BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19891_g1_i1 len=1586 path=[1966:0-1067 3034:1068-1585]

Length=1586
                                                                      Score     E

ref|XP_009597152.1|  PREDICTED: probable protein phosphatase 2C 34      509   1e-174   
emb|CDO98822.1|  unnamed protein product                                508   4e-174   
ref|XP_004229276.1|  PREDICTED: probable protein phosphatase 2C 34      503   3e-172   
ref|XP_009778679.1|  PREDICTED: probable protein phosphatase 2C 34      502   1e-171   
ref|XP_006354291.1|  PREDICTED: probable protein phosphatase 2C 3...    499   9e-171   
ref|XP_011091017.1|  PREDICTED: probable protein phosphatase 2C 34      486   2e-165   
ref|XP_007035669.1|  Phosphatase 2C family protein isoform 1            461   1e-155   
ref|XP_002272978.2|  PREDICTED: probable protein phosphatase 2C 34      459   7e-155   Vitis vinifera
ref|XP_002315485.1|  hypothetical protein POPTR_0010s00840g             459   8e-155   Populus trichocarpa [western balsam poplar]
gb|KDP27848.1|  hypothetical protein JCGZ_18928                         459   8e-155   
ref|XP_007031061.1|  Phosphatase 2C family protein isoform 1            457   3e-154   
gb|KHG01784.1|  hypothetical protein F383_10634                         457   3e-154   
emb|CBI22956.3|  unnamed protein product                                459   7e-154   
ref|XP_002516975.1|  protein phosphatase 2c, putative                   456   2e-153   Ricinus communis
ref|XP_007163346.1|  hypothetical protein PHAVU_001G227100g             453   9e-153   
ref|XP_006419491.1|  hypothetical protein CICLE_v10005158mg             454   9e-153   
ref|XP_006489025.1|  PREDICTED: probable protein phosphatase 2C 7...    453   1e-152   
ref|XP_006419490.1|  hypothetical protein CICLE_v10005158mg             454   2e-152   
gb|KHG02727.1|  putative phosphatase 2C 73 -like protein                450   2e-151   
ref|XP_002283583.1|  PREDICTED: probable protein phosphatase 2C 34      450   2e-151   Vitis vinifera
gb|KHN20262.1|  Hypothetical protein glysoja_023825                     449   3e-151   
ref|XP_011092105.1|  PREDICTED: probable protein phosphatase 2C 34      449   4e-151   
ref|XP_004494566.1|  PREDICTED: probable protein phosphatase 2C 7...    449   1e-150   
gb|KEH24500.1|  protein phosphatase 2C family protein                   449   1e-150   
ref|XP_006588446.1|  PREDICTED: uncharacterized protein LOC100794...    448   1e-150   
ref|XP_003626188.1|  hypothetical protein MTR_7g112490                  448   2e-150   
ref|XP_002512471.1|  protein phosphatase 2c, putative                   447   3e-150   Ricinus communis
ref|XP_010674092.1|  PREDICTED: probable protein phosphatase 2C 34      447   4e-150   
ref|XP_011007059.1|  PREDICTED: probable protein phosphatase 2C 41      447   5e-150   
gb|KHG21938.1|  putative phosphatase 2C 73 -like protein                446   6e-150   
ref|XP_006472147.1|  PREDICTED: probable protein phosphatase 2C 7...    446   7e-150   
ref|XP_004144769.1|  PREDICTED: probable protein phosphatase 2C 7...    446   7e-150   
ref|XP_006433478.1|  hypothetical protein CICLE_v10001565mg             446   8e-150   
ref|XP_008453907.1|  PREDICTED: probable protein phosphatase 2C 34      446   9e-150   
ref|NP_001242626.1|  uncharacterized protein LOC100794039               446   1e-149   
gb|KDO81764.1|  hypothetical protein CISIN_1g015633mg                   446   1e-149   
ref|XP_010024092.1|  PREDICTED: probable protein phosphatase 2C 34      445   2e-149   
ref|XP_002315484.1|  hypothetical protein POPTR_0010s00830g             442   2e-148   Populus trichocarpa [western balsam poplar]
ref|XP_009411656.1|  PREDICTED: probable protein phosphatase 2C 73      441   3e-148   
ref|XP_009603244.1|  PREDICTED: probable protein phosphatase 2C 34      442   5e-148   
ref|XP_010421561.1|  PREDICTED: probable protein phosphatase 2C 73      441   7e-148   
ref|XP_008775900.1|  PREDICTED: probable protein phosphatase 2C 34      440   1e-147   
ref|XP_009790307.1|  PREDICTED: probable protein phosphatase 2C 34      440   2e-147   
ref|XP_002318972.1|  phosphatase 2C family protein                      440   2e-147   Populus trichocarpa [western balsam poplar]
gb|KHN03336.1|  Hypothetical protein glysoja_004362                     440   2e-147   
ref|XP_003550418.1|  PREDICTED: probable protein phosphatase 2C 7...    440   2e-147   
ref|XP_010493963.1|  PREDICTED: probable protein phosphatase 2C 73      439   3e-147   
ref|XP_002872251.1|  hypothetical protein ARALYDRAFT_489539             440   3e-147   
ref|XP_010455072.1|  PREDICTED: probable protein phosphatase 2C 73      439   5e-147   
ref|XP_003554628.1|  PREDICTED: probable protein phosphatase 2C 7...    439   5e-147   
emb|CDP17222.1|  unnamed protein product                                437   2e-146   
ref|XP_006582948.1|  PREDICTED: uncharacterized protein LOC100817...    437   3e-146   
ref|XP_009611823.1|  PREDICTED: probable protein phosphatase 2C 3...    437   3e-146   
ref|XP_009611824.1|  PREDICTED: probable protein phosphatase 2C 3...    436   4e-146   
ref|XP_011023729.1|  PREDICTED: probable protein phosphatase 2C 34      436   4e-146   
ref|XP_010524853.1|  PREDICTED: probable protein phosphatase 2C 7...    436   4e-146   
ref|XP_008775678.1|  PREDICTED: probable protein phosphatase 2C 34      436   6e-146   
gb|KDP23431.1|  hypothetical protein JCGZ_23264                         436   1e-145   
ref|NP_001242855.1|  uncharacterized protein LOC100817397               435   1e-145   
ref|NP_568503.1|  putative protein phosphatase 2C 73                    435   3e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394930.1|  hypothetical protein EUTSA_v10004414mg             435   3e-145   
ref|XP_010921599.1|  PREDICTED: probable protein phosphatase 2C 73      434   4e-145   
dbj|BAC43045.1|  putative protein phosphatase 2C                        434   4e-145   
ref|XP_004508189.1|  PREDICTED: probable protein phosphatase 2C 3...    433   5e-145   
ref|XP_011036910.1|  PREDICTED: probable protein phosphatase 2C 34      434   6e-145   
gb|AAM64353.1|  protein phosphatase-like                                434   6e-145   
ref|XP_010094717.1|  putative protein phosphatase 2C 73                 434   7e-145   
ref|XP_002884522.1|  hypothetical protein ARALYDRAFT_477856             432   1e-144   
dbj|BAF01792.1|  protein phosphatase 2C like protein                    432   3e-144   
ref|XP_004296877.1|  PREDICTED: probable protein phosphatase 2C 3...    432   4e-144   
ref|XP_011007060.1|  PREDICTED: probable protein phosphatase 2C 34      432   4e-144   
ref|XP_010245469.1|  PREDICTED: probable protein phosphatase 2C 34      431   5e-144   
gb|KHN03955.1|  Hypothetical protein glysoja_022641                     431   5e-144   
ref|XP_009384412.1|  PREDICTED: probable protein phosphatase 2C 34      430   5e-144   
gb|KHF99107.1|  hypothetical protein F383_20162                         431   6e-144   
ref|XP_003556526.1|  PREDICTED: probable protein phosphatase 2C 7...    431   7e-144   
ref|XP_006344705.1|  PREDICTED: probable protein phosphatase 2C 7...    430   1e-143   
gb|AFK40530.1|  unknown                                                 430   2e-143   
gb|KEH32310.1|  catalytic/protein phosphatase type 2C                   429   3e-143   
ref|XP_004230268.1|  PREDICTED: probable protein phosphatase 2C 34      429   4e-143   
ref|XP_006382439.1|  phosphatase 2C family protein                      429   5e-143   
gb|KDO81763.1|  hypothetical protein CISIN_1g015633mg                   429   1e-142   
gb|ABK92926.1|  unknown                                                 427   1e-142   Populus trichocarpa [western balsam poplar]
emb|CDY19742.1|  BnaA09g03950D                                          428   1e-142   
ref|XP_009111736.1|  PREDICTED: probable protein phosphatase 2C 73      427   1e-142   
ref|XP_008370407.1|  PREDICTED: probable protein phosphatase 2C 34      427   2e-142   
gb|AFK41200.1|  unknown                                                 427   2e-142   
ref|NP_187215.1|  putative protein phosphatase 2C                       426   2e-142   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25013.1|  BnaC02g39950D                                          427   4e-142   
ref|XP_009129890.1|  PREDICTED: probable protein phosphatase 2C 73      427   4e-142   
ref|XP_007205376.1|  hypothetical protein PRUPE_ppa007304mg             426   5e-142   
ref|XP_006286743.1|  hypothetical protein CARUB_v10003011mg             426   7e-142   
ref|XP_010259459.1|  PREDICTED: probable protein phosphatase 2C 73      425   9e-142   
ref|XP_010546744.1|  PREDICTED: probable protein phosphatase 2C 73      425   1e-141   
emb|CDY53338.1|  BnaCnng24960D                                          424   4e-141   
gb|EYU37272.1|  hypothetical protein MIMGU_mgv1a008718mg                423   7e-141   
ref|XP_003591185.1|  hypothetical protein MTR_1g083690                  422   9e-141   
ref|XP_003521676.1|  PREDICTED: probable protein phosphatase 2C 73      422   1e-140   
ref|XP_010486021.1|  PREDICTED: probable protein phosphatase 2C 3...    423   2e-140   
gb|AFK47876.1|  unknown                                                 422   2e-140   
ref|XP_010486022.1|  PREDICTED: probable protein phosphatase 2C 3...    422   3e-140   
ref|XP_009124867.1|  PREDICTED: probable protein phosphatase 2C 34      420   5e-140   
ref|XP_008388508.1|  PREDICTED: probable protein phosphatase 2C 34      421   7e-140   
ref|XP_007223348.1|  hypothetical protein PRUPE_ppa007423mg             420   1e-139   
ref|XP_010109579.1|  putative protein phosphatase 2C 73                 419   2e-139   
ref|XP_010524855.1|  PREDICTED: probable protein phosphatase 2C 7...    417   3e-139   
ref|XP_008223256.1|  PREDICTED: probable protein phosphatase 2C 34      419   3e-139   
ref|XP_007154313.1|  hypothetical protein PHAVU_003G108200g             419   4e-139   
ref|XP_006297924.1|  hypothetical protein CARUB_v10013967mg             416   5e-138   
ref|XP_009758950.1|  PREDICTED: probable protein phosphatase 2C 34      415   8e-138   
ref|XP_009338220.1|  PREDICTED: probable protein phosphatase 2C 34      415   1e-137   
emb|CDY05554.1|  BnaA02g31370D                                          413   6e-137   
ref|XP_010464096.1|  PREDICTED: probable protein phosphatase 2C 3...    413   1e-136   
ref|XP_010430361.1|  PREDICTED: probable protein phosphatase 2C 34      412   2e-136   
ref|XP_010938350.1|  PREDICTED: probable protein phosphatase 2C 7...    410   3e-136   
ref|XP_010464095.1|  PREDICTED: probable protein phosphatase 2C 3...    414   3e-136   
ref|XP_004302264.1|  PREDICTED: probable protein phosphatase 2C 3...    412   3e-136   
ref|XP_007144971.1|  hypothetical protein PHAVU_007G198700g             410   5e-136   
gb|KEH37184.1|  catalytic/protein phosphatase type 2C                   410   6e-136   
dbj|BAB84697.1|  protein phosphatase 2C                                 408   3e-135   
ref|XP_006408045.1|  hypothetical protein EUTSA_v10020968mg             408   5e-135   
gb|EYU43985.1|  hypothetical protein MIMGU_mgv1a021301mg                404   2e-133   
ref|XP_008351175.1|  PREDICTED: probable protein phosphatase 2C 34      404   3e-133   
ref|XP_009369998.1|  PREDICTED: probable protein phosphatase 2C 34      404   3e-133   
ref|XP_008390615.1|  PREDICTED: probable protein phosphatase 2C 34      404   4e-133   
ref|XP_010938349.1|  PREDICTED: probable protein phosphatase 2C 7...    402   9e-133   
gb|AGV54512.1|  protein phosphatase 2C 73-like protein                  401   3e-132   
ref|XP_010670936.1|  PREDICTED: probable protein phosphatase 2C 34      401   3e-132   
gb|KEH37182.1|  catalytic/protein phosphatase type 2C                   399   8e-132   
ref|XP_010487547.1|  PREDICTED: probable protein phosphatase 2C 41      397   6e-131   
ref|XP_010465704.1|  PREDICTED: probable protein phosphatase 2C 41      397   9e-131   
ref|XP_008245630.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    397   1e-130   
ref|NP_188303.1|  putative protein phosphatase 2C                       396   1e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004962337.1|  PREDICTED: probable protein phosphatase 2C 4...    395   2e-130   
gb|ABH11524.1|  PP2C                                                    394   7e-130   
ref|XP_002883028.1|  hypothetical protein ARALYDRAFT_479146             394   1e-129   
emb|CDY50503.1|  BnaC01g44410D                                          391   1e-128   
ref|XP_010504668.1|  PREDICTED: probable protein phosphatase 2C 41      391   1e-128   
emb|CDY67911.1|  BnaA01g37010D                                          390   2e-128   
ref|XP_006298033.1|  hypothetical protein CARUB_v10014078mg             390   3e-128   
ref|XP_009114164.1|  PREDICTED: probable protein phosphatase 2C 41      389   6e-128   
ref|XP_006406805.1|  hypothetical protein EUTSA_v10021041mg             387   4e-127   
ref|XP_008450566.1|  PREDICTED: probable protein phosphatase 2C 34      387   1e-126   
ref|XP_006855364.1|  hypothetical protein AMTR_s00057p00118530          386   8e-126   
gb|KEH37183.1|  catalytic/protein phosphatase type 2C                   381   3e-124   
gb|KDO81765.1|  hypothetical protein CISIN_1g015633mg                   378   3e-124   
ref|XP_006433477.1|  hypothetical protein CICLE_v10001565mg             377   4e-124   
dbj|BAH20266.1|  AT3G05640                                              377   8e-124   Arabidopsis thaliana [mouse-ear cress]
emb|CDX95903.1|  BnaC05g36540D                                          378   1e-123   
ref|XP_003568624.1|  PREDICTED: probable protein phosphatase 2C 48      377   2e-123   
ref|XP_002440955.1|  hypothetical protein SORBIDRAFT_09g017821          377   3e-123   Sorghum bicolor [broomcorn]
gb|KGN66023.1|  hypothetical protein Csa_1G568520                       378   3e-123   
ref|XP_009146057.1|  PREDICTED: probable protein phosphatase 2C 41      377   4e-123   
ref|XP_004135769.1|  PREDICTED: probable protein phosphatase 2C 7...    377   5e-123   
dbj|BAJ89888.1|  predicted protein                                      375   2e-122   
dbj|BAJ94796.1|  predicted protein                                      374   3e-122   
ref|XP_004157287.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    375   4e-122   
emb|CDX92097.1|  BnaA05g23100D                                          373   1e-121   
dbj|BAK07762.1|  predicted protein                                      372   2e-121   
ref|NP_001151041.1|  catalytic/ protein phosphatase type 2C             369   7e-120   Zea mays [maize]
gb|EPS69184.1|  hypothetical protein M569_05582                         368   2e-119   
ref|XP_004494568.1|  PREDICTED: probable protein phosphatase 2C 7...    366   3e-119   
ref|XP_003568623.1|  PREDICTED: probable protein phosphatase 2C 48      366   6e-119   
ref|NP_001241841.1|  putative protein phosphatase 2C family protein     366   1e-118   
ref|XP_004150097.1|  PREDICTED: probable protein phosphatase 2C 7...    360   2e-116   
ref|NP_001055303.1|  Os05g0358500                                       359   4e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004494569.1|  PREDICTED: probable protein phosphatase 2C 7...    353   7e-115   
gb|EMS64498.1|  putative protein phosphatase 2C 48                      356   2e-114   
ref|XP_010524559.1|  PREDICTED: probable protein phosphatase 2C 4...    353   2e-113   
ref|XP_010524561.1|  PREDICTED: probable protein phosphatase 2C 4...    350   2e-112   
ref|XP_006297925.1|  hypothetical protein CARUB_v10013967mg             345   4e-111   
ref|XP_008458396.1|  PREDICTED: probable protein phosphatase 2C 73      344   3e-110   
ref|XP_007031062.1|  Phosphatase 2C family protein isoform 2            339   3e-109   
gb|EMT18540.1|  Putative protein phosphatase 2C 48                      335   2e-106   
ref|NP_001030713.1|  putative protein phosphatase 2C                    327   6e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002986464.1|  hypothetical protein SELMODRAFT_235030             316   8e-98    
ref|XP_002978948.1|  hypothetical protein SELMODRAFT_153020             316   9e-98    
gb|EMT22010.1|  Putative protein phosphatase 2C 48                      310   2e-97    
ref|XP_006655232.1|  PREDICTED: probable protein phosphatase 2C 4...    306   2e-96    
ref|XP_010027087.1|  PREDICTED: probable protein phosphatase 2C 41      306   3e-96    
gb|EYU39712.1|  hypothetical protein MIMGU_mgv1a008325mg                309   3e-96    
ref|XP_002992818.1|  hypothetical protein SELMODRAFT_187001             308   6e-95    
ref|XP_002987553.1|  hypothetical protein SELMODRAFT_183192             308   1e-94    
ref|XP_010549876.1|  PREDICTED: probable protein phosphatase 2C 33      309   4e-94    
ref|XP_008244425.1|  PREDICTED: probable protein phosphatase 2C 33      304   7e-94    
ref|XP_011084661.1|  PREDICTED: probable protein phosphatase 2C 33      305   3e-93    
dbj|BAJ34625.1|  unnamed protein product                                296   5e-93    
ref|XP_002325473.1|  phosphatase 2C family protein                      303   2e-92    Populus trichocarpa [western balsam poplar]
ref|XP_009416608.1|  PREDICTED: probable protein phosphatase 2C 33      300   2e-92    
emb|CDY33350.1|  BnaC05g12330D                                          301   4e-92    
ref|XP_008777864.1|  PREDICTED: probable protein phosphatase 2C 3...    302   4e-92    
ref|XP_008441722.1|  PREDICTED: probable protein phosphatase 2C 33      301   4e-92    
gb|KCW61207.1|  hypothetical protein EUGRSUZ_H03968                     295   6e-92    
gb|KHG03244.1|  putative phosphatase 2C 33 -like protein                301   6e-92    
gb|KDP26876.1|  hypothetical protein JCGZ_18034                         301   7e-92    
ref|XP_004497423.1|  PREDICTED: probable protein phosphatase 2C 3...    296   8e-92    
ref|XP_010673906.1|  PREDICTED: probable protein phosphatase 2C 33      300   9e-92    
ref|XP_009415101.1|  PREDICTED: probable protein phosphatase 2C 33      298   9e-92    
ref|XP_009149058.1|  PREDICTED: probable protein phosphatase 2C 6       300   1e-91    
ref|XP_003627112.1|  Protein phosphatase 2c                             297   1e-91    
emb|CDY35072.1|  BnaA06g10820D                                          300   2e-91    
ref|XP_007222732.1|  hypothetical protein PRUPE_ppa006494mg             297   2e-91    
gb|EYU39458.1|  hypothetical protein MIMGU_mgv1a005481mg                299   3e-91    
ref|XP_002514837.1|  protein phosphatase-2c, putative                   300   3e-91    Ricinus communis
ref|XP_011013066.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    300   3e-91    
ref|XP_006416840.1|  hypothetical protein EUTSA_v10007474mg             299   3e-91    
emb|CBI17615.3|  unnamed protein product                                298   4e-91    
ref|XP_002277393.1|  PREDICTED: probable protein phosphatase 2C 33      299   6e-91    Vitis vinifera
ref|XP_010247822.1|  PREDICTED: probable protein phosphatase 2C 33      298   1e-90    
ref|XP_004249060.1|  PREDICTED: probable protein phosphatase 2C 65      296   2e-90    
ref|XP_011077163.1|  PREDICTED: probable protein phosphatase 2C 33      298   2e-90    
gb|KHG26837.1|  putative phosphatase 2C 33 -like protein                297   2e-90    
gb|ABR16400.1|  unknown                                                 298   3e-90    Picea sitchensis
gb|ACN40371.1|  unknown                                                 298   3e-90    Picea sitchensis
ref|XP_004296680.1|  PREDICTED: probable protein phosphatase 2C 3...    295   3e-90    
ref|XP_006363628.1|  PREDICTED: probable protein phosphatase 2C 3...    295   5e-90    
gb|ABR16508.1|  unknown                                                 297   5e-90    Picea sitchensis
ref|XP_004239696.1|  PREDICTED: probable protein phosphatase 2C 33      295   7e-90    
ref|XP_010272535.1|  PREDICTED: probable protein phosphatase 2C 66      296   1e-89    
ref|XP_009622508.1|  PREDICTED: probable protein phosphatase 2C 65      294   1e-89    
ref|XP_007139720.1|  hypothetical protein PHAVU_008G053700g             295   1e-89    
ref|XP_006857543.1|  hypothetical protein AMTR_s00061p00041440          296   2e-89    
emb|CBI39869.3|  unnamed protein product                                293   2e-89    
gb|KDO54036.1|  hypothetical protein CISIN_1g011218mg                   293   2e-89    
gb|KDP22816.1|  hypothetical protein JCGZ_00403                         292   2e-89    
ref|XP_010928162.1|  PREDICTED: probable protein phosphatase 2C 66      296   3e-89    
ref|XP_008648262.1|  PREDICTED: putative protein phosphatase 2C f...    291   3e-89    
emb|CDX88554.1|  BnaC06g39980D                                          294   3e-89    
ref|XP_009800840.1|  PREDICTED: probable protein phosphatase 2C 65      293   4e-89    
ref|XP_010089720.1|  putative protein phosphatase 2C 6                  293   5e-89    
ref|XP_010476727.1|  PREDICTED: probable protein phosphatase 2C 6       293   6e-89    
ref|XP_001764661.1|  predicted protein                                  293   6e-89    
ref|XP_006301326.1|  hypothetical protein CARUB_v10021735mg             293   6e-89    
gb|KHG02830.1|  hypothetical protein F383_26202                         294   9e-89    
ref|XP_007140186.1|  hypothetical protein PHAVU_008G091200g             291   1e-88    
gb|KDO54033.1|  hypothetical protein CISIN_1g011218mg                   293   1e-88    
ref|XP_008218455.1|  PREDICTED: probable protein phosphatase 2C 33      293   1e-88    
ref|XP_006480437.1|  PREDICTED: probable protein phosphatase 2C 3...    293   1e-88    
ref|XP_006847475.1|  hypothetical protein AMTR_s00163p00051750          292   2e-88    
ref|XP_001764662.1|  predicted protein                                  289   2e-88    
ref|XP_003555649.1|  PREDICTED: probable protein phosphatase 2C 3...    288   2e-88    
ref|NP_178081.2|  putative protein phosphatase 2C 18                    292   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010644704.1|  PREDICTED: probable protein phosphatase 2C 6       293   3e-88    
ref|XP_002889260.1|  phosphatase 2C family protein                      292   3e-88    
ref|XP_008384641.1|  PREDICTED: probable protein phosphatase 2C 6       293   4e-88    
ref|XP_009406352.1|  PREDICTED: probable protein phosphatase 2C 33      288   4e-88    
ref|XP_002526696.1|  protein phosphatase-2c, putative                   290   5e-88    Ricinus communis
ref|XP_008388813.1|  PREDICTED: probable protein phosphatase 2C 33      291   6e-88    
ref|XP_010485598.1|  PREDICTED: probable protein phosphatase 2C 3...    291   6e-88    
ref|XP_004249617.2|  PREDICTED: probable protein phosphatase 2C 65      288   7e-88    
gb|KDO73929.1|  hypothetical protein CISIN_1g011968mg                   290   9e-88    
ref|XP_004138909.1|  PREDICTED: probable protein phosphatase 2C 3...    290   1e-87    
ref|XP_010429862.1|  PREDICTED: probable protein phosphatase 2C 1...    290   1e-87    
ref|XP_006345821.1|  PREDICTED: probable protein phosphatase 2C 3...    290   1e-87    
gb|KDO73930.1|  hypothetical protein CISIN_1g011968mg                   289   1e-87    
ref|XP_009374430.1|  PREDICTED: probable protein phosphatase 2C 6       291   1e-87    
ref|XP_010907919.1|  PREDICTED: probable protein phosphatase 2C 33      290   1e-87    
ref|NP_173072.1|  putative protein phosphatase 2C 6                     290   1e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128377.1|  PREDICTED: probable protein phosphatase 2C 1...    289   2e-87    
emb|CDP04194.1|  unnamed protein product                                290   2e-87    
ref|XP_007142603.1|  hypothetical protein PHAVU_007G001500g             288   2e-87    
ref|XP_007205041.1|  hypothetical protein PRUPE_ppa004533mg             290   3e-87    
gb|KDP29523.1|  hypothetical protein JCGZ_19236                         290   3e-87    
ref|XP_006474744.1|  PREDICTED: probable protein phosphatase 2C 6...    290   3e-87    
ref|XP_010459160.1|  PREDICTED: probable protein phosphatase 2C 6       289   3e-87    
ref|XP_006339274.1|  PREDICTED: probable protein phosphatase 2C 6...    288   3e-87    
ref|XP_010472827.1|  PREDICTED: probable protein phosphatase 2C 18      289   3e-87    
ref|XP_011095082.1|  PREDICTED: probable protein phosphatase 2C 65      287   3e-87    
ref|XP_010463699.1|  PREDICTED: probable protein phosphatase 2C 33      289   3e-87    
ref|XP_010913240.1|  PREDICTED: probable protein phosphatase 2C 66      290   4e-87    
ref|XP_006452792.1|  hypothetical protein CICLE_v10007997mg             290   5e-87    
ref|XP_007029293.1|  Phosphatase 2C family protein isoform 1            288   5e-87    
ref|XP_009371152.1|  PREDICTED: probable protein phosphatase 2C 33      286   5e-87    
ref|XP_009147325.1|  PREDICTED: probable protein phosphatase 2C 33      287   6e-87    
ref|XP_006306059.1|  hypothetical protein CARUB_v10011374mg             288   6e-87    
emb|CDY53743.1|  BnaAnng12710D                                          288   7e-87    
emb|CDX87369.1|  BnaA07g35040D                                          288   7e-87    
ref|XP_003533680.1|  PREDICTED: probable protein phosphatase 2C 7...    286   7e-87    
gb|KHN29557.1|  Hypothetical protein glysoja_005281                     286   9e-87    
ref|XP_010500496.1|  PREDICTED: probable protein phosphatase 2C 33      288   9e-87    
ref|XP_004159488.1|  PREDICTED: probable protein phosphatase 2C 6...    289   9e-87    
ref|XP_003534509.1|  PREDICTED: probable protein phosphatase 2C 3...    288   9e-87    
ref|XP_007023520.1|  Phosphatase 2C family protein isoform 1            288   1e-86    
ref|XP_001753087.1|  predicted protein                                  288   1e-86    
ref|XP_004492843.1|  PREDICTED: probable protein phosphatase 2C 3...    288   1e-86    
ref|XP_003552448.1|  PREDICTED: probable protein phosphatase 2C 3...    287   1e-86    
ref|XP_010931503.1|  PREDICTED: probable protein phosphatase 2C 73      286   1e-86    
ref|XP_002890154.1|  phosphatase 2C family protein                      288   1e-86    
ref|XP_008337529.1|  PREDICTED: probable protein phosphatase 2C 33      285   1e-86    
ref|XP_006350422.1|  PREDICTED: probable protein phosphatase 2C 3...    290   2e-86    
ref|XP_009390619.1|  PREDICTED: probable protein phosphatase 2C 66      288   2e-86    
ref|XP_009106686.1|  PREDICTED: probable protein phosphatase 2C 18      287   2e-86    
ref|XP_008246536.1|  PREDICTED: probable protein phosphatase 2C 6       288   2e-86    
gb|KEH21866.1|  phosphatase 2C family protein                           285   2e-86    
ref|XP_009118526.1|  PREDICTED: probable protein phosphatase 2C 33      286   2e-86    
gb|EYU41970.1|  hypothetical protein MIMGU_mgv1a017784mg                285   2e-86    
ref|XP_008354142.1|  PREDICTED: probable protein phosphatase 2C 6       288   2e-86    
ref|XP_009379076.1|  PREDICTED: probable protein phosphatase 2C 6       288   2e-86    
ref|XP_004237585.1|  PREDICTED: probable protein phosphatase 2C 33      291   3e-86    
emb|CDY51537.1|  BnaA05g33370D                                          288   3e-86    
ref|XP_009602255.1|  PREDICTED: probable protein phosphatase 2C 65      285   3e-86    
ref|XP_009629131.1|  PREDICTED: probable protein phosphatase 2C 33      286   3e-86    
ref|XP_010069369.1|  PREDICTED: probable protein phosphatase 2C 33      283   4e-86    
ref|XP_008448968.1|  PREDICTED: probable protein phosphatase 2C 6       287   4e-86    
ref|XP_009413563.1|  PREDICTED: probable protein phosphatase 2C 3...    286   4e-86    
ref|XP_004147974.1|  PREDICTED: probable protein phosphatase 2C 6...    287   4e-86    
emb|CDY37649.1|  BnaC04g29910D                                          284   5e-86    
ref|XP_003621670.1|  Protein phosphatase 2c                             285   6e-86    
ref|XP_009401502.1|  PREDICTED: probable protein phosphatase 2C 66      286   6e-86    
emb|CDY53741.1|  BnaAnng12690D                                          285   6e-86    
ref|XP_010278294.1|  PREDICTED: probable protein phosphatase 2C 52      285   8e-86    
ref|XP_011077507.1|  PREDICTED: probable protein phosphatase 2C 65      283   9e-86    
ref|XP_008445704.1|  PREDICTED: probable protein phosphatase 2C 33      282   1e-85    
emb|CDY28706.1|  BnaCnng05920D                                          286   1e-85    
ref|XP_004294864.1|  PREDICTED: probable protein phosphatase 2C 6...    286   1e-85    
ref|XP_002319268.2|  phosphatase 2C family protein                      285   1e-85    
ref|XP_009340399.1|  PREDICTED: probable protein phosphatase 2C 33      285   1e-85    
ref|XP_002264900.2|  PREDICTED: probable protein phosphatase 2C 65      283   1e-85    
ref|XP_004140875.1|  PREDICTED: probable protein phosphatase 2C 3...    282   2e-85    
ref|XP_010928896.1|  PREDICTED: probable protein phosphatase 2C 66      286   2e-85    
ref|XP_009340340.1|  PREDICTED: probable protein phosphatase 2C 33      285   2e-85    
ref|XP_011009964.1|  PREDICTED: probable protein phosphatase 2C 33      284   2e-85    
ref|XP_008370833.1|  PREDICTED: probable protein phosphatase 2C 33      284   2e-85    
emb|CDP13625.1|  unnamed protein product                                285   2e-85    
gb|KHN40686.1|  Hypothetical protein glysoja_001184                     282   2e-85    
ref|XP_010093563.1|  putative protein phosphatase 2C 65                 283   2e-85    
ref|XP_008782938.1|  PREDICTED: probable protein phosphatase 2C 6...    286   2e-85    
emb|CDY63003.1|  BnaAnng18490D                                          282   2e-85    
ref|XP_003624186.1|  Protein phosphatase 2c                             284   3e-85    
ref|XP_009124235.1|  PREDICTED: probable protein phosphatase 2C 74      282   3e-85    
ref|XP_009415964.1|  PREDICTED: probable protein phosphatase 2C 33      282   3e-85    
ref|XP_002305698.2|  phosphatase 2C family protein                      283   3e-85    
ref|XP_006346061.1|  PREDICTED: probable protein phosphatase 2C 6...    285   3e-85    
gb|KHN13836.1|  Hypothetical protein glysoja_016120                     282   4e-85    
ref|XP_008806175.1|  PREDICTED: probable protein phosphatase 2C 66      285   4e-85    
ref|XP_003552650.1|  PREDICTED: probable protein phosphatase 2C 3...    282   4e-85    
ref|XP_011035437.1|  PREDICTED: probable protein phosphatase 2C 66      283   5e-85    
gb|KCW84581.1|  hypothetical protein EUGRSUZ_B01420                     281   5e-85    
ref|XP_010450435.1|  PREDICTED: probable protein phosphatase 2C 74      282   5e-85    
ref|XP_010070158.1|  PREDICTED: probable protein phosphatase 2C 33      284   5e-85    
ref|XP_004170792.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    280   6e-85    
ref|XP_010245945.1|  PREDICTED: probable protein phosphatase 2C 33      283   6e-85    
ref|XP_010529005.1|  PREDICTED: probable protein phosphatase 2C 74      286   7e-85    
ref|XP_009609263.1|  PREDICTED: probable protein phosphatase 2C 33      284   7e-85    
ref|XP_002309165.2|  hypothetical protein POPTR_0006s10580g             282   8e-85    
ref|XP_002884336.1|  phosphatase 2C family protein                      283   8e-85    
gb|AAV73837.1|  protein phosphatase 2c                                  283   9e-85    
ref|XP_004492511.1|  PREDICTED: probable protein phosphatase 2C 6...    281   1e-84    
ref|XP_010440790.1|  PREDICTED: probable protein phosphatase 2C 74      281   1e-84    
emb|CAN65584.1|  hypothetical protein VITISV_019794                     281   1e-84    
emb|CDX92009.1|  BnaC03g33110D                                          282   1e-84    
ref|XP_009766317.1|  PREDICTED: probable protein phosphatase 2C 52      281   1e-84    
ref|XP_003623414.1|  hypothetical protein MTR_7g070510                  281   1e-84    
gb|AAL31255.1|  AT5g36250/T30G6_11                                      281   1e-84    
ref|NP_001152031.1|  LOC100285668                                       283   1e-84    
ref|XP_009394985.1|  PREDICTED: probable protein phosphatase 2C 66      284   1e-84    
ref|XP_007205060.1|  hypothetical protein PRUPE_ppa004458mg             283   1e-84    
ref|NP_198474.1|  putative protein phosphatase 2C 74                    281   1e-84    
gb|AAL32574.1|  putative protein phosphatase-2C (PP2C)                  282   1e-84    
tpg|DAA47842.1|  TPA: putative protein phosphatase 2C family protein    283   1e-84    
ref|NP_186924.1|  putative protein phosphatase 2C 33                    282   1e-84    
ref|XP_010908969.1|  PREDICTED: probable protein phosphatase 2C 33      282   2e-84    
ref|XP_011007021.1|  PREDICTED: probable protein phosphatase 2C 6       282   2e-84    
ref|XP_002300600.2|  hypothetical protein POPTR_0001s47730g             282   2e-84    
ref|XP_010435503.1|  PREDICTED: probable protein phosphatase 2C 74      280   2e-84    
ref|XP_004243998.1|  PREDICTED: probable protein phosphatase 2C 6       282   2e-84    
ref|XP_011019056.1|  PREDICTED: probable protein phosphatase 2C 65      281   2e-84    
gb|EPS62214.1|  hypothetical protein M569_12579                         277   2e-84    
ref|XP_004302165.1|  PREDICTED: probable protein phosphatase 2C 3...    281   4e-84    
ref|XP_009782883.1|  PREDICTED: probable protein phosphatase 2C 65      280   4e-84    
ref|XP_007132652.1|  hypothetical protein PHAVU_011G113300g             280   4e-84    
ref|XP_008464241.1|  PREDICTED: probable protein phosphatase 2C 6...    280   4e-84    
gb|EEE63406.1|  hypothetical protein OsJ_18218                          275   4e-84    
ref|XP_009619304.1|  PREDICTED: probable protein phosphatase 2C 52      280   4e-84    
gb|KDO63278.1|  hypothetical protein CISIN_1g045692mg                   279   5e-84    
ref|XP_010558395.1|  PREDICTED: probable protein phosphatase 2C 6...    276   5e-84    
ref|XP_008341905.1|  PREDICTED: probable protein phosphatase 2C 52      280   6e-84    
ref|XP_008676760.1|  PREDICTED: putative protein phosphatase 2C f...    281   6e-84    
ref|XP_006481121.1|  PREDICTED: probable protein phosphatase 2C 6...    277   6e-84    
ref|XP_006408386.1|  hypothetical protein EUTSA_v10020601mg             280   7e-84    
gb|KFK30642.1|  hypothetical protein AALP_AA6G008500                    279   7e-84    
ref|NP_001065550.1|  Os11g0109000                                       278   7e-84    
gb|EMS64497.1|  putative protein phosphatase 2C 48                      278   7e-84    
ref|XP_002444805.1|  hypothetical protein SORBIDRAFT_07g028300          281   7e-84    
gb|EAZ17162.1|  hypothetical protein OsJ_32667                          278   7e-84    
ref|XP_010558393.1|  PREDICTED: probable protein phosphatase 2C 6...    276   7e-84    
ref|XP_006371587.1|  phosphatase 2C family protein                      280   8e-84    
ref|XP_010045969.1|  PREDICTED: probable protein phosphatase 2C 33      281   8e-84    
gb|EYU27523.1|  hypothetical protein MIMGU_mgv1a004849mg                281   8e-84    
ref|XP_010558391.1|  PREDICTED: probable protein phosphatase 2C 6...    277   8e-84    
ref|XP_004973821.1|  PREDICTED: probable protein phosphatase 2C 6...    281   8e-84    
ref|XP_002868461.1|  hypothetical protein ARALYDRAFT_493662             279   8e-84    
ref|XP_010264518.1|  PREDICTED: probable protein phosphatase 2C 6...    278   9e-84    
ref|XP_006297511.1|  hypothetical protein CARUB_v10013536mg             280   9e-84    
ref|XP_009766558.1|  PREDICTED: probable protein phosphatase 2C 33      281   9e-84    
ref|XP_011095667.1|  PREDICTED: probable protein phosphatase 2C 6       281   1e-83    
ref|XP_006283724.1|  hypothetical protein CARUB_v10004792mg             279   1e-83    
ref|XP_010061374.1|  PREDICTED: probable protein phosphatase 2C 6       281   1e-83    
ref|XP_011085339.1|  PREDICTED: probable protein phosphatase 2C 52      279   1e-83    
ref|XP_009627195.1|  PREDICTED: probable protein phosphatase 2C 6       280   1e-83    
ref|XP_010111089.1|  putative protein phosphatase 2C 33                 279   1e-83    
emb|CDP19943.1|  unnamed protein product                                278   1e-83    
ref|XP_010264516.1|  PREDICTED: probable protein phosphatase 2C 6...    278   1e-83    
emb|CDY49740.1|  BnaA02g19320D                                          293   1e-83    
ref|XP_006659550.1|  PREDICTED: probable protein phosphatase 2C 6...    278   2e-83    
ref|XP_009413564.1|  PREDICTED: probable protein phosphatase 2C 3...    279   2e-83    
ref|NP_001130320.1|  uncharacterized protein LOC100191414               277   2e-83    
ref|XP_004975270.1|  PREDICTED: probable protein phosphatase 2C 1...    280   2e-83    
ref|XP_011045478.1|  PREDICTED: probable protein phosphatase 2C 52      278   2e-83    
ref|XP_011032596.1|  PREDICTED: probable protein phosphatase 2C 65      278   2e-83    
ref|XP_003539901.1|  PREDICTED: probable protein phosphatase 2C 5...    278   2e-83    
ref|XP_003605716.1|  hypothetical protein MTR_4g037470                  278   3e-83    
ref|XP_011039750.1|  PREDICTED: probable protein phosphatase 2C 52      278   3e-83    
gb|EAY79673.1|  hypothetical protein OsI_34819                          276   3e-83    
ref|XP_010537844.1|  PREDICTED: probable protein phosphatase 2C 6       279   3e-83    
ref|XP_002517960.1|  protein phosphatase-2c, putative                   278   3e-83    
ref|XP_006828159.1|  hypothetical protein AMTR_s00023p00095420          275   3e-83    
ref|NP_001065952.2|  Os12g0108600                                       278   4e-83    
ref|XP_006366012.1|  PREDICTED: probable protein phosphatase 2C 5...    278   4e-83    
ref|XP_010268762.1|  PREDICTED: probable protein phosphatase 2C 1       278   4e-83    
ref|XP_006447330.1|  hypothetical protein CICLE_v10015132mg             278   5e-83    
gb|KDO40767.1|  hypothetical protein CISIN_1g012129mg                   277   5e-83    
ref|XP_008799822.1|  PREDICTED: probable protein phosphatase 2C 73      276   6e-83    
ref|XP_002323635.2|  hypothetical protein POPTR_0016s13560g             277   6e-83    
gb|EMS48353.1|  putative protein phosphatase 2C 73                      277   6e-83    
ref|XP_006395907.1|  hypothetical protein EUTSA_v10004207mg             276   6e-83    
ref|XP_004492043.1|  PREDICTED: probable protein phosphatase 2C 3...    276   6e-83    
gb|KHG11990.1|  hypothetical protein F383_16619                         277   8e-83    
ref|XP_003540353.1|  PREDICTED: probable protein phosphatase 2C 5...    277   9e-83    
ref|XP_006429502.1|  hypothetical protein CICLE_v10013751mg             278   9e-83    
ref|XP_009783863.1|  PREDICTED: probable protein phosphatase 2C 33      277   9e-83    
ref|XP_004248325.1|  PREDICTED: probable protein phosphatase 2C 6       279   1e-82    
dbj|BAJ88930.1|  predicted protein                                      275   1e-82    
ref|XP_004305101.1|  PREDICTED: probable protein phosphatase 2C 7...    276   1e-82    
gb|KHN04271.1|  Hypothetical protein glysoja_037951                     276   1e-82    
ref|XP_009793154.1|  PREDICTED: probable protein phosphatase 2C 6       278   1e-82    
ref|XP_006357501.1|  PREDICTED: probable protein phosphatase 2C 5...    276   1e-82    
ref|XP_003562890.1|  PREDICTED: probable protein phosphatase 2C 64      275   1e-82    
gb|KDP24167.1|  hypothetical protein JCGZ_25824                         276   1e-82    
gb|AFK36323.1|  unknown                                                 275   1e-82    
ref|XP_009618055.1|  PREDICTED: probable protein phosphatase 2C 6       278   2e-82    
gb|KHN41141.1|  Hypothetical protein glysoja_017185                     275   2e-82    
ref|XP_010100647.1|  putative protein phosphatase 2C 33                 275   2e-82    
ref|XP_008792186.1|  PREDICTED: probable protein phosphatase 2C 73      274   2e-82    
ref|XP_008455336.1|  PREDICTED: probable protein phosphatase 2C 5...    276   3e-82    
ref|XP_004136816.1|  PREDICTED: probable protein phosphatase 2C 5...    275   3e-82    
ref|XP_010257126.1|  PREDICTED: probable protein phosphatase 2C 73      276   3e-82    
ref|XP_009134702.1|  PREDICTED: probable protein phosphatase 2C 33      276   3e-82    
ref|XP_008370206.1|  PREDICTED: probable protein phosphatase 2C 65      275   3e-82    
gb|ABA96190.1|  protein phosphatase 2c, putative, expressed             278   3e-82    
ref|XP_002319366.1|  phosphatase 2C family protein                      275   3e-82    
gb|KHN31949.1|  Hypothetical protein glysoja_025783                     275   3e-82    
ref|XP_009623039.1|  PREDICTED: probable protein phosphatase 2C 52      275   3e-82    
ref|XP_003527445.1|  PREDICTED: probable protein phosphatase 2C 5...    275   3e-82    
ref|XP_009787955.1|  PREDICTED: probable protein phosphatase 2C 6...    276   3e-82    
gb|AAF68125.1|AC010793_20  F20B17.6                                     277   4e-82    
ref|XP_009128378.1|  PREDICTED: probable protein phosphatase 2C 1...    272   5e-82    
ref|XP_009776219.1|  PREDICTED: probable protein phosphatase 2C 52      275   7e-82    
gb|KHG17181.1|  hypothetical protein F383_23069                         272   1e-81    
ref|XP_009373099.1|  PREDICTED: probable protein phosphatase 2C 65      274   1e-81    
ref|XP_008678656.1|  PREDICTED: probable protein phosphatase 2C 75      273   1e-81    
ref|XP_007043535.1|  Phosphatase 2C 52 isoform 1                        274   1e-81    
ref|XP_006665077.1|  PREDICTED: probable protein phosphatase 2C 7...    271   1e-81    
ref|XP_006352576.1|  PREDICTED: probable protein phosphatase 2C 6...    276   1e-81    
ref|XP_003543347.1|  PREDICTED: probable protein phosphatase 2C 5...    273   2e-81    
gb|EPS70212.1|  hypothetical protein M569_04548                         273   2e-81    
ref|XP_004958055.1|  PREDICTED: probable protein phosphatase 2C 6...    272   2e-81    
emb|CDX74239.1|  BnaA03g28080D                                          273   2e-81    
ref|XP_010924065.1|  PREDICTED: probable protein phosphatase 2C 64      273   3e-81    
dbj|BAJ88611.1|  predicted protein                                      271   3e-81    
ref|XP_007026551.1|  Phosphatase 2C family protein, putative            274   3e-81    
gb|EPS66665.1|  hypothetical protein M569_08112                         273   4e-81    
ref|NP_001067763.2|  Os11g0417400                                       271   4e-81    
ref|XP_010556832.1|  PREDICTED: probable protein phosphatase 2C 52      272   5e-81    
gb|EEE68422.1|  hypothetical protein OsJ_26787                          271   5e-81    
gb|EMT27153.1|  Putative protein phosphatase 2C 64                      271   5e-81    
ref|XP_002463038.1|  hypothetical protein SORBIDRAFT_02g036610          271   5e-81    
ref|XP_004243332.1|  PREDICTED: probable protein phosphatase 2C 52      272   5e-81    
emb|CDP14742.1|  unnamed protein product                                272   5e-81    
emb|CBI28905.3|  unnamed protein product                                271   6e-81    
ref|XP_006658703.1|  PREDICTED: probable protein phosphatase 2C 6...    270   7e-81    
gb|EMS49236.1|  putative protein phosphatase 2C 66                      274   7e-81    
gb|KEH39098.1|  catalytic/protein phosphatase type 2C                   271   8e-81    
ref|XP_003576070.2|  PREDICTED: probable protein phosphatase 2C 75      271   8e-81    
ref|NP_001031302.1|  putative protein phosphatase 2C 18                 270   8e-81    
ref|XP_004506557.1|  PREDICTED: probable protein phosphatase 2C 5...    271   1e-80    
ref|NP_001060016.1|  Os07g0566200                                       270   1e-80    
ref|XP_010657270.1|  PREDICTED: probable protein phosphatase 2C 52      271   1e-80    
ref|XP_009410548.1|  PREDICTED: probable protein phosphatase 2C 73      270   1e-80    
ref|XP_010264517.1|  PREDICTED: probable protein phosphatase 2C 6...    270   1e-80    
ref|XP_007149875.1|  hypothetical protein PHAVU_005G106100g             271   2e-80    
gb|KHN44853.1|  Hypothetical protein glysoja_024424                     267   2e-80    
ref|XP_008777865.1|  PREDICTED: probable protein phosphatase 2C 3...    270   2e-80    
ref|XP_009388680.1|  PREDICTED: probable protein phosphatase 2C 12      266   2e-80    
gb|EAY82001.1|  hypothetical protein OsI_37184                          278   3e-80    
ref|XP_010683599.1|  PREDICTED: probable protein phosphatase 2C 73      270   3e-80    
ref|XP_010095801.1|  putative protein phosphatase 2C 52                 270   3e-80    
ref|XP_006853933.1|  hypothetical protein AMTR_s00036p00202740          266   3e-80    
ref|XP_007139305.1|  hypothetical protein PHAVU_008G018200g             269   3e-80    
gb|KEH29533.1|  catalytic/protein phosphatase type 2C                   270   3e-80    



