sbjct  100  SKNKAKPPIIITRDSANALRSHVMEVANGCDIMESVSTFARRRQRGVCILSGSGTVTNVT  159

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL+G+FLP P+PP ++ LTIYLAGGQGQ VGG VVG L+A
Sbjct  160  LRQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASCLTIYLAGGQGQGVGGGVVGPLLA  219

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  220  SGPVVIMAASFGNAAYER  237



>ref|XP_004307477.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=320

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +T++SPNALRSHVLE++SG+D+ +SIA FA+RR RGV V+S SG V+NVT
Sbjct  100  SKNKPKPPIIITKESPNALRSHVLEISSGSDIVDSIATFAQRRHRGVSVLSGSGIVSNVT  159

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+AP  V+ LHGRFEILSL GAFLP PSPPG++GLT+YL GGQGQVVGG+VVG LVA
Sbjct  160  LRQPAAPSGVITLHGRFEILSLNGAFLPAPSPPGASGLTVYLGGGQGQVVGGTVVGPLVA  219

Query  361  agPVMVIGSTFSNATYER  414
            +GPVM+I +TF+NATYER
Sbjct  220  SGPVMIIAATFTNATYER  237



>ref|XP_011017502.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=298

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+ASG D+ ES++ FA RRQRGVC++S +GTVTNVT
Sbjct  89   SKNKPKPPIIITRDSANALRSHVMEIASGCDIMESVSTFAGRRQRGVCILSGTGTVTNVT  148

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            L+QP++PGAV+ LHGRFEILSL+G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG L+A
Sbjct  149  LKQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLLA  208

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  209  SGPVVIMAASFGNAAYER  226



>ref|XP_003516633.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=250

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPP+ +TR+S NALR+H+LEVASG DV ES+A +ARRRQRG+C++S SGTVTNV+
Sbjct  54   SKNKPKPPVIITRESANALRAHILEVASGCDVFESVASYARRRQRGICILSGSGTVTNVS  113

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++ GAV  LHGRFEILSLTG+FLP P+PPG+T L+IYLAGGQGQVVGGSVVG L A
Sbjct  114  LRQPASAGAVATLHGRFEILSLTGSFLPPPAPPGATSLSIYLAGGQGQVVGGSVVGELTA  173

Query  361  agPVMVIGSTFSNATYER  414
            AGPV+VI ++F+N  YER
Sbjct  174  AGPVIVIAASFTNVAYER  191



>ref|XP_003538721.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=298

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NAL++HV+EVA G D+ ES++ FARRRQRGVC+MS +GTVTNVT
Sbjct  87   SKNKPKPPIIITRDSANALKTHVMEVADGCDIVESVSAFARRRQRGVCIMSGTGTVTNVT  146

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++ GAV+ LHGRFEILSL G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  147  LRQPASSGAVVTLHGRFEILSLAGSFLPPPAPPEASGLTIYLAGGQGQVVGGSVVGALIA  206

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  207  SGPVVIMSASFSNAAYER  224



>ref|XP_010558745.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=300

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 157/225 (70%), Gaps = 27/225 (12%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPIFVTRDSPNAL+SHV+E+ASG+DV E++A FARRRQRGVC++S +GTV NVT
Sbjct  84   SKNKPKPPIFVTRDSPNALKSHVMEIASGSDVVETLATFARRRQRGVCILSGNGTVANVT  143

Query  181  LRQPSA------------PGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgq  324
            LRQPS+             G VMALHGRFEILS+TG+FLPGP+PPGSTGLTIYLAGGQGQ
Sbjct  144  LRQPSSTPAAGGGGGAVGAGGVMALHGRFEILSMTGSFLPGPAPPGSTGLTIYLAGGQGQ  203

Query  325  vvggsvvgslvaagPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgma  504
            +VGGSVVG L+AAGPVM+I +TFSNATYER                   GG G    G  
Sbjct  204  IVGGSVVGPLMAAGPVMLIAATFSNATYER-------LPLEEEEERAGGGGPGQLAGGGG  256

Query  505  sagagmgdpspMPGVYNLPPNMV-------ASNEAFAWAHGRPPY  618
            S  +G      +P VYNLP N+V       +S +A+ W+  RP Y
Sbjct  257  SPPSGGDGNQGLP-VYNLPGNLVNGGGEQISSQDAYGWSQTRPGY  300



>ref|XP_007158420.1| hypothetical protein PHAVU_002G151600g [Phaseolus vulgaris]
 gb|ESW30414.1| hypothetical protein PHAVU_002G151600g [Phaseolus vulgaris]
Length=299