>ref|XP_009597152.1| PREDICTED: probable protein phosphatase 2C 34 [Nicotiana tomentosiformis]
Length=371

 Score =   509 bits (1312),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 254/357 (71%), Positives = 295/357 (83%), Gaps = 9/357 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MVQFSS+FNGF K+++ K+GRK S  D GRE AN LAKEA+KNEL+L++SG V A  S N
Sbjct  1     MVQFSSVFNGFKKSLAIKNGRK-SGHDFGREVANTLAKEAKKNELMLTSSGCV-ACGSKN  58

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S  S+ GKKG NQDR IVWE+FG Q+DMIFCGVFDGHGPWGHLVAKRVR+L+P +LL 
Sbjct  59    SVSFFSKGGKKGINQDRFIVWEDFGCQDDMIFCGVFDGHGPWGHLVAKRVRKLMPPALLH  118

Query  538   NWQKALAHNMDN--LGFD-NCL-LDVWKQSHIKACSEVDQQLEQQAGSFYSGTTALTVVK  705
             NWQK + + +D   +G D +C   D+WKQS+ + CS +DQ+LE  A SFYSGTTALT+V+
Sbjct  119   NWQKRVVNYIDGDGIGIDRSCFQFDIWKQSYFETCSTIDQELEHYADSFYSGTTALTLVR  178

Query  706   QGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEP  885
             QGD++VVANVGDSRAVLAT DDDG L  VQLTVDLKPNLP E ERIM+S+GRV S DDEP
Sbjct  179   QGDLLVVANVGDSRAVLATTDDDGRLGPVQLTVDLKPNLPRESERIMQSRGRVLSCDDEP  238

Query  886   GVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATD  1065
             GVYRVWMPN      +EGPGLA+SRAFGDYY+KDFGLISEPE T R+IT RDQFAILATD
Sbjct  239   GVYRVWMPNRG---TIEGPGLAISRAFGDYYLKDFGLISEPELTSRSITQRDQFAILATD  295

Query  1066  GVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             GVWDV+SNQEAVEIVSS PER ++AKRLVE A+CAWKR RRGI MDD+SAICLFFH+
Sbjct  296   GVWDVLSNQEAVEIVSSTPEREDAAKRLVESAICAWKRKRRGIPMDDISAICLFFHS  352



>emb|CDO98822.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   508 bits (1309),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 252/363 (69%), Positives = 293/363 (81%), Gaps = 14/363 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MVQF+++ +  AK IS +SGRK SR  VGR+AA+ LAKEARKNE++L++SG VNA  + N
Sbjct  1     MVQFTTILSTLAKNISIRSGRK-SRLGVGRDAADTLAKEARKNEMMLTSSGIVNANRTSN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS +S++GKKG NQDR IVWEEFG QEDMIFCG+FDGHGPWGHLVAK VR+L+PS LLC
Sbjct  60    MASAYSKKGKKGINQDRFIVWEEFGCQEDMIFCGIFDGHGPWGHLVAKTVRQLMPSFLLC  119

Query  538   NWQKALAH-----NMDNLGFDN---CLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTT  687
             NWQ+ LA      + D  G  +   C  D+WKQS+ KACS +D QL Q  G  SFYSG+T
Sbjct  120   NWQETLAQFVVKPDSDEFGSSDGCRCQFDIWKQSYFKACSAIDYQLAQLPGIDSFYSGST  179

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             ALT+V+QG+++VVANVGDSRAVLAT  DDG+LV +QLTVDLKPNLP E ERI +S GR+ 
Sbjct  180   ALTIVRQGNLIVVANVGDSRAVLATTSDDGSLVPIQLTVDLKPNLPQESERITQSNGRIC  239

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
             S  DEPGVYRVWMPN N    +EGPGLA+SRAFGDYYIKDFGLISEPE T R IT  DQF
Sbjct  240   SCHDEPGVYRVWMPNGN---TLEGPGLAISRAFGDYYIKDFGLISEPELTQRRITDTDQF  296

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
             AILATDGVWDV+SNQEAV+IVSS PER ESAK+LVE AVCAWKR R GIAMDD+SAICLF
Sbjct  297   AILATDGVWDVISNQEAVDIVSSTPEREESAKKLVESAVCAWKRKRPGIAMDDISAICLF  356

Query  1228  FHN  1236
             FH+
Sbjct  357   FHD  359



>ref|XP_004229276.1| PREDICTED: probable protein phosphatase 2C 34 [Solanum lycopersicum]
 ref|XP_010321558.1| PREDICTED: probable protein phosphatase 2C 34 [Solanum lycopersicum]
Length=361

 Score =   503 bits (1295),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 249/358 (70%), Positives = 295/358 (82%), Gaps = 13/358 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MVQFSS+F G  K+I+ ++G+K S+ D GRE A+ALAKEA+KNE++L++SG V A +SHN
Sbjct  1     MVQFSSIFTGITKSIAIRNGKK-SKHDDGRETADALAKEAKKNEMMLTSSGSV-AGASHN  58

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A + S+ GKKG NQDR +VWE+FG Q+DMIFCGVFDGHGPWGHLVAKRVR+L+P++LL 
Sbjct  59    LAVVFSKGGKKGINQDRFVVWEDFGCQDDMIFCGVFDGHGPWGHLVAKRVRKLMPTALLR  118

Query  538   NWQKALAHNMDN---LGFD-NCL-LDVWKQSHIKACSEVDQQLEQQAGSFYSGTTALTVV  702
             NWQK +AH +D    +  D +C   D+WKQS+ + CS +DQ+LEQ A SFYSGTTALT+V
Sbjct  119   NWQKRVAHTVDGTNGISIDKSCFQFDIWKQSYFETCSIIDQELEQYADSFYSGTTALTLV  178

Query  703   KQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDE  882
             +QG ++VVANVGDSRAVLAT DDDG LV+VQLTVDLKPNLP E ERIM+S+GRV S +DE
Sbjct  179   RQGGLLVVANVGDSRAVLATTDDDGRLVSVQLTVDLKPNLPRESERIMQSRGRVLSCEDE  238

Query  883   PGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILAT  1062
             PGVYRVWMP       VEGPGLA+SRAFGDYYIKDFGLISEPE T R IT RDQFAILAT
Sbjct  239   PGVYRVWMPT------VEGPGLAISRAFGDYYIKDFGLISEPELTSRKITHRDQFAILAT  292

Query  1063  DGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             DGVWDV+SN EAVEIVSS  ER ++AKRLVE A+CAWK  RRG  MDD+SAICLFFHN
Sbjct  293   DGVWDVMSNDEAVEIVSSTGEREDAAKRLVESAICAWKHKRRGAPMDDISAICLFFHN  350



>ref|XP_009778679.1| PREDICTED: probable protein phosphatase 2C 34 [Nicotiana sylvestris]
 ref|XP_009778680.1| PREDICTED: probable protein phosphatase 2C 34 [Nicotiana sylvestris]
Length=369

 Score =   502 bits (1292),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 249/357 (70%), Positives = 295/357 (83%), Gaps = 9/357 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MVQFSS+F GF K+++ K+GRK S  D GRE AN LAKEA+KNEL+L++SG V A  S N
Sbjct  1     MVQFSSIFTGFRKSLAIKNGRK-SGHDFGREVANTLAKEAKKNELMLTSSGCV-AGGSKN  58

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S  S+ GKKG NQDR IVWE+FG Q+DMIFCGVFDGHGPWGHLVAKRVR+L+P +LL 
Sbjct  59    LVSFFSKGGKKGINQDRFIVWEDFGCQDDMIFCGVFDGHGPWGHLVAKRVRKLMPPALLH  118

Query  538   NWQKALAHNMDN--LGFD-NCL-LDVWKQSHIKACSEVDQQLEQQAGSFYSGTTALTVVK  705
             NW+K + + +D   +G D +C   D+WKQS+ +ACS +DQ+LEQ A SFYSGTTALT+V+
Sbjct  119   NWKKRVVNYIDGDGIGIDRSCFQFDIWKQSYFEACSTIDQELEQHADSFYSGTTALTLVR  178

Query  706   QGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEP  885
             QGD++VVAN+GDSRAVLAT DDDG LV VQLTVDLKPNLP E +RIM+S+GRV S DDEP
Sbjct  179   QGDLLVVANIGDSRAVLATTDDDGRLVPVQLTVDLKPNLPRESQRIMQSRGRVLSCDDEP  238

Query  886   GVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATD  1065
             GVYRVWM N   G  +EGPGLA+SR FGDYY+KDFGLISEPE T R+IT RDQFAILATD
Sbjct  239   GVYRVWMSN---GGTIEGPGLAISRPFGDYYLKDFGLISEPELTSRSITNRDQFAILATD  295

Query  1066  GVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             GVWDV+SN+EAVEIVSS P+R E+AKRLVE A+CAWK  RRGI MDD+SAICL+FH+
Sbjct  296   GVWDVLSNKEAVEIVSSTPQREEAAKRLVESAICAWKCKRRGIPMDDISAICLYFHS  352



>ref|XP_006354291.1| PREDICTED: probable protein phosphatase 2C 34-like [Solanum tuberosum]
Length=358

 Score =   499 bits (1285),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 245/358 (68%), Positives = 295/358 (82%), Gaps = 16/358 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MVQFSS+F GF K+I+ ++G+K S+ D GRE A++LAKEA+KNE++L++SG V    + N
Sbjct  1     MVQFSSIFTGFTKSIAIRNGKK-SKHDDGRETADSLAKEAKKNEMMLTSSGSV----AGN  55

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A + S+ GKKG NQDR +VWE+FG Q+DMIFCGVFDGHGPWGHLVAKRVR+L+P +LL 
Sbjct  56    LAVVFSKGGKKGINQDRFVVWEDFGCQDDMIFCGVFDGHGPWGHLVAKRVRKLMPPALLR  115

Query  538   NWQKALAHNMDN---LGFD-NCL-LDVWKQSHIKACSEVDQQLEQQAGSFYSGTTALTVV  702
             NWQK ++H +D    +  D +C   D+WK S+ + CS +DQ+LEQ A SFYSGTTALT+V
Sbjct  116   NWQKRVSHTVDGTDGISIDRSCFQFDIWKHSYFETCSIIDQELEQYADSFYSGTTALTLV  175

Query  703   KQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDE  882
             +QGD++VVANVGDSRAVLAT DDDG LV+VQLTVDLKPNLP E ERIM+S+GRV S +DE
Sbjct  176   RQGDLLVVANVGDSRAVLATTDDDGRLVSVQLTVDLKPNLPRESERIMQSRGRVLSCEDE  235

Query  883   PGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILAT  1062
             PGVYR+WMP       VEGPGLA+SRAFGDYYIKDFGLISEPE T RNIT RDQFAILAT
Sbjct  236   PGVYRMWMPT------VEGPGLAISRAFGDYYIKDFGLISEPELTSRNITHRDQFAILAT  289

Query  1063  DGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             DGVWDV+SN+EAVEIV S  ER ++AKRLVE A+CAWKR RRG+ MDD+SAICLFFHN
Sbjct  290   DGVWDVMSNEEAVEIVFSTEEREDAAKRLVESAICAWKRKRRGVPMDDISAICLFFHN  347



>ref|XP_011091017.1| PREDICTED: probable protein phosphatase 2C 34 [Sesamum indicum]
 ref|XP_011091019.1| PREDICTED: probable protein phosphatase 2C 34 [Sesamum indicum]
 ref|XP_011091020.1| PREDICTED: probable protein phosphatase 2C 34 [Sesamum indicum]
Length=374

 Score =   486 bits (1252),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 239/363 (66%), Positives = 291/363 (80%), Gaps = 12/363 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MVQ S+LF+ F+K I+   G+K SR  V REAA  LAKEA+++EL+L+ SG   A +  N
Sbjct  1     MVQLSALFHTFSKNITSGPGKK-SRHGVEREAAIHLAKEAKRHELVLTASGVATARNQKN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A+ +S+QGKKG NQDR IVW+EFG QEDMIFCGVFDGHGPWGHLVAK +REL+PS LLC
Sbjct  60    FAAAYSKQGKKGLNQDRFIVWQEFGCQEDMIFCGVFDGHGPWGHLVAKCIRELMPSLLLC  119

Query  538   NWQKAL---AHNMD-NLGFD--NCLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTAL  693
             NWQ+A+    H+ D +LG D      D+WKQS+ K C+ VDQ+L++  G  SFYSG+TAL
Sbjct  120   NWQEAVELNGHDADYSLGLDRNKAQFDMWKQSYYKTCAAVDQELQRHPGIDSFYSGSTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
              +V+QGD+M+VAN+GDSRAVLAT  DDG+LVA QLTVDLKPNLP E +RI +S+GRV++ 
Sbjct  180   ALVRQGDLMIVANIGDSRAVLATTSDDGSLVATQLTVDLKPNLPHESKRIAQSRGRVYAC  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEP V+RVWMPN   G  V+GPGLAVSRAFGDYYIK+FG+ISEPE T R+IT RDQFAI
Sbjct  240   PDEPAVHRVWMPN---GQTVKGPGLAVSRAFGDYYIKEFGVISEPEITQRSITIRDQFAI  296

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAVEIV+S PER ESAKRLVEHAVCAWKR  +   +DD+SA+CLFFH
Sbjct  297   LATDGVWDVISNQEAVEIVASTPERAESAKRLVEHAVCAWKRKGKSNVIDDISAVCLFFH  356

Query  1234  NKL  1242
             + +
Sbjct  357   HSI  359



>ref|XP_007035669.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 ref|XP_007035670.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY06595.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY06596.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
Length=377

 Score =   461 bits (1186),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 232/364 (64%), Positives = 278/364 (76%), Gaps = 15/364 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV   S  +G A+T+S K GR   + DVGREAA  +AK+A+KNEL+ S+SG V +I S N
Sbjct  1     MVLIPSFLDGLARTVSIKKGRNGGQTDVGREAAETMAKDAKKNELMRSSSGTVKSIKSSN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD A+VWEEFG QEDMIFCG+FDGHGPWGH+VAKRVRE VP SLLC
Sbjct  61    FASVCSKRGQKGINQDSAVVWEEFGCQEDMIFCGIFDGHGPWGHVVAKRVRESVPPSLLC  120

Query  538   NWQKALAHNMDNLGFDNCLL-------DVWKQSHIKACSEVDQQLEQQAG--SFYSGTTA  690
             +WQK LA        D  +L       DVWKQS++K  +++D +L+Q  G  SF SGTTA
Sbjct  121   HWQKNLALTSLGQELDTEVLNRSIHQFDVWKQSYLKTYADIDLELKQHPGIDSFRSGTTA  180

Query  691   LTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWS  870
             LT++KQG+ +V+ANVGD RAVLAT  DDGNLV +QLTVD KPN+P E ERI +SKGRV+ 
Sbjct  181   LTIIKQGEHLVIANVGDCRAVLATTSDDGNLVPLQLTVDFKPNIPEEAERITQSKGRVFC  240

Query  871   SDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFA  1050
               DEPGVYRVWMPN N       PGLA+SRAFGDY +K+FGLIS P+ T RNIT +DQF 
Sbjct  241   LGDEPGVYRVWMPNGN------TPGLALSRAFGDYCVKEFGLISVPDVTQRNITSKDQFV  294

Query  1051  ILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             ILATDGVWDVVSN+EAVEIVSSA +R +SAKRLV+ A+ AWK  +RGIAMDDMSAICLFF
Sbjct  295   ILATDGVWDVVSNREAVEIVSSAEDREKSAKRLVQCAIRAWKYKKRGIAMDDMSAICLFF  354

Query  1231  HNKL  1242
             H  L
Sbjct  355   HPTL  358



>ref|XP_002272978.2| PREDICTED: probable protein phosphatase 2C 34 [Vitis vinifera]
Length=373

 Score =   459 bits (1181),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 228/358 (64%), Positives = 279/358 (78%), Gaps = 13/358 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M    +LF+   + IS   G ++ R DVGREAA +LAKEAR N L+L++ G +N+  S N
Sbjct  1     MENLLALFDALMRNISLMKG-ESWRSDVGREAAESLAKEARGNNLMLTSPGIINSRGSSN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++GKKG NQD  IVWEEFG QEDM FCG+FDGHG WGH VAKRVR+L+PS LLC
Sbjct  60    FASVFSKKGKKGVNQDCFIVWEEFGCQEDMTFCGIFDGHGLWGHHVAKRVRKLMPSFLLC  119

Query  538   NWQK--ALAHNMDNLGFDN--CLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTV  699
             +WQ+  ALA   D +G D   C  D+W+QS++K C+ +D++LEQ A   SF SGTTALT+
Sbjct  120   HWQETLALAQGFDMMGLDRNLCPFDIWRQSYLKTCAAIDEELEQHADLDSFRSGTTALTI  179

Query  700   VKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDD  879
             V+QG+++++ANVGDSRAVL T  DDG+LVAVQLTVD KPNLP E ERI +S+G+V+   D
Sbjct  180   VRQGELIIIANVGDSRAVLGTTSDDGSLVAVQLTVDFKPNLPQEAERITKSRGQVYCLQD  239

Query  880   EPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILA  1059
             EPGVYRVWMPN       + PGLA+SRAFGDY +KDFG+IS PE T RNIT RDQFAILA
Sbjct  240   EPGVYRVWMPN------TKTPGLAISRAFGDYCMKDFGVISVPEVTQRNITSRDQFAILA  293

Query  1060  TDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             TDGVWDV+SNQEAVEIVSSAP+R +SAKRLVE AV AWKR +RG+A DD++AICLFFH
Sbjct  294   TDGVWDVISNQEAVEIVSSAPDRNKSAKRLVECAVDAWKRKKRGVATDDITAICLFFH  351



>ref|XP_002315485.1| hypothetical protein POPTR_0010s00840g [Populus trichocarpa]
 gb|EEF01656.1| hypothetical protein POPTR_0010s00840g [Populus trichocarpa]
Length=375

 Score =   459 bits (1181),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 230/360 (64%), Positives = 278/360 (77%), Gaps = 15/360 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F SL +G A T+S K GR NSR+D GREAA ALAK+ARKNEL+LS+SG V +  S N
Sbjct  1     MVLFPSLLDGLAGTVSIKKGR-NSRKDAGREAAEALAKDARKNELMLSSSGIVKSNKSSN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  +VWEEFG QEDMIFCG+FDGHGPWGH V+KRVRE VPSSLLC
Sbjct  60    FASVCSKRGQKGINQDSLVVWEEFGCQEDMIFCGIFDGHGPWGHFVSKRVRESVPSSLLC  119

Query  538   NWQKALAHNMDNLGFDNCL------LDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
              WQ+ L+     + F+  L       D+WKQS++K  + +D +L+Q  +  SF SG+TAL
Sbjct  120   KWQETLSLTSLGMDFEMDLDRNLHQFDIWKQSYLKTYAAIDHELKQHPEIDSFCSGSTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T++KQG+ +V+ NVGDSRAVLAT DDDG LV +QLT+D KPNLP E ERI RS GRV+  
Sbjct  180   TIIKQGEHLVITNVGDSRAVLATTDDDGCLVPLQLTIDFKPNLPEEAERITRSNGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGV+RVWMPN       + PGLA+SRAFGD+ +KDFGLISEP+ T RNIT RDQF I
Sbjct  240   RDEPGVFRVWMPNG------KTPGLALSRAFGDHCVKDFGLISEPDVTQRNITSRDQFVI  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAV++V S P+R +SAKRLVE AV AWK  +RGIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVISNQEAVQVVFSTPDREKSAKRLVECAVRAWKNKKRGIAMDDISAICLFFH  353



>gb|KDP27848.1| hypothetical protein JCGZ_18928 [Jatropha curcas]
Length=375

 Score =   459 bits (1181),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 229/360 (64%), Positives = 285/360 (79%), Gaps = 15/360 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  F S+F+GFA+T+S K GR N+++DVG+EAA++LAK+A+KNEL+LS SG V +  S+N
Sbjct  1     MAPFPSIFDGFARTVSIKKGR-NAQKDVGKEAADSLAKDAKKNELMLSCSGIVKSNKSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH+V+KRVRE VPSSLLC
Sbjct  60    FASVCSKRGQKGINQDCLIVWEEFGCQEDMIFCGIFDGHGPWGHVVSKRVRESVPSSLLC  119

Query  538   NWQKALAHNMDNLGFDNCL------LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTAL  693
             NWQ+ LA    +  F+  L       DVWKQ+++K  + +DQ+L+Q  G  +F SGTT L
Sbjct  120   NWQETLALTSIDKDFEMELDRDLHQFDVWKQAYLKTYAVIDQELKQNPGIDAFCSGTTGL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+VKQG+ +V+ANVGDSRAVLAT  +DG+LV +QLT+D KPNLP E ERI +SKGRV+  
Sbjct  180   TIVKQGEHLVIANVGDSRAVLATTSEDGSLVPLQLTIDFKPNLPQEAERITQSKGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGVYRVWMPN       + PGLA+SRAFGDY +KDFGLIS P+ T R+IT RDQF I
Sbjct  240   PDEPGVYRVWMPNG------KRPGLALSRAFGDYCVKDFGLISIPDVTQRSITSRDQFVI  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDG+WDV+SNQEAV+IVSS P+R +SAKRLV+ A  AWK  +RGIAMDD+SAICLFFH
Sbjct  294   LATDGLWDVISNQEAVQIVSSTPDREKSAKRLVQCAARAWKYKKRGIAMDDISAICLFFH  353



>ref|XP_007031061.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY11563.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
Length=369

 Score =   457 bits (1177),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 224/364 (62%), Positives = 280/364 (77%), Gaps = 15/364 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S + G KNS  D GREAA A+AK+A+KN+LIL +SGFVN   S+N
Sbjct  1     MRHFSSMFNGLARSFSIRRG-KNSENDDGREAAEAMAKDAKKNDLILRSSGFVNVDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD AIVWEEFG Q DM+FCG+FDGHGPWGH VAK+VRE +PSSLLC
Sbjct  60    LASVFSKRGRKGVNQDCAIVWEEFGCQADMLFCGIFDGHGPWGHFVAKKVRESLPSSLLC  119

Query  538   NWQKALAHNMDNLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             +WQ+ LA    +   D      +   D+WK S++K C+ VDQ+L+Q  +  SFYSGTTAL
Sbjct  120   HWQETLAQTSLDPDIDLESDKKHQRFDIWKHSYLKTCAAVDQELQQYRKIDSFYSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QGD+M VAN+GDSRAVLAT  DDG+LV VQLTVD KPNLP E ERI++ KGRV+  
Sbjct  180   TIVRQGDLMYVANIGDSRAVLATTSDDGDLVPVQLTVDFKPNLPQEAERIIQCKGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGV+RVW+P+       E PGLA+SRAFGDY IK++GLIS PE T R IT RDQF +
Sbjct  240   HDEPGVHRVWLPDE------ESPGLAMSRAFGDYCIKEYGLISVPEVTQRQITSRDQFVV  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEA++IVSS P++ ++AK LVE A  AWK+ R+GIAMDD+S ICL FH
Sbjct  294   LATDGVWDVISNQEAIQIVSSTPDKAKAAKCLVECAAHAWKKKRKGIAMDDISVICLLFH  353

Query  1234  NKLI  1245
             +  +
Sbjct  354   SSAV  357



>gb|KHG01784.1| hypothetical protein F383_10634 [Gossypium arboreum]
Length=364

 Score =   457 bits (1176),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 222/359 (62%), Positives = 281/359 (78%), Gaps = 13/359 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S + G+ +S  D GREAA  +AK+A+K+++IL +SGFVN   S+N
Sbjct  1     MRHFSSMFNGLARSFSMRRGKNSSNGD-GREAAETMAKDAKKHDMILRSSGFVNVDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD AIVWE FG Q DM+FCG+FDGHGPWGH VAK+VRE +PSSLLC
Sbjct  60    LASVCSKRGRKGVNQDCAIVWEGFGCQADMLFCGIFDGHGPWGHFVAKKVRESMPSSLLC  119

Query  538   NWQKALAHNMDNLGFD----NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTALTV  699
             NWQ+ LA    +   +    +    +WK S++K C+ VD++LEQ  +  SFYSGTTALT+
Sbjct  120   NWQETLAQTSLDPDLESDKKHQRFHIWKHSYLKTCAAVDRELEQYRKIDSFYSGTTALTI  179

Query  700   VKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDD  879
             V+QGD++ VANVGDSRAVLAT  DDGNLV VQLTVD KPNLP E ERI++ +GRV+   D
Sbjct  180   VRQGDIIYVANVGDSRAVLATNSDDGNLVPVQLTVDFKPNLPQESERIIQCQGRVFCMHD  239

Query  880   EPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILA  1059
             EPGV+RVW+PN       E PGLA+SRAFGDY IKD+GLIS PE T R+IT +DQF +LA
Sbjct  240   EPGVHRVWLPNE------ESPGLAMSRAFGDYCIKDYGLISVPEVTQRHITNKDQFVVLA  293

Query  1060  TDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             TDGVWDVVSNQEA++IVSS P++ ++AKRLVE A CAWK+ R+GIA+DD+SAICLFFH+
Sbjct  294   TDGVWDVVSNQEAIQIVSSTPDKAKAAKRLVEFAACAWKKKRKGIAVDDISAICLFFHS  352



>emb|CBI22956.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   459 bits (1181),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 228/363 (63%), Positives = 280/363 (77%), Gaps = 13/363 (4%)
 Frame = +1

Query  163   IRAEKMVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNA  342
             +    M    +LF+   + IS   G ++ R DVGREAA +LAKEAR N L+L++ G +N+
Sbjct  67    LEGRPMENLLALFDALMRNISLMKG-ESWRSDVGREAAESLAKEARGNNLMLTSPGIINS  125

Query  343   ISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVP  522
               S N AS+ S++GKKG NQD  IVWEEFG QEDM FCG+FDGHG WGH VAKRVR+L+P
Sbjct  126   RGSSNFASVFSKKGKKGVNQDCFIVWEEFGCQEDMTFCGIFDGHGLWGHHVAKRVRKLMP  185

Query  523   SSLLCNWQK--ALAHNMDNLGFDN--CLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGT  684
             S LLC+WQ+  ALA   D +G D   C  D+W+QS++K C+ +D++LEQ A   SF SGT
Sbjct  186   SFLLCHWQETLALAQGFDMMGLDRNLCPFDIWRQSYLKTCAAIDEELEQHADLDSFRSGT  245

Query  685   TALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRV  864
             TALT+V+QG+++++ANVGDSRAVL T  DDG+LVAVQLTVD KPNLP E ERI +S+G+V
Sbjct  246   TALTIVRQGELIIIANVGDSRAVLGTTSDDGSLVAVQLTVDFKPNLPQEAERITKSRGQV  305

Query  865   WSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQ  1044
             +   DEPGVYRVWMPN       + PGLA+SRAFGDY +KDFG+IS PE T RNIT RDQ
Sbjct  306   YCLQDEPGVYRVWMPN------TKTPGLAISRAFGDYCMKDFGVISVPEVTQRNITSRDQ  359

Query  1045  FAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICL  1224
             FAILATDGVWDV+SNQEAVEIVSSAP+R +SAKRLVE AV AWKR +RG+A DD++AICL
Sbjct  360   FAILATDGVWDVISNQEAVEIVSSAPDRNKSAKRLVECAVDAWKRKKRGVATDDITAICL  419

Query  1225  FFH  1233
             FFH
Sbjct  420   FFH  422



>ref|XP_002516975.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF45589.1| protein phosphatase 2c, putative [Ricinus communis]
Length=369

 Score =   456 bits (1172),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 227/363 (63%), Positives = 286/363 (79%), Gaps = 15/363 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F S+F+G A+++S K GR NS++DVG+EAA ALAK ARKNEL+LS+SG V ++ S+N
Sbjct  1     MVLFPSIFDGLARSVSVKKGR-NSQKDVGKEAAEALAKNARKNELMLSSSGIVKSMKSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH+VAKRV+E VPSSLLC
Sbjct  60    FASVCSKRGQKGINQDCFIVWEEFGCQEDMIFCGIFDGHGPWGHVVAKRVKESVPSSLLC  119

Query  538   NWQKALAHNMDNLGFDNCL------LDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             NWQ+ LA    ++ F+  L       D+WKQS++K  + VDQ+L+Q  +  +F SG+TAL
Sbjct  120   NWQETLALTSLDMDFEMELDRNLHQFDIWKQSYLKTYATVDQELKQHPEIDAFSSGSTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+VKQG+ +V+ANVGDSRAVLAT  DDG+L ++QLT D KPNLP E ERI +S GRV+  
Sbjct  180   TIVKQGEHLVIANVGDSRAVLATISDDGSLASLQLTTDFKPNLPQEAERITQSNGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGVYRVWMP+       + PGLA+SRAFGDY +KDFGLIS P+ T R+IT RDQF I
Sbjct  240   HDEPGVYRVWMPDG------KRPGLALSRAFGDYCVKDFGLISIPDVTQRSITSRDQFVI  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDG+WDV+SNQEAV+IVSS P+R ++AKRLV+ AV AWK  +RG+A DD+SAICLFF 
Sbjct  294   LATDGLWDVISNQEAVQIVSSTPDRQKAAKRLVQSAVRAWKYKKRGLATDDISAICLFFR  353

Query  1234  NKL  1242
             + L
Sbjct  354   DSL  356



>ref|XP_007163346.1| hypothetical protein PHAVU_001G227100g [Phaseolus vulgaris]
 ref|XP_007163347.1| hypothetical protein PHAVU_001G227100g [Phaseolus vulgaris]
 gb|ESW35340.1| hypothetical protein PHAVU_001G227100g [Phaseolus vulgaris]
 gb|ESW35341.1| hypothetical protein PHAVU_001G227100g [Phaseolus vulgaris]
Length=357

 Score =   453 bits (1165),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 226/364 (62%), Positives = 281/364 (77%), Gaps = 16/364 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S K GRKN +   GREAA A+AK A+KNE++L +SG V+   S+N
Sbjct  1     MGHFSSMFNGLARSFSMKKGRKNEKCG-GREAAEAMAKVAKKNEMMLCSSGTVHVDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH VAK+VRE +PSSLLC
Sbjct  60    FASVFSKRGQKGVNQDCCIVWEEFGCQEDMIFCGIFDGHGPWGHFVAKKVRESMPSSLLC  119

Query  538   NWQKALAHNMDNLGFDN-------CLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTA  690
             NWQ+ LA    + G D           +VWK S++K C+ +DQ+L+Q  +  SFYSGTTA
Sbjct  120   NWQETLAQTSVDPGIDVEEGKKQLYRFNVWKHSYLKTCAAIDQELKQYRKIDSFYSGTTA  179

Query  691   LTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWS  870
             L++V+QG+++V+ANVGDSRAVLAT  DDG+LVAVQLTVD KPNLP E ERI+  +GRV+ 
Sbjct  180   LSIVRQGELIVIANVGDSRAVLATTSDDGSLVAVQLTVDFKPNLPQEAERIIECQGRVFC  239

Query  871   SDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFA  1050
              +DEPGV+RVW+P+       E PGLA+SRAFGDY IK  GLIS PE T RNI+ RDQF 
Sbjct  240   LEDEPGVHRVWLPD------AESPGLAMSRAFGDYCIKGHGLISVPEVTHRNISSRDQFV  293

Query  1051  ILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             + ATDGVWDV+SN+EAVEIVSS P++ ++AKRLVE A  AWKR RRGIA+DD+SAICLFF
Sbjct  294   VAATDGVWDVISNKEAVEIVSSTPDKAKAAKRLVECAEDAWKRKRRGIAVDDISAICLFF  353

Query  1231  HNKL  1242
             H+ L
Sbjct  354   HSFL  357



>ref|XP_006419491.1| hypothetical protein CICLE_v10005158mg [Citrus clementina]
 gb|ESR32731.1| hypothetical protein CICLE_v10005158mg [Citrus clementina]
Length=374

 Score =   454 bits (1167),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 235/359 (65%), Positives = 275/359 (77%), Gaps = 16/359 (4%)
 Frame = +1

Query  187   FSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCAS  366
             F SL +G A+T+S K G KN R D GREAA ALAK ARKNEL+LS+SG V +  S N AS
Sbjct  3     FPSLIDGLARTVSIKRG-KNCRNDSGREAAEALAKSARKNELMLSSSGIVKSNKSSNFAS  61

Query  367   LHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQ  546
             + S++G+KG NQD AIVWEEFG QEDM+FCG+FDGHGPWGH+VAKRVRE VP SLLCNWQ
Sbjct  62    VCSKRGQKGINQDCAIVWEEFGCQEDMVFCGIFDGHGPWGHVVAKRVRESVPYSLLCNWQ  121

Query  547   KAL------AHNMDNLGFDNC-LLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTV  699
             + L      A N+D  G  N    D+W QS +K  + +DQ+L+Q  G  SF SGTTALT+
Sbjct  122   ETLLSSTSPAMNLDLDGNRNVPQYDIWNQSCLKTYAAIDQELKQHTGIDSFRSGTTALTI  181

Query  700   VKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDD  879
             VKQG+ +VVANVGDSRAVLAT  DDG+LV  QLTVD KPN+P E ERI +SKG V+  +D
Sbjct  182   VKQGESLVVANVGDSRAVLATLSDDGDLVPFQLTVDFKPNIPEEAERITQSKGLVFCLND  241

Query  880   EPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILA  1059
             EPGVYRVWMPN       E PGLA+SRA GDY +KD+GLIS P  T RNIT RDQF ILA
Sbjct  242   EPGVYRVWMPNG------ETPGLAMSRALGDYCVKDYGLISVPHVTQRNITTRDQFVILA  295

Query  1060  TDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             +DGVWDV+SNQEAVEIVSS  +R ++AKRLVE AV AWK  +RGIAMDD+SAICLFFH+
Sbjct  296   SDGVWDVISNQEAVEIVSSIVDREKAAKRLVECAVRAWKYKKRGIAMDDISAICLFFHS  354



>ref|XP_006489025.1| PREDICTED: probable protein phosphatase 2C 73-like [Citrus sinensis]
Length=374

 Score =   453 bits (1166),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 235/359 (65%), Positives = 275/359 (77%), Gaps = 16/359 (4%)
 Frame = +1

Query  187   FSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCAS  366
             F SL +G A+T+S K G KN R D GREAA ALAK ARKNEL+LS+SG V +  S N AS
Sbjct  3     FPSLIDGLARTVSIKRG-KNCRNDSGREAAEALAKSARKNELMLSSSGIVKSNKSSNFAS  61

Query  367   LHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQ  546
             + S++G+KG NQD AIVWEEFG QEDM+FCG+FDGHGPWGH+VAKRVRE VP SLLCNWQ
Sbjct  62    VCSKRGQKGINQDCAIVWEEFGCQEDMVFCGIFDGHGPWGHVVAKRVRESVPYSLLCNWQ  121

Query  547   KAL------AHNMDNLGFDNC-LLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTV  699
             + L      A N+D  G  N    D+W QS +K  + +DQ+L+Q  G  SF SGTTALT+
Sbjct  122   ETLLSSTSPAMNLDLDGNRNVPQYDIWNQSCLKTYAAIDQELKQHTGIDSFRSGTTALTI  181

Query  700   VKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDD  879
             VKQG+ +VVANVGDSRAVLAT  DDG+LV  QLTVD KPN+P E ERI +SKG V+  +D
Sbjct  182   VKQGESLVVANVGDSRAVLATLSDDGDLVPFQLTVDFKPNIPEEAERITQSKGLVFCLND  241

Query  880   EPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILA  1059
             EPGVYRVWMPN       E PGLA+SRA GDY +KD+GLIS P  T RNIT RDQF ILA
Sbjct  242   EPGVYRVWMPNG------ETPGLAMSRALGDYCVKDYGLISVPHVTQRNITTRDQFVILA  295

Query  1060  TDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             +DGVWDV+SNQEAVEIVSS  +R ++AKRLVE AV AWK  +RGIAMDD+SAICLFFH+
Sbjct  296   SDGVWDVISNQEAVEIVSSIVDREKAAKRLVECAVRAWKYKKRGIAMDDISAICLFFHS  354



>ref|XP_006419490.1| hypothetical protein CICLE_v10005158mg [Citrus clementina]
 gb|ESR32730.1| hypothetical protein CICLE_v10005158mg [Citrus clementina]
Length=383

 Score =   454 bits (1167),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 235/359 (65%), Positives = 275/359 (77%), Gaps = 16/359 (4%)
 Frame = +1

Query  187   FSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCAS  366
             F SL +G A+T+S K G KN R D GREAA ALAK ARKNEL+LS+SG V +  S N AS
Sbjct  12    FPSLIDGLARTVSIKRG-KNCRNDSGREAAEALAKSARKNELMLSSSGIVKSNKSSNFAS  70

Query  367   LHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQ  546
             + S++G+KG NQD AIVWEEFG QEDM+FCG+FDGHGPWGH+VAKRVRE VP SLLCNWQ
Sbjct  71    VCSKRGQKGINQDCAIVWEEFGCQEDMVFCGIFDGHGPWGHVVAKRVRESVPYSLLCNWQ  130

Query  547   KAL------AHNMDNLGFDNC-LLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTV  699
             + L      A N+D  G  N    D+W QS +K  + +DQ+L+Q  G  SF SGTTALT+
Sbjct  131   ETLLSSTSPAMNLDLDGNRNVPQYDIWNQSCLKTYAAIDQELKQHTGIDSFRSGTTALTI  190

Query  700   VKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDD  879
             VKQG+ +VVANVGDSRAVLAT  DDG+LV  QLTVD KPN+P E ERI +SKG V+  +D
Sbjct  191   VKQGESLVVANVGDSRAVLATLSDDGDLVPFQLTVDFKPNIPEEAERITQSKGLVFCLND  250

Query  880   EPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILA  1059
             EPGVYRVWMPN       E PGLA+SRA GDY +KD+GLIS P  T RNIT RDQF ILA
Sbjct  251   EPGVYRVWMPNG------ETPGLAMSRALGDYCVKDYGLISVPHVTQRNITTRDQFVILA  304

Query  1060  TDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             +DGVWDV+SNQEAVEIVSS  +R ++AKRLVE AV AWK  +RGIAMDD+SAICLFFH+
Sbjct  305   SDGVWDVISNQEAVEIVSSIVDREKAAKRLVECAVRAWKYKKRGIAMDDISAICLFFHS  363



>gb|KHG02727.1| putative phosphatase 2C 73 -like protein [Gossypium arboreum]
Length=359

 Score =   450 bits (1158),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 227/364 (62%), Positives = 279/364 (77%), Gaps = 20/364 (5%)
 Frame = +1

Query  172   EKMVQFSSLFNGFAKTISKK-SGRKNSREDVGREAANALAKEARKNELILSTSGFVNAIS  348
             E M QFSS+F G A++IS K SG  +     GREAA A+AK A+KN LIL +SG VN   
Sbjct  3     ETMRQFSSMFYGLARSISGKISGNGD-----GREAAEAMAKNAKKNYLILRSSGSVNVDG  57

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S+N AS+ S++G+KG NQD AIVWEEFG Q DM+FCG+FDGHGPWGH VAK+VRE +PSS
Sbjct  58    SNNLASVFSKRGRKGVNQDCAIVWEEFGCQADMLFCGIFDGHGPWGHFVAKKVRESMPSS  117

Query  529   LLCNWQKALAHNMDNLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGT  684
             LLCNWQ+ LA    +   D      +    +WK S+++ C+ VD +LEQ  +  SFYSGT
Sbjct  118   LLCNWQETLAQASLDPEIDLESDKKHQRFHIWKHSYLRTCAAVDHELEQHRKIDSFYSGT  177

Query  685   TALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRV  864
             TALT+V+QGD++ VAN+GDSRAVLAT  DDGNLV VQLT+D KPNLP E ERI++ KGRV
Sbjct  178   TALTIVRQGDLIYVANIGDSRAVLATTSDDGNLVPVQLTIDFKPNLPQEAERIVQCKGRV  237

Query  865   WSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQ  1044
             +   DEPGV+RVW+P+       E PGLA+SRAFGDY IKD+GLIS PE T R+IT RDQ
Sbjct  238   FCLHDEPGVHRVWLPDE------ESPGLAMSRAFGDYCIKDYGLISVPEVTQRHITSRDQ  291

Query  1045  FAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICL  1224
             F +LATDGVWDVVSNQEAV+IVSS P++ ++AKRLVE+AV AWK+ R+ IAMDD+SAICL
Sbjct  292   FVVLATDGVWDVVSNQEAVQIVSSTPDKQKAAKRLVEYAVRAWKKKRKDIAMDDISAICL  351

Query  1225  FFHN  1236
             FFH+
Sbjct  352   FFHS  355



>ref|XP_002283583.1| PREDICTED: probable protein phosphatase 2C 34 [Vitis vinifera]
 ref|XP_010659641.1| PREDICTED: probable protein phosphatase 2C 34 [Vitis vinifera]
 ref|XP_010659642.1| PREDICTED: probable protein phosphatase 2C 34 [Vitis vinifera]
 emb|CBI39528.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   450 bits (1157),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 229/360 (64%), Positives = 275/360 (76%), Gaps = 15/360 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG+A++ S K    +S    GREA   +AKEA+KN+LIL +SGFVN   S+N
Sbjct  1     MGHFSSMFNGWARSFSIKKA-SSSGNCGGREAVEVMAKEAKKNDLILHSSGFVNVNGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               SL+S++G+KG NQD  IVWEEFGGQEDM+FCGVFDGHGPWGH VAKRVRE +PSSLLC
Sbjct  60    FTSLYSKRGEKGVNQDCFIVWEEFGGQEDMLFCGVFDGHGPWGHYVAKRVRESMPSSLLC  119

Query  538   NWQKALAHNMDNLGFDNCL------LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTAL  693
             NWQ+ LA    +  FD          ++WK S++K C+ +DQ+LE  ++  SF SGTTAL
Sbjct  120   NWQETLAEASLDPDFDLQAEKKLHRFNIWKHSYLKTCAAIDQELEHHRRIDSFNSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QG+ + VANVGDSRAVLAT  DDGNL  VQLT+D KPNLP E ERI++ KGRV+  
Sbjct  180   TIVRQGESIFVANVGDSRAVLATMSDDGNLEPVQLTIDFKPNLPQEAERIIQCKGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGV+RVW+P+       E PGLA+SRAFGDY +KDFGLIS PE T RNIT RDQF +
Sbjct  240   GDEPGVHRVWLPHE------ESPGLAMSRAFGDYCVKDFGLISVPEVTQRNITSRDQFVV  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDVVSNQEAV+IVSS P R +SAKRLVE A  AWKR RRGIA+DD+SA+CLFFH
Sbjct  294   LATDGVWDVVSNQEAVQIVSSTPNRAKSAKRLVECAARAWKRKRRGIAVDDISAVCLFFH  353



>gb|KHN20262.1| Hypothetical protein glysoja_023825 [Glycine soja]
Length=367

 Score =   449 bits (1156),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 222/363 (61%), Positives = 279/363 (77%), Gaps = 17/363 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS FN  AK+ + K GR +S E  GREAA  +AKEA++N  +L +SG VN   S+N
Sbjct  1     MGHFSSAFNRLAKSFTTKKGR-SSDECNGREAAETMAKEAKRNHFMLHSSGTVNVDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ SR+G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH VAKRVR+ +P SLLC
Sbjct  60    FASVFSRKGQKGVNQDCCIVWEEFGCQEDMIFCGIFDGHGPWGHFVAKRVRKSMPPSLLC  119

Query  538   NWQKALAHN--MDNLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTT  687
             NWQ+ L+      ++ FD          ++WK S++K C+ +D++LEQ  +  SFYSGTT
Sbjct  120   NWQETLSQTPLHSDVDFDIETEKKQHRFNLWKHSYLKTCAAIDRELEQNRKIDSFYSGTT  179

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             AL++V+QG+++++ANVGDSRAVLAT  DDG+LV VQLT+D KPNLP E ERI+ S+GRV+
Sbjct  180   ALSIVRQGELIIIANVGDSRAVLATTSDDGSLVPVQLTIDFKPNLPQEAERILESQGRVF  239

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
               DDEPGV+RVW+P+       E PGLA+SRAFGDY +K +GLIS PE T RNIT +DQF
Sbjct  240   CLDDEPGVHRVWLPDE------EFPGLAMSRAFGDYCVKKYGLISVPEVTHRNITTKDQF  293

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              +LATDGVWDV+SNQEAV+IVSS P+R +S+KRLVE A+ AWKR RRGIAMDD+SAICLF
Sbjct  294   VVLATDGVWDVISNQEAVDIVSSTPDRTDSSKRLVECAMRAWKRKRRGIAMDDISAICLF  353

Query  1228  FHN  1236
             FH+
Sbjct  354   FHS  356



>ref|XP_011092105.1| PREDICTED: probable protein phosphatase 2C 34 [Sesamum indicum]
 ref|XP_011092106.1| PREDICTED: probable protein phosphatase 2C 34 [Sesamum indicum]
Length=373

 Score =   449 bits (1156),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 224/364 (62%), Positives = 275/364 (76%), Gaps = 17/364 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTIS---KKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAIS  348
             M  FSS+FNG A+++S    K+ R N     GREA  A+AK+A+KN+LIL TSG VNA  
Sbjct  1     MGHFSSMFNGLARSLSIRRTKNSRSNCGSCDGREAVEAMAKDAKKNDLILRTSGIVNAEG  60

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S N A++ S++G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH VAK VRE +PSS
Sbjct  61    SKNLATVFSKRGEKGVNQDCCIVWEEFGCQEDMIFCGIFDGHGPWGHFVAKSVRESMPSS  120

Query  529   LLCNWQKALAHNMDNLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGT  684
             LLCNWQ+ L     +  FD          ++WK S++KAC+ VDQ+LEQ  +  +F+SGT
Sbjct  121   LLCNWQETLVEASVDPDFDLESDKKLHRFNIWKHSYLKACAAVDQELEQHRKIDAFHSGT  180

Query  685   TALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRV  864
             TALT+V+QGD++ +ANVGDSRAVL T  D GNLVAVQLT+D KPNLP E ERI++  GRV
Sbjct  181   TALTIVRQGDIIFLANVGDSRAVLGTTSDSGNLVAVQLTIDFKPNLPQEAERIIQCNGRV  240

Query  865   WSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQ  1044
             +   DEPGV+RVW+P+       E PGLA+SRAFGDY +KDFGLIS PE T R+IT +DQ
Sbjct  241   YCLHDEPGVHRVWLPHE------ESPGLAMSRAFGDYCVKDFGLISVPEVTQRHITSKDQ  294

Query  1045  FAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICL  1224
             F +LATDGVWDV+SNQEAV+IVS+ P R +SAKRLVE A  AWKR R+GIAMDD+SAI L
Sbjct  295   FVVLATDGVWDVISNQEAVQIVSTTPNRAKSAKRLVESAAHAWKRKRKGIAMDDISAIVL  354

Query  1225  FFHN  1236
             FFH+
Sbjct  355   FFHS  358



>ref|XP_004494566.1| PREDICTED: probable protein phosphatase 2C 73-like isoform X1 
[Cicer arietinum]
 ref|XP_004494567.1| PREDICTED: probable protein phosphatase 2C 73-like isoform X2 
[Cicer arietinum]
Length=377

 Score =   449 bits (1154),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 220/370 (59%), Positives = 281/370 (76%), Gaps = 21/370 (6%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+FNG A++ S K GR+NS     REA  A+AKEA+KN+L+L +SG VN   S+N
Sbjct  2     MGHLSSMFNGLARSFSLKKGRRNSVRCERREAVEAMAKEAKKNDLMLCSSGTVNVDGSNN  61

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH VAKRVRE +P SLLC
Sbjct  62    FASVFSKRGQKGVNQDCCIVWEEFGCQEDMIFCGIFDGHGPWGHFVAKRVRESMPRSLLC  121

Query  538   NWQKALAHNM---DNLGFDNC----------LLDVWKQSHIKACSEVDQQLE--QQAGSF  672
             NWQ+ LA      D+   D+             ++WK S++K C+ +DQ+LE  ++  +F
Sbjct  122   NWQETLASQSSLDDDKDIDHVKAVATDNKQHRFNIWKHSYLKTCASIDQELEHNRKIDTF  181

Query  673   YSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRS  852
             YSGTTAL++V+QG+++++ANVGDSRAVLAT  D+G+L+AVQLTVD KPNLP E ERIM  
Sbjct  182   YSGTTALSIVRQGELIMIANVGDSRAVLATTSDNGSLIAVQLTVDFKPNLPQEAERIMEC  241

Query  853   KGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNIT  1032
             +GRV+  +DEPGV+R+W+P+       E PGLA+SRAFGDY IK++GLIS PE T+RNIT
Sbjct  242   QGRVFCLEDEPGVHRLWLPDG------ESPGLAMSRAFGDYCIKEYGLISVPEVTYRNIT  295

Query  1033  FRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMS  1212
              +D F +LATDGVWDV+SN+EAVEIVSS  ++ +SAKRLVE AV AWKR RRGIA+DD+S
Sbjct  296   TQDHFLVLATDGVWDVISNEEAVEIVSSTEDKAKSAKRLVECAVHAWKRKRRGIAIDDIS  355

Query  1213  AICLFFHNKL  1242
             AICLF H+ L
Sbjct  356   AICLFLHSPL  365



>gb|KEH24500.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=395

 Score =   449 bits (1155),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 228/374 (61%), Positives = 283/374 (76%), Gaps = 24/374 (6%)
 Frame = +1

Query  172   EKMVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISS  351
             E M   SS+FNG A++ S K GR + R +  REA  A+AKEA+KN+LIL +SG VN   S
Sbjct  17    ELMGHLSSMFNGLARSFSLKKGRNSVRCE-RREAVEAMAKEAKKNDLILCSSGTVNVDGS  75

Query  352   HNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSL  531
             +N AS+ S++G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH VAKRVRE +P SL
Sbjct  76    NNFASIFSKRGQKGTNQDCCIVWEEFGCQEDMIFCGIFDGHGPWGHFVAKRVRESMPRSL  135

Query  532   LCNWQKALAHNMDNL------------GFDN--CLLDVWKQSHIKACSEVDQQLE--QQA  663
             LCNWQ+ LA    +L              DN     ++WK S++K C+ +DQ+LE  ++ 
Sbjct  136   LCNWQETLAAQSSSLDDHVKDTDHVKTAADNKQQRFNIWKHSYLKTCASIDQELEHCRKF  195

Query  664   GSFYSGTTALTVVKQGDVMVVANVGDSRAVLAT-ADDDGNLVAVQLTVDLKPNLPGERER  840
              SFYSGTTAL+VV+QG+ + +ANVGDSRAVLAT +DDDG+LVAVQLTVD KPNLP E ER
Sbjct  196   DSFYSGTTALSVVRQGETVFIANVGDSRAVLATTSDDDGSLVAVQLTVDFKPNLPQEEER  255

Query  841   IMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTF  1020
             I++ +GRV+   DEPG +RVW+P+      VE PGLA+SRAFGDY IKD+GLIS PE T 
Sbjct  256   IIQCQGRVFCLHDEPGTHRVWLPD------VESPGLAMSRAFGDYCIKDYGLISVPEVTQ  309

Query  1021  RNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAM  1200
             RNI+ +DQF +LATDGVWDV+SNQEAV+IVSS P++ +SAKRLVE AV AWKR RRGIA+
Sbjct  310   RNISSKDQFIVLATDGVWDVISNQEAVDIVSSTPDKAKSAKRLVECAVHAWKRKRRGIAI  369

Query  1201  DDMSAICLFFHNKL  1242
             DD+SAICLF H+ +
Sbjct  370   DDISAICLFLHSPI  383



>ref|XP_006588446.1| PREDICTED: uncharacterized protein LOC100794039 isoform X1 [Glycine 
max]
 gb|KHN16089.1| Hypothetical protein glysoja_012065 [Glycine soja]
Length=368

 Score =   448 bits (1152),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 223/363 (61%), Positives = 281/363 (77%), Gaps = 17/363 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS FN  AK+ + K GR +S E  GREAA A+AKEA++N  +L +SG VN   S+N
Sbjct  1     MGHFSSAFNRLAKSFATKKGR-SSDECNGREAAVAMAKEAKRNHFMLHSSGTVNVDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH VAKRVR+ +P+SLLC
Sbjct  60    FASVFSKKGQKGVNQDCCIVWEEFGCQEDMIFCGIFDGHGPWGHFVAKRVRKSMPTSLLC  119

Query  538   NWQKALAHNM--DNLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTT  687
             NWQ+ L+ +    ++ FD          ++WK S++K C+ +D++LEQ  +  SFYSGTT
Sbjct  120   NWQETLSQSPLDSDVDFDVETEKKQHRFNMWKHSYLKTCAAIDRELEQNRKIDSFYSGTT  179

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             AL++V+QG+++++ANVGDSRAVLAT  DDG+LV VQLTVD KPNLP E ERI+ S GRV+
Sbjct  180   ALSIVRQGELIIIANVGDSRAVLATTSDDGSLVPVQLTVDFKPNLPQEAERILESNGRVF  239

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
               DDEPGV+RVW+P+       E PGLA+SRAFGDY +K +GLIS PE T RNIT +DQF
Sbjct  240   CLDDEPGVHRVWLPDE------EFPGLAMSRAFGDYCVKKYGLISVPEVTQRNITSKDQF  293

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              +LATDGVWDV+SNQEAV+IVSS P+R +S+KRLVE A+ AWKR RRGIAMDD+SAICLF
Sbjct  294   VVLATDGVWDVISNQEAVDIVSSTPDRTDSSKRLVECAMRAWKRKRRGIAMDDISAICLF  353

Query  1228  FHN  1236
             FH+
Sbjct  354   FHS  356



>ref|XP_003626188.1| hypothetical protein MTR_7g112490 [Medicago truncatula]
 gb|AES82406.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=377

 Score =   448 bits (1152),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 227/372 (61%), Positives = 282/372 (76%), Gaps = 24/372 (6%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+FNG A++ S K GR + R +  REA  A+AKEA+KN+LIL +SG VN   S+N
Sbjct  1     MGHLSSMFNGLARSFSLKKGRNSVRCE-RREAVEAMAKEAKKNDLILCSSGTVNVDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH VAKRVRE +P SLLC
Sbjct  60    FASIFSKRGQKGTNQDCCIVWEEFGCQEDMIFCGIFDGHGPWGHFVAKRVRESMPRSLLC  119

Query  538   NWQKALAHNMDNL------------GFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGS  669
             NWQ+ LA    +L              DN     ++WK S++K C+ +DQ+LE  ++  S
Sbjct  120   NWQETLAAQSSSLDDHVKDTDHVKTAADNKQQRFNIWKHSYLKTCASIDQELEHCRKFDS  179

Query  670   FYSGTTALTVVKQGDVMVVANVGDSRAVLAT-ADDDGNLVAVQLTVDLKPNLPGERERIM  846
             FYSGTTAL+VV+QG+ + +ANVGDSRAVLAT +DDDG+LVAVQLTVD KPNLP E ERI+
Sbjct  180   FYSGTTALSVVRQGETVFIANVGDSRAVLATTSDDDGSLVAVQLTVDFKPNLPQEEERII  239

Query  847   RSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRN  1026
             + +GRV+   DEPG +RVW+P+      VE PGLA+SRAFGDY IKD+GLIS PE T RN
Sbjct  240   QCQGRVFCLHDEPGTHRVWLPD------VESPGLAMSRAFGDYCIKDYGLISVPEVTQRN  293

Query  1027  ITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDD  1206
             I+ +DQF +LATDGVWDV+SNQEAV+IVSS P++ +SAKRLVE AV AWKR RRGIA+DD
Sbjct  294   ISSKDQFIVLATDGVWDVISNQEAVDIVSSTPDKAKSAKRLVECAVHAWKRKRRGIAIDD  353

Query  1207  MSAICLFFHNKL  1242
             +SAICLF H+ +
Sbjct  354   ISAICLFLHSPI  365



>ref|XP_002512471.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF49923.1| protein phosphatase 2c, putative [Ricinus communis]
Length=359

 Score =   447 bits (1149),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 278/360 (77%), Gaps = 15/360 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+FNG A++++ + G+ N   D GREAA+A+ KEA+KN+LIL +SG VN   S N
Sbjct  1     MGHISSMFNGLARSLAIRKGKNNGNGD-GREAAHAIIKEAKKNDLILRSSGSVNVDGSKN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH VAK+VRE +PSSLLC
Sbjct  60    FASVFSKKGEKGINQDCFIVWEEFGCQEDMIFCGIFDGHGPWGHFVAKKVREWMPSSLLC  119

Query  538   NWQKALAHNMDNLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
              WQ+ LAH   +   D      +    +WK S++K C+ VDQ+LEQ  +  +F+SGTTAL
Sbjct  120   TWQETLAHTSIDPDIDLEADKKHHGFHIWKHSYMKTCAAVDQELEQHRKIDTFHSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QG+++ +ANVGDSRAVLAT  DDGNLV+VQLT+D KPNLP E ERI++  GRV+  
Sbjct  180   TIVRQGELIYIANVGDSRAVLATTSDDGNLVSVQLTIDFKPNLPQEAERIIQCNGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGV+R+W+P+       E PGLA+SRAFGDY +KDFGLIS PE T R+IT  DQF +
Sbjct  240   NDEPGVHRIWLPDQ------ESPGLAMSRAFGDYCVKDFGLISVPEVTQRHITSSDQFVV  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAV+IVSSA +R ++AK LVE AV AWKR R+GIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVISNQEAVQIVSSASDRAKAAKCLVESAVHAWKRKRKGIAMDDISAICLFFH  353



>ref|XP_010674092.1| PREDICTED: probable protein phosphatase 2C 34 [Beta vulgaris 
subsp. vulgaris]
Length=372

 Score =   447 bits (1149),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 220/361 (61%), Positives = 281/361 (78%), Gaps = 14/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  +SS+FNG A++ S K  + +S  DVG+EAA  +AK+A+K++LIL +SG VN   S N
Sbjct  1     MGHWSSMFNGLARSFSMKKLKNSSNGDVGKEAAETMAKDAKKSDLILRSSGIVNVNGSEN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ +R+G+KG NQD  +VWEEFG Q DM+FCG+FDGHGPWGH VAK VRE +P SLLC
Sbjct  61    FASVFTRRGQKGVNQDCCMVWEEFGCQPDMLFCGIFDGHGPWGHFVAKTVRESMPPSLLC  120

Query  538   NWQKALAHNMDNLGFDNCL------LDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             NWQ++LA  + +  FD  L       ++WK+S++K C+ +DQ+LEQ  +  +FYSGTTAL
Sbjct  121   NWQESLAEMVLDPDFDLELDKKVDWFNIWKRSYLKTCATIDQELEQHRKIDAFYSGTTAL  180

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             ++V+QG+ +++ANVGDSRAVLAT  DDG+L AVQLT+D KP LP E ERI +  GRV+  
Sbjct  181   SIVRQGEKIIIANVGDSRAVLATTSDDGDLEAVQLTLDFKPGLPQEAERITQCNGRVFCL  240

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGV+RVW+P+       E PGLA+SRAFGDY IKDFGLIS PE T RNIT +DQF +
Sbjct  241   QDEPGVHRVWLPDE------ELPGLAMSRAFGDYCIKDFGLISVPEVTQRNITSKDQFIV  294

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LA+DGVWDVVSNQEAVEIVSS+ +RG++AKRLV+HAV AWKR RRGIA+DD+SAICLFFH
Sbjct  295   LASDGVWDVVSNQEAVEIVSSSLDRGKAAKRLVDHAVRAWKRKRRGIAIDDISAICLFFH  354

Query  1234  N  1236
             +
Sbjct  355   S  355



>ref|XP_011007059.1| PREDICTED: probable protein phosphatase 2C 41 [Populus euphratica]
Length=375

 Score =   447 bits (1149),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 224/360 (62%), Positives = 276/360 (77%), Gaps = 15/360 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F SL +G A T+S K GR NSR+D G+ AA ALAK+ARKNEL+LS+SG V +  S+N
Sbjct  1     MVLFPSLLDGLAGTVSIKKGR-NSRKDAGKVAAEALAKDARKNELMLSSSGIVKSNKSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  +VWEEFG QEDMIFCG+FDGHGPWGH ++KRVRE VPSSLLC
Sbjct  60    FASVCSKRGQKGINQDSLVVWEEFGCQEDMIFCGIFDGHGPWGHFISKRVRESVPSSLLC  119

Query  538   NWQKALAHNMDNLGFDNCL------LDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
              WQ+ L+     + F+  L       D+WKQ ++K  + +D +L+Q  +  SF SG+TAL
Sbjct  120   KWQETLSLTSLGMDFEMDLERNLHQFDIWKQFYLKTYAAIDHELKQHPEIDSFCSGSTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T++KQG+ +V+ NVGDSRAVLAT +DDG LV +QLT+D KPNLP E ERI RS GRV+  
Sbjct  180   TIIKQGEHLVITNVGDSRAVLATTNDDGCLVPLQLTIDFKPNLPEEAERITRSNGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGV+RVWMPN       + PGLA+SRAFGD+ +KDFGLISEP+ T RNIT  DQF I
Sbjct  240   RDEPGVFRVWMPNG------KTPGLALSRAFGDHCVKDFGLISEPDVTQRNITRGDQFVI  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAV++V S P+R +SAKRLVE AV AWK  +RGIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVISNQEAVQVVFSTPDREKSAKRLVECAVRAWKNKKRGIAMDDISAICLFFH  353



>gb|KHG21938.1| putative phosphatase 2C 73 -like protein [Gossypium arboreum]
Length=360

 Score =   446 bits (1147),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 219/361 (61%), Positives = 276/361 (76%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M QFSS+FNG A++ S + G+     D GREAA A+AK+ +KN+LIL +SGFVN   S+N
Sbjct  1     MSQFSSMFNGLARSFSIRRGKNPGNGD-GREAAEAMAKDGKKNDLILRSSGFVNIDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  IVWEEFG Q DM+FCG+FDGHGPWGH VAK+VRE +PSSLLC
Sbjct  60    FASVFSKRGRKGVNQDCTIVWEEFGCQADMLFCGIFDGHGPWGHFVAKKVRESMPSSLLC  119

Query  538   NWQKALAHNMDNLGFD------NCLLDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTAL  693
             NWQ+ LA    +  FD      +    +WK S+++ C+ VD++LE  ++  S YSGTTAL
Sbjct  120   NWQETLAQASLDPDFDLESDKKHHRFHIWKHSYLQTCAIVDRELEHCRKIDSLYSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QGD++ VAN+GDSRAVLAT  DDGNLV +QLTVD KPNLP E ERI + KGRV+  
Sbjct  180   TIVRQGDLIYVANIGDSRAVLATTSDDGNLVPIQLTVDFKPNLPQEAERITQCKGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGV+RVW+P+       E PGLA+SRAFGDY IKD+GLIS PE T R+IT RDQF +
Sbjct  240   HDEPGVHRVWLPDE------ESPGLAMSRAFGDYCIKDYGLISVPEVTQRHITSRDQFVV  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SN+EA+ IVSS P++ ++AK LVE A  AWK+ R+GIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVISNEEAIRIVSSTPDKAKAAKHLVESAARAWKKKRKGIAMDDISAICLFFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>ref|XP_006472147.1| PREDICTED: probable protein phosphatase 2C 73-like isoform X1 
[Citrus sinensis]
 ref|XP_006472148.1| PREDICTED: probable protein phosphatase 2C 73-like isoform X2 
[Citrus sinensis]
Length=368

 Score =   446 bits (1148),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 229/361 (63%), Positives = 285/361 (79%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S + G KNS    GR AA A+AKEA++NE+IL +SGFVN  SS+N
Sbjct  1     MGHFSSMFNGLARSFSIRKG-KNSESCAGRGAAEAMAKEAKRNEMILRSSGFVNVDSSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A++ S++G+KG NQD AIVWEEFG Q DM+FCG+FDGHGPWGH VAK+VRE +PSSLLC
Sbjct  60    FAAVFSKRGEKGVNQDCAIVWEEFGCQADMMFCGIFDGHGPWGHFVAKKVRESMPSSLLC  119

Query  538   NWQKALAHN--MDNLGFDN----CLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             NWQ+ LA    + ++  D+       ++WK S++K C+ VDQ+LEQ  +  SFYSGTTAL
Sbjct  120   NWQETLAEASLLPDIDLDSDKKTHRFNIWKHSYVKTCAAVDQELEQHRKIDSFYSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QG+ ++VANVGDSRAVLAT  +DG+LV VQLTVD KPNLP E ERI++ KGRV+  
Sbjct  180   TIVRQGEFIMVANVGDSRAVLATTSEDGSLVPVQLTVDFKPNLPYEAERIIQCKGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGV+RVW+PN       E PGLA+SRAFGDY +KD+GLIS PE T R+IT RDQF +
Sbjct  240   EDEPGVHRVWLPNE------ECPGLAMSRAFGDYCVKDYGLISVPEVTQRHITSRDQFVV  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEA++IVSS P R +SAKRLVE AV AWKR R+GIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVISNQEAIQIVSSTPNRAKSAKRLVECAVHAWKRRRKGIAMDDISAICLFFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>ref|XP_004144769.1| PREDICTED: probable protein phosphatase 2C 73-like [Cucumis sativus]
 ref|XP_004158730.1| PREDICTED: probable protein phosphatase 2C 73-like [Cucumis sativus]
 gb|KGN60971.1| hypothetical protein Csa_2G033260 [Cucumis sativus]
Length=367

 Score =   446 bits (1147),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 222/361 (61%), Positives = 277/361 (77%), Gaps = 14/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVG--REAANALAKEARKNELILSTSGFVNAISS  351
             M  FS++FNG A++ S K GR +   D G  RE+A A+ K+A++ + IL TSG +N+  S
Sbjct  1     MGHFSTMFNGLARSFSFKKGRNSGSLDDGGGRESAKAMLKDAKRKDSILCTSGVLNSEGS  60

Query  352   HNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSL  531
                AS+ S++G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH VAK VRE +P SL
Sbjct  61    DTFASVFSKKGEKGVNQDCCIVWEEFGCQEDMIFCGIFDGHGPWGHFVAKTVRESLPPSL  120

Query  532   LCNWQKALAHNMDNLGFD----NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             LC+WQ+ LA    +   D    +   D+WK S+++ C+ +D++LEQ  +  +FYSGTTAL
Sbjct  121   LCHWQQGLAQAFLDPELDSEKKHQRYDIWKHSYLRTCAAIDRELEQHRKIDTFYSGTTAL  180

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             ++VKQG+++V+ANVGDSRAVLAT  DDG++VAVQLTVD KPNLP E ERI++  GRV+  
Sbjct  181   SIVKQGELVVLANVGDSRAVLATTSDDGSVVAVQLTVDFKPNLPQETERIIQCNGRVFCL  240

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGV+RVW+PN       E PGLA+SRAFGDY IKDFGLIS PE T R+IT RDQF I
Sbjct  241   SDEPGVHRVWLPNE------ESPGLAMSRAFGDYCIKDFGLISVPEVTHRSITSRDQFII  294

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDVV+NQEAVEIVSS P+R +++KRLVE AV AWKR RRGIAMDD+SAICLFFH
Sbjct  295   LATDGVWDVVTNQEAVEIVSSTPDRAKASKRLVECAVRAWKRKRRGIAMDDISAICLFFH  354

Query  1234  N  1236
             +
Sbjct  355   S  355



>ref|XP_006433478.1| hypothetical protein CICLE_v10001565mg [Citrus clementina]
 ref|XP_006433479.1| hypothetical protein CICLE_v10001565mg [Citrus clementina]
 ref|XP_006433480.1| hypothetical protein CICLE_v10001565mg [Citrus clementina]
 gb|ESR46718.1| hypothetical protein CICLE_v10001565mg [Citrus clementina]
 gb|ESR46719.1| hypothetical protein CICLE_v10001565mg [Citrus clementina]
 gb|ESR46720.1| hypothetical protein CICLE_v10001565mg [Citrus clementina]
Length=368

 Score =   446 bits (1147),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 230/361 (64%), Positives = 284/361 (79%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+F G A++ S + G KNS    GR AA A+AKEA++NE+IL +SGFVN  SS+N
Sbjct  1     MGHFSSMFYGLARSFSIRKG-KNSESCAGRGAAEAMAKEAKRNEMILRSSGFVNVDSSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD AIVWEEFG Q DM+FCG+FDGHGPWGH VAK+VRE +PSSLLC
Sbjct  60    FASVFSKRGEKGVNQDCAIVWEEFGCQADMMFCGIFDGHGPWGHFVAKKVRESMPSSLLC  119

Query  538   NWQKALAHN--MDNLGFDNCL----LDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             NWQ+ LA    + ++  D+       ++WK S++K C+ VDQ+LEQ  Q  SFYSGTTAL
Sbjct  120   NWQETLAEASLLPDIDLDSDKKTHGFNIWKHSYVKTCAAVDQELEQHRQIDSFYSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QG+ ++VANVGDSRAVLAT  +DG+LV VQLTVD KPNLP E ERI++ KGRV+  
Sbjct  180   TIVRQGEFIMVANVGDSRAVLATTSEDGSLVPVQLTVDFKPNLPYEAERIIQCKGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGV+RVW+PN       E PGLA+SRAFGDY +KD+GLIS PE T R+IT RDQF +
Sbjct  240   EDEPGVHRVWLPNE------ECPGLAMSRAFGDYCVKDYGLISVPEVTQRHITSRDQFVV  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEA++IVSS P R +SAKRLVE AV AWKR R+GIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVISNQEAIQIVSSTPNRAKSAKRLVECAVHAWKRKRKGIAMDDISAICLFFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>ref|XP_008453907.1| PREDICTED: probable protein phosphatase 2C 34 [Cucumis melo]
Length=367

 Score =   446 bits (1147),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 222/361 (61%), Positives = 277/361 (77%), Gaps = 14/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVG--REAANALAKEARKNELILSTSGFVNAISS  351
             M  FS++FNG A++ S K GR +   D G  RE+A A+ K+A++ + IL TSG +N+  S
Sbjct  1     MGHFSTMFNGLARSFSFKKGRNSGSLDDGGGRESAKAMLKDAKRKDSILCTSGVLNSEGS  60

Query  352   HNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSL  531
                AS+ S++G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH VAK VRE +P SL
Sbjct  61    DTFASVFSKKGEKGVNQDCCIVWEEFGCQEDMIFCGIFDGHGPWGHFVAKTVRESLPPSL  120

Query  532   LCNWQKALAHNMDNLGFD----NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             LC+WQ+ LA    +   D    +   D+WK S+++ C+ +D++LEQ  +  +FYSGTTAL
Sbjct  121   LCHWQQGLAQAFLDPELDLEKKHQRYDIWKHSYLRTCAAIDRELEQHRKIDTFYSGTTAL  180

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             ++VKQG+++V+ANVGDSRAVLAT  DDG++VAVQLTVD KPNLP E ERI++  GRV+  
Sbjct  181   SIVKQGELVVLANVGDSRAVLATTSDDGSVVAVQLTVDFKPNLPQEAERIIQCNGRVFCL  240

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGV+RVW+PN       E PGLA+SRAFGDY IKDFGLIS PE T R+IT RDQF I
Sbjct  241   SDEPGVHRVWLPNE------ESPGLAMSRAFGDYCIKDFGLISVPEVTHRSITSRDQFII  294

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDVV+NQEAVEIVSS P+R +++KRLVE AV AWKR RRGIAMDD+SAICLFFH
Sbjct  295   LATDGVWDVVTNQEAVEIVSSTPDRAKASKRLVECAVRAWKRKRRGIAMDDISAICLFFH  354

Query  1234  N  1236
             +
Sbjct  355   S  355



>ref|NP_001242626.1| uncharacterized protein LOC100794039 [Glycine max]
 gb|ACU24033.1| unknown [Glycine max]
Length=368

 Score =   446 bits (1146),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 223/363 (61%), Positives = 282/363 (78%), Gaps = 17/363 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS FN  AK+ + K GR +S E  GREAA A+AKEA++N  +L +SG VN   S+N
Sbjct  1     MGHFSSAFNRLAKSFATKKGR-SSDECNGREAAVAMAKEAKRNHFMLHSSGTVNVDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH VAKRVR+ +P+SLLC
Sbjct  60    FASVFSKKGQKGVNQDCCIVWEEFGCQEDMIFCGIFDGHGPWGHFVAKRVRKSMPTSLLC  119

Query  538   NWQKALAHN-MD-NLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTT  687
             NWQ+ L+ + +D ++ FD          ++WK S++K C+ +D++LEQ  +  SFYSGTT
Sbjct  120   NWQETLSQSPLDSDVDFDVETEKKQHRFNMWKHSYLKTCAAIDRELEQNRKIDSFYSGTT  179

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             AL++V+QG+++++ANVGDSRAVLAT  DDG+LV VQLTVD KPNLP E ERI+ S GRV+
Sbjct  180   ALSIVRQGELIIIANVGDSRAVLATTSDDGSLVPVQLTVDFKPNLPQEAERILESNGRVF  239

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
               DDEPGV+RVW+P+       E PGLA+SRAFGDY +K +GLIS PE T RNIT +DQF
Sbjct  240   CLDDEPGVHRVWLPDE------EFPGLAMSRAFGDYCVKKYGLISVPEVTQRNITSKDQF  293

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              +LATDGVWDV+SNQEAV+IV S P+R +S+KRLVE A+ AWKR RRGIAMDD+SAICLF
Sbjct  294   VVLATDGVWDVISNQEAVDIVFSTPDRTDSSKRLVECAMRAWKRKRRGIAMDDISAICLF  353

Query  1228  FHN  1236
             FH+
Sbjct  354   FHS  356



>gb|KDO81764.1| hypothetical protein CISIN_1g015633mg [Citrus sinensis]
Length=368

 Score =   446 bits (1146),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 229/361 (63%), Positives = 284/361 (79%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+F G A++ S + G KNS    GR AA A+AKEA++NE+IL +SGFVN  SS+N
Sbjct  1     MGHFSSMFYGLARSFSIRKG-KNSESCAGRGAAEAMAKEAKRNEMILRSSGFVNVDSSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A++ S++G+KG NQD AIVWEEFG Q DM+FCG+FDGHGPWGH VAK+VRE +PSSLLC
Sbjct  60    FAAVFSKRGEKGVNQDCAIVWEEFGCQADMMFCGIFDGHGPWGHFVAKKVRESMPSSLLC  119

Query  538   NWQKALAHN--MDNLGFDN----CLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             NWQ+ LA    + ++  D+       ++WK S++K C+ VDQ+LEQ  Q  SFYSGTTAL
Sbjct  120   NWQETLAEASLLPDIDLDSDKKTHRFNIWKHSYVKTCAAVDQELEQHRQIDSFYSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QG+ ++VANVGDSRAVLAT  +DG+LV VQLTVD KPNLP E ERI++ KGRV+  
Sbjct  180   TIVRQGEFIMVANVGDSRAVLATTSEDGSLVPVQLTVDFKPNLPYEAERIIQCKGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGV+RVW+PN       E PGLA+SRAFGDY +KD+GLIS PE T R+IT RDQF +
Sbjct  240   EDEPGVHRVWLPNE------ECPGLAMSRAFGDYCVKDYGLISVPEVTQRHITSRDQFVV  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEA++IVSS P R +SAKRLVE AV AWKR R+GIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVISNQEAIQIVSSTPNRAKSAKRLVECAVHAWKRKRKGIAMDDISAICLFFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>ref|XP_010024092.1| PREDICTED: probable protein phosphatase 2C 34 [Eucalyptus grandis]
 gb|KCW60523.1| hypothetical protein EUGRSUZ_H03267 [Eucalyptus grandis]
 gb|KCW60524.1| hypothetical protein EUGRSUZ_H03267 [Eucalyptus grandis]
Length=371

 Score =   445 bits (1144),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/361 (61%), Positives = 276/361 (76%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FS++FNG A++ S K GR     DV REAA  +AKEA+KN+LIL +SG VNA  S N
Sbjct  1     MGHFSTIFNGLARSFSFKKGRSTGDCDV-REAAETMAKEAKKNDLILCSSGIVNANGSEN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KGANQD  IVWEEFG Q DMIFCG+FDGHGPWGH VAKRVR+ +P SLLC
Sbjct  60    FASVFSKRGEKGANQDCCIVWEEFGCQNDMIFCGIFDGHGPWGHYVAKRVRQTMPPSLLC  119

Query  538   NWQKALAH-----NMDNLGFDNC-LLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             NWQ+ LA      ++D      C   D+WK S++K C+ +D +L Q  +  S YSGTTAL
Sbjct  120   NWQETLAQASLDPDLDLESDKRCHCFDIWKSSYLKTCAAIDNELGQHRKIDSCYSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QG+ +++ANVGDSRAVLAT  +DG+++ VQLTVD KPN+P E ERI++  GR++  
Sbjct  180   TIVRQGEYIIIANVGDSRAVLATTSEDGSILPVQLTVDFKPNIPQEAERIIQCNGRIFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGV+R+W+P+       E PGLA+SRAFGD+ +KDFGLIS PE T RNI+ RDQF +
Sbjct  240   EDEPGVHRLWLPDG------ESPGLAMSRAFGDHCVKDFGLISVPEVTQRNISSRDQFVV  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAV+IVSS P+R +SAKRLVE A  AWKR RRGIAMDD+SAICL+FH
Sbjct  294   LATDGVWDVISNQEAVDIVSSTPDRSKSAKRLVECAAHAWKRKRRGIAMDDISAICLYFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>ref|XP_002315484.1| hypothetical protein POPTR_0010s00830g [Populus trichocarpa]
 gb|EEF01655.1| hypothetical protein POPTR_0010s00830g [Populus trichocarpa]
Length=375

 Score =   442 bits (1138),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/360 (61%), Positives = 278/360 (77%), Gaps = 15/360 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F S  +G ++ IS   GR NS++D G+EAA ALAK+ARKNEL+LS+SG V +  S N
Sbjct  1     MVLFPSFHDGLSRIISTIKGR-NSQKDTGKEAAEALAKDARKNELMLSSSGNVKSSKSDN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD ++VWE FG Q+DMIFCG+FDGHGPWGH V+K+VRE VPS LLC
Sbjct  60    FASVCSKRGQKGINQDSSVVWEGFGSQDDMIFCGIFDGHGPWGHFVSKKVRESVPSLLLC  119

Query  538   NWQKALAHNMDNLGFDNCL------LDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             NWQ+ LA     + F+  L       D+WKQS++K  + +DQ+L+Q  +  SF+SGTTA+
Sbjct  120   NWQENLALTSLGMDFEMDLDRNLHQFDIWKQSYLKTYAAIDQELKQNRKIDSFFSGTTAV  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T++KQG+ +V+ANVGDSRAVLAT   DG+LV +QLT+D KPNLP E ERI +SKGRV+  
Sbjct  180   TIIKQGENLVIANVGDSRAVLATTSIDGSLVPLQLTIDFKPNLPEEAERITQSKGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGVYRVWMPN       + PGL++SRAFGD+ +KDFGL+SEP+ T RNI+ RDQF I
Sbjct  240   HDEPGVYRVWMPNG------KTPGLSLSRAFGDHCVKDFGLVSEPDVTRRNISSRDQFVI  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAV++VS  P+R ESAKRLVE A  AW+  ++GIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVISNQEAVQVVSLTPDREESAKRLVECAGRAWRYKKKGIAMDDISAICLFFH  353



>ref|XP_009411656.1| PREDICTED: probable protein phosphatase 2C 73 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411657.1| PREDICTED: probable protein phosphatase 2C 73 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411658.1| PREDICTED: probable protein phosphatase 2C 73 [Musa acuminata 
subsp. malaccensis]
Length=350

 Score =   441 bits (1135),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 221/359 (62%), Positives = 276/359 (77%), Gaps = 13/359 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M Q SSLFNG AK++     RK +  + GREAA+ L  EA+KN++IL +SG + +  S +
Sbjct  1     MRQISSLFNGLAKSLYA-GKRKVTGAEEGREAADELRSEAKKNDMILRSSGSIRSAGSKS  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S+ S++G+KG NQD +IVWEEFG QEDM+FCGVFDGHGPWGH VAK+V + +PSSLLC
Sbjct  60    LVSVFSQRGEKGVNQDCSIVWEEFGCQEDMMFCGVFDGHGPWGHYVAKKVLKSLPSSLLC  119

Query  538   NWQKALAHNMDNLGFDN--CLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVK  705
             NWQ++LA  + +L  D   C  D+WKQ++++AC  VD++LE      SF+SGTTALT+VK
Sbjct  120   NWQESLA--LASLVADKKLCNFDLWKQAYLRACGVVDKELEHDRSLDSFHSGTTALTIVK  177

Query  706   QGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEP  885
             QG++MV+ANVGDSRAVLATA DDG+LV +QLT+D KPNLP E ERI  SKGRV    DEP
Sbjct  178   QGELMVIANVGDSRAVLATASDDGSLVPIQLTIDFKPNLPQEAERITESKGRVLCLRDEP  237

Query  886   GVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATD  1065
             GV+RVW+P+ +       PGLA+SRAFGDY IKD+GLIS PE T R+IT RDQF +LATD
Sbjct  238   GVHRVWLPDEDA------PGLAMSRAFGDYCIKDYGLISVPEVTQRSITSRDQFVVLATD  291

Query  1066  GVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHNKL  1242
             GVWDV+SNQEAV+IVSS  +R ++AKRLVE AVCAWKR RRGIA DD SAIC+F  + L
Sbjct  292   GVWDVISNQEAVDIVSSTKDRRKAAKRLVERAVCAWKRKRRGIAADDCSAICMFLQSTL  350



>ref|XP_009603244.1| PREDICTED: probable protein phosphatase 2C 34 [Nicotiana tomentosiformis]
 ref|XP_009603245.1| PREDICTED: probable protein phosphatase 2C 34 [Nicotiana tomentosiformis]
 ref|XP_009603246.1| PREDICTED: probable protein phosphatase 2C 34 [Nicotiana tomentosiformis]
Length=371

 Score =   442 bits (1136),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 227/364 (62%), Positives = 282/364 (77%), Gaps = 18/364 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRK---NSREDVGREAANALAKEARKNELILSTSGFVNAIS  348
             M  FSS+FNG A++ S K  R    N + D GREA  A+AKEA+KN+LIL +SG VN + 
Sbjct  1     MGHFSSMFNGLARSFSLKKRRNCTGNGKYD-GREAVEAMAKEAKKNDLILRSSGTVNVVG  59