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NAL++HV+EVA G D+ +S++ FARRRQRGVC+MS +GTVTNVT
Sbjct  92   SKNKPKPPIIITRDSANALKTHVMEVADGCDIVDSVSTFARRRQRGVCIMSGTGTVTNVT  151

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++ GAV+ LHGRFEILSL G+FLP P+PP +TGLTIYLAGGQGQVVGGSVVG+LVA
Sbjct  152  LRQPASSGAVVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALVA  211

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  212  SGPVVIMSASFSNAAYER  229



>ref|XP_009763802.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
sylvestris]
Length=294

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ +SI+ FARRRQRGVC+MS +G VTNV 
Sbjct  87   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMDSISNFARRRQRGVCIMSGTGIVTNVN  146

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  147  LRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALMA  206

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  207  SGPVVIMAASFSNAAYER  224



>ref|XP_010092850.1| hypothetical protein L484_022445 [Morus notabilis]
 gb|EXB52668.1| hypothetical protein L484_022445 [Morus notabilis]
Length=326

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+E+A+  DV +S++ FARRRQRG+CV+S +GTVTNVT
Sbjct  105  SKNKPKPPIIITRDSANALRSHVMEIANACDVMDSMSAFARRRQRGICVLSGTGTVTNVT  164

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV++LHGRFEILSL+G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG L+A
Sbjct  165  LRQPASPGAVVSLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMA  224

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  225  SGPVVIMAASFGNAAYER  242



>ref|XP_003517441.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=300

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NAL++HV+EVA G D+ +S++ FARRRQRGVC+MS +GTVTNVT
Sbjct  88   SKNKPKPPIIITRDSANALKTHVMEVADGCDIVDSVSAFARRRQRGVCIMSGTGTVTNVT  147

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++ GAV+ LHGRFEILSL G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  148  LRQPASSGAVVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALIA  207

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  208  SGPVVIMSASFSNAAYER  225



>ref|XP_009763803.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
sylvestris]
Length=291

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+A G D+ +SI+ FARRRQRGVC+MS +G VTNV 
Sbjct  84   SKNKPKPPIIITRDSANALRTHVMEIADGCDIMDSISNFARRRQRGVCIMSGTGIVTNVN  143

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGA++ LHGRFEILSL G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+L+A
Sbjct  144  LRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALMA  203

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  204  SGPVVIMAASFSNAAYER  221



>ref|XP_008803114.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=318

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPP+ +TR+SPNALRSHVLE+ASG D+ ++IA FARRRQRG+ ++S SG VTNVTL
Sbjct  94   KNKPKPPVIITRESPNALRSHVLEIASGTDIMDAIAVFARRRQRGMSILSGSGVVTNVTL  153

Query  184  RQPSA-PGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            RQP+A PGAV+ LHGRFEILSL+GAFLP PS PG++GLT+YLAG QGQ+VGGSVVG LVA
Sbjct  154  RQPAAPPGAVVTLHGRFEILSLSGAFLPAPSLPGASGLTVYLAGRQGQMVGGSVVGELVA  213

Query  361  agPVMVIGSTFSNATYER  414
            +GPVMVI +TF+NA YER
Sbjct  214  SGPVMVIAATFANAIYER  231



>ref|XP_006649829.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Oryza 
brachyantha]
Length=260

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 1/139 (1%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPP+ VTR+SPNA+RSHVLE+ASGAD+ E+IA F+RRRQRGV V+S SG VTNVT
Sbjct  56   SKNKPKPPVVVTRESPNAMRSHVLEIASGADIVEAIAGFSRRRQRGVSVLSGSGAVTNVT  115

Query  181  LRQPSAPG-AVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslv  357
            LRQP+  G A +AL GRFEILS++GAFLP P+PPG+TGL +YLAGGQGQVVGGSV+G L+
Sbjct  116  LRQPAGTGAAAVALRGRFEILSMSGAFLPAPAPPGATGLAVYLAGGQGQVVGGSVMGELI  175

Query  358  aagPVMVIGSTFSNATYER  414
            A+GPVMVI +TF NATYER
Sbjct  176  ASGPVMVIAATFGNATYER  194



>gb|EPS64135.1| hypothetical protein M569_10646 [Genlisea aurea]
Length=318

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALRSHV+EVA+G D+ ES++ FA RRQRGVC++S +GTVTNVT
Sbjct  104  SKNKPKPPIIITRDSANALRSHVIEVATGCDIQESVSTFATRRQRGVCILSGTGTVTNVT  163