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S N ASL SR+G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH VAK+VRE + SS
Sbjct  60    SKNFASLFSRRGEKGVNQDCFIVWEEFGCQEDMIFCGIFDGHGPWGHFVAKKVRESMVSS  119

Query  529   LLCNWQKALAH-NMD---NLGFDNCL--LDVWKQSHIKACSEVDQQLEQ--QAGSFYSGT  684
             LLCNWQ++LA  ++D   +L  D  L   ++WK S++KAC+ VDQ+LE   +  +FYSGT
Sbjct  120   LLCNWQESLAEASVDPDLDLDSDKKLQRFNIWKDSYLKACAAVDQELEHHPKIDTFYSGT  179

Query  685   TALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRV  864
             TALT+V+QG+++ +ANVGDSRAVLAT  DDGNLV VQLT+D KPNLP E ERI++  GRV
Sbjct  180   TALTIVRQGEIIFIANVGDSRAVLATTCDDGNLVPVQLTIDFKPNLPQETERIIQCNGRV  239

Query  865   WSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQ  1044
             +  DDE GV+R+W+P+       E PGLA+SRAFGDY +KDFGLIS P+ T R+IT +DQ
Sbjct  240   FCLDDESGVHRLWLPDE------ESPGLAMSRAFGDYCVKDFGLISVPDVTQRHITSKDQ  293

Query  1045  FAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICL  1224
             F +LATDGVWDVVSNQEAVEIVS+ P+R ++AK LV+ AV AWKR RRGIA+DD+SAI L
Sbjct  294   FVVLATDGVWDVVSNQEAVEIVSTTPDRAKAAKCLVQCAVRAWKRKRRGIAVDDISAIVL  353

Query  1225  FFHN  1236
             FFH+
Sbjct  354   FFHS  357



>ref|XP_010421561.1| PREDICTED: probable protein phosphatase 2C 73 [Camelina sativa]
Length=366

 Score =   441 bits (1134),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 215/357 (60%), Positives = 276/357 (77%), Gaps = 11/357 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A+T S K  + N+     +EAA+ +AK+A+K ELIL +SG+VNA  S+N
Sbjct  1     MGHFSSMFNGLARTFSIKRVKNNNGNSDAKEAADDMAKDAKKKELILKSSGYVNAQGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD A+VWE FG QEDMIFCG+FDGHGPWGH V+K VR  +PSSLLC
Sbjct  61    SASIFSKRGEKGVNQDCALVWEGFGCQEDMIFCGIFDGHGPWGHYVSKHVRNSMPSSLLC  120

Query  538   NWQKALAHNMDNLGFDNCLL---DVWKQSHIKACSEVDQQLE--QQAGSFYSGTTALTVV  702
             NWQ  LA    +L   N  L   D+WKQS++K C++VDQ+LE  ++  ++YSG+T+LT+V
Sbjct  121   NWQNILAQATLDLEGSNKKLSRFDIWKQSYLKTCAKVDQELEHHRKIDAYYSGSTSLTIV  180

Query  703   KQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDE  882
             +QGDV+ VANVGDSRAVLAT  D+ +LVAVQLT+D KPNLP E+ERI+  +GRV+  +DE
Sbjct  181   RQGDVIYVANVGDSRAVLATVSDEESLVAVQLTLDFKPNLPQEKERILGCQGRVFCLEDE  240

Query  883   PGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILAT  1062
             PGV+RVW P+       + PGLA+SRAFGDY IKD+GL+S PE T R+I+ +D F ILA+
Sbjct  241   PGVHRVWQPD------AKTPGLAMSRAFGDYCIKDYGLVSVPEVTQRHISTKDHFIILAS  294

Query  1063  DGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             DG+WDV+SNQEAVEIVSS  ER ++AKRLVE AV AWK+ RRGI+MDDMS +CLF H
Sbjct  295   DGIWDVISNQEAVEIVSSTAERPKAAKRLVEQAVRAWKKKRRGISMDDMSVVCLFLH  351



>ref|XP_008775900.1| PREDICTED: probable protein phosphatase 2C 34 [Phoenix dactylifera]
Length=354

 Score =   440 bits (1132),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 225/353 (64%), Positives = 271/353 (77%), Gaps = 9/353 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSSLFNG AK++    G K S  D GREA + LA+EA+KN++IL +SG V    S++
Sbjct  1     MRHFSSLFNGLAKSLYSGRG-KLSGIDCGREAVDELAREAKKNDMILKSSGTVRGEGSNS  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S+ SR+G+KG NQD ++VWEEFG QEDMIFCG+FDGHGPWGH VAK VR+ +P SLLC
Sbjct  60    FVSVFSRRGEKGVNQDCSVVWEEFGCQEDMIFCGIFDGHGPWGHYVAKAVRKSLPPSLLC  119

Query  538   NWQKALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTALTVVKQG  711
             +WQ+ALA          C  D+WKQS+++ C+ VD++LEQ  +  SF+SGTT+LT+VKQG
Sbjct  120   DWQEALALAALVADKKLCQFDIWKQSYLRTCATVDKELEQHRKLDSFHSGTTSLTIVKQG  179

Query  712   DVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGV  891
             + MV+ANVGDSRAVLAT  +DG+LV VQLTVD KPNLP E ERI R  GRV+   DEPGV
Sbjct  180   EFMVIANVGDSRAVLATTSEDGSLVPVQLTVDSKPNLPQEAERITRCNGRVFCLPDEPGV  239

Query  892   YRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGV  1071
             +RVW+PN       E PGLA+SRAFGDY IKD+GLIS PE + R IT RDQF +LATDGV
Sbjct  240   HRVWLPND------ETPGLAMSRAFGDYCIKDYGLISVPEVSQRTITNRDQFIVLATDGV  293

Query  1072  WDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             WDV+SNQEAV+IVSS  ERG+SAKRLVE AV AWKR RRGIA+DD SAICLFF
Sbjct  294   WDVISNQEAVQIVSSTKERGKSAKRLVECAVRAWKRKRRGIAVDDCSAICLFF  346



>ref|XP_009790307.1| PREDICTED: probable protein phosphatase 2C 34 [Nicotiana sylvestris]
 ref|XP_009790308.1| PREDICTED: probable protein phosphatase 2C 34 [Nicotiana sylvestris]
 ref|XP_009790309.1| PREDICTED: probable protein phosphatase 2C 34 [Nicotiana sylvestris]
Length=371

 Score =   440 bits (1132),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 226/364 (62%), Positives = 281/364 (77%), Gaps = 18/364 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTIS---KKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAIS  348
             M  FSS+FNG A++ S   +K+   N + D GREA  A+AKEA+KN+LIL +SG VN + 
Sbjct  1     MGHFSSMFNGLARSFSLKKRKNCTGNGKYD-GREAVEAMAKEAKKNDLILRSSGTVNVVG  59

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S N  SL SR+G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH VAK+VRE + SS
Sbjct  60    SKNFTSLFSRRGEKGVNQDCFIVWEEFGCQEDMIFCGIFDGHGPWGHFVAKKVRESIVSS  119

Query  529   LLCNWQKALAH-NMD---NLGFDNCL--LDVWKQSHIKACSEVDQQLEQ--QAGSFYSGT  684
             LLCNWQ++LA  ++D   +L  D  L   ++WK S++KAC+ VDQ+LE   +  +FYSGT
Sbjct  120   LLCNWQESLAEASVDPDLDLDSDKKLQRFNIWKDSYLKACAAVDQELEHHPKIDTFYSGT  179

Query  685   TALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRV  864
             TALT+V+QG+V+ +ANVGDSRAVLAT  DDGNLV VQLT+D KPNLP E ERI++  GRV
Sbjct  180   TALTIVRQGEVIFIANVGDSRAVLATTCDDGNLVPVQLTIDFKPNLPQETERIIQCNGRV  239

Query  865   WSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQ  1044
             +  DDE GV+R+W+P+       E PGLA+SRAFGDY +KDFGLIS P+ T R IT +DQ
Sbjct  240   FCLDDESGVHRLWLPDE------ESPGLAMSRAFGDYCVKDFGLISVPDVTQRRITSKDQ  293

Query  1045  FAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICL  1224
             F +LATDGVWDVVSNQEAVEIVS+ P+R ++AK LV+ AV AWKR RRGIA+DD+SAI L
Sbjct  294   FVVLATDGVWDVVSNQEAVEIVSTTPDRAKAAKCLVQCAVRAWKRKRRGIAVDDISAIVL  353

Query  1225  FFHN  1236
             FFH+
Sbjct  354   FFHS  357



>ref|XP_002318972.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|EEE94895.1| phosphatase 2C family protein [Populus trichocarpa]
Length=368

 Score =   440 bits (1132),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 221/361 (61%), Positives = 273/361 (76%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG AK+ + +  + N   D GREAA A+AK+A+KNE+IL +SG VN   S N
Sbjct  1     MGHFSSMFNGLAKSFTIRKVKSNGNGD-GREAAEAMAKDAKKNEMILRSSGCVNVDGSKN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ SR+G+KG NQD  IVWEEFG Q DM FCG+FDGHG WGH VAK+VRE + +SLLC
Sbjct  60    FASVFSRRGEKGVNQDCCIVWEEFGCQADMTFCGIFDGHGQWGHFVAKKVRESMATSLLC  119

Query  538   NWQKALAHNMDNLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             NWQ+ LA    +   D      +   ++WK S++K C+ VDQ+LEQ  +  SFYSGTTAL
Sbjct  120   NWQETLAQCSLDPDIDLESDKKHQRFNMWKHSYLKTCAAVDQELEQHRKIDSFYSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QG+ + VANVGDSRAVLAT  DDG+LV VQLTVD KPNLP E ERI++ +GRV+  
Sbjct  180   TIVRQGEHIFVANVGDSRAVLATTADDGSLVQVQLTVDFKPNLPQETERILQCRGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             DDEPGV+RVW P+       E PGLA+SRAFGDY +K+FGLIS PE T R++T  DQF I
Sbjct  240   DDEPGVHRVWQPD------AESPGLAMSRAFGDYCVKNFGLISVPEVTQRHLTSEDQFVI  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAV+IVSS P+R ++AKRLV+ AV AWKR R+GIAMDD+SAICLF H
Sbjct  294   LATDGVWDVISNQEAVQIVSSTPDRAKAAKRLVQSAVHAWKRKRKGIAMDDISAICLFVH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>gb|KHN03336.1| Hypothetical protein glysoja_004362 [Glycine soja]
Length=376

 Score =   440 bits (1132),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 217/361 (60%), Positives = 270/361 (75%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F S  NG  +T+S K  +   +ED GR+A   LAKEARKNEL+LS+SG V +  ++N
Sbjct  9     MVLFPSFVNGLVRTVSIKKEKNCQKED-GRKAVEELAKEARKNELLLSSSGVVKSTKANN  67

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S+ + +G+KG NQDR +VWEEFG Q+DM+FCGVFDGHGPWGH VAKRVR+LVP+ LLC
Sbjct  68    FVSVFTNRGQKGVNQDRLLVWEEFGCQQDMMFCGVFDGHGPWGHFVAKRVRKLVPAVLLC  127

Query  538   NWQKALAHNMDNLGF----DNCL--LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTAL  693
             NWQ+ LA    +L F    D  +  LD+WKQS+IK C+ VDQ L+Q  G  SF SG+TAL
Sbjct  128   NWQENLAATSLDLDFKMEADKNIHGLDIWKQSYIKTCAAVDQDLKQHTGIDSFLSGSTAL  187

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T++KQG+ + +AN+GD RAVLAT  DDG L   QLT D KPNLP E ERI +S+GRV+  
Sbjct  188   TIIKQGEYLTIANIGDCRAVLATTSDDGILTPHQLTTDFKPNLPQEAERITQSRGRVFCM  247

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGVYRVWMPN       + PGLA+SRAFGD+ +KDFGLIS P+ T R IT RDQF I
Sbjct  248   EDEPGVYRVWMPNG------KTPGLAISRAFGDHCMKDFGLISVPDVTHRKITTRDQFVI  301

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAV+IVS+   + ++A+RLV+ A+  WKR + GIAMDDMSAICLFFH
Sbjct  302   LATDGVWDVISNQEAVKIVSATSHKEKAAQRLVKCAIHEWKRKKSGIAMDDMSAICLFFH  361

Query  1234  N  1236
             +
Sbjct  362   S  362



>ref|XP_003550418.1| PREDICTED: probable protein phosphatase 2C 73-like [Glycine max]
Length=368

 Score =   440 bits (1131),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 217/361 (60%), Positives = 270/361 (75%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F S  NG  +T+S K  +   +ED GR+A   LAKEARKNEL+LS+SG V +  ++N
Sbjct  1     MVLFPSFVNGLVRTVSIKKEKNCQKED-GRKAVEELAKEARKNELLLSSSGVVKSTKANN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S+ + +G+KG NQDR +VWEEFG Q+DM+FCGVFDGHGPWGH VAKRVR+LVP+ LLC
Sbjct  60    FVSVFTNRGQKGVNQDRLLVWEEFGCQQDMMFCGVFDGHGPWGHFVAKRVRKLVPAVLLC  119

Query  538   NWQKALAHNMDNLGF----DNCL--LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTAL  693
             NWQ+ LA    +L F    D  +  LD+WKQS+IK C+ VDQ L+Q  G  SF SG+TAL
Sbjct  120   NWQENLAATSLDLDFKMEADKNIHGLDIWKQSYIKTCAAVDQDLKQHTGIDSFLSGSTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T++KQG+ + +AN+GD RAVLAT  DDG L   QLT D KPNLP E ERI +S+GRV+  
Sbjct  180   TIIKQGEYLTIANIGDCRAVLATTSDDGILTPHQLTTDFKPNLPQEAERITQSRGRVFCM  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGVYRVWMPN       + PGLA+SRAFGD+ +KDFGLIS P+ T R IT RDQF I
Sbjct  240   EDEPGVYRVWMPNG------KTPGLAISRAFGDHCMKDFGLISVPDVTHRKITTRDQFVI  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAV+IVS+   + ++A+RLV+ A+  WKR + GIAMDDMSAICLFFH
Sbjct  294   LATDGVWDVISNQEAVKIVSATSHKEKAAQRLVKCAIHEWKRKKSGIAMDDMSAICLFFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>ref|XP_010493963.1| PREDICTED: probable protein phosphatase 2C 73 [Camelina sativa]
 ref|XP_010493964.1| PREDICTED: probable protein phosphatase 2C 73 [Camelina sativa]
 ref|XP_010493965.1| PREDICTED: probable protein phosphatase 2C 73 [Camelina sativa]
Length=366

 Score =   439 bits (1130),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 215/357 (60%), Positives = 274/357 (77%), Gaps = 11/357 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A+T S K  + N+     +EAA+ +AK+A+K ELIL +SG+VNA  S+N
Sbjct  1     MGHFSSMFNGLARTFSIKRVKNNNGNSDAKEAADDMAKDAKKKELILKSSGYVNAQGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD A+VWE FG QEDMIFCG+FDGHGPWGH V+K VR  +PSSLLC
Sbjct  61    SASIFSKRGEKGVNQDCALVWEGFGCQEDMIFCGIFDGHGPWGHYVSKHVRNSMPSSLLC  120

Query  538   NWQKALAHNMDNLGFDNCLL---DVWKQSHIKACSEVDQQLE--QQAGSFYSGTTALTVV  702
             NWQ  LA    +L   N  L   D+WKQS++K C+ VDQ+LE  ++  ++YSG+T+LT+V
Sbjct  121   NWQNILAQATLDLEGSNKKLSRFDIWKQSYLKTCATVDQELEHHRKIDAYYSGSTSLTIV  180

Query  703   KQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDE  882
             +QGDV+ VANVGDSRAVLAT  D+ +LVAVQLT+D KPNLP E ERI+  +GRV+  +DE
Sbjct  181   RQGDVIYVANVGDSRAVLATVSDEESLVAVQLTLDFKPNLPQEEERILGCQGRVFCLEDE  240

Query  883   PGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILAT  1062
             PGV+RVW P+       + PGLA+SRAFGDY IKD+GL+S PE T R+I+ +D F ILA+
Sbjct  241   PGVHRVWQPD------AKTPGLAMSRAFGDYCIKDYGLVSVPEVTQRHISTKDHFIILAS  294

Query  1063  DGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             DG+WDV+SNQEAVEIVSS  ER ++AKRLVE AV AWK+ RRGI+MDDMS +CLF H
Sbjct  295   DGIWDVISNQEAVEIVSSTAERPKAAKRLVEQAVRAWKKKRRGISMDDMSVVCLFLH  351



>ref|XP_002872251.1| hypothetical protein ARALYDRAFT_489539 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48510.1| hypothetical protein ARALYDRAFT_489539 [Arabidopsis lyrata subsp. 
lyrata]
Length=372

 Score =   440 bits (1131),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 217/359 (60%), Positives = 277/359 (77%), Gaps = 15/359 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S K  + N+     +EAA+ +A EA+K ELIL +SG+VNA  S+N
Sbjct  1     MGHFSSMFNGLARSFSIKKVKNNNGNCDAKEAADEMANEAKKKELILKSSGYVNAQGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD A+VWE FG QEDMIFCG+FDGHGPWGH VAK+VR  +PSSLLC
Sbjct  61    LASVFSKRGEKGVNQDCALVWEGFGCQEDMIFCGIFDGHGPWGHYVAKQVRNSMPSSLLC  120

Query  538   NWQKALAH-----NMDNLGFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTA  690
             NWQK LA       +D  G +  L   D+WKQS++K C+ VDQ+LE  ++  S+YSGTTA
Sbjct  121   NWQKILAQATLEPELDLEGSNKKLSRFDIWKQSYLKTCATVDQELEHHRKIDSYYSGTTA  180

Query  691   LTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWS  870
             LT+V+QG+V+ VANVGDSRAVLAT  D+G+LVAVQLT+D KPNLP E+ERI+  KGRV+ 
Sbjct  181   LTIVRQGEVIYVANVGDSRAVLATVSDEGSLVAVQLTLDFKPNLPQEKERIIGCKGRVFC  240

Query  871   SDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFA  1050
              +DEPGV+RVW P+       E PGLA+SRAFGDY IK++GL+S PE T R+I+ +D F 
Sbjct  241   LEDEPGVHRVWQPDS------ETPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISTKDHFI  294

Query  1051  ILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
             ILA+DG+WDV+SNQEA+EIVSS  ER ++AKRLVE AV AWK+ RRG++MDDMS +CLF
Sbjct  295   ILASDGIWDVISNQEAIEIVSSMAERPKAAKRLVEQAVRAWKKKRRGLSMDDMSVVCLF  353



>ref|XP_010455072.1| PREDICTED: probable protein phosphatase 2C 73 [Camelina sativa]
Length=370

 Score =   439 bits (1129),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 216/361 (60%), Positives = 276/361 (76%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A+T S K  + N+     +EAA+ +AK+A+K ELIL +SG+VNA  S+N
Sbjct  1     MGHFSSMFNGLARTFSIKRVKNNNGNSDAKEAADDMAKDAKKKELILKSSGYVNAQGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD A+VWE FG QEDMIFCG+FDGHGPWGH V+K VR  +PSSLLC
Sbjct  61    SASIFSKRGEKGVNQDCALVWEGFGCQEDMIFCGIFDGHGPWGHYVSKHVRNSMPSSLLC  120

Query  538   NWQKALAH-----NMDNLGFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTA  690
             NWQ  LA      ++D  G +  L   D+WKQS++K C+ VDQ+LE  ++  ++YSG+TA
Sbjct  121   NWQNILAQATLYPDLDLEGSNKKLSRFDIWKQSYLKTCATVDQELEHHRKIDAYYSGSTA  180

Query  691   LTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWS  870
             LT+V+QGDV+ VANVGDSRAVLAT  D+ +LVAVQLT+D KPNLP E ERI+  +GRV+ 
Sbjct  181   LTIVRQGDVIYVANVGDSRAVLATVSDEESLVAVQLTLDFKPNLPQEEERILGCQGRVFC  240

Query  871   SDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFA  1050
              +DEPGV+RVW P+       + PGLA+SRAFGDY IKD+GL+S PE T R+I+ +D F 
Sbjct  241   LEDEPGVHRVWQPD------AKTPGLAMSRAFGDYCIKDYGLVSVPEVTQRHISTKDHFI  294

Query  1051  ILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             ILA+DG+WDV+SNQEAVEIVSS  ER ++AKRLVE AV AWK+ RRGI+MDDMS +CLF 
Sbjct  295   ILASDGIWDVISNQEAVEIVSSTAERPKAAKRLVEQAVRAWKKKRRGISMDDMSVVCLFL  354

Query  1231  H  1233
             H
Sbjct  355   H  355



>ref|XP_003554628.1| PREDICTED: probable protein phosphatase 2C 73-like isoform X1 
[Glycine max]
 ref|XP_006604797.1| PREDICTED: probable protein phosphatase 2C 73-like isoform X2 
[Glycine max]
 gb|KHN43326.1| Hypothetical protein glysoja_001909 [Glycine soja]
Length=369

 Score =   439 bits (1129),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 220/364 (60%), Positives = 280/364 (77%), Gaps = 16/364 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S K G KN +   GRE A+A+AKEA+KN+++L +SG V+   S+N
Sbjct  1     MGHFSSMFNGLARSFSMKKGGKNGKC-GGRETADAMAKEAKKNDMMLCSSGIVHVDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH VAKRVRE +P SLLC
Sbjct  60    FASVFSKRGQKGVNQDCCIVWEEFGCQEDMIFCGIFDGHGPWGHFVAKRVRESMPPSLLC  119

Query  538   NWQKALAHNMDNLGFD-------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTA  690
             NWQ+ LA    +   D           ++WK S++K C+ +DQ+LEQ  +  SFYSGTTA
Sbjct  120   NWQETLAQTSIDQAIDVEEEKSKQYRFNIWKHSYLKTCAAIDQELEQYRKIDSFYSGTTA  179

Query  691   LTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWS  870
             L++V+QG+++V+ANVGDSRAVLAT  DDG+LV VQLT+D KPNLP E ERI++ +GRV+ 
Sbjct  180   LSIVRQGELIVIANVGDSRAVLATTSDDGSLVPVQLTIDFKPNLPQEAERIIQCQGRVFC  239

Query  871   SDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFA  1050
              +DEPGV+RVW+P+       E PGLA+SRAFGDY IK  GLIS PE T RNI+ RDQF 
Sbjct  240   LEDEPGVHRVWLPDE------ESPGLAMSRAFGDYCIKGHGLISVPEVTHRNISSRDQFV  293

Query  1051  ILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             +LATDGVWDV+SN+EAV+IVSS  ++ ++AKRLVE AV AWKR R+GIA+DD+SAICLFF
Sbjct  294   VLATDGVWDVISNKEAVDIVSSTADKAKAAKRLVECAVHAWKRKRQGIAVDDISAICLFF  353

Query  1231  HNKL  1242
             H+ L
Sbjct  354   HSSL  357



>emb|CDP17222.1| unnamed protein product [Coffea canephora]
Length=369

 Score =   437 bits (1124),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 221/361 (61%), Positives = 269/361 (75%), Gaps = 14/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M Q S++FNG A+++S K  R       GREA  A+ +EA+K  LIL TSG VN   S N
Sbjct  1     MGQLSTMFNGLARSLSIKQRRSYFGSCRGREAMEAMTEEAKKEGLILRTSGTVNVDVSKN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A++ S++G+KG NQD  IVWEEFGGQ+DM+FCGVFDGHG WGH VAK VRE +PSSLLC
Sbjct  61    FAAVFSKRGEKGVNQDCCIVWEEFGGQKDMVFCGVFDGHGQWGHFVAKSVRESMPSSLLC  120

Query  538   NWQKALAHNMDNLGFDNC------LLDVWKQSHIKACSEVDQQLEQQA--GSFYSGTTAL  693
             NWQ+ LA    +  FD          + WKQS+IK C+ VDQQL++Q    +F SGTTAL
Sbjct  121   NWQETLAEASLDPSFDLASEKKLNTFNKWKQSYIKTCAAVDQQLKRQRKFDTFNSGTTAL  180

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QGD++ VANVGDSRAVLAT  DDGNLV VQLT+D KPNLP E ERI + +GRV   
Sbjct  181   TIVRQGDLIYVANVGDSRAVLATTSDDGNLVPVQLTIDFKPNLPEEAERISKCRGRVICL  240

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGV+R+W+P+       E PGLA+SRAFGDY +KDFGLIS PE T R+I+  DQF +
Sbjct  241   EDEPGVHRLWLPDE------ESPGLAMSRAFGDYCVKDFGLISVPEVTQRHISGNDQFVV  294

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDVVSNQEAV+IV+S P+R +SAKRLVE A  AW+R RRGIAMDD+SAI L+FH
Sbjct  295   LATDGVWDVVSNQEAVQIVASTPDRAKSAKRLVECAAHAWRRKRRGIAMDDISAIVLYFH  354

Query  1234  N  1236
             N
Sbjct  355   N  355



>ref|XP_006582948.1| PREDICTED: uncharacterized protein LOC100817397 isoform X1 [Glycine 
max]
 gb|KHN02939.1| Hypothetical protein glysoja_009805 [Glycine soja]
Length=367

 Score =   437 bits (1123),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 215/361 (60%), Positives = 268/361 (74%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F S  NG  +T+S K  +   RED GR+A   LAKEARKNEL+LS+SG V +  ++N
Sbjct  1     MVLFPSFVNGLVRTVSIKKEKNCQRED-GRKAVEELAKEARKNELLLSSSGVVKSTKANN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S+ + +G+KG NQDR +VWEEFG Q+DM+FCGVFDGHGPWGH VAKRVR+LVP+ LLC
Sbjct  60    FVSVFTNRGQKGVNQDRLLVWEEFGCQQDMMFCGVFDGHGPWGHFVAKRVRKLVPAFLLC  119

Query  538   NWQKALAHNMDNLGF----DNCL--LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTAL  693
             NWQ+ LA    +L F    D  +   D+WKQS+IK C+ VDQ L+Q  G  S+ SGTTAL
Sbjct  120   NWQENLATTSLDLDFKMEADKNIHGFDIWKQSYIKTCAAVDQDLKQHTGIDSYLSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T++KQG+ + +AN+GDSRAVLA   DDG L   QLT D KPNLP E ERI +S+G+V+  
Sbjct  180   TIIKQGEYLTIANIGDSRAVLAATSDDGTLTPHQLTTDFKPNLPQEAERITQSRGQVFCM  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGVYRVWMPN       + PGLA+SRAFGD+ +KDFGLIS P+ T R IT RDQF I
Sbjct  240   EDEPGVYRVWMPNG------KTPGLAISRAFGDHCMKDFGLISVPDVTHRKITPRDQFVI  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAV+IVS+   + ++A+RLV+ A+  WKR + GIAMDDMS ICLFFH
Sbjct  294   LATDGVWDVISNQEAVKIVSATSHKEKAAQRLVKCAIHEWKRKKSGIAMDDMSVICLFFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>ref|XP_009611823.1| PREDICTED: probable protein phosphatase 2C 34 isoform X1 [Nicotiana 
tomentosiformis]
Length=363

 Score =   437 bits (1123),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 219/360 (61%), Positives = 268/360 (74%), Gaps = 12/360 (3%)
 Frame = +1

Query  175   KMVQFSSLFNGFAKTISKKSGRKNSREDV--GREAANALAKEARKNELILSTSGFVNAIS  348
             +M  FSS+FNG A+++S K GR+NS      G EAA A+AK A+KN+ IL +SG VN   
Sbjct  7     EMGHFSSMFNGLARSLSLKKGRENSGNGNYNGTEAAEAMAKGAKKNDFILRSSGTVNVDG  66

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S N AS+ S++G+KG NQD  IVWEEFG QEDMIFCGVFDGHGPWGH VAK VR+ +PSS
Sbjct  67    SKNLASVFSKRGEKGVNQDCVIVWEEFGCQEDMIFCGVFDGHGPWGHFVAKCVRDSMPSS  126

Query  529   LLCNWQKAL--AHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQA--GSFYSGTTALT  696
             LL NWQ+ L  A    +   D+   D+WK S+ KAC+ VD +LEQ     SFYSGTT+LT
Sbjct  127   LLSNWQEILSEASTDSDFDLDSDKFDIWKHSYTKACAAVDHELEQHPKIDSFYSGTTSLT  186

Query  697   VVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSD  876
             +++QG+ + +ANVGDSRAVLAT  +DGNLV VQLT D KPNLP E ERI +  GRV+  D
Sbjct  187   ILRQGEALFIANVGDSRAVLATMSEDGNLVPVQLTKDFKPNLPQEAERIKQCNGRVFCLD  246

Query  877   DEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAIL  1056
             DEPGV+R+W+P        E PGLA+SRAFGDY +KDFGL S P+   R IT +DQF +L
Sbjct  247   DEPGVHRLWLPED------ESPGLAISRAFGDYCVKDFGLTSVPDVIERYITSKDQFVVL  300

Query  1057  ATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             ATDGVWDV+SNQEAV+IVSS PER ++AKRLV+ A CAW+  RRGIAMDD+SAI LFFH+
Sbjct  301   ATDGVWDVISNQEAVQIVSSTPERAKAAKRLVQSAGCAWRHKRRGIAMDDISAIVLFFHS  360



>ref|XP_009611824.1| PREDICTED: probable protein phosphatase 2C 34 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009611825.1| PREDICTED: probable protein phosphatase 2C 34 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009611826.1| PREDICTED: probable protein phosphatase 2C 34 isoform X2 [Nicotiana 
tomentosiformis]
Length=356

 Score =   436 bits (1122),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 267/359 (74%), Gaps = 12/359 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDV--GREAANALAKEARKNELILSTSGFVNAISS  351
             M  FSS+FNG A+++S K GR+NS      G EAA A+AK A+KN+ IL +SG VN   S
Sbjct  1     MGHFSSMFNGLARSLSLKKGRENSGNGNYNGTEAAEAMAKGAKKNDFILRSSGTVNVDGS  60

Query  352   HNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSL  531
              N AS+ S++G+KG NQD  IVWEEFG QEDMIFCGVFDGHGPWGH VAK VR+ +PSSL
Sbjct  61    KNLASVFSKRGEKGVNQDCVIVWEEFGCQEDMIFCGVFDGHGPWGHFVAKCVRDSMPSSL  120

Query  532   LCNWQKAL--AHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQA--GSFYSGTTALTV  699
             L NWQ+ L  A    +   D+   D+WK S+ KAC+ VD +LEQ     SFYSGTT+LT+
Sbjct  121   LSNWQEILSEASTDSDFDLDSDKFDIWKHSYTKACAAVDHELEQHPKIDSFYSGTTSLTI  180

Query  700   VKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDD  879
             ++QG+ + +ANVGDSRAVLAT  +DGNLV VQLT D KPNLP E ERI +  GRV+  DD
Sbjct  181   LRQGEALFIANVGDSRAVLATMSEDGNLVPVQLTKDFKPNLPQEAERIKQCNGRVFCLDD  240

Query  880   EPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILA  1059
             EPGV+R+W+P        E PGLA+SRAFGDY +KDFGL S P+   R IT +DQF +LA
Sbjct  241   EPGVHRLWLPED------ESPGLAISRAFGDYCVKDFGLTSVPDVIERYITSKDQFVVLA  294

Query  1060  TDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             TDGVWDV+SNQEAV+IVSS PER ++AKRLV+ A CAW+  RRGIAMDD+SAI LFFH+
Sbjct  295   TDGVWDVISNQEAVQIVSSTPERAKAAKRLVQSAGCAWRHKRRGIAMDDISAIVLFFHS  353



>ref|XP_011023729.1| PREDICTED: probable protein phosphatase 2C 34 [Populus euphratica]
Length=368

 Score =   436 bits (1122),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 221/361 (61%), Positives = 271/361 (75%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG AK+ + +  + N   D GREAA A+AK+A+KNE IL +SG VN   S  
Sbjct  1     MGHFSSMFNGLAKSFTIRKVKSNGNGD-GREAAEAMAKDAKKNETILRSSGCVNVDGSKI  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ SR+G+KG NQD  IVWEEFG Q DM FCG+FDGHG WGH VAK+VRE + +SLLC
Sbjct  60    FASVFSRRGEKGVNQDCCIVWEEFGCQADMTFCGIFDGHGQWGHFVAKKVRESMATSLLC  119

Query  538   NWQKALAHNMDNLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             NWQ+ LA    +   D      +   ++WK S++K C+ VDQ+LEQ  +  SFYSGTTAL
Sbjct  120   NWQETLAQCSLDPDIDLESDIKHQRFNMWKHSYLKTCAVVDQELEQHRKIDSFYSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QG+ + VANVGDSRAVLAT  DDG+LV VQLTVD KPNLP E ERI++ +GRV+  
Sbjct  180   TIVRQGEHIFVANVGDSRAVLATTADDGSLVQVQLTVDFKPNLPQETERILQCRGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             DDEPGV+RVW P+       E PGLA+SRAFGDY +K+FGLIS PE T R++T  DQF I
Sbjct  240   DDEPGVHRVWQPD------AESPGLAMSRAFGDYCVKNFGLISVPEVTQRHLTSEDQFVI  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAV+IVSS P+R ++AKRLV  AV AWKR R+GIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVISNQEAVQIVSSTPDRAKAAKRLVHSAVHAWKRKRKGIAMDDISAICLFFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>ref|XP_010524853.1| PREDICTED: probable protein phosphatase 2C 73 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010524854.1| PREDICTED: probable protein phosphatase 2C 73 isoform X1 [Tarenaya 
hassleriana]
Length=356

 Score =   436 bits (1121),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 221/361 (61%), Positives = 273/361 (76%), Gaps = 17/361 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG   +   K  R N   +  REAA+ +A+EA+KNELIL +SG++ A  S+ 
Sbjct  1     MGHFSSMFNGLTPSFLIKKVRNN---NGNREAADEMAREAKKNELILRSSGYIYADGSNT  57

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD AIVWE+FG QED+IFCG+FDGHGPWGH VAK VR  +PSSLLC
Sbjct  58    LASVFSKRGEKGVNQDCAIVWEKFGCQEDIIFCGIFDGHGPWGHFVAKHVRNSLPSSLLC  117

Query  538   NWQKALAHNMDN----LGFDNCL--LDVWKQSHIKACSEVDQQLEQQ--AGSFYSGTTAL  693
             NWQ+ LAH   N    L  D  L   ++WK+S++K CSEVDQ+LE Q    +FYSGTT L
Sbjct  118   NWQETLAHIELNTETGLESDKKLQPFNIWKRSYLKTCSEVDQELENQRKIDTFYSGTTGL  177

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QG+ + VANVGDSRAVLAT   +G+LV+VQLT+D KP+LP E ERI+RS GRV+  
Sbjct  178   TIVRQGEDIYVANVGDSRAVLATVSAEGSLVSVQLTIDFKPDLPQEEERIVRSNGRVFCL  237

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGV RVW+P+       E PGLA+SRAFGDY IK++GL+S PE T R IT RDQF I
Sbjct  238   EDEPGVQRVWLPDE------ESPGLAMSRAFGDYCIKEYGLVSVPEVTQRRITTRDQFVI  291

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAVEIVSS  ER ++A+RLVE AV AWK+ R G AMDD+SAICLFFH
Sbjct  292   LATDGVWDVISNQEAVEIVSSVSERPKAARRLVEKAVKAWKKKRPGFAMDDISAICLFFH  351

Query  1234  N  1236
             +
Sbjct  352   S  352



>ref|XP_008775678.1| PREDICTED: probable protein phosphatase 2C 34 [Phoenix dactylifera]
Length=354

 Score =   436 bits (1120),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 223/353 (63%), Positives = 272/353 (77%), Gaps = 9/353 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M    SLFNG AK++    G K S  D GREAA+ LA+EA+KN++IL +SG V    S++
Sbjct  1     MRHLLSLFNGLAKSLYSGRG-KFSGIDCGREAADELAREAKKNDMILKSSGTVGGEGSNS  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S+ SR+G+KG NQD +IVWEEFG QEDMIFCG+FDGHGPWGH V+K VR+ +P SLLC
Sbjct  60    FVSVFSRRGEKGVNQDCSIVWEEFGCQEDMIFCGIFDGHGPWGHYVSKAVRKSLPPSLLC  119

Query  538   NWQKALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTALTVVKQG  711
             NWQ+ALA        + C  D+WKQS++  C+ VD++LE+  +  SF+SGTTALT+VKQG
Sbjct  120   NWQEALALAALVADKNLCQFDIWKQSYLSTCATVDKELEKHRRLDSFHSGTTALTIVKQG  179

Query  712   DVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGV  891
             ++MV+ANVGDSRAVLAT  +DG+LV VQLT+D KPNLP E ERI R KG V+   DEPGV
Sbjct  180   ELMVIANVGDSRAVLATTAEDGSLVPVQLTIDFKPNLPQEAERITRCKGCVFCLHDEPGV  239

Query  892   YRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGV  1071
             +RVW+PN       E PGLA+SRAFGDY +KD+GLIS PE T R IT RDQF +LATDGV
Sbjct  240   HRVWLPNG------ETPGLAMSRAFGDYCVKDYGLISVPEVTQRRITNRDQFIVLATDGV  293

Query  1072  WDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             WDV+SNQEAV++VSS+ ERG+SAK LVEHAV AWKR RRGIA+DD SAICLFF
Sbjct  294   WDVISNQEAVQMVSSSRERGKSAKWLVEHAVRAWKRKRRGIAVDDCSAICLFF  346



>gb|KDP23431.1| hypothetical protein JCGZ_23264 [Jatropha curcas]
Length=369

 Score =   436 bits (1120),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 227/361 (63%), Positives = 276/361 (76%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+FNG A+++  + G+     D GREAA  +AKEA+KN+LIL +SGF+N   S N
Sbjct  1     MGHLSSMFNGLARSLLIRKGKNYDSGD-GREAAEEMAKEAKKNDLILRSSGFINLDGSKN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS  S++G+KG NQD  I+WEEFG QEDMIFCG+FDGHGPWGH VAK+VRE +PSSLLC
Sbjct  60    SASGFSKRGEKGTNQDCFIIWEEFGCQEDMIFCGIFDGHGPWGHYVAKKVREWMPSSLLC  119

Query  538   NWQKALAHNMDNLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             NWQ+ LA    +   D      +   ++WK S+IKAC+ VDQ+LEQ  +  SF+SG TAL
Sbjct  120   NWQETLAQTSLDPDIDLDSDKKHQRFNIWKHSYIKACAAVDQELEQHRKIDSFHSGATAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QG+++ VANVGDSRAVLAT  +DGNLV VQLTVD KPNLP E ERI + +GRV   
Sbjct  180   TIVRQGELLFVANVGDSRAVLATTSNDGNLVPVQLTVDFKPNLPQEAERIHQCRGRVSCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             DDEPGV+R+W+PN       E PGLA+SRAFGDY IKDFGLIS PE T RNIT  DQF +
Sbjct  240   DDEPGVHRIWLPNE------ESPGLAMSRAFGDYCIKDFGLISVPEVTQRNITSEDQFVV  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAV+IVSS P+R ++AKRLVE AV AWKR R+GIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVISNQEAVQIVSSTPDRAKAAKRLVESAVHAWKRKRKGIAMDDISAICLFFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>ref|NP_001242855.1| uncharacterized protein LOC100817397 [Glycine max]
 gb|ACU22838.1| unknown [Glycine max]
Length=367

 Score =   435 bits (1119),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 214/361 (59%), Positives = 267/361 (74%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F S  NG  +T+S K  +   RED GR+A   LAKEARKNEL+LS+SG V +  ++N
Sbjct  1     MVLFPSFVNGLVRTVSIKKEKNCQRED-GRKAVEELAKEARKNELLLSSSGVVKSTKANN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S+ + +G+KG NQDR +VWEEFG Q+DM+FCGVFDGHGPWGH V KRVR+LVP+ LLC
Sbjct  60    FVSVFTNRGQKGVNQDRLLVWEEFGCQQDMMFCGVFDGHGPWGHFVVKRVRKLVPAFLLC  119

Query  538   NWQKALAHNMDNLGF----DNCL--LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTAL  693
             NWQ+ LA    +L F    D  +   D+WKQS+IK C+ VDQ L+Q  G  S+ SGTTAL
Sbjct  120   NWQENLATTSLDLDFKMEADKNIHGFDIWKQSYIKTCAAVDQDLKQHTGIDSYLSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T++KQG+ + +AN+GDSRAVLA   DDG L   QLT D KPNLP E ERI +S+G+V+  
Sbjct  180   TIIKQGEYLTIANIGDSRAVLAATSDDGTLTPHQLTTDFKPNLPQEAERITQSRGQVFCM  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGVYRVWMPN       + PGLA+SRAFGD+ +KDFGLIS P+ T R IT RDQF I
Sbjct  240   EDEPGVYRVWMPNG------KTPGLAISRAFGDHCMKDFGLISVPDVTHRKITPRDQFVI  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAV+IVS+   + ++A+RLV+ A+  WKR + GIAMDDMS ICLFFH
Sbjct  294   LATDGVWDVISNQEAVKIVSATSHKEKAAQRLVKCAIHEWKRKKSGIAMDDMSVICLFFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>ref|NP_568503.1| putative protein phosphatase 2C 73 [Arabidopsis thaliana]
 ref|NP_851086.1| putative protein phosphatase 2C 73 [Arabidopsis thaliana]
 sp|Q0WRB2.1|P2C73_ARATH RecName: Full=Probable protein phosphatase 2C 73; Short=AtPP2C73; 
AltName: Full=AtPPC6;7 [Arabidopsis thaliana]
 dbj|BAF00337.1| protein phosphatase 2C like protein [Arabidopsis thaliana]
 gb|ABH04570.1| At5g27930 [Arabidopsis thaliana]
 gb|AED93745.1| putative protein phosphatase 2C 73 [Arabidopsis thaliana]
 gb|AED93746.1| putative protein phosphatase 2C 73 [Arabidopsis thaliana]
Length=373

 Score =   435 bits (1118),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 215/359 (60%), Positives = 273/359 (76%), Gaps = 15/359 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S K  + N+     +EAA+ +A EA+K ELIL +SG+VN   S+N
Sbjct  1     MGHFSSMFNGLARSFSIKKVKNNNGNCDAKEAADEMASEAKKKELILKSSGYVNVQGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              ASL S++G+KG NQD A+VWE FG QEDMIFCG+FDGHGPWGH VAK+VR  +P SLLC
Sbjct  61    LASLFSKRGEKGVNQDCALVWEGFGCQEDMIFCGIFDGHGPWGHYVAKQVRNSMPLSLLC  120

Query  538   NWQKALAH-----NMDNLGFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTA  690
             NWQK LA       +D  G +  +   D+WKQS++K C+ VDQ+LE  ++  S+YSGTTA
Sbjct  121   NWQKILAQATLEPELDLEGSNKKISRFDIWKQSYLKTCATVDQELEHHRKIDSYYSGTTA  180

Query  691   LTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWS  870
             LT+V+QG+V+ VANVGDSRAVLA   D+G+LVAVQLT+D KPNLP E+ERI+  KGRV+ 
Sbjct  181   LTIVRQGEVIYVANVGDSRAVLAMESDEGSLVAVQLTLDFKPNLPQEKERIIGCKGRVFC  240

Query  871   SDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFA  1050
              DDEPGV+RVW P+       E PGLA+SRAFGDY IK++GL+S PE T R+I+ +D F 
Sbjct  241   LDDEPGVHRVWQPD------AETPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISTKDHFI  294

Query  1051  ILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
             ILA+DG+WDV+SNQEA+EIVSS  ER ++AKRLVE AV AWK+ RRG +MDDMS +CLF
Sbjct  295   ILASDGIWDVISNQEAIEIVSSTAERPKAAKRLVEQAVRAWKKKRRGYSMDDMSVVCLF  353



>ref|XP_006394930.1| hypothetical protein EUTSA_v10004414mg [Eutrema salsugineum]
 ref|XP_006394931.1| hypothetical protein EUTSA_v10004414mg [Eutrema salsugineum]
 dbj|BAJ33753.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ32216.1| hypothetical protein EUTSA_v10004414mg [Eutrema salsugineum]
 gb|ESQ32217.1| hypothetical protein EUTSA_v10004414mg [Eutrema salsugineum]
Length=376

 Score =   435 bits (1118),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 214/362 (59%), Positives = 272/362 (75%), Gaps = 16/362 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S K  + N+     +EAA+ +AKEA+K ELIL + G+V A  S+N
Sbjct  1     MGHFSSMFNGLARSFSIKKVKNNNGNSDAKEAADEMAKEAKKKELILKSCGYVYAEGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD AIVWE FG QEDMIFCG+FDGHGPWGH VAK VR  +PSSLLC
Sbjct  61    SASVFSKRGEKGVNQDCAIVWEGFGCQEDMIFCGIFDGHGPWGHYVAKHVRNSMPSSLLC  120

Query  538   NWQKALAH------NMDNLGFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTT  687
             NWQK LA        +D  G D  L   D+WK S++K C+ VDQ+LE  ++  S+ SGTT
Sbjct  121   NWQKTLAQATLLDPELDLEGSDKGLERFDIWKHSYLKTCASVDQELEHHRKIDSYNSGTT  180

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             ALT+++QG+++ V+NVGDSRAVLAT  D+G+LVAVQLT+D KPNLP E+ERI+  KGRV+
Sbjct  181   ALTIIRQGEIIYVSNVGDSRAVLATVSDEGSLVAVQLTLDFKPNLPQEKERIIGCKGRVF  240

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
                DEPGV+RVW P+       E PGLA+SRAFGDY IK++GL+S PE T R+I+ +D F
Sbjct  241   CLKDEPGVHRVWQPD------AETPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISAKDHF  294

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              ILA+DG+WDV+SNQEA+E+VS   ER ++AKRLVE AV AWK+ RRGIAMDDMS +CLF
Sbjct  295   IILASDGIWDVISNQEAIEVVSLTAERPKAAKRLVEQAVRAWKKKRRGIAMDDMSVVCLF  354

Query  1228  FH  1233
              H
Sbjct  355   LH  356



>ref|XP_010921599.1| PREDICTED: probable protein phosphatase 2C 73 [Elaeis guineensis]
Length=354

 Score =   434 bits (1115),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 224/353 (63%), Positives = 269/353 (76%), Gaps = 9/353 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SSLFNG AK++    G K S  D GREAA+ LA+EA+KNELIL +SG V    S++
Sbjct  1     MRHLSSLFNGLAKSLYSGRG-KLSGIDCGREAADELAREAKKNELILKSSGTVKGEGSNS  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S+ S++G+KG NQD +IVWEEFG QEDMIFCG+FDGHG WGH VAK V++ +P  LLC
Sbjct  60    FVSVFSQRGEKGVNQDCSIVWEEFGCQEDMIFCGIFDGHGSWGHYVAKAVQKSLPPCLLC  119

Query  538   NWQKALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTALTVVKQG  711
             NWQ+ALA          C  D+WKQS+++ C+ VD++LEQ  +  SF+SGTTALT+VKQG
Sbjct  120   NWQEALALAALVADKKLCQFDIWKQSYLRTCTTVDKELEQHRRLDSFHSGTTALTIVKQG  179

Query  712   DVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGV  891
             + MV+ANVGDSRAVLAT  +DG+LV +QLTVD KPNLP E ERI +  GRV+   DEPGV
Sbjct  180   EFMVIANVGDSRAVLATTLEDGSLVPLQLTVDFKPNLPQEAERITQCNGRVFCLHDEPGV  239

Query  892   YRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGV  1071
             +R+W+PN       E PGLA+SRAFGDY +KDFGLIS PE T R IT RD+F +LATDGV
Sbjct  240   HRLWLPNG------ETPGLAMSRAFGDYCVKDFGLISVPEVTQRRITNRDRFIVLATDGV  293

Query  1072  WDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             WDVVSNQEAV+IVSS  ERG+SAKRLVE AV AWKR RRGIA+DD SAICLFF
Sbjct  294   WDVVSNQEAVQIVSSTKERGKSAKRLVECAVRAWKRKRRGIAIDDCSAICLFF  346



>dbj|BAC43045.1| putative protein phosphatase 2C [Arabidopsis thaliana]
Length=373

 Score =   434 bits (1116),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 215/359 (60%), Positives = 273/359 (76%), Gaps = 15/359 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S K  + N+     +EAA+ +A EA+K ELIL +SG+VN   S+N
Sbjct  1     MGHFSSMFNGLARSFSIKKVKNNNGNCDAKEAADEMASEAKKKELILKSSGYVNVHGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              ASL S++G+KG NQD A+VWE FG QEDMIFCG+FDGHGPWGH VAK+VR  +P SLLC
Sbjct  61    LASLFSKRGEKGVNQDCALVWEGFGCQEDMIFCGIFDGHGPWGHYVAKQVRNSMPLSLLC  120

Query  538   NWQKALAH-----NMDNLGFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTA  690
             NWQK LA       +D  G +  +   D+WKQS++K C+ VDQ+LE  ++  S+YSGTTA
Sbjct  121   NWQKILAQATLEPELDLEGSNKKVSRFDIWKQSYLKTCATVDQELEHHRKIDSYYSGTTA  180

Query  691   LTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWS  870
             LT+V+QG+V+ VANVGDSRAVLA   D+G+LVAVQLT+D KPNLP E+ERI+  KGRV+ 
Sbjct  181   LTIVRQGEVIYVANVGDSRAVLAMESDEGSLVAVQLTLDFKPNLPQEKERIIGCKGRVFC  240

Query  871   SDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFA  1050
              DDEPGV+RVW P+       E PGLA+SRAFGDY IK++GL+S PE T R+I+ +D F 
Sbjct  241   LDDEPGVHRVWQPD------AETPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISTKDHFI  294

Query  1051  ILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
             ILA+DG+WDV+SNQEA+EIVSS  ER ++AKRLVE AV AWK+ RRG +MDDMS +CLF
Sbjct  295   ILASDGIWDVISNQEAIEIVSSTAERPKAAKRLVEQAVRAWKKKRRGYSMDDMSVVCLF  353



>ref|XP_004508189.1| PREDICTED: probable protein phosphatase 2C 34-like [Cicer arietinum]
Length=359

 Score =   433 bits (1114),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 218/365 (60%), Positives = 269/365 (74%), Gaps = 15/365 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F S  NG AKT+S K   KN  +D  R+A   LAKEARKNEL+L +SG V +   + 
Sbjct  1     MVHFPSFVNGLAKTVSNKK-EKNFPKDDARKAIEELAKEARKNELLLKSSGVVKSNKDNG  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S+ + +G+KG NQD  +VWEEFGGQ+DM+FCGV+DGHG WGH VAKRVR+LVP+ LLC
Sbjct  60    FVSVFTNRGQKGVNQDCLMVWEEFGGQQDMMFCGVYDGHGAWGHFVAKRVRKLVPAFLLC  119

Query  538   NWQKALAHNMDNLGF----DNCL--LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTAL  693
             NW++ +A    NL F    D  +  LD+WKQS+IK  + VDQ L+Q  G  SF SGTTAL
Sbjct  120   NWKENVAGTSINLDFKMEADKNIHGLDLWKQSYIKTYAAVDQDLKQHTGFDSFRSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T++KQG+ +++ANVGDSR VLAT  +DG L  +QLT D KPNLP E ERI +SKGRV+  
Sbjct  180   TIIKQGENLIIANVGDSRVVLATTSEDGTLFPLQLTTDFKPNLPKEAERIEQSKGRVFCM  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGVYRVWMPN       + PGLA+SRAFGDY +KDFGLIS P+ T   +T RDQF I
Sbjct  240   KDEPGVYRVWMPNG------KTPGLALSRAFGDYCMKDFGLISVPDVTHTKLTTRDQFII  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDVVSNQEAV+IVS+ P + ++ +RLV++A+  WKR + GIAMDDMSAICLFFH
Sbjct  294   LATDGVWDVVSNQEAVKIVSTTPHKEKAGQRLVKYAMREWKRKKSGIAMDDMSAICLFFH  353

Query  1234  NKLIV  1248
              KL+V
Sbjct  354   TKLVV  358



>ref|XP_011036910.1| PREDICTED: probable protein phosphatase 2C 34 [Populus euphratica]
Length=368

 Score =   434 bits (1115),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 218/361 (60%), Positives = 279/361 (77%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+FN  A++ S +  + N   D GREAA+ + K+A+KNE+IL +SG+VN   S+N
Sbjct  1     MGHLSSMFNVLARSFSLRKVKNNGNGD-GREAADLMVKDAKKNEMILRSSGYVNIDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A++ SR+G+KG NQD  IVWE FG Q DM+FCG+FDGHG WGH VAK+VRE +PSSLLC
Sbjct  60    FAAVCSRRGEKGVNQDCCIVWEGFGCQADMMFCGIFDGHGSWGHFVAKKVRESMPSSLLC  119

Query  538   NWQKALAH-NMD---NLGFD--NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             NWQ+ LA  ++D   NL  D  +   ++WK S++K C+ VDQ+LEQ  +  SF SGTTAL
Sbjct  120   NWQETLAQCSLDPDINLESDKKHQRFNIWKHSYLKTCAAVDQELEQHRRIDSFSSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QG+++ VANVGDSRAVLAT  +DG+LV VQLT D KPNLP E ERI++ KGRV+  
Sbjct  180   TIVRQGELIFVANVGDSRAVLATTGEDGSLVPVQLTFDFKPNLPQEAERILQCKGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGV+RVW+P+       + PGLA+SRAFGDY +KDFGLISEPE T R+IT +DQF I
Sbjct  240   NDEPGVHRVWLPD------ADSPGLAMSRAFGDYCVKDFGLISEPEVTQRHITSKDQFVI  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV++NQ AVEIVSS P++ ++AKRLV+ AV AWKR R+GIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVITNQAAVEIVSSTPDKAKAAKRLVQSAVHAWKRKRKGIAMDDISAICLFFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>gb|AAM64353.1| protein phosphatase-like [Arabidopsis thaliana]
Length=373

 Score =   434 bits (1115),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 214/359 (60%), Positives = 273/359 (76%), Gaps = 15/359 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S K  + N+     +EAA+ +A EA+K ELIL +SG+VN   S+N
Sbjct  1     MGHFSSMFNGLARSFSIKKVKNNNGNCDAKEAADEMASEAKKKELILKSSGYVNVQGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              ASL S++G+KG NQD A+VWE FG QEDMIFCG+FDGHGPWGH VAK+VR  +P SLLC
Sbjct  61    LASLFSKRGEKGVNQDCALVWEGFGCQEDMIFCGIFDGHGPWGHYVAKQVRNSMPLSLLC  120

Query  538   NWQKALAH-----NMDNLGFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTA  690
             NWQK LA       +D  G +  +   D+WKQS++K C+ VDQ+LE  ++  S+YSGTTA
Sbjct  121   NWQKILAQATLEPELDLEGSNKKISRFDIWKQSYLKTCATVDQELEHHRKIDSYYSGTTA  180

Query  691   LTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWS  870
             LT+V+QG+V+ VANVGDSRAVLA   D+G+LVAVQLT+D KPNLP E+ERI+  KGRV+ 
Sbjct  181   LTIVRQGEVIYVANVGDSRAVLAMESDEGSLVAVQLTLDFKPNLPQEKERIIGCKGRVFC  240

Query  871   SDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFA  1050
              DDEPGV+RVW P+       E PGLA+SRAFGDY IK++GL+S PE T R+I+ +D F 
Sbjct  241   LDDEPGVHRVWQPD------AETPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISTKDHFI  294

Query  1051  ILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
             ILA+DG+WDV+SNQEA+EIVSS  ER ++AKRL+E AV AWK+ RRG +MDDMS +CLF
Sbjct  295   ILASDGIWDVISNQEAIEIVSSTAERPKAAKRLLEQAVRAWKKKRRGYSMDDMSVVCLF  353



>ref|XP_010094717.1| putative protein phosphatase 2C 73 [Morus notabilis]
 gb|EXB56797.1| putative protein phosphatase 2C 73 [Morus notabilis]
Length=371

 Score =   434 bits (1115),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 219/364 (60%), Positives = 270/364 (74%), Gaps = 18/364 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+FNG A++ S K GR +     GREAA A+AK+A+KN+ IL TSG VNA  S N
Sbjct  1     MGHLSSMFNGLARSFSFKKGRSSENRHGGREAAEAMAKDAKKNDSILRTSGTVNASGSDN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ SR+G+KG NQD  IVWEEFG QEDM+FCG+FDGHGPWGH VAK VRE +P SLLC
Sbjct  61    FASVFSRRGQKGMNQDCCIVWEEFGCQEDMMFCGIFDGHGPWGHFVAKTVRESMPPSLLC  120

Query  538   NWQKALAHNMDNLGF---------DNCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGT  684
             NWQ+ L                   +   ++WK S++K C+ +D++LEQ  +  SFYSGT
Sbjct  121   NWQETLLSQTCLDPDLDLDLESEKKHHRFNIWKHSYLKTCAAIDKELEQHRKIDSFYSGT  180

Query  685   TALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRV  864
             TAL++V+QG+++ +ANVGDSRAVLAT  DDG+LV  QLTVD KPNLP E ERI++ KGRV
Sbjct  181   TALSIVRQGELIFIANVGDSRAVLATTSDDGSLVPDQLTVDFKPNLPQEAERIIQCKGRV  240

Query  865   WSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQ  1044
             +    EPGV+RVW+P+       E PGLA+SRAFGDY +KDFGLIS PE T R+IT RDQ
Sbjct  241   FCL-HEPGVHRVWLPD------AESPGLAMSRAFGDYCVKDFGLISVPEVTQRHITNRDQ  293

Query  1045  FAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICL  1224
             F +LATDGVWDV+SNQEAV+IVSS P+R +SAK LVE AV +WKR R+ IAMDD+SAICL
Sbjct  294   FVVLATDGVWDVISNQEAVQIVSSTPDRAKSAKCLVECAVRSWKRKRKDIAMDDISAICL  353

Query  1225  FFHN  1236
             FFH+
Sbjct  354   FFHS  357



>ref|XP_002884522.1| hypothetical protein ARALYDRAFT_477856 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60781.1| hypothetical protein ARALYDRAFT_477856 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   432 bits (1112),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 216/357 (61%), Positives = 267/357 (75%), Gaps = 13/357 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S K  + N+ +   +EA + +A+EA+K ELIL +SG +NA  S+N
Sbjct  1     MGHFSSMFNGIARSFSTKKAKNNNSKSYAKEATDEMAREAKKKELILRSSGCINADGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ SR+G+KG NQD AIVWE FG QEDMIFCG+FDGHGPWGH V+K+VR  +P SLLC
Sbjct  61    LASVFSRRGEKGVNQDSAIVWEGFGCQEDMIFCGIFDGHGPWGHFVSKQVRNSMPLSLLC  120

Query  538   NWQKALAHNMDNLGFDNCLLD---VWKQSHIKACSEVDQQLE--QQAGSFYSGTTALTVV  702
             NW++ L+     L   +  L    +WK S +K C  VD++LE  ++  SF SGTTALTVV
Sbjct  121   NWKETLSQT--TLAEPDKKLQRFAIWKYSFLKTCEAVDRELEHHRKIDSFNSGTTALTVV  178

Query  703   KQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDE  882
             +QGDV+ +ANVGDSRAVLAT  D+G+LVAVQLTVD KPNLP E ERI+   GRV+   DE
Sbjct  179   RQGDVIYIANVGDSRAVLATVSDEGSLVAVQLTVDFKPNLPQEEERIIGCNGRVFCLQDE  238

Query  883   PGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILAT  1062
             PGV+RVW P        E PGLA+SRAFGDY IKD+GL+S PE T R+I+ RDQF ILAT
Sbjct  239   PGVHRVWQPEE------ESPGLAMSRAFGDYCIKDYGLVSVPEVTQRHISIRDQFIILAT  292

Query  1063  DGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             DGVWDV+SNQEA+ IVSS  ER ++AKRLV+ AV AW R RRGIAMDD+SA+CLFFH
Sbjct  293   DGVWDVISNQEAIAIVSSTEERPKAAKRLVQQAVRAWNRKRRGIAMDDISAVCLFFH  349



>dbj|BAF01792.1| protein phosphatase 2C like protein [Arabidopsis thaliana]
Length=373

 Score =   432 bits (1110),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 214/359 (60%), Positives = 272/359 (76%), Gaps = 15/359 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S K  + N+     +EAA+ +A EA+K ELIL +SG+VN   S+N
Sbjct  1     MGHFSSMFNGLARSFSIKKVKNNNGNCDAKEAADEMASEAKKKELILKSSGYVNVQGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              ASL S++G+KG NQD A+VWE FG QEDMIFCG+FDGHGPWGH VAK+VR  +P SLLC
Sbjct  61    LASLFSKRGEKGVNQDCALVWEGFGCQEDMIFCGIFDGHGPWGHYVAKQVRNSMPLSLLC  120

Query  538   NWQKALAH-----NMDNLGFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTA  690
             NWQK LA       +D  G +  +   D+WKQS++K C+ VDQ+LE  ++  S+YSGTTA
Sbjct  121   NWQKILAQATLEPELDLEGSNKKISRFDIWKQSYLKTCATVDQELEHHRKIDSYYSGTTA  180

Query  691   LTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWS  870
             LT+V+QG+V+ VANVGDSRAVLA   D G+LVAVQLT+D KPNLP E+ERI+  KGRV+ 
Sbjct  181   LTIVRQGEVIYVANVGDSRAVLAMESDAGSLVAVQLTLDFKPNLPQEKERIIGCKGRVFC  240

Query  871   SDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFA  1050
              DDEPGV+RVW P+       E PGLA+SRAFGDY IK++GL+S PE T R+I+ +D F 
Sbjct  241   LDDEPGVHRVWQPD------AETPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISTKDHFI  294

Query  1051  ILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
             ILA+DG+WDV+SNQEA+EIVSS  ER ++AKRLVE AV AWK+ R+G +MDDMS +CLF
Sbjct  295   ILASDGIWDVISNQEAIEIVSSTAERPKAAKRLVEQAVRAWKKKRQGYSMDDMSVVCLF  353



>ref|XP_004296877.1| PREDICTED: probable protein phosphatase 2C 34-like [Fragaria 
vesca subsp. vesca]
Length=377

 Score =   432 bits (1110),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 217/360 (60%), Positives = 271/360 (75%), Gaps = 15/360 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F S  +G  +TIS K   KN   DV +E A ALAKEA+KNEL+LS+SG VN+  S+N
Sbjct  1     MVLFPSFLDGLGRTISNKK-TKNCHNDVAKETAEALAKEAKKNELVLSSSGIVNSDKSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              +S+ S++G+KG NQD  ++WEEFG QEDMIFCGVFDGHG WGHLV++RVR+ +PSSLLC
Sbjct  60    FSSICSKRGQKGINQDCLVIWEEFGCQEDMIFCGVFDGHGQWGHLVSRRVRQSMPSSLLC  119

Query  538   NWQKALAHNMDNLGF----DNCL--LDVWKQSHIKACSEVDQQLEQQA--GSFYSGTTAL  693
             NWQ+ L+    +L F    D  L   + WKQS +K  + +DQ+L+  +   S+ SGTTAL
Sbjct  120   NWQETLSLTSLDLNFKMEMDRKLHRYNTWKQSFLKTYAAIDQELKHSSKIDSYRSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T++KQG++++ A+VGDSRAVLAT  +DG+LV VQLTVD KPNLP E ERI RS GRV+  
Sbjct  180   TIIKQGELLITAHVGDSRAVLATTSEDGSLVPVQLTVDFKPNLPQEAERIRRSNGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPG YRVWMPN       + PGLAVSRAFGDY +KDFGLIS P+ + R IT +D F I
Sbjct  240   PDEPGTYRVWMPNG------KTPGLAVSRAFGDYCVKDFGLISVPDVSQRYITRKDLFVI  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SN+EA++IVSSAP+R ++AKRLV  A  AWK  RRGIAMDD+SAICLFF+
Sbjct  294   LATDGVWDVISNKEAIQIVSSAPDRNKAAKRLVACAALAWKSKRRGIAMDDISAICLFFN  353



>ref|XP_011007060.1| PREDICTED: probable protein phosphatase 2C 34 [Populus euphratica]
 ref|XP_011007061.1| PREDICTED: probable protein phosphatase 2C 34 [Populus euphratica]
Length=383

 Score =   432 bits (1111),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 214/367 (58%), Positives = 277/367 (75%), Gaps = 21/367 (6%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGR-------KNSREDVGREAANALAKEARKNELILSTSGFV  336
             MV F S  +G ++ IS   GR       +NS++D G+EAA ALAK+ARKNEL+LS+SG V
Sbjct  1     MVLFPSFHDGLSRIISTIKGRIISTIKGRNSQKDTGKEAAEALAKDARKNELMLSSSGNV  60

Query  337   NAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVREL  516
              +  + N A++ S +G+KG NQD ++VWE FG Q+DMIFCG+FDGHGPWGH V+K+VRE 
Sbjct  61    KSSKTDNFAAVCSTRGQKGINQDSSVVWEGFGSQDDMIFCGIFDGHGPWGHFVSKKVRES  120

Query  517   VPSSLLCNWQKALAHNMDNLGFDNCL------LDVWKQSHIKACSEVDQQLEQ--QAGSF  672
             VPS LLCNWQ+ LA    ++ F+  L       D+WKQS++K  + +D +L+Q  +  SF
Sbjct  121   VPSLLLCNWQENLALTSLDMDFEMDLDRNLHQFDIWKQSYLKTYAAIDHELKQNRKIDSF  180

Query  673   YSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRS  852
             +SGTTA+T++KQG+ +V+ANVGDSRAVLAT   DG+LV +QLT+D KPN+P E ERI +S
Sbjct  181   FSGTTAVTIIKQGENLVIANVGDSRAVLATTSIDGSLVPLQLTIDFKPNIPEEAERITQS  240

Query  853   KGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNIT  1032
             KGRV+   DEPGVYRVWMPN       + PGL++SRAFGD+ +KDFGL+SEP+ T RNI+
Sbjct  241   KGRVFCLHDEPGVYRVWMPNG------KTPGLSLSRAFGDHCVKDFGLVSEPDVTRRNIS  294

Query  1033  FRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMS  1212
              RDQF ILATDGVWDV+SNQEAV++VS   +R ESAKRLVE A  AW+  ++GIAMDD+S
Sbjct  295   SRDQFVILATDGVWDVISNQEAVQVVSLTQDREESAKRLVECAGRAWRYKKKGIAMDDIS  354

Query  1213  AICLFFH  1233
             AICLFFH
Sbjct  355   AICLFFH  361



>ref|XP_010245469.1| PREDICTED: probable protein phosphatase 2C 34 [Nelumbo nucifera]
Length=372

 Score =   431 bits (1109),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 229/361 (63%), Positives = 282/361 (78%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SSLF+G AK++S K  RK    D G+EAA A+AKEA+KN+LIL +SG VN+  S+N
Sbjct  1     MGHLSSLFDGLAKSLSVKR-RKRCGNDDGKEAAEAMAKEAKKNDLILRSSGIVNSDCSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S+ S++G+KG NQD  IVWEEFG Q DMIFCG+FDGHGPWGH VAKRVRE +P SLLC
Sbjct  60    FVSIFSKRGQKGVNQDCFIVWEEFGCQPDMIFCGIFDGHGPWGHFVAKRVRESMPPSLLC  119

Query  538   NWQKALA-HNMD---NLGFDNCL--LDVWKQSHIKACSEVDQQLEQQA--GSFYSGTTAL  693
             NWQ+ LA  ++D   +LG D  L   DVWKQS++K C+ +DQ+LE      SFYSGTTAL
Sbjct  120   NWQETLALTSLDPEFDLGSDKKLHRFDVWKQSYLKTCAAIDQELEHHPRIDSFYSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             ++V+QG+++V+ANVGDSRAVLAT  DDG+LV VQLT+D KPNLP E ERI + KGRV+  
Sbjct  180   SIVRQGELVVIANVGDSRAVLATTSDDGSLVPVQLTIDFKPNLPQEAERITQCKGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGV+RVW+PN       E PGLA+SRAFGDY +KD+GLIS PE T RN++ RDQF +
Sbjct  240   HDEPGVHRVWLPNG------ETPGLAMSRAFGDYCVKDYGLISVPEVTQRNLSNRDQFIV  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQ+AV+IVSS  +R +SAKRLV+ AV AWKR RRG+AMDD+SAICLFFH
Sbjct  294   LATDGVWDVISNQQAVDIVSSTTDRAKSAKRLVQCAVHAWKRNRRGVAMDDISAICLFFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>gb|KHN03955.1| Hypothetical protein glysoja_022641 [Glycine soja]
Length=371

 Score =   431 bits (1109),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 221/363 (61%), Positives = 284/363 (78%), Gaps = 17/363 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S K GR+N +   GREAA A+AKEA+KN+++L +SG V+   S+N
Sbjct  1     MGHFSSMFNGLARSFSMKKGRRNGKCG-GREAAEAMAKEAKKNDMMLCSSGIVHVDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  +VWEEFG QEDMIFCG+FDGHGPWGH VAKR+RE +P SLLC
Sbjct  60    FASVFSKRGQKGVNQDCCMVWEEFGCQEDMIFCGIFDGHGPWGHFVAKRIRESMPPSLLC  119

Query  538   NWQKALAH-NMDNLGFD-------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTT  687
             NWQ+ LA  ++D+   D       +   ++WK S++K C+ +DQ+LEQ  +  SFYSGTT
Sbjct  120   NWQETLAQTSIDHPAIDVEEEKSKHYRFNIWKHSYLKTCAAIDQELEQYRKIDSFYSGTT  179

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             AL++V+QG+++V+ANVGDSRAVLAT  DDG+LV VQLT+D KPNLP E ERI++ +GRV+
Sbjct  180   ALSIVRQGELIVIANVGDSRAVLATTSDDGSLVPVQLTIDFKPNLPQEAERIIQCQGRVF  239

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
               +DEPGV+RVW+P+       E PGLA+SRAFGDY IK  GLIS PE T RNIT RDQF
Sbjct  240   CLEDEPGVHRVWLPDE------ESPGLAMSRAFGDYCIKGHGLISVPEVTHRNITSRDQF  293

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              +LATDGVWDV+SN+EAV+IVSS  ++ ++AKRLVE AV AWKR RRGIA+DD+SAICLF
Sbjct  294   VVLATDGVWDVISNKEAVDIVSSTADKAKAAKRLVECAVHAWKRKRRGIAVDDISAICLF  353

Query  1228  FHN  1236
             FH+
Sbjct  354   FHS  356



>ref|XP_009384412.1| PREDICTED: probable protein phosphatase 2C 34 [Musa acuminata 
subsp. malaccensis]
Length=342

 Score =   430 bits (1106),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 219/354 (62%), Positives = 269/354 (76%), Gaps = 14/354 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M Q SSL NG AK++     RK    + GREAA+ L +EA+KN+ IL +SG     ++ +
Sbjct  1     MRQLSSLLNGLAKSLYA-GKRKVPGVEEGREAADELRREAKKNDTILRSSG-----TTRS  54

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
             C S+ S++G+KG NQD +IVWEEFG QEDM+FCG+FDGHG WGH VAK VR+ +PSSLLC
Sbjct  55    CVSVFSQRGEKGVNQDCSIVWEEFGCQEDMMFCGIFDGHGSWGHYVAKAVRKSLPSSLLC  114

Query  538   NWQKALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTALTVVKQG  711
             NWQ+ALA          C  DVWKQS+IK+ + VD++LE  ++  SF SG+TALT+VKQG
Sbjct  115   NWQEALALASLVADKKPCHFDVWKQSYIKSFAAVDKELEHDRRLDSFRSGSTALTIVKQG  174

Query  712   DVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGV  891
             ++MV+AN+GDSRAVLAT  DDG+LV +QLT+D KPNLP E ERI + KGRV+   DEPGV
Sbjct  175   ELMVIANIGDSRAVLATTSDDGSLVPIQLTIDFKPNLPQEAERITQCKGRVFCLQDEPGV  234

Query  892   YRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGV  1071
             +RVW+PN       E PGLA+SRAFGDY IKDFGLIS PE T R+IT RDQF +LATDGV
Sbjct  235   HRVWLPNE------EAPGLAMSRAFGDYCIKDFGLISVPEVTQRSITGRDQFVVLATDGV  288

Query  1072  WDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             WDV+SNQEAV IVSS  +R +SAKRLVE AV AWKR RRG+A+DD SA+CLFFH
Sbjct  289   WDVISNQEAVNIVSSTKDRRKSAKRLVECAVGAWKRKRRGVAVDDCSAVCLFFH  342



>gb|KHF99107.1| hypothetical protein F383_20162 [Gossypium arboreum]
Length=377

 Score =   431 bits (1109),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 218/366 (60%), Positives = 280/366 (77%), Gaps = 19/366 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGR-KNSREDVGREAANALAKEARKNELILSTSGFVNAISSH  354
             MV   SLF+G A+++S K G+ +N+  D GREAA ++AK+A+KNE++L +SG VN+  S+
Sbjct  1     MVLLPSLFDGLARSVSMKKGKNQNNEMDGGREAAESMAKDAKKNEMMLCSSGTVNSNKSN  60

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
             + AS+ S++G+KG NQD AIVWE+FG QEDMIFCG+FDGHG WGH+VAKRV++ VP+SLL
Sbjct  61    DFASICSKKGQKGTNQDSAIVWEKFGCQEDMIFCGIFDGHGSWGHIVAKRVKKSVPASLL  120

Query  535   CNWQKALA-----HNMD---NLGFDNCLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGT  684
             CNWQKAL+       +D   N  F +   D+WKQS++K  ++VD +L+   G  +F SGT
Sbjct  121   CNWQKALSLTSLPRQLDTEFNSTFHH--FDIWKQSYLKTYADVDLELKHHPGIDAFRSGT  178

Query  685   TALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRV  864
             TALT++KQG  +V+ANVGDSRAVLAT  DDG LV +QLTVD KPN+P E ERI++  GRV
Sbjct  179   TALTIIKQGGHLVIANVGDSRAVLATTSDDGKLVPLQLTVDFKPNIPEEAERILQCNGRV  238

Query  865   WSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQ  1044
             +   DEPGVYRVW PN       + PGLA+SRA GD+ +K+FGLIS P+ T RNIT  DQ
Sbjct  239   FCLRDEPGVYRVWTPNG------DTPGLALSRAIGDHCVKEFGLISVPDVTQRNITNNDQ  292

Query  1045  FAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICL  1224
             F ILATDGVWDV+SN+EAVEIVSS  +R +SAK+LV+ A+ AWK  +RGIAMDD+SAICL
Sbjct  293   FVILATDGVWDVISNEEAVEIVSSTEDREKSAKKLVQCAMRAWKYKKRGIAMDDISAICL  352

Query  1225  FFHNKL  1242
             FFH KL
Sbjct  353   FFHPKL  358



>ref|XP_003556526.1| PREDICTED: probable protein phosphatase 2C 73-like isoform X1 
[Glycine max]
 ref|XP_006606544.1| PREDICTED: probable protein phosphatase 2C 73-like isoform X2 
[Glycine max]
Length=367

 Score =   431 bits (1107),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 222/363 (61%), Positives = 280/363 (77%), Gaps = 17/363 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS FN  AK+ + K GR +S E  GREAA A+AKEA++N  +L +SG VN   S+N
Sbjct  1     MGHFSSAFNRLAKSFTTKKGR-SSDECNGREAAEAMAKEAKRNHFMLHSSGTVNVDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ SR+G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH VAKRVR+ +P SLLC
Sbjct  60    FASVFSRKGQKGVNQDCCIVWEEFGCQEDMIFCGIFDGHGPWGHFVAKRVRKSMPPSLLC  119

Query  538   NWQKALAHN--MDNLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTT  687
             NWQ+ L+      ++ FD          ++WK S++K C+ +D++LEQ  +  SFYSGTT
Sbjct  120   NWQETLSQTPLHSDVDFDIETEKKQHRFNLWKHSYLKTCAAIDRELEQNRKIDSFYSGTT  179

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             AL++V+QG+++++ANVGDSRAVLAT  DDG+LV VQLT+D KPNLP E +RI+ S+GRV+
Sbjct  180   ALSIVRQGELIIIANVGDSRAVLATTSDDGSLVPVQLTIDFKPNLPQEAQRILESQGRVF  239

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
               DDEPGV+RVW+P+       E PGLA+SRAFGDY +K +GLIS PE T RNIT +DQF
Sbjct  240   CLDDEPGVHRVWLPDE------EFPGLAMSRAFGDYCVKKYGLISVPEVTHRNITTKDQF  293

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              +LATDGVWDV+SNQEAV+IVSS P+R +S+KRLVE A+ AWKR RRGIAMDD+SAICLF
Sbjct  294   VVLATDGVWDVISNQEAVDIVSSTPDRTDSSKRLVECAMRAWKRKRRGIAMDDISAICLF  353

Query  1228  FHN  1236
             FH+
Sbjct  354   FHS  356



>ref|XP_006344705.1| PREDICTED: probable protein phosphatase 2C 73-like isoform X1 
[Solanum tuberosum]
 ref|XP_006344706.1| PREDICTED: probable protein phosphatase 2C 73-like isoform X2 
[Solanum tuberosum]
Length=367

 Score =   430 bits (1106),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 220/361 (61%), Positives = 274/361 (76%), Gaps = 14/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSRED---VGREAANALAKEARKNELILSTSGFVNAIS  348
             M  FSS+FNG A++ S K  RKNS  +    GR+A  A+AKEA++N+LIL +SG VN   
Sbjct  1     MGHFSSMFNGLARSFSLKK-RKNSSGNGKYDGRDAVEAMAKEAKRNDLILRSSGTVNVDG  59

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S N ASL SR+G+KG NQD  IVWEEFG Q DM FCG+FDGHGPWGH V+K+VRE + SS
Sbjct  60    SKNFASLFSRRGEKGVNQDCFIVWEEFGCQHDMAFCGIFDGHGPWGHFVSKQVRESIVSS  119

Query  529   LLCNWQKALAHNMDNLGFD--NCLLDVWKQSHIKACSEVDQQLEQQA--GSFYSGTTALT  696
             LLC WQ++LA    +   D  +   ++WK+S +KAC+ VDQ+LE      +FYSGTTALT
Sbjct  120   LLCIWQESLAEASADPDLDKKDQRFNIWKESFLKACATVDQELEHHPKIDTFYSGTTALT  179

Query  697   VVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSD  876
             +V+QG+V+ VANVGDSRAVLAT  DDGNLV VQLTVD KPNLP E ERI++  GRV+  D
Sbjct  180   IVRQGEVLFVANVGDSRAVLATTCDDGNLVPVQLTVDFKPNLPQETERILQCNGRVFCLD  239

Query  877   DEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAIL  1056
             DE GV+R+W+P+ +       PGLA+SRAFGDY +KDFGLIS P+ T R+IT +DQF +L
Sbjct  240   DESGVHRLWLPDESS------PGLAMSRAFGDYCVKDFGLISVPDVTQRHITSKDQFVVL  293

Query  1057  ATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             ATDGVWDV+SN+EAVEIVS  P+R ++AK LV+ AV AWKR RRGIA+DD+SAI LFFH+
Sbjct  294   ATDGVWDVISNEEAVEIVSETPDRAKAAKHLVQCAVRAWKRKRRGIAVDDISAIVLFFHS  353

Query  1237  K  1239
             K
Sbjct  354   K  354



>gb|AFK40530.1| unknown [Lotus japonicus]
Length=374

 Score =   430 bits (1106),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 218/362 (60%), Positives = 267/362 (74%), Gaps = 16/362 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F S  NG A+T+S K  +   + + GR+   +L KEARKNEL+LSTSG V +   +N
Sbjct  1     MVLFPSFVNGLARTVSLKKEKSRGKNE-GRKVVKSLIKEARKNELLLSTSGIVKSSKGNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A + ++QG+KG NQD  IVWEEFG  ED+ FCG+FDGHGPWGH VAKRVR+LVP+SLLC
Sbjct  60    FACVFTKQGQKGVNQDCLIVWEEFGCHEDITFCGIFDGHGPWGHFVAKRVRKLVPASLLC  119

Query  538   NWQKALAHNMD-NLGF----DNCL--LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTA  690
             NWQ+ LA +   +L F    D  L   D WKQS+IK  + +DQ L+QQ G  SF SGTTA
Sbjct  120   NWQENLAVSTQLDLDFKMEEDMNLHRFDTWKQSYIKTFAAIDQDLKQQTGIDSFQSGTTA  179

Query  691   LTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWS  870
             LT++KQG+ +++ANVGDSRAVLAT  +DG L A+QLT DLKPNLP E ERI +SKG+V+ 
Sbjct  180   LTIIKQGEHLILANVGDSRAVLATTSEDGTLTALQLTTDLKPNLPKEAERITQSKGQVFC  239

Query  871   SDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFA  1050
              +DEPGVYRVWMPN          GLA+SRAFGDY +KDFG+IS PE T RN+   DQF 
Sbjct  240   LEDEPGVYRVWMPNGRKA------GLAISRAFGDYCLKDFGIISVPEVTQRNLNPMDQFV  293

Query  1051  ILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             ILATDGVWDV+SNQEAV IVSS P R ++AKRLV+ A   WKR RRGIA+DD+SA+CLFF
Sbjct  294   ILATDGVWDVISNQEAVRIVSSTPNREKAAKRLVKCATYEWKRKRRGIAIDDISAVCLFF  353

Query  1231  HN  1236
              +
Sbjct  354   RS  355



>gb|KEH32310.1| catalytic/protein phosphatase type 2C [Medicago truncatula]
Length=362

 Score =   429 bits (1103),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 217/360 (60%), Positives = 265/360 (74%), Gaps = 15/360 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F S  NG A+T+S K   KN R+D  R+A   LAKEARKNEL+LS+SG V A   ++
Sbjct  1     MVHFPSFVNGLARTMSIKK-EKNFRKDDARKAVEELAKEARKNELLLSSSGVVKANKDNS  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S+ + +G+KG NQDR IVWEEFG Q+DM+FCGVFDGHGPWGH VAKRVR+L+P+ LLC
Sbjct  60    FVSVFTHRGQKGVNQDRLIVWEEFGCQQDMMFCGVFDGHGPWGHFVAKRVRKLIPAILLC  119

Query  538   NWQKALAHNMDNLGF----DNCL--LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTAL  693
             NWQK LA    +L      D  +  LD+WKQS+IK  + VDQ L+   G  SF SGTTAL
Sbjct  120   NWQKNLAAASIDLDLKMEGDKNIHGLDLWKQSYIKTFAAVDQDLKLHTGIDSFQSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T++KQG+ +++ANVGDSR VLAT  +DG L  +QLT D KPNLP E ERI  SKGRV+  
Sbjct  180   TIIKQGENLIIANVGDSRLVLATTSEDGTLFPLQLTTDFKPNLPNEAERIKESKGRVFCM  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGVYRVWMPN       + PGLA+SRAFGDY +KD+GLIS P+ T R +T  DQF I
Sbjct  240   KDEPGVYRVWMPNG------KTPGLAISRAFGDYCMKDYGLISVPDVTHRKLTTGDQFII  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDVVSN+EAV+IV +A  + ++ +RLV++A+  WKR R GIAMDDMSAICLFFH
Sbjct  294   LATDGVWDVVSNEEAVKIVCAAAHKEKAGERLVKYAIREWKRKRSGIAMDDMSAICLFFH  353



>ref|XP_004230268.1| PREDICTED: probable protein phosphatase 2C 34 [Solanum lycopersicum]
Length=367

 Score =   429 bits (1103),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 219/361 (61%), Positives = 273/361 (76%), Gaps = 14/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSRED---VGREAANALAKEARKNELILSTSGFVNAIS  348
             M  FSS+FNG A++ S K  RKNS  +    GR+A  A+AKEA++N+LIL +SG VN   
Sbjct  1     MGHFSSMFNGLARSFSLKK-RKNSSGNGKYDGRDAVEAMAKEAKRNDLILRSSGTVNVDG  59

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S N ASL SR+G+KG NQD  IVWEEFG QEDM FCG+FDGHGPWGH V+K+VRE + SS
Sbjct  60    SKNFASLFSRRGEKGVNQDCFIVWEEFGCQEDMTFCGIFDGHGPWGHFVSKKVRESIVSS  119

Query  529   LLCNWQKALAHNMDNLGFDNCL--LDVWKQSHIKACSEVDQQLEQQA--GSFYSGTTALT  696
             LLC WQ++LA    +   D      ++WK+S +KAC+ VDQ+LE      +FYSGTTALT
Sbjct  120   LLCLWQESLAEASADPDLDKKAQRFNIWKESFLKACATVDQELEHHPKIDTFYSGTTALT  179

Query  697   VVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSD  876
             +V+QG+V+ +ANVGDSRAVLAT  DDGNLV VQLTVD KPNLP E ERI++  GRV+  D
Sbjct  180   IVRQGEVLFIANVGDSRAVLATTCDDGNLVPVQLTVDFKPNLPQETERILQCNGRVFCLD  239

Query  877   DEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAIL  1056
             DE GV+R+W+P+ +       PGLA+SRAFGDY +KDFGLIS P+ T R+IT +DQF +L
Sbjct  240   DESGVHRLWLPDESS------PGLAMSRAFGDYCVKDFGLISVPDVTQRHITSKDQFVVL  293

Query  1057  ATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             ATDGVWDV+SN+EAVEIVS  P+R ++AK LV+ AV AWKR RRGIA+DD+SAI LFF +
Sbjct  294   ATDGVWDVISNEEAVEIVSETPDRAKAAKHLVQCAVRAWKRKRRGIAVDDISAIVLFFLS  353

Query  1237  K  1239
             K
Sbjct  354   K  354



>ref|XP_006382439.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|ERP60236.1| phosphatase 2C family protein [Populus trichocarpa]
Length=368

 Score =   429 bits (1102),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 213/361 (59%), Positives = 272/361 (75%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+FN  A++ S +  + N   D GREAA+ + K+A+KNE+IL +SG+VN   S N
Sbjct  1     MGHLSSMFNVLARSFSLRKVKNNGNGD-GREAADVMVKDAKKNEMILRSSGYVNVDGSKN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A++ SR+G+KG NQD  IVWE FG Q DM+FCG+FDGHG WGH VAK VRE +P SLLC
Sbjct  60    FAAVCSRRGEKGVNQDCCIVWEGFGCQADMMFCGIFDGHGSWGHFVAKTVRESMPLSLLC  119

Query  538   NWQKALAHNMDNLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             NWQ+ LA    +   D      +   ++WK S++K C+ VDQ+LEQ  +  SF SGTTAL
Sbjct  120   NWQETLAQCSLDPDIDLESDKKHQRFNIWKHSYLKTCAAVDQELEQHRRIDSFSSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QG+++ VANVGDSRAVLAT  +DG+LV VQLTVD KPNLP E ERI++ KGRV+  
Sbjct  180   TIVRQGELIFVANVGDSRAVLATTGEDGSLVPVQLTVDFKPNLPQEAERILQCKGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGV+RVW+P+       + PGLA+SRAFGDY +KDFGLIS PE T R+IT +DQF +
Sbjct  240   NDEPGVHRVWLPD------ADSPGLAMSRAFGDYCVKDFGLISVPEVTQRHITSKDQFVV  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV++NQ AVEIVSS P++ ++AKRLV+ AV AWKR R+GIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVITNQAAVEIVSSTPDKAKAAKRLVQSAVHAWKRKRKGIAMDDISAICLFFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>gb|KDO81763.1| hypothetical protein CISIN_1g015633mg [Citrus sinensis]
Length=403