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            +RQP++PGAV+ L GRFEILSLTG+FLP P+PP ++ LTIYLAG QGQV+GG++VG L+A
Sbjct  164  IRQPTSPGAVLTLQGRFEILSLTGSFLPPPAPPAASSLTIYLAGSQGQVMGGTIVGPLIA  223

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  224  SGPVVIMAASFGNAAYER  241



>dbj|BAK03205.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=309

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS N LR+HV+EVA G D++ESI  FARRRQRGVCV+S +GTVTNVT
Sbjct  98   SKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESITAFARRRQRGVCVLSGAGTVTNVT  157

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++ GAV+ALHGRFEILSL+G+FLP P+PP +TGLT+YLAGG+GQVVGG+VVGSL A
Sbjct  158  LRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGKGQVVGGTVVGSLTA  217

Query  361  agPVMVIGSTFSNATYER  414
            AGPV+++ ++F+NA YER
Sbjct  218  AGPVVIMAASFANAVYER  235



>ref|XP_009607803.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=319

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI VT++SPN+LRSHVLE+ SG+D+ ESIA FA RR RGV V+S SG VTNVT
Sbjct  113  SKNKPKPPIVVTKESPNSLRSHVLEIKSGSDIVESIATFAHRRGRGVSVLSGSGIVTNVT  172

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+A G V+ LHGRFEILSL+GAFLP PSPPG+TGLT+YLAG QGQVVGG+VVG L+A
Sbjct  173  LRQPAAAGGVITLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGSQGQVVGGNVVGELMA  232

Query  361  agPVMVIGSTFSNATYER  414
            +GPVMVI +TF+NAT+ER
Sbjct  233  SGPVMVIAATFTNATFER  250



>ref|XP_008785537.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=317

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 122/139 (88%), Gaps = 1/139 (1%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +T++SPNALRSHVLE+ASG D+ +++A FARRRQRG+ ++S SG VTNVT
Sbjct  91   SKNKPKPPIIITKESPNALRSHVLEIASGTDIMDAVAVFARRRQRGISILSGSGVVTNVT  150

Query  181  LRQPSA-PGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslv  357
            LRQP+A PG V+ LHGRFEILSL+GAFLP PSP  STGLT+Y AGGQGQVVGGSVVG LV
Sbjct  151  LRQPAAPPGTVVTLHGRFEILSLSGAFLPEPSPTVSTGLTVYFAGGQGQVVGGSVVGELV  210

Query  358  aagPVMVIGSTFSNATYER  414
            A+GPVMVI +TF+NA YER
Sbjct  211  ASGPVMVIAATFTNAMYER  229



>ref|XP_004952401.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=318

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS N LR+HV+EVA G D++ESI  FARRRQRGVCV+S +GTVTNVT
Sbjct  109  SKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESITAFARRRQRGVCVLSGAGTVTNVT  168

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++ GAV+ALHGRFEILSL+G+FLP P+PP +TGLT+YLAGGQGQVVGGSVVG+L A
Sbjct  169  LRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALTA  228

Query  361  agPVMVIGSTFSNATYER  414
            AGPV+++ ++F+NA YER
Sbjct  229  AGPVVIMAASFANAVYER  246



>gb|KDP28740.1| hypothetical protein JCGZ_14511 [Jatropha curcas]
Length=308

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNK KPPI +TRDS NALRSHV+E+A+G D+ ES++ FARRRQRGVC++S +GTVTNVT
Sbjct  94   SKNKAKPPIIITRDSANALRSHVMEIANGCDIMESVSTFARRRQRGVCILSGTGTVTNVT  153

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL+G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG L+A
Sbjct  154  LRQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLLA  213

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  214  SGPVVIMAASFGNAAYER  231



>ref|XP_008371927.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=322

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +T++SPNALRSHVLE++SG+D+ +SIA FA+RR RGV V+S SG V NVT
Sbjct  105  SKNKPKPPIVITKESPNALRSHVLEISSGSDIVDSIATFAQRRHRGVSVLSGSGIVANVT  164

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP+AP  V+ LHGRFEILS++GAFLP PSPPG+TGLT+YLAGGQGQVVGG+V+G+LVA
Sbjct  165  LRQPAAPTGVITLHGRFEILSMSGAFLPSPSPPGATGLTVYLAGGQGQVVGGTVMGALVA  224

Query  361  agPVMVIGSTFSNATYER  414
            +GPVMVI +TF+NATYER
Sbjct  225  SGPVMVIAATFTNATYER  242



>ref|XP_003573204.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=312

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS N LR+HV+EVA G D++ESI  FARRRQRGVCV+S +GTVTNVT
Sbjct  106  SKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESITAFARRRQRGVCVLSGAGTVTNVT  165