 Score =   429 bits (1103),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 229/396 (58%), Positives = 284/396 (72%), Gaps = 50/396 (13%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+F G A++ S + G KNS    GR AA A+AKEA++NE+IL +SGFVN  SS+N
Sbjct  1     MGHFSSMFYGLARSFSIRKG-KNSESCAGRGAAEAMAKEAKRNEMILRSSGFVNVDSSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A++ S++G+KG NQD AIVWEEFG Q DM+FCG+FDGHGPWGH VAK+VRE +PSSLLC
Sbjct  60    FAAVFSKRGEKGVNQDCAIVWEEFGCQADMMFCGIFDGHGPWGHFVAKKVRESMPSSLLC  119

Query  538   NWQKALAHN--MDNLGFDN----CLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             NWQ+ LA    + ++  D+       ++WK S++K C+ VDQ+LEQ  Q  SFYSGTTAL
Sbjct  120   NWQETLAEASLLPDIDLDSDKKTHRFNIWKHSYVKTCAAVDQELEQHRQIDSFYSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QG+ ++VANVGDSRAVLAT  +DG+LV VQLTVD KPNLP E ERI++ KGRV+  
Sbjct  180   TIVRQGEFIMVANVGDSRAVLATTSEDGSLVPVQLTVDFKPNLPYEAERIIQCKGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGV+RVW+PN       E PGLA+SRAFGDY +KD+GLIS PE T R+IT RDQF +
Sbjct  240   EDEPGVHRVWLPNE------ECPGLAMSRAFGDYCVKDYGLISVPEVTQRHITSRDQFVV  293

Query  1054  LATDG-----------------------------------VWDVVSNQEAVEIVSSAPER  1128
             LATDG                                   VWDV+SNQEA++IVSS P R
Sbjct  294   LATDGVSIMHYYDITIIFKLFLFVKIKENKLKIFIGLILQVWDVISNQEAIQIVSSTPNR  353

Query  1129  GESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
              +SAKRLVE AV AWKR R+GIAMDD+SAICLFFH+
Sbjct  354   AKSAKRLVECAVHAWKRKRKGIAMDDISAICLFFHS  389



>gb|ABK92926.1| unknown [Populus trichocarpa]
Length=368

 Score =   427 bits (1099),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 212/361 (59%), Positives = 272/361 (75%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+FN  A++ S +  + N   D GREAA+ + K+A+KNE+IL +SG+VN   S N
Sbjct  1     MGHLSSMFNVLARSFSLRKVKNNGNGD-GREAADVMVKDAKKNEMILRSSGYVNVDGSKN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A++ SR+G+KG NQD  IVWE FG Q DM+FCG+FDGHG WGH VAK VRE +P SLLC
Sbjct  60    FAAVCSRRGEKGVNQDCCIVWEGFGCQADMMFCGIFDGHGSWGHFVAKTVRESMPLSLLC  119

Query  538   NWQKALAHNMDNLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             NWQ+ LA    +   D      +   ++WK S++K C+ VDQ+LEQ  +  SF SGTTAL
Sbjct  120   NWQETLAQCSLDPDIDLESDKKHQRFNIWKHSYLKTCAAVDQELEQHRRIDSFSSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QG+++ VANVGDSRAVLAT  +DG+LV VQLTVD KPNLP E ERI++ KGRV+  
Sbjct  180   TIVRQGELIFVANVGDSRAVLATTGEDGSLVPVQLTVDFKPNLPQEAERILQCKGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGV+RVW+P+       + PGLA+SRAFGDY +KDFG+IS PE T R+IT +DQF +
Sbjct  240   NDEPGVHRVWLPD------ADSPGLAMSRAFGDYCVKDFGVISVPEVTQRHITSKDQFVV  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV++NQ AVEIVSS P++ ++AKRLV+ AV AWKR R+GIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVITNQAAVEIVSSTPDKAKAAKRLVQSAVHAWKRKRKGIAMDDISAICLFFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>emb|CDY19742.1| BnaA09g03950D [Brassica napus]
Length=373

 Score =   428 bits (1100),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 212/361 (59%), Positives = 272/361 (75%), Gaps = 16/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+F+GFA++ S K  + N+     +EAA+ +A++A+K E IL + G+V A  S+N
Sbjct  1     MGYFSSMFSGFARSFSIKKVKNNNGTSDAKEAADEMARDAKKKEKILKSCGYVYADGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD AIVWE FG QEDMIFCG+FDGHGPWGH VAK VR  +PSSLLC
Sbjct  61    SASVFSKRGEKGVNQDCAIVWEGFGCQEDMIFCGIFDGHGPWGHYVAKHVRNSMPSSLLC  120

Query  538   NWQKALAH------NMDNLGFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTT  687
             NWQK+LA        +D  G +  L   D+WK S++K C+ VDQ+LE  ++  S+ SGTT
Sbjct  121   NWQKSLAQATLLDPEIDLEGSNKKLSRFDIWKHSYLKTCASVDQELEHHRKIDSYNSGTT  180

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             ALT+V+QG+V+ ++NVGDSRAVLAT  D+G+LVAVQLT+D KPNLP E+ERI+  KGRV+
Sbjct  181   ALTIVRQGEVIYISNVGDSRAVLATVSDEGSLVAVQLTLDFKPNLPQEKERILGCKGRVF  240

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
                DEPGV+RVW P+       E PGLA+SRAFGDY IKD+GL+S PE T R+I+ +D F
Sbjct  241   CLKDEPGVHRVWQPD------AETPGLAMSRAFGDYCIKDYGLVSVPEVTQRHISAKDHF  294

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              ILA+DG+WDV+SNQEA+EIVS   ER ++AKRLVE AV AWK+ RRGIAMDDMS +CLF
Sbjct  295   IILASDGIWDVISNQEAIEIVSLTTERPKAAKRLVEQAVQAWKKKRRGIAMDDMSVVCLF  354

Query  1228  F  1230
              
Sbjct  355   L  355



>ref|XP_009111736.1| PREDICTED: probable protein phosphatase 2C 73 [Brassica rapa]
Length=373

 Score =   427 bits (1099),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 213/361 (59%), Positives = 272/361 (75%), Gaps = 16/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+F+GFA++ S K  + N+     +EAA+ +A++A+K E IL + G+V A  S+N
Sbjct  1     MGYFSSMFSGFARSFSIKKVKNNNGTSDAKEAADEMARDAKKKEKILKSCGYVYADGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD AIVWE FG QEDMIFCG+FDGHGPWGH VAK VR  +PSSLLC
Sbjct  61    SASVFSKRGEKGVNQDCAIVWEGFGCQEDMIFCGIFDGHGPWGHYVAKHVRNSMPSSLLC  120

Query  538   NWQKALAH------NMDNLGFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTT  687
             NWQK+LA        +D  G +  L   D+WK S++K C+ VDQ+LE  ++  S+ SGTT
Sbjct  121   NWQKSLAQATLLDPEIDLEGSNKKLSRFDIWKHSYLKTCASVDQELEHHRKIDSYNSGTT  180

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             ALT+V+QG+V+ ++NVGDSRAVLAT  D+G+LVAVQLT+D KPNLP E+ERI+  KGRV+
Sbjct  181   ALTIVRQGEVIYISNVGDSRAVLATVSDEGSLVAVQLTLDFKPNLPQEKERILGCKGRVF  240

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
                DEPGV+RVW P+       E PGLA+SRAFGDY IKD+GL+S PE T R+I+ +D F
Sbjct  241   CLKDEPGVHRVWQPD------AETPGLAMSRAFGDYCIKDYGLVSVPEVTQRHISAKDHF  294

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              ILA+DG+WDV+SNQEAVEIVS   ER ++AKRLVE AV AWK+ RRGIAMDDMS +CLF
Sbjct  295   IILASDGIWDVISNQEAVEIVSLTTERPKAAKRLVEQAVRAWKKKRRGIAMDDMSVVCLF  354

Query  1228  F  1230
              
Sbjct  355   L  355



>ref|XP_008370407.1| PREDICTED: probable protein phosphatase 2C 34 [Malus domestica]
Length=374

 Score =   427 bits (1099),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/361 (58%), Positives = 269/361 (75%), Gaps = 14/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+F+G A+++  K G+ N  +   R AA A+AK A+KN++IL +SG VN   S+N
Sbjct  1     MGYLSSMFSGLARSLLFKKGKNNGXDSGARGAAEAMAKVAKKNDMILRSSGIVNVDGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  IVWEEFG QEDM+FCG+FDGHGPWGH VAK++RE +P SLLC
Sbjct  61    FASVFSKRGEKGVNQDCCIVWEEFGCQEDMMFCGIFDGHGPWGHFVAKQIRETMPPSLLC  120

Query  538   NWQKALAHNMDNLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             +WQ+ L     +L  D          ++WK S+I+ C+ +D +LEQ  +  SFYSGTTAL
Sbjct  121   SWQETLGQTSIDLDSDLESDKKRHRFNIWKDSYIRTCAAIDHELEQHRRIDSFYSGTTAL  180

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             ++V+QG+++ +ANVGDSRAVLAT  DDG+L  VQLTVD KP+LP E ERI++S GRV+  
Sbjct  181   SIVRQGELIFIANVGDSRAVLATTLDDGSLTPVQLTVDFKPSLPQEEERIIQSNGRVFCL  240

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGV RVW P+       E PGLA+SRAFGDY +KDFGLIS PE + RNIT +DQF +
Sbjct  241   EDEPGVQRVWQPDG------ETPGLAMSRAFGDYCLKDFGLISVPEVSHRNITSKDQFVV  294

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAV+IV S  +R ++AK LVE A  AWKR RRGIAMDD+SAICLFFH
Sbjct  295   LATDGVWDVISNQEAVQIVGSTADRAKAAKLLVECAAQAWKRKRRGIAMDDISAICLFFH  354

Query  1234  N  1236
             +
Sbjct  355   S  355



>gb|AFK41200.1| unknown [Medicago truncatula]
Length=362

 Score =   427 bits (1097),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 216/360 (60%), Positives = 264/360 (73%), Gaps = 15/360 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F S  NG A+T+S K   KN R+D  R+A   LAKEARKNEL+LS+SG V A   ++
Sbjct  1     MVHFPSFVNGLARTMSIKK-EKNFRKDDARKAVEELAKEARKNELLLSSSGVVKANKDNS  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S+ + +G+KG NQDR  VWEEFG Q+DM+FCGVFDGHGPWGH VAKRVR+L+P+ LLC
Sbjct  60    FVSVFTHRGQKGVNQDRLTVWEEFGCQQDMMFCGVFDGHGPWGHFVAKRVRKLIPAILLC  119

Query  538   NWQKALAHNMDNLGF----DNCL--LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTAL  693
             NWQK LA    +L      D  +  LD+WKQS+IK  + VDQ L+   G  SF SGTTAL
Sbjct  120   NWQKNLAAASIDLDLKMEGDKNIHGLDLWKQSYIKTFAAVDQDLKPHTGIDSFQSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T++KQG+ +++ANVGDSR VLAT  +DG L  +QLT D KPNLP E ERI  SKGRV+  
Sbjct  180   TIIKQGENLIIANVGDSRLVLATTSEDGTLFPLQLTTDFKPNLPNEAERIKESKGRVFCM  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGVYRVWMPN       + PGLA+SRAFGDY +KD+GLIS P+ T R +T  DQF I
Sbjct  240   KDEPGVYRVWMPNG------KTPGLAISRAFGDYCMKDYGLISVPDVTHRKLTTGDQFII  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDVVSN+EAV+IV +A  + ++ +RLV++A+  WKR R GIAMDDMSAICLFFH
Sbjct  294   LATDGVWDVVSNEEAVKIVCAAAHKEKAGERLVKYAIREWKRKRSGIAMDDMSAICLFFH  353



>ref|NP_187215.1| putative protein phosphatase 2C [Arabidopsis thaliana]
 ref|NP_974230.1| putative protein phosphatase 2C [Arabidopsis thaliana]
 sp|Q9M9W9.1|P2C34_ARATH RecName: Full=Probable protein phosphatase 2C 34; Short=AtPP2C34 
[Arabidopsis thaliana]
 gb|AAF26133.1|AC011620_9 putative protein phosphatase-2C [Arabidopsis thaliana]
 gb|AAK91405.1| AT3g05640/F18C1_9 [Arabidopsis thaliana]
 gb|AAM10415.1| AT3g05640/F18C1_9 [Arabidopsis thaliana]
 dbj|BAH19512.1| AT3G05640 [Arabidopsis thaliana]
 gb|AEE74270.1| putative protein phosphatase 2C [Arabidopsis thaliana]
 gb|AEE74271.1| putative protein phosphatase 2C [Arabidopsis thaliana]
Length=358

 Score =   426 bits (1096),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 214/356 (60%), Positives = 267/356 (75%), Gaps = 10/356 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTIS-KKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSH  354
             M  FSS+FNG A++ S KK+   NS +   +EA + +A+EA+K ELIL +SG +NA  S+
Sbjct  1     MGHFSSMFNGIARSFSIKKAKNINSSKSYAKEATDEMAREAKKKELILRSSGCINADGSN  60

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
             N AS+ SR+G+KG NQD AIVWE +G QEDMIFCG+FDGHGPWGH V+K+VR  +P SLL
Sbjct  61    NLASVFSRRGEKGVNQDCAIVWEGYGCQEDMIFCGIFDGHGPWGHFVSKQVRNSMPISLL  120

Query  535   CNWQKALAHN-MDNLGFDNCLLDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTALTVVK  705
             CNW++ L+   +     +     +WK S +K C  VD +LE  ++  SF SGTTALT+V+
Sbjct  121   CNWKETLSQTTIAEPDKELQRFAIWKYSFLKTCEAVDLELEHHRKIDSFNSGTTALTIVR  180

Query  706   QGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEP  885
             QGDV+ +ANVGDSRAVLAT  D+G+LVAVQLTVD KPNLP E ERI+   GRV+   DEP
Sbjct  181   QGDVIYIANVGDSRAVLATVSDEGSLVAVQLTVDFKPNLPQEEERIIGCNGRVFCLQDEP  240

Query  886   GVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATD  1065
             GV+RVW P        E PGLA+SRAFGDY IKD+GL+S PE T R+I+ RDQF ILATD
Sbjct  241   GVHRVWQP------VDESPGLAMSRAFGDYCIKDYGLVSVPEVTQRHISIRDQFIILATD  294

Query  1066  GVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             GVWDV+SNQEA++IVSS  ER ++AKRLV+ AV AW R RRGIAMDD+SA+CLFFH
Sbjct  295   GVWDVISNQEAIDIVSSTAERAKAAKRLVQQAVRAWNRKRRGIAMDDISAVCLFFH  350



>emb|CDY25013.1| BnaC02g39950D [Brassica napus]
Length=375

 Score =   427 bits (1097),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 208/362 (57%), Positives = 271/362 (75%), Gaps = 16/362 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+F+G A++ S K  + N+     +EAA+ + K+A+K E+IL + G+V A  S+N
Sbjct  1     MGHFSSMFSGLARSFSIKKVKNNNGTCDAKEAADEMVKDAKKKEMILKSCGYVYAEGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD AIVWE FG QEDMIFCG+FDGHGPWGH VAK VR  +PSSLLC
Sbjct  61    SASVFSKRGEKGVNQDCAIVWEGFGCQEDMIFCGIFDGHGPWGHYVAKHVRNSMPSSLLC  120

Query  538   NWQKALAHN------MDNLGFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTT  687
             NWQK LA        +D  G +      D+WK S++K C+ VDQ+LE  ++  S+ SGTT
Sbjct  121   NWQKTLAQTALLEPELDLEGSNKKFSRFDIWKHSYLKTCASVDQELEHHRKIDSYNSGTT  180

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             A+T+V+QGDV+ V+NVGDSRAVLAT+ D+G++VA+QLT+D KPNLP E+ERI+   GRV+
Sbjct  181   AITIVRQGDVIYVSNVGDSRAVLATSSDEGSMVAIQLTLDFKPNLPQEKERIIGCNGRVF  240

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
                DEPGV+RVW P+       E PGLA+SRAFGDY IK++GL+S PE T R+I+ +D F
Sbjct  241   CMKDEPGVHRVWQPD------TEAPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISAKDHF  294

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              ILA+DG+WDV++NQEA+EIVSS  ER ++AKRLVE AV AWK+ RRGIAMDDMS +CLF
Sbjct  295   IILASDGIWDVITNQEAIEIVSSTAERPKAAKRLVEQAVRAWKKKRRGIAMDDMSVVCLF  354

Query  1228  FH  1233
              H
Sbjct  355   LH  356



>ref|XP_009129890.1| PREDICTED: probable protein phosphatase 2C 73 [Brassica rapa]
 ref|XP_009129891.1| PREDICTED: probable protein phosphatase 2C 73 [Brassica rapa]
Length=375

 Score =   427 bits (1097),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 209/362 (58%), Positives = 270/362 (75%), Gaps = 16/362 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+F+G A++ S K  + N+     ++AA+ + K+A+K E+IL + G+V A  S+N
Sbjct  1     MGHFSSMFSGLARSFSIKKVKNNNGTCDAKQAADEMVKDAKKKEMILKSCGYVYAEGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD AIVWE FG QEDMIFCG+FDGHGPWGH VAK VR  +PSSLLC
Sbjct  61    SASVFSKRGQKGVNQDCAIVWEGFGCQEDMIFCGIFDGHGPWGHYVAKHVRNSMPSSLLC  120

Query  538   NWQKALAHN------MDNLGFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTT  687
             NWQK LA        +D  G +      D+WK S++K C+ VDQ+LE  ++  S+ SGTT
Sbjct  121   NWQKTLAQTALLEPELDLEGSNKKFSRFDIWKHSYLKTCASVDQELEHHRKIDSYNSGTT  180

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             A+T+V+QGDV+ V+NVGDSRAVLAT  D+G+LVAVQLT+D KPNLP E+ERI+   GRV+
Sbjct  181   AITIVRQGDVIYVSNVGDSRAVLATTSDEGSLVAVQLTLDFKPNLPQEKERIIGCNGRVF  240

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
                DEPGV+RVW P+       E PGLA+SRAFGDY IK++GL+S PE T R+I+ +D F
Sbjct  241   CMKDEPGVHRVWQPD------TEAPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISAKDHF  294

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              ILA+DG+WDV++NQEA+EIVSS  ER ++AKRLVE AV AWK+ RRGIAMDDMS +CLF
Sbjct  295   IILASDGIWDVITNQEAIEIVSSTAERPKAAKRLVEQAVRAWKKKRRGIAMDDMSVVCLF  354

Query  1228  FH  1233
              H
Sbjct  355   LH  356



>ref|XP_007205376.1| hypothetical protein PRUPE_ppa007304mg [Prunus persica]
 gb|EMJ06575.1| hypothetical protein PRUPE_ppa007304mg [Prunus persica]
Length=373

 Score =   426 bits (1096),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 226/383 (59%), Positives = 282/383 (74%), Gaps = 23/383 (6%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+F+G  +++S K G+ N      R+AA A+AKEA+KN++IL +SG VN   S+N
Sbjct  1     MGHFSSMFSGLVRSLSIKKGKNNRGNSDARDAAEAMAKEAKKNDMILRSSGIVNVDGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  IVWEEFG QEDM+FCG+FDGHGPWGH VAKR+RE +P SLLC
Sbjct  61    FASVFSKRGQKGVNQDCCIVWEEFGCQEDMMFCGIFDGHGPWGHFVAKRIRETMPPSLLC  120

Query  538   NWQKALAHNMDNLGFDNCL------LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTAL  693
             +WQ+ LA    +   D  L       ++WK S+IK C+ +DQ+L+  ++  SFYSGTTAL
Sbjct  121   SWQETLAQTSLDPDLDLELDKKGHRFNIWKHSYIKTCAAIDQELDRHRRIDSFYSGTTAL  180

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             ++V+QG+++ +ANVGDSRAVLAT  +DG+LV VQLTVD KP+LP E ERI++SKGRV+  
Sbjct  181   SIVRQGELIFIANVGDSRAVLATTSEDGSLVPVQLTVDFKPSLPQEAERIIQSKGRVFCL  240

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             DDEPGV RVW P+       E PGLA+SRAFGDY +K FGLIS PE T RNIT RDQF +
Sbjct  241   DDEPGVQRVWQPDG------ETPGLAMSRAFGDYCVKGFGLISVPEVTQRNITSRDQFVV  294

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDVVSNQEAV+IV S  +R +SAKRLVE AV AWKR RRGIAMDD+SAICLFFH
Sbjct  295   LATDGVWDVVSNQEAVQIVGSTADRAKSAKRLVECAVHAWKRKRRGIAMDDISAICLFFH  354

Query  1234  NKLIV*rrrrrrLHDMMQKQPIT  1302
             +           L D  Q  PI+
Sbjct  355   SS---------PLSDPQQVHPIS  368



>ref|XP_006286743.1| hypothetical protein CARUB_v10003011mg [Capsella rubella]
 gb|EOA19641.1| hypothetical protein CARUB_v10003011mg [Capsella rubella]
Length=373

 Score =   426 bits (1095),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 208/361 (58%), Positives = 274/361 (76%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+F+G A++ S K  + N+  +  +EAA+ +  +A+K +LIL +SG+VNA  S++
Sbjct  1     MGHFSSMFSGLARSFSIKKVKNNNGNNDAKEAADEMVNDAKKKQLILKSSGYVNAEGSNS  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD A+VWE FG QEDMIFCG+FDGHGPWGH VAK VR  +PSSLLC
Sbjct  61    SASVFSKRGEKGVNQDCALVWEGFGCQEDMIFCGIFDGHGPWGHYVAKHVRNSMPSSLLC  120

Query  538   NWQKALAH-------NMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTA  690
             NWQK LA        ++++        ++WKQS++K C+ VDQ+LEQ  +  ++YSG+T+
Sbjct  121   NWQKILAQKTLEPDLDLEDSNKKQSRFEIWKQSYLKTCAMVDQELEQHRKIDAYYSGSTS  180

Query  691   LTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWS  870
             LT+V+QG+V+ +ANVGDSRAVLAT  D+G+LVAVQLT+D KPNLP E ERI+  KGRV+ 
Sbjct  181   LTIVRQGEVIYIANVGDSRAVLATVSDEGSLVAVQLTLDFKPNLPQEEERIIGCKGRVFC  240

Query  871   SDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFA  1050
               DEPGV+RVW P+       E PGLA+SRAFGDY IKD+GL+S PE T R+I+ +D F 
Sbjct  241   LKDEPGVHRVWQPD------AETPGLAMSRAFGDYCIKDYGLVSVPEVTQRHISTKDHFI  294

Query  1051  ILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             ILA+DG+WDV+SNQEAVEIVSS  ER ++AKRLV+ AV AWK+ RRGI+MDDMS +CLF 
Sbjct  295   ILASDGIWDVISNQEAVEIVSSTAERPKAAKRLVQQAVRAWKKKRRGISMDDMSVVCLFL  354

Query  1231  H  1233
             H
Sbjct  355   H  355



>ref|XP_010259459.1| PREDICTED: probable protein phosphatase 2C 73 [Nelumbo nucifera]
Length=355

 Score =   425 bits (1092),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 228/361 (63%), Positives = 275/361 (76%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   S+LF+G A+++S K G KN   D G+EAA A+AKEA+KN+LI  +SG VN+  S N
Sbjct  1     MGHLSTLFDGLARSLSFKRG-KNCGNDAGKEAAEAMAKEAKKNDLISRSSGIVNSNGSSN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++GKKG NQD  IVWEEFG QEDMIFCGVFDGHGPWG  VAK VRE +P SLLC
Sbjct  60    FASIFSKKGKKGVNQDCFIVWEEFGCQEDMIFCGVFDGHGPWGRFVAKTVRESMPLSLLC  119

Query  538   NWQKALAHNMDNLGFDN------CLLDVWKQSHIKACSEVDQQLEQQA--GSFYSGTTAL  693
             NWQ+ LA       FD          +VWKQS++K C+ +DQ+LE  +   SFYSGTTAL
Sbjct  120   NWQETLALASLEPEFDFESDKELYHFNVWKQSYLKTCAAIDQELEHHSRIDSFYSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             +VV+QG+ +V+ANVGDSRAVLAT  DDG+LV VQLT+D KPNLP E ERI + KGRV+S 
Sbjct  180   SVVRQGEFIVIANVGDSRAVLATTCDDGSLVPVQLTIDFKPNLPQEAERITQCKGRVFSL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGV+RVW+PN       E PGLA+SRAFGDY +KDFGLIS PE T R+IT +DQF +
Sbjct  240   HDEPGVHRVWLPNS------ETPGLAMSRAFGDYCVKDFGLISVPEVTQRSITTKDQFIV  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDG+WDV+SNQE V+IVSS  +R +SAKRLVE AV AWKR R+GIAMDD+SAICLFFH
Sbjct  294   LATDGLWDVISNQEVVDIVSSTTDREKSAKRLVECAVHAWKRKRKGIAMDDISAICLFFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>ref|XP_010546744.1| PREDICTED: probable protein phosphatase 2C 73 [Tarenaya hassleriana]
 ref|XP_010546745.1| PREDICTED: probable protein phosphatase 2C 73 [Tarenaya hassleriana]
 ref|XP_010546746.1| PREDICTED: probable protein phosphatase 2C 73 [Tarenaya hassleriana]
 ref|XP_010546747.1| PREDICTED: probable protein phosphatase 2C 73 [Tarenaya hassleriana]
 ref|XP_010546748.1| PREDICTED: probable protein phosphatase 2C 73 [Tarenaya hassleriana]
Length=362

 Score =   425 bits (1092),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 213/361 (59%), Positives = 270/361 (75%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S K  + ++    G+ AA+ + +EA+KNELIL +SG++ A   +N
Sbjct  1     MGHFSSMFNGLARSFSIKKVKSSNGGSDGKVAADEMVREAKKNELILRSSGYLYADGLNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD AIVW+EFG QEDMIFCG+FDGHGPWGH VAK+VR  +P  LL 
Sbjct  61    LASVFSKRGEKGVNQDCAIVWKEFGCQEDMIFCGIFDGHGPWGHFVAKQVRNSLPPLLLR  120

Query  538   NWQKALAHNM--DNLGFDNC-----LLDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTA  690
             NWQ+ LA       L  D         ++WK+S++K C+ VDQ+LE  ++  SFYSGTTA
Sbjct  121   NWQETLAQTAVDPELELDTSDEKLQRFNIWKRSYLKTCASVDQELEHHRKIDSFYSGTTA  180

Query  691   LTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWS  870
             LT+V+QG+++ VANVGDSRAVLAT  D+G+LV VQLTVD KPNLP E ERI++  GRV+ 
Sbjct  181   LTIVRQGELLYVANVGDSRAVLATVSDEGSLVPVQLTVDFKPNLPQEEERILQCNGRVFC  240

Query  871   SDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFA  1050
               DEPGV+RVW+P+       E PGLA+SRAFGDY IK++GL+S PE   R+IT RD+F 
Sbjct  241   LQDEPGVHRVWLPDE------ESPGLAMSRAFGDYCIKEYGLVSVPEVMQRHITGRDKFV  294

Query  1051  ILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             ILATDGVWDV SNQEAVEIVSS  E  ++AKRLVE AV AWK+ RRGIAMDD+SA+CLFF
Sbjct  295   ILATDGVWDVTSNQEAVEIVSSTGEPAKAAKRLVEQAVRAWKKKRRGIAMDDISAVCLFF  354

Query  1231  H  1233
             H
Sbjct  355   H  355



>emb|CDY53338.1| BnaCnng24960D [Brassica napus]
Length=373

 Score =   424 bits (1090),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 209/358 (58%), Positives = 271/358 (76%), Gaps = 16/358 (4%)
 Frame = +1

Query  187   FSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCAS  366
             FSS+F+GFA++ S K  + N+     +EAA+ +A++A+K E IL + G+V A  S+N AS
Sbjct  4     FSSMFSGFARSFSIKKVKNNNGTSDAKEAADEMARDAKKKEKILKSCGYVYADGSNNSAS  63

Query  367   LHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQ  546
             + S++G+KG NQD AIVWE FG QEDMIFCG+FDGHGPWGH VAK VR  +PSSLLCNWQ
Sbjct  64    VFSKRGEKGVNQDCAIVWEGFGCQEDMIFCGIFDGHGPWGHYVAKHVRNSMPSSLLCNWQ  123

Query  547   KALAH------NMDNLGFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTALT  696
             K+LA        +D  G +  L   D+WK S++K C+ VDQ+LE  ++  S+ SGTTALT
Sbjct  124   KSLAQATLLDPELDLEGSNKKLSRFDIWKHSYLKTCASVDQELEHHRKIDSYNSGTTALT  183

Query  697   VVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSD  876
             +V+QG+V+ ++NVGDSRAVLAT  D+G+LVAVQLT+D KPNLP E+ERI+  KGRV+   
Sbjct  184   IVRQGEVIYISNVGDSRAVLATVSDEGSLVAVQLTLDFKPNLPQEKERILGCKGRVFCLK  243

Query  877   DEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAIL  1056
             DEPGV+RVW P+       E PGLA+SRAFGDY IKD+GL+S PE T R+I+ +D F IL
Sbjct  244   DEPGVHRVWQPD------AETPGLAMSRAFGDYCIKDYGLVSVPEVTQRHISAKDHFIIL  297

Query  1057  ATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             A+DG+WDV+SNQEA+EIVS   ER ++AK+LVE AV AWK+ +RGIAMDDMS +CLF 
Sbjct  298   ASDGIWDVISNQEAIEIVSLTTERPKAAKKLVEQAVRAWKKKKRGIAMDDMSVVCLFL  355



>gb|EYU37272.1| hypothetical protein MIMGU_mgv1a008718mg [Erythranthe guttata]
Length=364

 Score =   423 bits (1087),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 205/359 (57%), Positives = 268/359 (75%), Gaps = 12/359 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+FNG  +++S K  +++      R+A +A+AK+A+KN+LIL  SG +N   S N
Sbjct  1     MGHLSSMFNGLTRSLSIKRIKRSKSNCDERDAVDAMAKDAKKNDLILRKSGILNVDGSRN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  +VWEEFG QEDM+FCG+FDGHGPWGH V+KRVRE +PS+LLC
Sbjct  61    LASVFSKRGEKGVNQDCCVVWEEFGCQEDMMFCGIFDGHGPWGHFVSKRVRESMPSTLLC  120

Query  538   NWQKALAHNMDNLGFDN----CLLDVWKQSHIKACSEVDQQL--EQQAGSFYSGTTALTV  699
             NWQ+ L     N   D+       ++WK S++K C+ VD++L   ++  +F+SGTTALT+
Sbjct  121   NWQQTLVEASLNSDSDSDKKLQSFNIWKHSYLKTCAAVDRELHHHRKIDAFHSGTTALTI  180

Query  700   VKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDD  879
             V+QG+ + +ANVGDSRAVL T  ++GNLVAVQLT+D KPNLP E ERIM  KGRV+  +D
Sbjct  181   VRQGEFIFIANVGDSRAVLGTTSENGNLVAVQLTIDFKPNLPQEAERIMECKGRVYCLED  240

Query  880   EPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILA  1059
             EPGV+RVW+PN       E PGLA+SRAFGDY +KD+GLIS PE T R+IT +D F +LA
Sbjct  241   EPGVHRVWLPNE------ESPGLAMSRAFGDYCVKDYGLISVPEITHRHITTQDLFVVLA  294

Query  1060  TDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             TDGVWDVVSN+EAV IVS+  +R + AKRLVE A  +WKR R+GIAMDD+SAI LFFH+
Sbjct  295   TDGVWDVVSNEEAVRIVSATEDRAKCAKRLVERAANSWKRIRKGIAMDDISAIVLFFHS  353



>ref|XP_003591185.1| hypothetical protein MTR_1g083690 [Medicago truncatula]
 gb|ABD28350.1| Protein phosphatase 2C-like [Medicago truncatula]
 gb|AES61436.1| catalytic/protein phosphatase type 2C [Medicago truncatula]
Length=352

 Score =   422 bits (1085),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 215/361 (60%), Positives = 276/361 (76%), Gaps = 17/361 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A+++  K GR       GREAA ALAKEA++N  ++++SG +N   S+N
Sbjct  1     MGHFSSMFNGLAQSLKMKKGRSKCS---GREAAEALAKEAKRNHSLINSSGTINVDGSNN  57

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++GKKG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH V++ VRE +PS+LLC
Sbjct  58    FASVFSKRGKKGVNQDCCIVWEEFGCQEDMIFCGIFDGHGPWGHYVSRTVRESMPSALLC  117

Query  538   NWQKALAHNMDNLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             NWQ+ L+    +   D      +   ++WK S++K C+ +DQ+LEQ  +  SF+SGTTA+
Sbjct  118   NWQETLSQTSIDPEIDLKTGKKHQQFNIWKHSYLKTCASIDQELEQNHKIDSFFSGTTAV  177

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             ++V+QG+++V+ANVGDSRAVLAT  DDGNLV VQLT+D KPNLP E ERI+  +GRV+  
Sbjct  178   SIVRQGELIVIANVGDSRAVLATTSDDGNLVPVQLTIDFKPNLPQEAERILDCQGRVFCL  237

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             DDEPGV+RVW+PN       E PGLA+SRAFGDY +KD+GLIS PE T RNIT +DQF +
Sbjct  238   DDEPGVHRVWLPNE------ESPGLAMSRAFGDYSMKDYGLISVPEVTQRNITSKDQFVV  291

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LA+DGVWDV+SNQEAV+IVSS  +R  S+KRLVE A+ AWK  R+GIAMDD+SAICLFFH
Sbjct  292   LASDGVWDVISNQEAVDIVSSTEDRTSSSKRLVECAMHAWKCKRQGIAMDDISAICLFFH  351

Query  1234  N  1236
             +
Sbjct  352   S  352



>ref|XP_003521676.1| PREDICTED: probable protein phosphatase 2C 73 [Glycine max]
Length=371

 Score =   422 bits (1086),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 222/363 (61%), Positives = 285/363 (79%), Gaps = 17/363 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S K GR+N +   GREAA A+AKEA+KN+++L +SG V+   S+N
Sbjct  1     MGHFSSMFNGLARSFSMKKGRRNGKCG-GREAAEAMAKEAKKNDMMLCSSGIVHVDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  +VWEEFG QEDMIFCG+FDGHGPWGH VAKR+RE +P SLLC
Sbjct  60    FASVFSKRGQKGVNQDCCMVWEEFGCQEDMIFCGIFDGHGPWGHFVAKRIRESMPPSLLC  119

Query  538   NWQKALAH-NMDNLGFD-------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTT  687
             NWQ+ LA  ++D+   D       +   ++WK S++K C+ +DQ+LEQ  +  SFYSGTT
Sbjct  120   NWQETLAQTSIDHPAIDVEEEKSKHYRFNIWKHSYLKTCAAIDQELEQYRKIDSFYSGTT  179

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             AL++V+QG+++V+ANVGDSRAVLAT  DDG+LV VQLT+D KPNLP E ERI++ +GRV+
Sbjct  180   ALSIVRQGELIVIANVGDSRAVLATTSDDGSLVPVQLTIDFKPNLPQEAERIIQCQGRVF  239

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
               +DEPGV+RVW+P+       E PGLA+SRAFGDY IK  GLIS PE T RNIT RDQF
Sbjct  240   CLEDEPGVHRVWLPDE------ESPGLAMSRAFGDYCIKGHGLISVPEVTHRNITSRDQF  293

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              +LATDGVWDV+SN+EAV+IVSSA ++ ++AKRLVE AV AWKR RRGIA+DD+SAICLF
Sbjct  294   VVLATDGVWDVISNKEAVDIVSSAADKAKAAKRLVECAVHAWKRKRRGIAVDDISAICLF  353

Query  1228  FHN  1236
             FH+
Sbjct  354   FHS  356



>ref|XP_010486021.1| PREDICTED: probable protein phosphatase 2C 34 isoform X1 [Camelina 
sativa]
Length=391

 Score =   423 bits (1088),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 211/363 (58%), Positives = 269/363 (74%), Gaps = 16/363 (4%)
 Frame = +1

Query  172   EKMVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISS  351
             +KM   SS+FNG A++ S K  +  + +   +EAA+ +A+EA+K +LIL +SG +NA  S
Sbjct  16    KKMGHLSSMFNGLARSFSIKKAKNKNGKSYAKEAADEMAREAKKKDLILRSSGCINADGS  75

Query  352   HNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSL  531
             +N AS+ SR+G+KG NQD AIVWE FG QEDMIFCG+FDGHGPWGH V+K+VR  +P SL
Sbjct  76    NNLASVFSRRGEKGVNQDCAIVWEGFGCQEDMIFCGIFDGHGPWGHFVSKQVRNSMPISL  135

Query  532   LCNWQKALAH--------NMDNLGFDNCLLDVWKQSHIKACSEVDQQLE--QQAGSFYSG  681
             LCNW++ L+         ++D          +WK S++K C  VD++LE  ++  SF SG
Sbjct  136   LCNWKETLSQTTLAEPETDLDESDKKLQRFAIWKYSYLKTCEAVDRELEHHRKIDSFNSG  195

Query  682   TTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGR  861
             TTALTVV+QG+VM +ANVGDSRAVLAT  D+G+LVAVQLTVD KPNLP E ERI+   GR
Sbjct  196   TTALTVVRQGEVMYIANVGDSRAVLATVSDEGSLVAVQLTVDFKPNLPQEEERIIGCNGR  255

Query  862   VWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRD  1041
             V+   DEPGV+RVW P        E PGLA+SRAFGDY IK++GL+S PE T R+I+ RD
Sbjct  256   VFCLQDEPGVHRVWQPEE------EYPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISIRD  309

Query  1042  QFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAIC  1221
             QF ILATDGVWDV+SNQEA++IVSS  +R ++AKRLV+ AV AW R RRGIAMDD+SA+C
Sbjct  310   QFVILATDGVWDVISNQEAIDIVSSTDDRPKAAKRLVQQAVKAWNRKRRGIAMDDISAVC  369

Query  1222  LFF  1230
             LFF
Sbjct  370   LFF  372



>gb|AFK47876.1| unknown [Lotus japonicus]
Length=365

 Score =   422 bits (1085),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 219/361 (61%), Positives = 277/361 (77%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG AK+ + K GR + R   GREAA A+AKEA+KN  IL +SG V+   S+N
Sbjct  1     MGHFSSVFNGLAKSFAMKKGRSSGRCS-GREAAEAMAKEAKKNHSILKSSGTVDVDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  +VWEEFG QED+IFCGVFDGHGPWGH VA+RVR+ +P+SLLC
Sbjct  60    FASVFSKKGQKGVNQDCCLVWEEFGCQEDIIFCGVFDGHGPWGHYVARRVRKSMPASLLC  119

Query  538   NWQKALAHNMDNLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             NWQ+ L+    +   D          D WK S++K C+ +D++L+Q  +  SFYSGTTA+
Sbjct  120   NWQEKLSQTSLDPDVDIESQKKQYRFDAWKHSYLKTCAAIDRELQQNCKIDSFYSGTTAV  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             ++V+QG V+V+ANVGDSRAVLAT  DDG+LV VQLTVD KPNLP E ERI+  +GRV+  
Sbjct  180   SIVRQGGVIVIANVGDSRAVLATTSDDGSLVPVQLTVDFKPNLPQEAERILEHQGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             DDEPGV+RVW+P+       E PGLA+SRAFGDY +K++GLIS PE T RNIT +DQF +
Sbjct  240   DDEPGVHRVWLPDE------ESPGLAMSRAFGDYCVKEYGLISVPEVTQRNITSKDQFVV  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SN+EAV+IVSS  +R +SAKRLV+ A+ AWKR RRGIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVISNEEAVDIVSSTADRTDSAKRLVKCAMRAWKRKRRGIAMDDISAICLFFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>ref|XP_010486022.1| PREDICTED: probable protein phosphatase 2C 34 isoform X2 [Camelina 
sativa]
 ref|XP_010486023.1| PREDICTED: probable protein phosphatase 2C 34 isoform X2 [Camelina 
sativa]
Length=374

 Score =   422 bits (1084),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 210/361 (58%), Positives = 267/361 (74%), Gaps = 16/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+FNG A++ S K  +  + +   +EAA+ +A+EA+K +LIL +SG +NA  S+N
Sbjct  1     MGHLSSMFNGLARSFSIKKAKNKNGKSYAKEAADEMAREAKKKDLILRSSGCINADGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ SR+G+KG NQD AIVWE FG QEDMIFCG+FDGHGPWGH V+K+VR  +P SLLC
Sbjct  61    LASVFSRRGEKGVNQDCAIVWEGFGCQEDMIFCGIFDGHGPWGHFVSKQVRNSMPISLLC  120

Query  538   NWQKALAH--------NMDNLGFDNCLLDVWKQSHIKACSEVDQQLE--QQAGSFYSGTT  687
             NW++ L+         ++D          +WK S++K C  VD++LE  ++  SF SGTT
Sbjct  121   NWKETLSQTTLAEPETDLDESDKKLQRFAIWKYSYLKTCEAVDRELEHHRKIDSFNSGTT  180

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             ALTVV+QG+VM +ANVGDSRAVLAT  D+G+LVAVQLTVD KPNLP E ERI+   GRV+
Sbjct  181   ALTVVRQGEVMYIANVGDSRAVLATVSDEGSLVAVQLTVDFKPNLPQEEERIIGCNGRVF  240

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
                DEPGV+RVW P        E PGLA+SRAFGDY IK++GL+S PE T R+I+ RDQF
Sbjct  241   CLQDEPGVHRVWQPEE------EYPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISIRDQF  294

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              ILATDGVWDV+SNQEA++IVSS  +R ++AKRLV+ AV AW R RRGIAMDD+SA+CLF
Sbjct  295   VILATDGVWDVISNQEAIDIVSSTDDRPKAAKRLVQQAVKAWNRKRRGIAMDDISAVCLF  354

Query  1228  F  1230
             F
Sbjct  355   F  355



>ref|XP_009124867.1| PREDICTED: probable protein phosphatase 2C 34 [Brassica rapa]
 emb|CDY18810.1| BnaAnng02750D [Brassica napus]
Length=348

 Score =   420 bits (1080),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 206/355 (58%), Positives = 267/355 (75%), Gaps = 9/355 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FN  A++ S K    N + +  +EAA+ +A+EA+K  +IL +SG VNA  S+N
Sbjct  1     MGHFSSMFNSLARSFSNKKDNNNGKSN-AKEAADEMAREAKKKAMILKSSGCVNADGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ SR+G+KG NQD AIVWE FG QE+MIFCG+FDGHGPWGH V+K+VR  +P SLLC
Sbjct  60    LASVFSRRGEKGVNQDCAIVWEGFGCQEEMIFCGIFDGHGPWGHFVSKQVRNSMPISLLC  119

Query  538   NWQKALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTALTVVKQG  711
             NWQ+ L+         +    +WK  ++K C++VDQ+L+  ++  +F SGTTALTVV+QG
Sbjct  120   NWQETLSQTTLVEPETDQRFAIWKHLYLKTCADVDQELQHHRKIDTFNSGTTALTVVRQG  179