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++ GAV+ALHGRFEILSL+G+FLP P+PP +TGLT+YLAGGQGQVVGGSVVG+L A
Sbjct  166  LRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALTA  225

Query  361  agPVMVIGSTFSNATYER  414
            AGPV+++ ++F+NA YER
Sbjct  226  AGPVVIMAASFANAVYER  243



>ref|NP_001049682.1| Os03g0270000 [Oryza sativa Japonica Group]
 gb|AAP06862.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP06928.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF95202.1| DNA-binding protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11596.1| Os03g0270000 [Oryza sativa Japonica Group]
 gb|EAY89405.1| hypothetical protein OsI_10910 [Oryza sativa Indica Group]
 dbj|BAG88018.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97544.1| unnamed protein product [Oryza sativa Japonica Group]
Length=258

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 1/139 (1%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPP+ VTR+SPNA+RSHVLE+ASGAD+ E+IA F+RRRQRGV V+S SG VTNVT
Sbjct  54   SKNKPKPPVVVTRESPNAMRSHVLEIASGADIVEAIAGFSRRRQRGVSVLSGSGAVTNVT  113

Query  181  LRQPSAPG-AVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslv  357
            LRQP+  G A +AL GRFEILS++GAFLP P+PPG+TGL +YLAGGQGQVVGGSV+G L+
Sbjct  114  LRQPAGTGAAAVALRGRFEILSMSGAFLPAPAPPGATGLAVYLAGGQGQVVGGSVMGELI  173

Query  358  aagPVMVIGSTFSNATYER  414
            A+GPVMVI +TF NATYER
Sbjct  174  ASGPVMVIAATFGNATYER  192



>ref|XP_004306909.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=325

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNK KPPI +TRDS NALRSHV+EVA+G D+ +S++ FARRRQRGVC++S SGTVTNVT
Sbjct  103  SKNKAKPPIIITRDSANALRSHVMEVANGCDIMDSVSTFARRRQRGVCILSGSGTVTNVT  162

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++PGAV+ LHGRFEILSL+G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG L+A
Sbjct  163  LRQPASPGAVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLLA  222

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++F NA YER
Sbjct  223  SGPVVIMAASFGNAAYER  240



>ref|XP_010433987.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=324

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 150/215 (70%), Gaps = 12/215 (6%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NALR+HV+E+  G D+ ES+A FARRRQRGVCVMS +G VTNVT
Sbjct  113  SKNKPKPPIIITRDSANALRTHVMEIGDGCDLVESVATFARRRQRGVCVMSGTGNVTNVT  172

Query  181  LRQPS---APGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgs  351
            +RQP    +PG+V++LHGRFEILSL+G+FLP P+PP +TGL++YLAGGQGQVVGGSVVG 
Sbjct  173  IRQPGSHPSPGSVVSLHGRFEILSLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGP  232

Query  352  lvaagPVMVIGSTFSNATYERlplepdeeeaaaataepqlggggspppgmasagagmgdp  531
            L+ AGPV+V+ ++FSNA YER    P EE+          GGGGS               
Sbjct  233  LLCAGPVVVMAASFSNAAYER---LPLEEDEMQTPVHGGGGGGGSMESPPMMGQQLQHQQ  289

Query  532  spMPGVYNLPPNMVAS------NEAFAWAHGRPPY  618
              M G + LPPN++ S      ++   W+ GRPPY
Sbjct  290  QAMSGHHGLPPNLLGSVQLQQQHDQSYWSTGRPPY  324



>ref|XP_003549894.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=287

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS NA+R+H++EVA G D+ ES+++FAR+RQRG+C+MS +GTVTNVT
Sbjct  82   SKNKPKPPIIITRDSANAMRTHMMEVADGYDIVESVSEFARKRQRGICIMSGTGTVTNVT  141

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++ G+V+ LHGRFEILSL+G+FLP P+PP ++GLTIYLAGGQGQVVGGSVVG+LVA
Sbjct  142  LRQPASSGSVVTLHGRFEILSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLVA  201