Query  712   DVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGV  891
             +V+ VANVGDSRAVLAT  ++G+L AVQLTVD KPN+P E ERI+   GRV+  +DEPGV
Sbjct  180   EVIYVANVGDSRAVLATVSEEGSLTAVQLTVDFKPNIPQEEERIIGCNGRVFCLEDEPGV  239

Query  892   YRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGV  1071
             +RVW P        E PGLA+SRAFGDY IK++GL+S PE T R+I+ RDQF ILATDGV
Sbjct  240   HRVWQPEE------ESPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISTRDQFVILATDGV  293

Query  1072  WDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             WDV+SN+EA++IVSS  ER ++AKRLVE AV AW + RRGIAMDD+SA+CLFFH+
Sbjct  294   WDVISNEEAIDIVSSTAERPKAAKRLVEQAVKAWNKKRRGIAMDDISAVCLFFHS  348



>ref|XP_008388508.1| PREDICTED: probable protein phosphatase 2C 34 [Malus domestica]
Length=372

 Score =   421 bits (1081),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 272/359 (76%), Gaps = 12/359 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M Q SS+F+G A+++S K G+ N  +   R AA A+AKEA+KN++IL +SG V    S+N
Sbjct  1     MEQLSSMFSGLARSLSLKKGKNNDEKSGARGAAEAMAKEAKKNDMILRSSGIVYVDGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD   VWE FG QEDM+FCG+FDGHGPWGH VAK++RE +P SLLC
Sbjct  61    FASVFSKRGEKGVNQDCCXVWEGFGXQEDMMFCGIFDGHGPWGHFVAKQIRETMPPSLLC  120

Query  538   NWQKALAHNM----DNLGFDNCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTALTV  699
             +WQ+ LA        +L       +VWK S+IK C+ +D +L Q  +  SFYSGTTAL++
Sbjct  121   SWQETLAQTSIVPDPDLDKKCHRFNVWKDSYIKTCAAIDHELGQHRRIDSFYSGTTALSI  180

Query  700   VKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDD  879
             V+QG+++ +ANVGDSRAVLAT  DDG+LV VQLTVD KP+LP E ERI++S GRV+  DD
Sbjct  181   VRQGELIFIANVGDSRAVLATTLDDGSLVPVQLTVDFKPSLPQEAERIIQSNGRVFCLDD  240

Query  880   EPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILA  1059
             EPGV RVW P+       E PGLA+SRAFGDY +KDFGLIS PE + RNIT RDQF +LA
Sbjct  241   EPGVQRVWQPDG------ETPGLAMSRAFGDYCVKDFGLISVPEVSQRNITSRDQFVVLA  294

Query  1060  TDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             TDGVWDVVSNQEAV+IVSS  ERG++AKRLVE A  AWKR RRGIAMDD+SAICLFFH+
Sbjct  295   TDGVWDVVSNQEAVQIVSSTAERGKAAKRLVEFAARAWKRKRRGIAMDDISAICLFFHS  353



>ref|XP_007223348.1| hypothetical protein PRUPE_ppa007423mg [Prunus persica]
 gb|EMJ24547.1| hypothetical protein PRUPE_ppa007423mg [Prunus persica]
Length=368

 Score =   420 bits (1080),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 214/361 (59%), Positives = 266/361 (74%), Gaps = 16/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTS-GFVNAISSH  354
             MV F  L  G A+T S K   KN  EDV R+ A AL KEA+KNEL+LS+S G V +  S+
Sbjct  1     MVLFPYLLEGLARTRSLKK-MKNCHEDVARKTAEALEKEAKKNELVLSSSSGIVMSDKSN  59

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
             N +S+ S++G+KG NQD  I+WEEFG QEDMIFCG+FDGHG WGH V+KRV+E +P+SLL
Sbjct  60    NFSSVCSKRGQKGINQDCLIIWEEFGCQEDMIFCGIFDGHGQWGHHVSKRVKESMPASLL  119

Query  535   CNWQKALAHNMDNLGFDNCL------LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTA  690
             CNWQ+ L     NL F+  +       D+WKQS +K  + +DQ+L+  +   S+ SG TA
Sbjct  120   CNWQETLTLASLNLDFEMEMDRNLHRFDIWKQSFLKTYAAIDQELKHSSKMDSYRSGATA  179

Query  691   LTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWS  870
              T+VKQG+ ++VANVGDSRAVLA+  +DG+LV +QLTVD KPN+P E ERI RS GRV+ 
Sbjct  180   STIVKQGEHLIVANVGDSRAVLASISEDGSLVPLQLTVDFKPNIPQEAERITRSNGRVFC  239

Query  871   SDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFA  1050
               DEPG YRVWMPN       + PGLA+SRAFGDY +KDFGLIS P  + R+IT RDQF 
Sbjct  240   LHDEPGTYRVWMPNG------KTPGLAISRAFGDYCVKDFGLISVPAVSQRHITSRDQFV  293

Query  1051  ILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             ILATDGVWDV+SN+EAV+IVSS P+R ++AKRLV  A  AWK  +RGIAMDD+SAICLFF
Sbjct  294   ILATDGVWDVISNEEAVQIVSSTPDRKKAAKRLVGCATLAWKSKKRGIAMDDISAICLFF  353

Query  1231  H  1233
             H
Sbjct  354   H  354



>ref|XP_010109579.1| putative protein phosphatase 2C 73 [Morus notabilis]
 gb|EXC23288.1| putative protein phosphatase 2C 73 [Morus notabilis]
Length=374

 Score =   419 bits (1078),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 211/364 (58%), Positives = 267/364 (73%), Gaps = 16/364 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F S+ +G  +TI+ K  R +  + VGR+ A AL+K A+K ELI ++SG V +  S N
Sbjct  1     MVLFPSILDGLVRTITIKKDRCD--DHVGRKTAEALSKVAKKKELISNSSGVVKSEKSDN  58

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              +S+ S++G+KG NQD  +VWEEFG QEDM+FCG+FDGHGPWGH+V+K VRE + +SLLC
Sbjct  59    LSSIFSKRGQKGINQDCLVVWEEFGCQEDMVFCGIFDGHGPWGHIVSKTVRESLAASLLC  118

Query  538   NWQKALAHNMDNLGF----DNCL--LDVWKQSHIKACSEVDQQLEQQA--GSFYSGTTAL  693
             NWQ+ LA    +L F    D  L   D WK+S +K  + +DQ+L+Q +   +F SGTTAL
Sbjct  119   NWQETLALTSLDLDFEMERDRNLHWFDTWKESFLKTYAAIDQELKQHSEIDTFRSGTTAL  178

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+VKQG+ +VVANVGDSRAVLAT  D G L+A+QLT+D KP+LP E ERI  SKGRV+  
Sbjct  179   TIVKQGERLVVANVGDSRAVLATTSDGGTLLALQLTIDFKPDLPQEAERITNSKGRVFCL  238

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGVYRVWMPN       + PGLA+SRAFGDY +K+FGL+S P  T RNIT RD F I
Sbjct  239   HDEPGVYRVWMPNG------KTPGLAISRAFGDYCVKEFGLVSVPYVTQRNITSRDHFVI  292

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDG+WDV+SNQEAVEIV S P++ +SA+RLV+ A  AWK  +RGIAMDD+S ICLFFH
Sbjct  293   LATDGLWDVISNQEAVEIVLSTPDKEKSARRLVQCAALAWKAKKRGIAMDDISVICLFFH  352

Query  1234  NKLI  1245
               L 
Sbjct  353   TSLF  356



>ref|XP_010524855.1| PREDICTED: probable protein phosphatase 2C 73 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010524856.1| PREDICTED: probable protein phosphatase 2C 73 isoform X2 [Tarenaya 
hassleriana]
Length=324

 Score =   417 bits (1072),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 207/326 (63%), Positives = 255/326 (78%), Gaps = 14/326 (4%)
 Frame = +1

Query  283   LAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGV  462
             +A+EA+KNELIL +SG++ A  S+  AS+ S++G+KG NQD AIVWE+FG QED+IFCG+
Sbjct  1     MAREAKKNELILRSSGYIYADGSNTLASVFSKRGEKGVNQDCAIVWEKFGCQEDIIFCGI  60

Query  463   FDGHGPWGHLVAKRVRELVPSSLLCNWQKALAHNMDN----LGFDNCL--LDVWKQSHIK  624
             FDGHGPWGH VAK VR  +PSSLLCNWQ+ LAH   N    L  D  L   ++WK+S++K
Sbjct  61    FDGHGPWGHFVAKHVRNSLPSSLLCNWQETLAHIELNTETGLESDKKLQPFNIWKRSYLK  120

Query  625   ACSEVDQQLEQQ--AGSFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQL  798
              CSEVDQ+LE Q    +FYSGTT LT+V+QG+ + VANVGDSRAVLAT   +G+LV+VQL
Sbjct  121   TCSEVDQELENQRKIDTFYSGTTGLTIVRQGEDIYVANVGDSRAVLATVSAEGSLVSVQL  180

Query  799   TVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYY  978
             T+D KP+LP E ERI+RS GRV+  +DEPGV RVW+P+       E PGLA+SRAFGDY 
Sbjct  181   TIDFKPDLPQEEERIVRSNGRVFCLEDEPGVQRVWLPDE------ESPGLAMSRAFGDYC  234

Query  979   IKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEH  1158
             IK++GL+S PE T R IT RDQF ILATDGVWDV+SNQEAVEIVSS  ER ++A+RLVE 
Sbjct  235   IKEYGLVSVPEVTQRRITTRDQFVILATDGVWDVISNQEAVEIVSSVSERPKAARRLVEK  294

Query  1159  AVCAWKRTRRGIAMDDMSAICLFFHN  1236
             AV AWK+ R G AMDD+SAICLFFH+
Sbjct  295   AVKAWKKKRPGFAMDDISAICLFFHS  320



>ref|XP_008223256.1| PREDICTED: probable protein phosphatase 2C 34 [Prunus mume]
Length=366

 Score =   419 bits (1076),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 214/362 (59%), Positives = 265/362 (73%), Gaps = 16/362 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTS-GFVNAISSH  354
             MV F SL  G A+T S K   KN  EDV R+ A AL KEA+KNEL+LS+S G V +  S+
Sbjct  1     MVLFPSLLEGLARTRSLKK-MKNCHEDVARKTAEALEKEAKKNELVLSSSSGIVMSDKSN  59

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
             N +S+ S++G+KG NQD   +WEEFG QEDMIFCG+FDGHG WGH V+KRV+E +P+SLL
Sbjct  60    NFSSVCSKRGQKGINQDCLFIWEEFGCQEDMIFCGIFDGHGQWGHHVSKRVKESMPASLL  119

Query  535   CNWQKALAHNMDNLGFDNCL------LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTA  690
             CNWQ+ L     NL F+  +       D+WKQS +K  + +DQ+L+  +   S+ SG TA
Sbjct  120   CNWQETLTLASLNLDFEMEMDRNIHRFDIWKQSFLKTYAAIDQELKHSSKMDSYRSGATA  179

Query  691   LTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWS  870
              T+VKQG+ ++VANVGDSRAVLA   +DG+LV +QLTVD KPN+P E ERI RS GRV+ 
Sbjct  180   STIVKQGEHLIVANVGDSRAVLAFISEDGSLVPLQLTVDFKPNIPQEAERITRSNGRVFC  239

Query  871   SDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFA  1050
               DEPG YRVWMPN       + PGLA+SRAFGDY +KDFGLIS P  + R+IT RDQF 
Sbjct  240   LHDEPGTYRVWMPNG------KTPGLAISRAFGDYCVKDFGLISVPAVSQRHITSRDQFV  293

Query  1051  ILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             ILATDGVWDV+SN+EAV+IVSS P+R ++AKRLV  A  AWK  +RGIAMDD+SAICLFF
Sbjct  294   ILATDGVWDVISNEEAVQIVSSTPDRKKAAKRLVGCATLAWKSKKRGIAMDDISAICLFF  353

Query  1231  HN  1236
             H 
Sbjct  354   HT  355



>ref|XP_007154313.1| hypothetical protein PHAVU_003G108200g [Phaseolus vulgaris]
 gb|ESW26307.1| hypothetical protein PHAVU_003G108200g [Phaseolus vulgaris]
Length=367

 Score =   419 bits (1076),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 211/361 (58%), Positives = 263/361 (73%), Gaps = 15/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F S  NG AKT+S K   KN + + GR+AA  LAKEARKNEL+LS+SG V +  + N
Sbjct  1     MVLFPSFVNGLAKTVSIKK-EKNCKGEDGRKAAEELAKEARKNELLLSSSGVVKSTKADN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S+ + +G+KG NQDR +VWEEFG Q+D+ FCGVFDGHGPWGH VAKRV++LVP+ LLC
Sbjct  60    LVSMFTNRGRKGVNQDRLLVWEEFGCQQDITFCGVFDGHGPWGHFVAKRVKKLVPAILLC  119

Query  538   NWQKALAHNMDNLGF----DNCL--LDVWKQSHIKACSEVDQQLEQQA--GSFYSGTTAL  693
             NWQ+ LA    +L F    D  +  LD+WK S+IK  + VDQ L+QQ    SF SG+TAL
Sbjct  120   NWQENLAATSLDLDFKMEADKHIRGLDMWKHSYIKTYAAVDQDLKQQTEFDSFLSGSTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T++KQG+ ++ AN+GDSRAVLAT  +DG L   QLT D KPNLP E ERI + +G+V+S 
Sbjct  180   TIIKQGEYLITANIGDSRAVLATTSEDGILTPYQLTTDFKPNLPEEAERITQCRGQVFSL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEP VYRVW PN       + PGLA+SRAFGD+ +KDFGLIS P+ T   IT RD F I
Sbjct  240   EDEPEVYRVWKPNG------KTPGLAISRAFGDHCMKDFGLISVPDVTHTKITNRDHFVI  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAV IVS+ P + ++A+ LV+ A+  WKR R  IAMDDMSAICLFFH
Sbjct  294   LATDGVWDVISNQEAVNIVSATPHKEKAAQSLVKCAMREWKRKRSSIAMDDMSAICLFFH  353

Query  1234  N  1236
             +
Sbjct  354   S  354



>ref|XP_006297924.1| hypothetical protein CARUB_v10013967mg [Capsella rubella]
 gb|EOA30822.1| hypothetical protein CARUB_v10013967mg [Capsella rubella]
Length=375

 Score =   416 bits (1070),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 206/358 (58%), Positives = 264/358 (74%), Gaps = 16/358 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+FNG A++ S K  +  + +   +EAA+ +A+EA+K ELIL +SG +NA  S+N
Sbjct  1     MGHLSSMFNGLARSFSIKKAKSKNGQSYAKEAADEMAREAKKKELILRSSGCINADGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ SR+G+KG NQD AIVW+ FG QEDMIFCG+FDGHGPWGH V+K+VR  +P SLLC
Sbjct  61    LASVFSRRGEKGVNQDCAIVWDRFGNQEDMIFCGIFDGHGPWGHFVSKQVRNSMPISLLC  120

Query  538   NWQKALAH--------NMDNLGFDNCLLDVWKQSHIKACSEVDQQLE--QQAGSFYSGTT  687
             NW++ L+         ++D          +WK S++K C  VD++LE  ++  SF SGTT
Sbjct  121   NWKETLSQTTLAEPETDLDESDKKLQRFAIWKYSYLKTCEAVDRELEHHRKIDSFNSGTT  180

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             ALTVV+QG+V+ +ANVGDSRAVLAT  D+G+LV VQLTVD KPNLP E ERI+R  GRV+
Sbjct  181   ALTVVRQGEVIYIANVGDSRAVLATVSDEGSLVPVQLTVDFKPNLPQEEERIIRCNGRVF  240

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
                DEPGV+RVW P        E PGLA+SRAFGDY IK++GL+S PE T R+I+ RDQF
Sbjct  241   CLQDEPGVHRVWQPEE------EYPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISTRDQF  294

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAIC  1221
              ILATDGVWDV+SNQEA++IVSS  +R ++AKRLV+ AV AW R RRGIAMDD+SA+C
Sbjct  295   VILATDGVWDVISNQEAIDIVSSTADRPKAAKRLVQQAVKAWNRKRRGIAMDDISAVC  352



>ref|XP_009758950.1| PREDICTED: probable protein phosphatase 2C 34 [Nicotiana sylvestris]
 ref|XP_009758951.1| PREDICTED: probable protein phosphatase 2C 34 [Nicotiana sylvestris]
Length=356

 Score =   415 bits (1066),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 217/359 (60%), Positives = 268/359 (75%), Gaps = 12/359 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDV--GREAANALAKEARKNELILSTSGFVNAISS  351
             M  FSS+FNG A+++S K GR+NSR     G EAA ++ K A+KN+ IL +SG VN   S
Sbjct  1     MGHFSSMFNGLARSLSLKKGRENSRNGNYNGTEAAESMDKGAKKNDFILRSSGTVNVDGS  60

Query  352   HNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSL  531
              N AS+ S++G+KG NQD  IVWEEFG Q+DMIFCGVFDGHGPWGH VAK VRE +PSSL
Sbjct  61    KNFASVFSKRGEKGVNQDCVIVWEEFGCQKDMIFCGVFDGHGPWGHFVAKCVRESLPSSL  120

Query  532   LCNWQKALAHNMDNLGFDNCL--LDVWKQSHIKACSEVDQQLEQQA--GSFYSGTTALTV  699
             L N  +A   +  +L  D  L   D+WK S+ KAC+ VD +LEQ     SFYSGTT+LT+
Sbjct  121   LSNLFEASTDSDFDLDSDKLLHEFDIWKHSYTKACAAVDHELEQHPKIDSFYSGTTSLTI  180

Query  700   VKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDD  879
             V+QG+ +  ANVGDSRAVLAT  +DGNLV VQLT+D KPNLP E ERI +  GRV+  DD
Sbjct  181   VRQGEALFTANVGDSRAVLATTSEDGNLVPVQLTIDFKPNLPQEAERIKQCNGRVFCVDD  240

Query  880   EPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILA  1059
             EPGV+R+W+P        + PGLA+SRAFGDY +KDFGL S P+   R+IT +DQF +LA
Sbjct  241   EPGVHRLWLPED------QSPGLAMSRAFGDYCVKDFGLTSVPDVIERSITSKDQFVVLA  294

Query  1060  TDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             TDGVWDV+SN+EAV+IVSS PER ++AKRLV+ A CAW+R RRGIAMDD+SAI LFFH+
Sbjct  295   TDGVWDVISNEEAVQIVSSTPERAKAAKRLVQSAGCAWRRKRRGIAMDDISAIVLFFHS  353



>ref|XP_009338220.1| PREDICTED: probable protein phosphatase 2C 34 [Pyrus x bretschneideri]
 ref|XP_009338221.1| PREDICTED: probable protein phosphatase 2C 34 [Pyrus x bretschneideri]
Length=374

 Score =   415 bits (1067),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 215/363 (59%), Positives = 275/363 (76%), Gaps = 18/363 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+F+G A+++  K G+ N  +   R AA A+AKEA+KN++IL +SG VN   S+N
Sbjct  1     MGHLSSMFSGLARSLLFKKGKNNGGDSGARGAAEAMAKEAKKNDMILRSSGIVNVDGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  IVWEEFG QEDM+FCG+FDGHGPWGH VAK++RE +P SLLC
Sbjct  61    FASVFSKRGEKGVNQDCCIVWEEFGCQEDMMFCGIFDGHGPWGHFVAKQIRETMPPSLLC  120

Query  538   NWQKALAHNMDNLGFDNCL--------LDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTT  687
             +WQ+ L     ++G D+ L         ++WK S+IK C+ +D +LEQ  +  SFYSGTT
Sbjct  121   SWQETLGQT--SIGPDSDLESDKKHHRFNIWKDSYIKTCAAIDHELEQHRRIDSFYSGTT  178

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             AL++V+QG+++ +ANVGDSRAVLAT  DDG+L+ VQLTVD KP+LP E ERI++S G+V+
Sbjct  179   ALSIVRQGELIFIANVGDSRAVLATTLDDGSLMPVQLTVDFKPSLPQEAERIIQSNGQVF  238

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
               DDEPGV RVW P+       E PGLA+SRAFGDY +KDFGLIS PE + RNIT +DQF
Sbjct  239   CLDDEPGVQRVWQPDG------ETPGLAMSRAFGDYCLKDFGLISVPEVSHRNITRKDQF  292

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              +LATDGVWDVVSNQEAV+IV S  +R ++AKRLVE A  AWKR RRGIAMDD+SAICLF
Sbjct  293   VVLATDGVWDVVSNQEAVQIVGSTADRAKAAKRLVECAAQAWKRKRRGIAMDDISAICLF  352

Query  1228  FHN  1236
             FH+
Sbjct  353   FHS  355



>emb|CDY05554.1| BnaA02g31370D [Brassica napus]
Length=368

 Score =   413 bits (1062),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 206/362 (57%), Positives = 265/362 (73%), Gaps = 23/362 (6%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+F+G A++ S K  + N+     ++AA+ +       E+IL + G+V A  S+N
Sbjct  1     MGHFSSMFSGLARSFSIKKVKNNNGTCDAKQAADEM-------EMILKSCGYVYAEGSNN  53

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD AIVWE FG QEDMIFCG+FDGHGPWGH VAK VR  +PSSLLC
Sbjct  54    SASVFSKRGQKGVNQDCAIVWEGFGCQEDMIFCGIFDGHGPWGHYVAKHVRNSMPSSLLC  113

Query  538   NWQKALAHN------MDNLGFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTT  687
             NWQK LA        +D  G +      D+WK S++K C+ VDQ+LE  ++  S+ SGTT
Sbjct  114   NWQKTLAQTALLEPELDLEGSNKKFSRFDIWKHSYLKTCASVDQELEHHRKIDSYNSGTT  173

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             A+T+V+QGDV+ V+NVGDSRAVLAT  D+G+LVAVQLT+D KPNLP E+ERI+   GRV+
Sbjct  174   AITIVRQGDVIYVSNVGDSRAVLATTSDEGSLVAVQLTLDFKPNLPQEKERIIGCNGRVF  233

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
                DEPGV+RVW P+       E PGLA+SRAFGDY IK++GL+S PE T R+I+ +D F
Sbjct  234   CMKDEPGVHRVWQPD------TEAPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISAKDHF  287

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              ILA+DG+WDV++NQEA+EIVSS  ER ++AKRLVE AV AWK+ RRGIAMDDMS +CLF
Sbjct  288   IILASDGIWDVITNQEAIEIVSSTAERPKAAKRLVEQAVRAWKKKRRGIAMDDMSVVCLF  347

Query  1228  FH  1233
              H
Sbjct  348   LH  349



>ref|XP_010464096.1| PREDICTED: probable protein phosphatase 2C 34 isoform X2 [Camelina 
sativa]
Length=374

 Score =   413 bits (1061),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 209/358 (58%), Positives = 265/358 (74%), Gaps = 16/358 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+FNG A++ S K  +  + +   +EAA+ +A+EA+K +LIL +SG +NA  S+N
Sbjct  1     MGHLSSMFNGLARSFSIKKAKNKNGKSYAKEAADEMAREAKKKDLILRSSGCINADGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ SR+G+KG NQD AIVWE FG QEDMIFCG+FDGHGPWGH V+K+VR  +P SLLC
Sbjct  61    LASVFSRRGEKGVNQDCAIVWEGFGCQEDMIFCGIFDGHGPWGHFVSKQVRNSMPISLLC  120

Query  538   NW-----QKALAHNMDNLGFDNCLLD---VWKQSHIKACSEVDQQLE--QQAGSFYSGTT  687
             NW     Q ALA    +L   +  L    +WK +++K C  VD++LE  ++  SF SGTT
Sbjct  121   NWKETLSQTALAEPEADLDESDKKLQRFAIWKYAYLKTCEAVDRELEHHRKIDSFNSGTT  180

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             ALTVV+QG+V+ +ANVGDSRAVLAT  D+G+LVAVQLTVD KPNLP E ERI+   GRV+
Sbjct  181   ALTVVRQGEVIYIANVGDSRAVLATVSDEGSLVAVQLTVDFKPNLPQEEERIIGCNGRVF  240

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
                DEPGV+RVW P        E PGLA+SRAFGDY IK++GL+S PE T R+I+ RDQF
Sbjct  241   CLQDEPGVHRVWQPEE------EYPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISIRDQF  294

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAIC  1221
              ILATDGVWDV+SNQEA++IVSS  +R ++AKRLV+ AV AW R RRGIAMDD+SA+C
Sbjct  295   VILATDGVWDVISNQEAIDIVSSTADRPKAAKRLVQQAVKAWNRKRRGIAMDDISAVC  352



>ref|XP_010430361.1| PREDICTED: probable protein phosphatase 2C 34 [Camelina sativa]
 ref|XP_010430434.1| PREDICTED: probable protein phosphatase 2C 34 [Camelina sativa]
Length=374

 Score =   412 bits (1059),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 206/358 (58%), Positives = 262/358 (73%), Gaps = 16/358 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+FN  A++ S K  +  + +   +EAA+ +A+EA+K ELIL +SG +NA  S+N
Sbjct  1     MGHLSSMFNALARSFSIKKAKNKNGKSYAKEAADEMAQEAKKKELILRSSGCINADGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ SR+G+KG NQD AIVWE FG QEDMIFCG+FDGHGPWGH V+K+VR  +P SLLC
Sbjct  61    LASVFSRRGEKGVNQDCAIVWEGFGSQEDMIFCGIFDGHGPWGHFVSKQVRNSMPISLLC  120

Query  538   NWQKALAH--------NMDNLGFDNCLLDVWKQSHIKACSEVDQQLE--QQAGSFYSGTT  687
             NW++ L+         ++D          +WK S++K C  VD++LE  ++  SF SGTT
Sbjct  121   NWKETLSQTTLAEPETDLDESDKKLQRFAIWKYSYLKTCEAVDRELEHHRKIDSFNSGTT  180

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             ALTVV+QG+V+ +ANVGDSRAVLAT  D+G+LVAVQLTVD KPNLP E ERI+   GRV+
Sbjct  181   ALTVVRQGEVIYIANVGDSRAVLATVSDEGSLVAVQLTVDFKPNLPQEEERIIGCNGRVF  240

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
                DEPGV+RVW P        E PGLA+SRAFGDY IK+ GL+S PE T R+I+ RDQF
Sbjct  241   CLQDEPGVHRVWQPEE------EYPGLAMSRAFGDYCIKEHGLVSVPEVTQRHISIRDQF  294

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAIC  1221
              ILATDGVWDV+SNQEA++IVSS  +R ++AKRLV+ AV AW R RRGIAMDD+SA+C
Sbjct  295   VILATDGVWDVISNQEAIDIVSSTADRPKAAKRLVQQAVKAWNRKRRGIAMDDISAVC  352



>ref|XP_010938350.1| PREDICTED: probable protein phosphatase 2C 73 isoform X2 [Elaeis 
guineensis]
Length=340

 Score =   410 bits (1055),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 211/342 (62%), Positives = 260/342 (76%), Gaps = 13/342 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   S LFNG AK++    G K S  D GREAA+ LA+EA+KN++IL +SG V    S++
Sbjct  1     MRHLSLLFNGLAKSLYSGRG-KLSGIDCGREAADELAREAKKNDMILKSSGTVRCEGSNS  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S+ S++G+KG NQD +IVWEEFG QEDMIFCG+FDGHGPWGH VAK VR+ +P SLLC
Sbjct  60    FVSVFSQRGEKGVNQDCSIVWEEFGCQEDMIFCGIFDGHGPWGHYVAKAVRKSLPPSLLC  119

Query  538   NWQKALAHNMDNLGFDN--CLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTALTVVK  705
             NWQ+ALA  +  L  D   C  D+WKQS++  C+ VDQ+LE+  +  SF+SGTTALT++K
Sbjct  120   NWQEALA--LAALVGDKKLCQFDIWKQSYLSTCAAVDQELEKHRRLDSFHSGTTALTIIK  177

Query  706   QGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEP  885
             QG++MV+ANVGDSRAVLAT  +DG+LV VQLT+D KPNLP E ERI R KGRV+   DEP
Sbjct  178   QGELMVIANVGDSRAVLATTAEDGSLVPVQLTIDFKPNLPQEAERITRCKGRVFCLHDEP  237

Query  886   GVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATD  1065
             GV+RVW+PN       E  GLA+SRAFGDY +KD+GLIS PE T R I  RD+F +LATD
Sbjct  238   GVHRVWLPNG------ETAGLAMSRAFGDYCLKDYGLISVPEVTQRKIINRDRFIVLATD  291

Query  1066  GVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRG  1191
             GVWDV+SN+EAV+IVSS  ERG+SAKRLV+ AV AWKR RRG
Sbjct  292   GVWDVISNEEAVQIVSSTKERGKSAKRLVKCAVRAWKRKRRG  333



>ref|XP_010464095.1| PREDICTED: probable protein phosphatase 2C 34 isoform X1 [Camelina 
sativa]
Length=429

 Score =   414 bits (1063),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 210/360 (58%), Positives = 267/360 (74%), Gaps = 16/360 (4%)
 Frame = +1

Query  172   EKMVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISS  351
             +KM   SS+FNG A++ S K  +  + +   +EAA+ +A+EA+K +LIL +SG +NA  S
Sbjct  54    KKMGHLSSMFNGLARSFSIKKAKNKNGKSYAKEAADEMAREAKKKDLILRSSGCINADGS  113

Query  352   HNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSL  531
             +N AS+ SR+G+KG NQD AIVWE FG QEDMIFCG+FDGHGPWGH V+K+VR  +P SL
Sbjct  114   NNLASVFSRRGEKGVNQDCAIVWEGFGCQEDMIFCGIFDGHGPWGHFVSKQVRNSMPISL  173

Query  532   LCNW-----QKALAHNMDNLGFDNCLLD---VWKQSHIKACSEVDQQLE--QQAGSFYSG  681
             LCNW     Q ALA    +L   +  L    +WK +++K C  VD++LE  ++  SF SG
Sbjct  174   LCNWKETLSQTALAEPEADLDESDKKLQRFAIWKYAYLKTCEAVDRELEHHRKIDSFNSG  233

Query  682   TTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGR  861
             TTALTVV+QG+V+ +ANVGDSRAVLAT  D+G+LVAVQLTVD KPNLP E ERI+   GR
Sbjct  234   TTALTVVRQGEVIYIANVGDSRAVLATVSDEGSLVAVQLTVDFKPNLPQEEERIIGCNGR  293

Query  862   VWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRD  1041
             V+   DEPGV+RVW P        E PGLA+SRAFGDY IK++GL+S PE T R+I+ RD
Sbjct  294   VFCLQDEPGVHRVWQPEE------EYPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISIRD  347

Query  1042  QFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAIC  1221
             QF ILATDGVWDV+SNQEA++IVSS  +R ++AKRLV+ AV AW R RRGIAMDD+SA+C
Sbjct  348   QFVILATDGVWDVISNQEAIDIVSSTADRPKAAKRLVQQAVKAWNRKRRGIAMDDISAVC  407



>ref|XP_004302264.1| PREDICTED: probable protein phosphatase 2C 34-like [Fragaria 
vesca subsp. vesca]
Length=376

 Score =   412 bits (1058),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 215/362 (59%), Positives = 271/362 (75%), Gaps = 20/362 (6%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVG-REAANALAKEARKNELILSTSGFVNAISSH  354
             M   SS+F+G A+++S K G+ +S      REAA A+AKEA++N+LIL TSG VN   S+
Sbjct  1     MGHLSSMFSGLARSLSLKKGKNSSGCKCNVREAAEAMAKEAKRNDLILRTSGTVNVDGSN  60

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
             N AS+ S++G+KG NQD  IVWEEFG Q+DM+FCG+FDGHG WGH VAKR+RE +P SLL
Sbjct  61    NLASVFSKRGQKGVNQDCCIVWEEFGCQQDMMFCGIFDGHGQWGHFVAKRIRETMPPSLL  120

Query  535   CNWQK------ALAHNMDNLGFD-----NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFY  675
             CNWQ+      +L  ++  L  +     +   ++WK S+IK C+ VDQ+LEQ  +  SFY
Sbjct  121   CNWQETLLAQTSLDPDLKELELESDKKYDQRFNIWKHSYIKTCAAVDQELEQDRKINSFY  180

Query  676   SGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSK  855
             SG+T LT+V+QGD++V++NVGDSRAVL T  +DG+LVAVQLTVD KPNLP E ERI +  
Sbjct  181   SGSTGLTIVRQGDLIVISNVGDSRAVLGTTLEDGSLVAVQLTVDFKPNLPEEAERITQRN  240

Query  856   GRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITF  1035
             GRV+S DDE GVYR+W+P        E PGLA+SRA+GDY +KDFGLISEPE T RNIT 
Sbjct  241   GRVFSLDDETGVYRLWLPYE------ESPGLAMSRAYGDYCVKDFGLISEPEVTHRNITS  294

Query  1036  RDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSA  1215
             RDQF +LATDGVWDV+SN+EAVEIV S  ER + AKRLVE+A  AWK+ RRG AMDD+SA
Sbjct  295   RDQFVVLATDGVWDVISNEEAVEIVGSTAEREKCAKRLVEYAAAAWKKKRRGYAMDDISA  354

Query  1216  IC  1221
             IC
Sbjct  355   IC  356



>ref|XP_007144971.1| hypothetical protein PHAVU_007G198700g [Phaseolus vulgaris]
 gb|ESW16965.1| hypothetical protein PHAVU_007G198700g [Phaseolus vulgaris]
Length=368

 Score =   410 bits (1055),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 215/363 (59%), Positives = 275/363 (76%), Gaps = 17/363 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS F+  AK+ + K G  +   + GREAA A+AKEA+KN  IL +SG +N   S+N
Sbjct  1     MGHFSSAFSRLAKSFATKKGGSSDGCN-GREAAEAMAKEAKKNHFILHSSGTINVDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  +VWEEFG QEDMIFCG+FDGHGPWGH VAKRVRE +P SLLC
Sbjct  60    FASVFSKKGQKGVNQDCCVVWEEFGCQEDMIFCGIFDGHGPWGHFVAKRVRESMPPSLLC  119

Query  538   NWQKALAHNMDNLGFDNCL--------LDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTT  687
             NWQ+ L+    +   D  +         ++WK S++K C+ +D++L+Q  +  SF+SGTT
Sbjct  120   NWQETLSQTSLDPDVDVDIETEKKQHRFNIWKHSYLKTCAAIDRELKQNRKIDSFFSGTT  179

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             AL++V+QG+++V+ANVGDSRAVLATA DDG+LVAVQLTVD KP+L  E ERI+  +GRV+
Sbjct  180   ALSIVRQGELIVIANVGDSRAVLATASDDGSLVAVQLTVDFKPSLRQEEERILECQGRVF  239

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
               +DEPGV+RVW+P+       E PGLA+SRAFGDY IK++GLIS PE T RNI+ +DQF
Sbjct  240   CLEDEPGVHRVWLPDE------ESPGLAMSRAFGDYCIKEYGLISVPEVTQRNISSKDQF  293

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              +LATDGVWDV+SNQEAV+IV S  +R ESAK LVE A+ AWKR RRGIAMDD+SAICLF
Sbjct  294   VVLATDGVWDVISNQEAVDIVCSTADRTESAKHLVECAMRAWKRKRRGIAMDDISAICLF  353

Query  1228  FHN  1236
             FH+
Sbjct  354   FHS  356



>gb|KEH37184.1| catalytic/protein phosphatase type 2C [Medicago truncatula]
Length=362

 Score =   410 bits (1054),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 203/361 (56%), Positives = 261/361 (72%), Gaps = 14/361 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV   SL N  ++T+S    +   ++D  R+   A+AKEA+KNE++LS+SG V +  S+N
Sbjct  1     MVSIPSLVNFISRTMSSNKDKSYGKDDDARKVVEAMAKEAKKNEMLLSSSGIVKSDKSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              + + +++G+KG NQD  IVWEEFG QED+I CGVFDGHGPWGH V+KRVR+++P  LL 
Sbjct  61    FSCVFTKKGQKGFNQDCLIVWEEFGCQEDIILCGVFDGHGPWGHFVSKRVRKMLPKFLLF  120

Query  538   NWQKALAHNMDNLGF----DNCL--LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTAL  693
             NWQ+ LA    +L F    D  L   D+WKQS+IK  + +DQ L++  G  SF SGTTAL
Sbjct  121   NWQENLAEKSLDLSFKMETDMNLHEYDIWKQSYIKTFAAIDQDLKRHTGIDSFQSGTTAL  180

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             TV+KQG+ +++ANVGDSRAVLAT  ++G L  +QLT DLKPNLP E ERIM S GRV+  
Sbjct  181   TVIKQGEYLIIANVGDSRAVLATTSENGTLTPIQLTTDLKPNLPNEAERIMESNGRVFCM  240

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGVYRVWMPN       + PGLA+SRAFGDY +KDFGLIS P+ T R +T  DQF I
Sbjct  241   EDEPGVYRVWMPNG------KSPGLAISRAFGDYCVKDFGLISVPDVTQRKLTTMDQFVI  294

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQ AV+IV+S P R ++A RLV+ A   W   R+GIA+DD+S ICLFFH
Sbjct  295   LATDGVWDVISNQVAVKIVASTPNREKAADRLVKCARHEWISKRKGIAIDDISVICLFFH  354

Query  1234  N  1236
             +
Sbjct  355   S  355



>dbj|BAB84697.1| protein phosphatase 2C [Arabidopsis thaliana]
Length=337

 Score =   408 bits (1048),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 200/323 (62%), Positives = 251/323 (78%), Gaps = 15/323 (5%)
 Frame = +1

Query  286   AKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVF  465
             A EA+K ELIL +SG+VN   S+N ASL S++G+KG NQD A+VWE FG QEDMIFCG+F
Sbjct  1     ASEAKKKELILKSSGYVNVQGSNNLASLFSKRGEKGVNQDCALVWEGFGCQEDMIFCGIF  60

Query  466   DGHGPWGHLVAKRVRELVPSSLLCNWQKALAH-----NMDNLGFDNCL--LDVWKQSHIK  624
             DGHGPWGH VAK+VR  +P SLLCNWQK LA       +D  G +  +   D+WKQS++K
Sbjct  61    DGHGPWGHYVAKQVRNSMPLSLLCNWQKILAQATLEPELDLEGSNKKISRFDIWKQSYLK  120

Query  625   ACSEVDQQLE--QQAGSFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQL  798
              C+ VDQ+LE  ++  S+YSGTTALT+V+QG+V+ VANVGDSRAVLA   D+G+LVAVQL
Sbjct  121   TCATVDQELEHHRKIDSYYSGTTALTIVRQGEVIYVANVGDSRAVLAMESDEGSLVAVQL  180

Query  799   TVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYY  978
             T+D KPNLP E+ERI+  KGRV+  +DEPGV+RVW P+       E PGLA+SRAFGDY 
Sbjct  181   TLDFKPNLPQEKERIIGCKGRVFCLNDEPGVHRVWQPD------AETPGLAMSRAFGDYC  234

Query  979   IKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEH  1158
             IK++GL+S PE T R+I+ +D F ILA+DG+WDV+SNQEA+EIVSS  ER ++AKRLVE 
Sbjct  235   IKEYGLVSVPEVTQRHISTKDHFIILASDGIWDVISNQEAIEIVSSTAERPKAAKRLVEQ  294

Query  1159  AVCAWKRTRRGIAMDDMSAICLF  1227
             AV AWK+ RRG +MDDMS +CLF
Sbjct  295   AVRAWKKKRRGYSMDDMSVVCLF  317



>ref|XP_006408045.1| hypothetical protein EUTSA_v10020968mg [Eutrema salsugineum]
 gb|ESQ49498.1| hypothetical protein EUTSA_v10020968mg [Eutrema salsugineum]
Length=371

 Score =   408 bits (1049),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 208/358 (58%), Positives = 264/358 (74%), Gaps = 16/358 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S K  +KN+ +   +EA   +A+EA+K ELIL +SG +NA  S+N
Sbjct  1     MGHFSSMFNGLARSFSIKKAKKNNSKSDVKEAVEEMAREAKKKELILKSSGCINADGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD AIVWE FG +EDMIFCG+FDGHGPWGH VAK+VR  +P +LLC
Sbjct  61    LASVFSKRGEKGVNQDCAIVWEGFGFEEDMIFCGIFDGHGPWGHFVAKQVRNSMPITLLC  120

Query  538   NWQKALAHNM---DNLGFDNC-----LLDVWKQSHIKACSEVDQQLE--QQAGSFYSGTT  687
             NWQ+ L+         G D          VWK  ++K C++VDQ+LE  ++  SF SGTT
Sbjct  121   NWQETLSQTTLAEPKTGLDESDKTLQRFAVWKYLYLKTCADVDQELEHHRKIDSFNSGTT  180

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             ALTVV+QG+V+ VANVGDSRAVLAT  +DG+L A+QLTVD KPN+P E ERI+   GRV+
Sbjct  181   ALTVVRQGEVIYVANVGDSRAVLATVSEDGSLTAIQLTVDFKPNIPQEEERIIGCNGRVF  240

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
                DEPGV+RVW P        E PGLA+SRAFGDY IK++GL+S PE T R+I+ RDQF
Sbjct  241   CLQDEPGVHRVWQPEE------ESPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISIRDQF  294

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAIC  1221
              I+ATDGVWDV++NQEA++IVSS  ER ++AKRLVE AV AW R RRGIAMDD+SA+C
Sbjct  295   VIMATDGVWDVITNQEAIDIVSSTAERSKAAKRLVEQAVRAWNRKRRGIAMDDISAVC  352



>gb|EYU43985.1| hypothetical protein MIMGU_mgv1a021301mg [Erythranthe guttata]
Length=350

 Score =   404 bits (1037),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 216/369 (59%), Positives = 267/369 (72%), Gaps = 38/369 (10%)
 Frame = +1

Query  178   MVQF-SSLFNGFAKTISKKSGRKNSREDVGREAANALAKEA-RKNELILSTSG----FVN  339
             MVQ+ SSLFN    T+SKK+                LAKE+ R N+L+L++S      +N
Sbjct  1     MVQYLSSLFN----TLSKKN--------------RILAKESKRNNQLMLTSSSDAVIMIN  42

Query  340   AISSHNCASLHSRQGKKGAN-QDRAIVWEEFGGQ-EDMIFCGVFDGHGPWGHLVAKRVRE  513
               +  N A+ +S++GKKG N QD  I+ EEFG + +D +FCGVFDGHG WGHLV+K VR+
Sbjct  43    PDNRKNYAAGYSKRGKKGINNQDCFIISEEFGCRDQDTVFCGVFDGHGQWGHLVSKTVRK  102

Query  514   LVPSSLLCNWQKALAHNMDNLGFD-------NCLLDVWKQSHIKACSEVDQQLEQ--QAG  666
              +PS+LLCNWQ+ +A N  +L +        N   D+WKQSH K C++VDQ+L+Q  +  
Sbjct  103   SMPSTLLCNWQENVALNAHDLDYGLGQENRGNIQFDMWKQSHYKTCADVDQELKQNPRID  162

Query  667   SFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIM  846
             SFYSG T LT+++QGD+M++ANVGDSRAVLAT  D+GNLVA+QL+ D KPNLP E +RI 
Sbjct  163   SFYSGCTGLTLIRQGDLMIIANVGDSRAVLATTSDNGNLVAIQLSTDFKPNLPHESKRIA  222

Query  847   RSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRN  1026
              S+GRV+S  DE GV+R+WMP    G  V+GPGLA+SRAFGDYYIKDFGLISEPE T RN
Sbjct  223   ESRGRVYSCPDEVGVHRLWMPR---GDTVKGPGLALSRAFGDYYIKDFGLISEPEITQRN  279