Query  361  agPVMVIGSTFSNATYER  414
            +GPV+++ ++FSNA YER
Sbjct  202  SGPVVIMAASFSNAAYER  219



>ref|NP_001046754.1| Os02g0448000 [Oryza sativa Japonica Group]
 dbj|BAD28974.1| putative DNA-binding protein AT-hook 2 [Oryza sativa Japonica 
Group]
 dbj|BAF08668.1| Os02g0448000 [Oryza sativa Japonica Group]
 gb|EAY85693.1| hypothetical protein OsI_07061 [Oryza sativa Indica Group]
 gb|EAZ22891.1| hypothetical protein OsJ_06576 [Oryza sativa Japonica Group]
Length=316

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS N LR+HV+EVA G D++ESI  FARRRQRGVCV+S +GTVTNVT
Sbjct  106  SKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESITTFARRRQRGVCVLSGAGTVTNVT  165

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++ GAV+ALHGRFEILSL+G+FLP P+PP +TGLT+YLAGGQGQVVGGSVVG+L A
Sbjct  166  LRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALTA  225

Query  361  agPVMVIGSTFSNATYER  414
            AGPV+++ ++F+NA YER
Sbjct  226  AGPVVIMAASFANAVYER  243



>gb|AIV43385.1| AHL protein [Triticum aestivum]
Length=256

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = +1

Query  4    KNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVTL  183
            KNKPKPP+ VTR+SPNA+RSHVLE+ASGAD+ E+IA F+RRRQRGV V+S SG VTNVTL
Sbjct  54   KNKPKPPVVVTRESPNAMRSHVLEIASGADIVEAIAAFSRRRQRGVSVLSGSGAVTNVTL  113

Query  184  RQPSAPG-AVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            RQP+  G A +AL GRFEILSL+GAFLP P+PPG+TGL +YLAGGQGQVVGGSV+G L+A
Sbjct  114  RQPAGTGAAAVALRGRFEILSLSGAFLPAPAPPGATGLAVYLAGGQGQVVGGSVMGELLA  173

Query  361  agPVMVIGSTFSNATYER  414
            +GPVMVI +TF NATYER
Sbjct  174  SGPVMVIAATFGNATYER  191



>ref|XP_002451872.1| hypothetical protein SORBIDRAFT_04g009050 [Sorghum bicolor]
 gb|EES04848.1| hypothetical protein SORBIDRAFT_04g009050 [Sorghum bicolor]
Length=327

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS N LR+HV+EVA G D++ESI  FARRRQRGVCV+S +GTVTNVT
Sbjct  116  SKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESITAFARRRQRGVCVLSGAGTVTNVT  175

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++ GAV+ALHGRFEILSL+G+FLP P+PP +TGLT+YLAGGQGQVVGGSVVG+L A
Sbjct  176  LRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALTA  235

Query  361  agPVMVIGSTFSNATYER  414
            AGPV+++ ++F+NA YER
Sbjct  236  AGPVVIMAASFANAVYER  253



>ref|XP_008233653.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=326

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +T++SPNALRSHVLE++SG+D+ +SIA FA+RR RGV V+S SG V NVT
Sbjct  107  SKNKPKPPIIITKESPNALRSHVLEISSGSDIVDSIATFAQRRHRGVSVLSGSGIVANVT  166

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LR P+AP  V+ LHGRFEILSL+GAFLP PSPPG+TGLT+YLAGGQGQVVGG+V+G+LVA
Sbjct  167  LRHPAAPSGVITLHGRFEILSLSGAFLPSPSPPGATGLTVYLAGGQGQVVGGTVMGALVA  226

Query  361  agPVMVIGSTFSNATYER  414
            +GPVMVI +TF+NATYER
Sbjct  227  SGPVMVIAATFTNATYER  244



>ref|NP_001146992.1| DNA binding protein [Zea mays]
 gb|ACG24948.1| DNA binding protein [Zea mays]
 gb|AFW65915.1| DNA binding protein [Zea mays]
Length=320

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    SKNKPKPPIFVTRDSPNALRSHVLEVASGADVAESIAQFARRRQRGVCVMSASGTVTNVT  180
            SKNKPKPPI +TRDS N LR+HV+EVA G D++ES+  FARRRQRGVCV+S +GTVTNVT
Sbjct  110  SKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESVTAFARRRQRGVCVLSGAGTVTNVT  169

Query  181  LRQPSAPGAVMALHGRFEILSLTGAFlpgpsppgstgltIYlaggqgqvvggsvvgslva  360
            LRQP++ GAV+ALHGRFEILSL+G+FLP P+PP +TGLT+YLAGGQGQVVGGSVVG+L A
Sbjct  170  LRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALTA  229

Query  361  agPVMVIGSTFSNATYER  414
            AGPV+V+ ++F+NA YER
Sbjct  230  AGPVVVMAASFANAVYER  247



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1590661965355