Query  1027  ITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDD  1206
             IT  DQFAILATDGVWDVV+NQEAVEIV S   R ESAKRLVE AVCAWKR  R   MDD
Sbjct  280   ITSTDQFAILATDGVWDVVTNQEAVEIVGSTRGRAESAKRLVEFAVCAWKRKGRSAVMDD  339

Query  1207  MSAICLFFH  1233
             +SA+CLFFH
Sbjct  340   ISAVCLFFH  348



>ref|XP_008351175.1| PREDICTED: probable protein phosphatase 2C 34 [Malus domestica]
 ref|XP_008367138.1| PREDICTED: probable protein phosphatase 2C 34 [Malus domestica]
Length=374

 Score =   404 bits (1038),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 210/360 (58%), Positives = 260/360 (72%), Gaps = 15/360 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F SL  G  +T S K   KN   DV R+ A AL KEA+KNE + S+SG V +  S+ 
Sbjct  1     MVLFPSLLEGLGRTKSGKK-TKNCPSDVARKTAKALEKEAKKNERVSSSSGMVMSERSNT  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              +S+ S++G+KG NQD   +W+EFG QEDMIFCG+FDGHG WGHLV+KRVRE +P+SLLC
Sbjct  60    LSSVCSKRGRKGINQDCLTIWKEFGCQEDMIFCGIFDGHGQWGHLVSKRVRESLPASLLC  119

Query  538   NWQKALAHNMDNLGFDNCL------LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTAL  693
             NWQ+ L     +L F+  +       D+WKQS +K  + +D +L+  +   S++SGTTAL
Sbjct  120   NWQETLTSTSLDLDFEXEMDRNLHGFDMWKQSFLKTYAAIDTELKHSSKLDSYWSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+VKQG+ ++VAN+GDSRAVLA+  +DG+L A+QLTVD KPNLP E ERI  S GRV+  
Sbjct  180   TIVKQGENLIVANIGDSRAVLASVSEDGSLAALQLTVDFKPNLPQEAERINSSNGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEP  YRVWMPN       + PGLA+SRAFGDY +KDFGLIS P+ T R IT  DQF I
Sbjct  240   QDEPRTYRVWMPNG------KTPGLAISRAFGDYCVKDFGLISMPDVTQRRITSSDQFVI  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAVEIVSS P+R + AKRLV  A  AWK  +RGIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVISNQEAVEIVSSCPDRKKXAKRLVGCASLAWKTKKRGIAMDDISAICLFFH  353



>ref|XP_009369998.1| PREDICTED: probable protein phosphatase 2C 34 [Pyrus x bretschneideri]
Length=374

 Score =   404 bits (1037),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 209/360 (58%), Positives = 262/360 (73%), Gaps = 15/360 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F SL  G+ +T S K   KN   DV R+ A A  KEA+KNE + S+SG V +  S+ 
Sbjct  1     MVLFPSLLEGWGRTKSGKK-TKNCPSDVARKTAKAWEKEAKKNERVSSSSGVVMSERSNT  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              +S+ S++G+KG NQD   +W+EFG QEDMIFCG+FDGHG WGHLV+KRVRE +P+SLLC
Sbjct  60    LSSVCSKRGRKGINQDCLTIWKEFGCQEDMIFCGIFDGHGQWGHLVSKRVRESLPASLLC  119

Query  538   NWQKALAHNMDNLGFDNCL------LDVWKQSHIKACSEVDQQLEQQA--GSFYSGTTAL  693
             NWQ+ L     +  F+  +       D+WKQS +K  + +D++L+  +   S++SG TAL
Sbjct  120   NWQETLTSTSLDPDFEMEMDRNLHGFDMWKQSFLKTYAAIDKELKHSSKLNSYWSGATAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T++KQG+ +VVAN+GDSRAVLA+  DDG+L A+QLTVD KPNLP E ERI RS GRV+  
Sbjct  180   TIIKQGENLVVANIGDSRAVLASVSDDGSLAALQLTVDFKPNLPQEAERINRSNGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPG YRVWMPN       + PGLA+SRAFGDY +KDFGLIS P+ T R IT  DQF I
Sbjct  240   QDEPGTYRVWMPNG------KTPGLAISRAFGDYCVKDFGLISMPDVTQRRITSSDQFVI  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAV+IVSS P+R ++AKRLV  A  AWK  +RGIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVISNQEAVKIVSSCPDRKKTAKRLVGCAALAWKTKKRGIAMDDISAICLFFH  353



>ref|XP_008390615.1| PREDICTED: probable protein phosphatase 2C 34 [Malus domestica]
Length=374

 Score =   404 bits (1037),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 210/360 (58%), Positives = 260/360 (72%), Gaps = 15/360 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F SL  G  +T S K   KN   DV R+ A AL KEA+KNE + S+SG V +  S+ 
Sbjct  1     MVLFPSLLEGLGRTKSGKK-TKNCPSDVARKTAKALEKEAKKNERVSSSSGMVMSERSNT  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              +S+ S++G+KG NQD   +W+EFG QEDMIFCG+FDGHG WGHLV+KRVRE +P+SLLC
Sbjct  60    LSSVCSKRGRKGINQDCLTIWKEFGCQEDMIFCGIFDGHGQWGHLVSKRVRESLPASLLC  119

Query  538   NWQKALAHNMDNLGFDNCL------LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTAL  693
             NWQ+ L     +L F+  +       D+WKQS +K  + +D +L+  +   S++SGTTAL
Sbjct  120   NWQETLTSTSLDLDFEXEMDRNLHGFDMWKQSFLKTYAAIDTELKHSSKLDSYWSGTTAL  179

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+VKQG+ ++VAN+GDSRAVLA+  +DG+L A+QLTVD KPNLP E ERI  S GRV+  
Sbjct  180   TIVKQGENLIVANIGDSRAVLASVSEDGSLAALQLTVDFKPNLPQEAERINSSNGRVFCL  239

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEP  YRVWMPN       + PGLA+SRAFGDY +KDFGLIS P+ T R IT  DQF I
Sbjct  240   QDEPRTYRVWMPNG------KTPGLAISRAFGDYCVKDFGLISMPDVTQRRITSSDQFVI  293

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SNQEAVEIVSS P+R + AKRLV  A  AWK  +RGIAMDD+SAICLFFH
Sbjct  294   LATDGVWDVISNQEAVEIVSSCPDRKKRAKRLVGCASLAWKTKKRGIAMDDISAICLFFH  353



>ref|XP_010938349.1| PREDICTED: probable protein phosphatase 2C 73 isoform X1 [Elaeis 
guineensis]
Length=352

 Score =   402 bits (1032),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 211/354 (60%), Positives = 260/354 (73%), Gaps = 25/354 (7%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   S LFNG AK++    G K S  D GREAA+ LA+EA+KN++IL +SG V    S++
Sbjct  1     MRHLSLLFNGLAKSLYSGRG-KLSGIDCGREAADELAREAKKNDMILKSSGTVRCEGSNS  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S+ S++G+KG NQD +IVWEEFG QEDMIFCG+FDGHGPWGH VAK VR+ +P SLLC
Sbjct  60    FVSVFSQRGEKGVNQDCSIVWEEFGCQEDMIFCGIFDGHGPWGHYVAKAVRKSLPPSLLC  119

Query  538   NWQKALAHNMDNLGFDN--CLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTALTVVK  705
             NWQ+ALA  +  L  D   C  D+WKQS++  C+ VDQ+LE+  +  SF+SGTTALT++K
Sbjct  120   NWQEALA--LAALVGDKKLCQFDIWKQSYLSTCAAVDQELEKHRRLDSFHSGTTALTIIK  177

Query  706   ------------QGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMR  849
                         QG++MV+ANVGDSRAVLAT  +DG+LV VQLT+D KPNLP E ERI R
Sbjct  178   QVITNFIYMHVTQGELMVIANVGDSRAVLATTAEDGSLVPVQLTIDFKPNLPQEAERITR  237

Query  850   SKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNI  1029
              KGRV+   DEPGV+RVW+PN       E  GLA+SRAFGDY +KD+GLIS PE T R I
Sbjct  238   CKGRVFCLHDEPGVHRVWLPNG------ETAGLAMSRAFGDYCLKDYGLISVPEVTQRKI  291

Query  1030  TFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRG  1191
               RD+F +LATDGVWDV+SN+EAV+IVSS  ERG+SAKRLV+ AV AWKR RRG
Sbjct  292   INRDRFIVLATDGVWDVISNEEAVQIVSSTKERGKSAKRLVKCAVRAWKRKRRG  345



>gb|AGV54512.1| protein phosphatase 2C 73-like protein [Phaseolus vulgaris]
Length=368

 Score =   401 bits (1030),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 210/362 (58%), Positives = 271/362 (75%), Gaps = 17/362 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS F+  AK+ + K G  +   + GREAA A+AKEA+KN  IL +SG +N   S+N
Sbjct  1     MGHFSSAFSRLAKSFATKKGGSSDGCN-GREAAEAMAKEAKKNHFILHSSGTINVDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  +VWEEFG QEDMIFCG+FDGHGPWGH VAK+VR+ +P SLLC
Sbjct  60    FASVFSKKGQKGVNQDCCVVWEEFGCQEDMIFCGIFDGHGPWGHFVAKKVRKSMPPSLLC  119

Query  538   NWQKALAHNMDNLGFDNCL--------LDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTT  687
             NWQ+ L+    +   D  +         ++WK S++K C+ +D++L+Q  +  SF+SGTT
Sbjct  120   NWQETLSQTPLDPDVDVDIETEKKQHPFNIWKHSYLKTCAAIDRELKQNRKIDSFFSGTT  179

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             AL++V+QG+++V+ANVGDSRAVLATA DDG+LVAVQLTVD KP+L  E ERI+  +GRV+
Sbjct  180   ALSIVRQGELIVIANVGDSRAVLATASDDGSLVAVQLTVDFKPSLRQEEERILECQGRVF  239

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
               +DEPGV+RVW+P+       E PGLA+SRAFGDY IK++G IS PE T RNI+ +DQF
Sbjct  240   CLEDEPGVHRVWLPDE------ESPGLAMSRAFGDYCIKEYGFISVPEVTQRNISSKDQF  293

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              +LATDGVWDV+SNQEAV+IV S  +R E AK LVE A+ AWKR RRGIAMDD+SAIC F
Sbjct  294   VVLATDGVWDVISNQEAVDIVCSTADRTEFAKHLVECAMRAWKRKRRGIAMDDISAICFF  353

Query  1228  FH  1233
             FH
Sbjct  354   FH  355



>ref|XP_010670936.1| PREDICTED: probable protein phosphatase 2C 34 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670937.1| PREDICTED: probable protein phosphatase 2C 34 [Beta vulgaris 
subsp. vulgaris]
Length=370

 Score =   401 bits (1030),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 212/366 (58%), Positives = 261/366 (71%), Gaps = 20/366 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MVQFSSLF G A+ +S K+  ++ + D  REAA++LA EARKN LI+   G   A  S+ 
Sbjct  1     MVQFSSLFEGLARGVSSKA--RSIKNDKEREAADSLADEARKNHLIVRCPGAKTA-RSNA  57

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD   VWEEFG Q+DM FCG+FDGHGP GH VAK V + +PS LL 
Sbjct  58    TASVFSKKGEKGINQDCLTVWEEFGCQQDMTFCGIFDGHGPLGHFVAKCVNKSLPSLLLR  117

Query  538   NWQKALAHNMDNLGFDNCL---------LDVWKQSHIKACSEVDQQLEQ--QAGSFYSGT  684
             NWQ  LA +      D  L           +WKQ++++ CS +DQ+LE+  +  SF SGT
Sbjct  118   NWQDFLAVHSLEFDLDAELNHLTKKARDFSIWKQAYLRTCSVIDQELERHPRVDSFDSGT  177

Query  685   TALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRV  864
             TAL +V+QG+ + VANVGDSRAVLAT  + G LV VQLTVD KPNLP E ERI  S+G V
Sbjct  178   TALAIVRQGETLTVANVGDSRAVLATMGESGKLVPVQLTVDFKPNLPQEAERIGLSRGLV  237

Query  865   WSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQ  1044
               S DEPGVYR+W PN         PGLA+SRAFGD+ +KDFGLISEPE T R+IT RDQ
Sbjct  238   SCSHDEPGVYRLWQPNKGT------PGLALSRAFGDHCMKDFGLISEPEVTERHITNRDQ  291

Query  1045  FAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICL  1224
             FAILATDGVWDV+SN+EAV+IVSSAP R +SAKRLV++A  AWK  R G+AMDD+SAIC+
Sbjct  292   FAILATDGVWDVLSNEEAVQIVSSAPTREKSAKRLVKYAAHAWKSKRPGVAMDDISAICM  351

Query  1225  FFHNKL  1242
             +FH  L
Sbjct  352   YFHGSL  357



>gb|KEH37182.1| catalytic/protein phosphatase type 2C [Medicago truncatula]
Length=348

 Score =   399 bits (1026),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 197/347 (57%), Positives = 253/347 (73%), Gaps = 14/347 (4%)
 Frame = +1

Query  220   ISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGAN  399
             +S    +   ++D  R+   A+AKEA+KNE++LS+SG V +  S+N + + +++G+KG N
Sbjct  1     MSSNKDKSYGKDDDARKVVEAMAKEAKKNEMLLSSSGIVKSDKSNNFSCVFTKKGQKGFN  60

Query  400   QDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKALAHNMDNLG  579
             QD  IVWEEFG QED+I CGVFDGHGPWGH V+KRVR+++P  LL NWQ+ LA    +L 
Sbjct  61    QDCLIVWEEFGCQEDIILCGVFDGHGPWGHFVSKRVRKMLPKFLLFNWQENLAEKSLDLS  120

Query  580   F----DNCL--LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVVANV  735
             F    D  L   D+WKQS+IK  + +DQ L++  G  SF SGTTALTV+KQG+ +++ANV
Sbjct  121   FKMETDMNLHEYDIWKQSYIKTFAAIDQDLKRHTGIDSFQSGTTALTVIKQGEYLIIANV  180

Query  736   GDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNP  915
             GDSRAVLAT  ++G L  +QLT DLKPNLP E ERIM S GRV+  +DEPGVYRVWMPN 
Sbjct  181   GDSRAVLATTSENGTLTPIQLTTDLKPNLPNEAERIMESNGRVFCMEDEPGVYRVWMPNG  240

Query  916   NGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQE  1095
                   + PGLA+SRAFGDY +KDFGLIS P+ T R +T  DQF ILATDGVWDV+SNQ 
Sbjct  241   ------KSPGLAISRAFGDYCVKDFGLISVPDVTQRKLTTMDQFVILATDGVWDVISNQV  294

Query  1096  AVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             AV+IV+S P R ++A RLV+ A   W   R+GIA+DD+S ICLFFH+
Sbjct  295   AVKIVASTPNREKAADRLVKCARHEWISKRKGIAIDDISVICLFFHS  341



>ref|XP_010487547.1| PREDICTED: probable protein phosphatase 2C 41 [Camelina sativa]
Length=350

 Score =   397 bits (1020),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 205/355 (58%), Positives = 255/355 (72%), Gaps = 10/355 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSR-EDVGREAANALAKEARKNELILSTSGFVNAISSH  354
             MV   +  +GFA+T+S K G+     ED GRE A ++ K+++KN  +L TSG V++ SS 
Sbjct  1     MVLLPAFLDGFARTVSTKKGKNPPENEDGGREIAKSMIKDSKKNSTLLGTSGCVSSESSK  60

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
                S+ S +G+KG NQDRAIVWE FG QED+ FCG+FDGHGPWGH++AKRV++  P SLL
Sbjct  61    RFTSICSNRGEKGINQDRAIVWEGFGCQEDITFCGMFDGHGPWGHVIAKRVKKSFPYSLL  120

Query  535   CNWQKALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQ  708
             C WQ+ LA ++ +       LD+WKQ+ +K  S VD  L+      S+ SG TALT V Q
Sbjct  121   CQWQQTLA-SLSSSAECYSPLDLWKQACLKTFSVVDLDLKINPSIDSYCSGCTALTAVLQ  179

Query  709   GDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPG  888
             GD +V+AN GDSRAVLAT  DDGN+V VQL+VD KPN+P E ERI +S GR++  DDEPG
Sbjct  180   GDHLVIANAGDSRAVLATTSDDGNVVPVQLSVDFKPNIPEEAERIKQSDGRLFCLDDEPG  239

Query  889   VYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDG  1068
             VYRV MPN  GG      GLAVSRAFGDY +KDFGL+SEPE T+R IT +DQF ILATDG
Sbjct  240   VYRVGMPN--GGSL----GLAVSRAFGDYCLKDFGLVSEPEVTYRKITDKDQFLILATDG  293

Query  1069  VWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             +WDV++N EAVEIV    ER +SAKRLVE AV  W+R RR IAMDD+S +CLFF 
Sbjct  294   MWDVMTNDEAVEIVRGVKERRKSAKRLVERAVVLWRRKRRSIAMDDISVLCLFFR  348



>ref|XP_010465704.1| PREDICTED: probable protein phosphatase 2C 41 [Camelina sativa]
Length=351

 Score =   397 bits (1019),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 206/358 (58%), Positives = 255/358 (71%), Gaps = 15/358 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRK--NSREDVGREAANALAKEARKNELILSTSGFVNAISS  351
             MV   +  +GFA+T+S K G+   +  ED GRE A ++ K+++KN  +L TSG V++ SS
Sbjct  1     MVLLPAFLDGFARTVSTKKGKNPPDQNEDGGREIAKSMIKDSKKNSTLLGTSGCVSSESS  60

Query  352   HNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSL  531
                 S+ S +G+KG NQDRAIVWE FG QED+ FCG+FDGHGPWGH++AKRV++  P SL
Sbjct  61    KRFTSICSNRGEKGINQDRAIVWEGFGCQEDITFCGMFDGHGPWGHVIAKRVKKSFPYSL  120

Query  532   LCNWQKALAHNMDNLGFDNCL--LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTV  699
             LC WQ+ LA    +     C   LD+WKQ+ +K  S VD  L+      S+ SG TALT 
Sbjct  121   LCQWQQTLASLSSS---PECYSPLDLWKQACLKTFSVVDLDLKINPSIDSYCSGCTALTA  177

Query  700   VKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDD  879
             V QGD +V+AN GDSRAVLAT  DDGN+V VQL+VD KPN+P E ERI +S GR++  DD
Sbjct  178   VLQGDHLVIANAGDSRAVLATTSDDGNVVPVQLSVDFKPNIPEEAERIKQSDGRLFCLDD  237

Query  880   EPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILA  1059
             EPGVYRV MPN  GG      GLAVSRAFGDY +KDFGL+SEPE T+R IT +DQF ILA
Sbjct  238   EPGVYRVGMPN--GGSL----GLAVSRAFGDYCLKDFGLVSEPEVTYRKITDKDQFLILA  291

Query  1060  TDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             TDG+WDV++N EAVEIV    ER +SAKRLVE AV  W+R RR IAMDD+S +CLFF 
Sbjct  292   TDGMWDVMTNDEAVEIVRGVKERRKSAKRLVERAVVLWRRKRRSIAMDDISVLCLFFR  349



>ref|XP_008245630.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 73 [Prunus mume]
Length=356

 Score =   397 bits (1019),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 217/383 (57%), Positives = 267/383 (70%), Gaps = 40/383 (10%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+F+G A+++S K G+ N      R+AA A+AKEA+KN++I              
Sbjct  1     MGHFSSMFSGLARSLSIKKGKNNHGNSDARDAAEAMAKEAKKNDMIXXXX----------  50

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
                    +G+KG NQD  IVWEEFG QEDM+FCG+FDGHGPWGH VAKR+RE +P SLLC
Sbjct  51    -------RGQKGVNQDCCIVWEEFGCQEDMMFCGIFDGHGPWGHFVAKRIRETMPPSLLC  103

Query  538   NWQKALAHNMDNLGFDNCL------LDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             +WQ+ LA    +   D  L       ++WK S+IK C+ +DQ+LE+  +  S YSGTTAL
Sbjct  104   SWQETLAQTSLDPDLDLELDKKGHRFNIWKHSYIKTCAAIDQELERHRRIDSVYSGTTAL  163

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             ++V+QGD++ VANVGDSRAVLAT  +DG+LV VQLTVD KP+LP E ERI++S GRV+  
Sbjct  164   SIVRQGDLIFVANVGDSRAVLATTSEDGSLVPVQLTVDFKPSLPQEAERIIQSNGRVFCL  223

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             DDEPGV RVW P+       E PGLA+SRAFGDY +K FGLIS PE T RNIT RDQF +
Sbjct  224   DDEPGVQRVWQPDG------ETPGLAMSRAFGDYCVKGFGLISVPEVTQRNITSRDQFVV  277

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDVVSNQEAV+IV S  +R +SAKRLV+ AV AWKR RRGIAMDD+SAICLFFH
Sbjct  278   LATDGVWDVVSNQEAVQIVGSTADRAKSAKRLVKCAVHAWKRKRRGIAMDDISAICLFFH  337

Query  1234  NKLIV*rrrrrrLHDMMQKQPIT  1302
             +           L D  Q  PI+
Sbjct  338   SS---------PLSDPQQVHPIS  351



>ref|NP_188303.1| putative protein phosphatase 2C [Arabidopsis thaliana]
 ref|NP_850599.2| putative protein phosphatase 2C [Arabidopsis thaliana]
 sp|Q9LRZ4.1|P2C41_ARATH RecName: Full=Probable protein phosphatase 2C 41; Short=AtPP2C41 
[Arabidopsis thaliana]
 dbj|BAA95773.1| protein phosphatase-2C-like protein [Arabidopsis thaliana]
 gb|AAM65915.1| protein phosphatase, putative [Arabidopsis thaliana]
 dbj|BAH19809.1| AT3G16800 [Arabidopsis thaliana]
 gb|AEE75866.1| putative protein phosphatase 2C [Arabidopsis thaliana]
 gb|AEE75867.1| putative protein phosphatase 2C [Arabidopsis thaliana]
Length=351

 Score =   396 bits (1018),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 205/356 (58%), Positives = 257/356 (72%), Gaps = 11/356 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSR-EDVGREAANALAKEARKNELILSTSGFVNAISSH  354
             MV   +  +G A+T+S K G+K S  ED GRE A ++ K+++KN  +L TSGFV++ SS 
Sbjct  1     MVLLPAFLDGLARTVSTKKGKKLSEDEDGGREIAKSMIKDSKKNSTLLGTSGFVSSESSK  60

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
                S+ S +G+KG NQDRAIVWE FG QED+ FCG+FDGHGPWGH++AKRV++  PSSLL
Sbjct  61    RFTSICSNRGEKGINQDRAIVWEGFGCQEDITFCGMFDGHGPWGHVIAKRVKKSFPSSLL  120

Query  535   CNWQKALAHNMDNLGFDNCLLDVWKQSHIKACS--EVDQQLEQQAGSFYSGTTALTVVKQ  708
             C WQ+ LA    +    +   D+WKQ+ +K  S  ++D ++     S+ SG TALT V Q
Sbjct  121   CQWQQTLASLSSSPECSS-PFDLWKQACLKTFSIIDLDLKISPSIDSYCSGCTALTAVLQ  179

Query  709   GDVMVVANVGDSRAVLATADDDGN-LVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEP  885
             GD +V+AN GDSRAV+AT  DDGN LV VQL+VD KPN+P E ERI +S GR++  DDEP
Sbjct  180   GDHLVIANAGDSRAVIATTSDDGNGLVPVQLSVDFKPNIPEEAERIKQSDGRLFCLDDEP  239

Query  886   GVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATD  1065
             GVYRV MPN  GG      GLAVSRAFGDY +KDFGL+SEPE T+R IT +DQF ILATD
Sbjct  240   GVYRVGMPN--GGSL----GLAVSRAFGDYCLKDFGLVSEPEVTYRKITDKDQFLILATD  293

Query  1066  GVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             G+WDV++N EAVEIV    ER +SAKRLVE AV  W+R RR IAMDD+S +CLFF 
Sbjct  294   GMWDVMTNNEAVEIVRGVKERRKSAKRLVERAVTLWRRKRRSIAMDDISVLCLFFR  349



>ref|XP_004962337.1| PREDICTED: probable protein phosphatase 2C 48-like [Setaria italica]
Length=346

 Score =   395 bits (1016),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 205/358 (57%), Positives = 254/358 (71%), Gaps = 20/358 (6%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M Q SSL  G A+++S    R+        +AA            +L +SG V    S  
Sbjct  1     MRQISSLLQGLARSLSVGRERRGDGGGGEGKAAA---------PAVLRSSGTVWGEGSET  51

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A++ SR+G+KG NQD +IVWE FG QED IFCG+FDGHGPWGH VAK VR+ +P SLLC
Sbjct  52    FAAVCSRRGEKGTNQDCSIVWEGFGCQEDTIFCGIFDGHGPWGHYVAKAVRDSLPPSLLC  111

Query  538   NWQKAL--AHNMDNLG-FDNCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTALTVV  702
             +WQ+AL  A  +D      +C  D+WKQS++ AC+ VD +L +  +  + YSG TAL+VV
Sbjct  112   HWQEALTLASLIDGEKRLSDCRFDLWKQSYVAACAAVDDELRRSRRLDAVYSGCTALSVV  171

Query  703   KQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDE  882
             KQGD+MV+ANVGDSRAVLAT  DDG + AVQLTVD KPNLP E+ERI R  G+V+   DE
Sbjct  172   KQGDLMVIANVGDSRAVLATTSDDGTVAAVQLTVDFKPNLPQEKERIRRCNGQVYCLADE  231

Query  883   PGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILAT  1062
             PGVYRVW P  +       PGLA+SRAFGDY +KD+G+IS PE T R I+ RDQFAILAT
Sbjct  232   PGVYRVWKPTQDS------PGLAMSRAFGDYSVKDYGVISAPEVTQRRISSRDQFAILAT  285

Query  1063  DGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             DGVWDV+SN+EAV+IV+  PERG++AKRLVE AV AW+R RRGIA+DD SAICLFFH+
Sbjct  286   DGVWDVLSNEEAVQIVAGTPERGKAAKRLVECAVRAWRRKRRGIAVDDCSAICLFFHS  343



>gb|ABH11524.1| PP2C [synthetic construct]
Length=351

 Score =   394 bits (1013),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 204/357 (57%), Positives = 257/357 (72%), Gaps = 11/357 (3%)
 Frame = +1

Query  175   KMVQFSSLFNGFAKTISKKSGRKNSR-EDVGREAANALAKEARKNELILSTSGFVNAISS  351
             + V   +  +G A+T+S K G+K S  ED GRE A ++ K+++KN  +L TSGFV++ SS
Sbjct  1     EFVLLPAFLDGLARTVSTKKGKKLSEDEDGGREIAKSMIKDSKKNSTLLGTSGFVSSESS  60

Query  352   HNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSL  531
                 S+ S +G+KG NQDRAIVWE FG QED+ FCG+FDGHGPWGH++AKRV++  PSSL
Sbjct  61    KRFTSICSNRGEKGINQDRAIVWEGFGCQEDITFCGMFDGHGPWGHVIAKRVKKSFPSSL  120

Query  532   LCNWQKALAHNMDNLGFDNCLLDVWKQSHIKACS--EVDQQLEQQAGSFYSGTTALTVVK  705
             LC WQ+ LA    +    +   D+WKQ+ +K  S  ++D ++     S+ SG TALT V 
Sbjct  121   LCQWQQTLASLSSSPECSS-PFDLWKQACLKTFSIIDLDLKISPSIDSYCSGCTALTAVL  179

Query  706   QGDVMVVANVGDSRAVLATADDDGN-LVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDE  882
             QGD +V+AN GDSRAV+AT  DDGN LV VQL+VD KPN+P E ERI +S GR++  DDE
Sbjct  180   QGDHLVIANAGDSRAVIATTSDDGNGLVPVQLSVDFKPNIPEEAERIKQSDGRLFCLDDE  239

Query  883   PGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILAT  1062
             PGVYRV MPN  GG      GLAVSRAFGDY +KDFGL+SEPE T+R IT +DQF ILAT
Sbjct  240   PGVYRVGMPN--GGSL----GLAVSRAFGDYCLKDFGLVSEPEVTYRKITDKDQFLILAT  293

Query  1063  DGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             DG+WDV++N EAVEIV    ER +SAKRLVE AV  W+R RR IAMDD+S +CLFF 
Sbjct  294   DGMWDVMTNNEAVEIVRGVKERRKSAKRLVERAVTLWRRKRRSIAMDDISVLCLFFR  350



>ref|XP_002883028.1| hypothetical protein ARALYDRAFT_479146 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59287.1| hypothetical protein ARALYDRAFT_479146 [Arabidopsis lyrata subsp. 
lyrata]
Length=351

 Score =   394 bits (1012),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 202/357 (57%), Positives = 258/357 (72%), Gaps = 11/357 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSR-EDVGREAANALAKEARKNELILSTSGFVNAISSH  354
             MV   +  +GFA+T+S K G+  S  ED GRE A ++ K+++KN  ++ TSGFV++ SS 
Sbjct  1     MVLLPAFLDGFARTVSTKKGKNLSEDEDGGREIAKSMIKDSKKNSTLIGTSGFVSSESSK  60

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
                S+ S +G+KG NQDRAIVWE FG QED+ FCG+FDGHGPWGH++AKRV++  P+SLL
Sbjct  61    RFTSICSNRGEKGINQDRAIVWEGFGCQEDITFCGMFDGHGPWGHVIAKRVKKSFPASLL  120

Query  535   CNWQKALAHNMDNLGFDNCLLDVWKQSHIKACS--EVDQQLEQQAGSFYSGTTALTVVKQ  708
             C WQ+ LA    +    +   D+WKQ+ +K  S  ++D ++     S+ SG TALT V Q
Sbjct  121   CQWQQTLASLSSSPECSS-PFDLWKQACLKTFSVIDLDLKISPSIDSYCSGCTALTAVLQ  179

Query  709   GDVMVVANVGDSRAVLATADDDGN-LVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEP  885
             GD +V+AN GDSRAV+AT  DDGN L+ VQL+VD KPN+P E ERI +S GR++  DDEP
Sbjct  180   GDHLVIANAGDSRAVIATTSDDGNGLMPVQLSVDFKPNIPEEAERIKQSDGRLFCLDDEP  239

Query  886   GVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATD  1065
             GVYRV MPN  GG      GLAVSRAFGDY +KDFGL+SEPE T+R IT +DQF ILATD
Sbjct  240   GVYRVGMPN--GGSL----GLAVSRAFGDYCLKDFGLVSEPEVTYRKITDKDQFLILATD  293

Query  1066  GVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             G+WDV++N EAVEIV    ER +SAKRLVE AV  W+R RR IAMDD+S +CLFF +
Sbjct  294   GMWDVMTNNEAVEIVRGVKERRKSAKRLVERAVTLWRRKRRSIAMDDISVLCLFFRS  350



>emb|CDY50503.1| BnaC01g44410D [Brassica napus]
Length=351

 Score =   391 bits (1005),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 204/357 (57%), Positives = 256/357 (72%), Gaps = 13/357 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSR-EDVGREAANALAKEARKNELILSTSGFVNAISSH  354
             MV   +  +G A+++S K G+     ED G E A +L K+A+KN  +L +SGFV + +S 
Sbjct  1     MVLLPAFLDGLARSVSMKKGKYIPEDEDGGGEIAKSLMKDAKKNSTLLGSSGFVKSETSK  60

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
                S+ S +G+KG NQDRAIVWEEFG QED+ FCG+FDGHGPWGH++ KRV++L PSSLL
Sbjct  61    RFTSICSNRGEKGINQDRAIVWEEFGCQEDITFCGMFDGHGPWGHVITKRVKKLFPSSLL  120

Query  535   CNWQKALAH-NMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVK  705
             C WQ+ LA  ++    F     D+WKQS +K  S +D  L+      S+ SG TALT V 
Sbjct  121   CQWQQTLASLSLSPECFSP--FDIWKQSCLKTFSLIDLDLKIHPSIDSYCSGCTALTAVL  178

Query  706   QGDVMVVANVGDSRAVLATADDDGN-LVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDE  882
             QGD +VVAN GDSRAV+AT  DDG+ LV VQL+VD KPN+P E ERI +S GR++  DDE
Sbjct  179   QGDHLVVANAGDSRAVIATTSDDGSGLVPVQLSVDFKPNIPEEAERIKQSDGRLFCLDDE  238

Query  883   PGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILAT  1062
             PGVYRV MPN   G ++   GLAVSRAFGDY +KDFGL+S PE T+R IT +DQF ILAT
Sbjct  239   PGVYRVGMPN---GRSL---GLAVSRAFGDYCLKDFGLVSVPEVTYRKITDKDQFLILAT  292

Query  1063  DGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             DG+WDV++N EAVEIV    ER +SAKRLVE A+  W+R RR IAMDD+SA+CLFFH
Sbjct  293   DGMWDVMTNDEAVEIVRGVKERRKSAKRLVERAMMLWRRKRRSIAMDDISALCLFFH  349



>ref|XP_010504668.1| PREDICTED: probable protein phosphatase 2C 41 [Camelina sativa]
Length=350

 Score =   391 bits (1004),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 203/357 (57%), Positives = 253/357 (71%), Gaps = 14/357 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGR-KNSREDVGREAANALAKEARKNELILSTSGFVNAISSH  354
             MV   +  +GFA+T+S K G+     ED GRE A ++ K+++KN  +L TSG V++ SS 
Sbjct  1     MVLLPAFLDGFARTVSTKKGKIPPENEDGGREIAKSMIKDSKKNSTLLGTSGCVSSESSK  60

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
                S+ S +G+KG NQDRAIVWE FG Q+D+ FCG+FDGHGPWGH++AKRV++  P SLL
Sbjct  61    RFTSICSNRGEKGINQDRAIVWEGFGCQDDITFCGMFDGHGPWGHVIAKRVKKSFPYSLL  120

Query  535   CNWQKALAHNMDNLGFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTALTVV  702
             C WQ+ LA    +     C   LD+WKQ+ +K  S VD  L+      S+ SG TAL  V
Sbjct  121   CQWQQTLASLSSS---PECYSPLDLWKQACLKTFSVVDLDLKINPSIDSYCSGCTALIAV  177

Query  703   KQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDE  882
              QGD +V+AN GDSRAVLAT  DDGN+V VQL+VD KPN+P E ERI ++ GR++  DDE
Sbjct  178   LQGDHLVIANAGDSRAVLATTSDDGNVVPVQLSVDFKPNIPEEAERIKQNDGRLFCLDDE  237

Query  883   PGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILAT  1062
             PGVYRV MPN  GG      GLAVSRAFGDY +KDFGL+SEPE T+R IT +DQF ILAT
Sbjct  238   PGVYRVGMPN--GGSL----GLAVSRAFGDYCLKDFGLVSEPEVTYRKITDKDQFLILAT  291

Query  1063  DGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             DG+WDV++N EAVEIV    ER +SAKRLVE AV  W+R RR IAMDD+S +CLFF 
Sbjct  292   DGMWDVMTNDEAVEIVRGVKERRKSAKRLVERAVVLWRRKRRSIAMDDISVLCLFFR  348



>emb|CDY67911.1| BnaA01g37010D [Brassica napus]
Length=351

 Score =   390 bits (1003),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 204/357 (57%), Positives = 255/357 (71%), Gaps = 13/357 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSR-EDVGREAANALAKEARKNELILSTSGFVNAISSH  354
             MV   +  +G A+++S K G+     ED G E A  L K+A+KN  +L +SGFV + +S 
Sbjct  1     MVLLPAFLDGLARSVSMKKGKYIPEDEDGGGEIAKLLMKDAKKNSTLLGSSGFVKSETSK  60

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
                S+ S +G+KG NQDRAIVWEEFG QED+ FCG+FDGHGPWGH++ KRV++L PSSLL
Sbjct  61    RFTSICSNRGEKGINQDRAIVWEEFGCQEDITFCGMFDGHGPWGHVITKRVKKLFPSSLL  120

Query  535   CNWQKALAH-NMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVK  705
             C WQ+ LA  ++    F     D+WKQS +K  S +D  L+      S+ SG TALT V 
Sbjct  121   CQWQQTLASLSLSPECFSP--FDIWKQSCLKTFSLIDLDLKIHPSIDSYCSGCTALTAVL  178

Query  706   QGDVMVVANVGDSRAVLATADDDGN-LVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDE  882
             QGD +VVAN GDSRAV+AT  DDG+ LV VQL+VD KPN+P E ERI +S GR++  DDE
Sbjct  179   QGDHLVVANAGDSRAVIATTSDDGSGLVPVQLSVDFKPNIPEEAERIKQSDGRLFCLDDE  238

Query  883   PGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILAT  1062
             PGVYRV MPN   G ++   GLAVSRAFGDY +KDFGL+S PE T+R IT +DQF ILAT
Sbjct  239   PGVYRVGMPN---GRSL---GLAVSRAFGDYCLKDFGLVSVPEVTYRKITDKDQFLILAT  292

Query  1063  DGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             DG+WDV++N EAVEIV    ER +SAKRLVE A+  W+R RR IAMDD+SA+CLFFH
Sbjct  293   DGMWDVMTNDEAVEIVRGVKERRKSAKRLVERAMMLWRRKRRSIAMDDISALCLFFH  349



>ref|XP_006298033.1| hypothetical protein CARUB_v10014078mg [Capsella rubella]
 gb|EOA30931.1| hypothetical protein CARUB_v10014078mg [Capsella rubella]
Length=351

 Score =   390 bits (1002),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 204/356 (57%), Positives = 256/356 (72%), Gaps = 11/356 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNS-REDVGREAANALAKEARKNELILSTSGFVNAISSH  354
             MV   +  +GFA+T+S K G+     ED GRE A ++ K+++KN  +L TSGFV++  S 
Sbjct  1     MVLLPAFLDGFARTVSTKKGKNPPGDEDKGREIAKSMIKDSKKNSSLLGTSGFVSSEISK  60

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
                S+ S +G+KG NQDRAIVWE FG QED+ FCG+FDGHGPWGH++AKRV++  PSSLL
Sbjct  61    RFTSICSNRGEKGINQDRAIVWEGFGCQEDITFCGMFDGHGPWGHVIAKRVKKSFPSSLL  120

Query  535   CNWQKALAHNMDNLGFDNCLLDVWKQSHIKACS--EVDQQLEQQAGSFYSGTTALTVVKQ  708
             C WQ+ LA    +    +  LD+WKQ+ +K  S  ++D ++     S+ SG TALT V Q
Sbjct  121   CQWQQTLASLSSSPECSS-PLDLWKQACLKTFSVIDLDLKINPSIDSYCSGCTALTAVLQ  179

Query  709   GDVMVVANVGDSRAVLATADDDGN-LVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEP  885
             GD +V+AN GDSRAVLAT  DDG+ LV VQL+VD KPN+P E ERI +S GR++  DDEP
Sbjct  180   GDHLVIANAGDSRAVLATTSDDGSGLVPVQLSVDFKPNIPEEAERIKQSDGRLFCLDDEP  239

Query  886   GVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATD  1065
             GVYRV MPN  GG      GLAVSRAFGDY +KDFGL+SEPE T+R IT +DQF ILATD
Sbjct  240   GVYRVGMPN--GGSL----GLAVSRAFGDYCLKDFGLVSEPEVTYRKITDKDQFLILATD  293

Query  1066  GVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             G+WDV++N EAVEIV    ER +SAKRLVE AV  W+R RR IAMDD+S +CLFF 
Sbjct  294   GMWDVMTNDEAVEIVRGVKERRKSAKRLVERAVVLWRRKRRSIAMDDISVLCLFFR  349



>ref|XP_009114164.1| PREDICTED: probable protein phosphatase 2C 41 [Brassica rapa]
Length=351

 Score =   389 bits (1000),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 203/357 (57%), Positives = 255/357 (71%), Gaps = 13/357 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSR-EDVGREAANALAKEARKNELILSTSGFVNAISSH  354
             MV   +  +G A+++S K G+     ED G E A  L K+A+KN  +L +SGFV + +S 
Sbjct  1     MVLLPAFLDGLARSVSMKKGKYIPEDEDGGGEIAKLLMKDAKKNSTLLGSSGFVKSETSK  60

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
                S+ S +G+KG NQDRAIVWEEFG QED+ FCG+FDGHGPWGH++ KRV++L PSSLL
Sbjct  61    RFTSICSNRGEKGINQDRAIVWEEFGCQEDITFCGMFDGHGPWGHVITKRVKKLFPSSLL  120

Query  535   CNWQKALAH-NMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVK  705
             C WQ+ +A  ++    F     D+WKQS +K  S +D  L+      S+ SG TALT V 
Sbjct  121   CQWQQTIASLSLSPECFSP--FDIWKQSCLKTFSLIDLDLKIHPSIDSYCSGCTALTAVL  178

Query  706   QGDVMVVANVGDSRAVLATADDDGN-LVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDE  882
             QGD +VVAN GDSRAV+AT  DDG+ LV VQL+VD KPN+P E ERI +S GR++  DDE
Sbjct  179   QGDHLVVANAGDSRAVIATTSDDGSGLVPVQLSVDFKPNIPEEAERIKQSDGRLFCLDDE  238

Query  883   PGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILAT  1062
             PGVYRV MPN   G ++   GLAVSRAFGDY +KDFGL+S PE T+R IT +DQF ILAT
Sbjct  239   PGVYRVGMPN---GRSL---GLAVSRAFGDYCLKDFGLVSVPEVTYRKITDKDQFLILAT  292

Query  1063  DGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             DG+WDV++N EAVEIV    ER +SAKRLVE A+  W+R RR IAMDD+SA+CLFFH
Sbjct  293   DGMWDVMTNDEAVEIVRGVKERRKSAKRLVERAMMLWRRKRRSIAMDDISALCLFFH  349



>ref|XP_006406805.1| hypothetical protein EUTSA_v10021041mg [Eutrema salsugineum]
 gb|ESQ48258.1| hypothetical protein EUTSA_v10021041mg [Eutrema salsugineum]
Length=351

 Score =   387 bits (995),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/358 (56%), Positives = 254/358 (71%), Gaps = 15/358 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSR-EDVGREAANALAKEARKNELILSTSGFVNAISSH  354
             MV   +  +GFA+++S K  +  S  ED GRE A ++ K+++KN  +L +SGFVN+ +S 
Sbjct  1     MVLLPAFLDGFARSVSTKKAKHLSEDEDGGREIAKSMIKDSKKNSTLLGSSGFVNSETSK  60

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
                S+ S +G+KG NQDRAIVWE FG QED+ FCG+FDGHGPWGH+++KRV++  PSSLL
Sbjct  61    RFTSICSNRGEKGINQDRAIVWEGFGCQEDITFCGMFDGHGPWGHVISKRVKKSFPSSLL  120

Query  535   CNWQKALAHNMDNLGFDNCL--LDVWKQSHIKACS--EVDQQLEQQAGSFYSGTTALTVV  702
             C WQ+ LA    +     C    D+WKQS +K  S  ++D ++     S+ SG TALT V
Sbjct  121   CQWQQTLASLSSS---PECFSPFDLWKQSCLKTFSIIDLDLKINPSIDSYCSGCTALTAV  177

Query  703   KQGDVMVVANVGDSRAVLATADDDGN-LVAVQLTVDLKPNLPGERERIMRSKGRVWSSDD  879
              QGD +VVAN GDSRAV+AT  DDGN LV VQL+VD KPN+P E ERI +S GR++   D
Sbjct  178   LQGDHLVVANAGDSRAVIATTSDDGNGLVPVQLSVDFKPNIPEEAERIKQSDGRLFCLAD  237

Query  880   EPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILA  1059
             EPGVYRV MPN       E  GLAVSRAFGDY +KDFGL+S P  T+R IT +DQF ILA
Sbjct  238   EPGVYRVGMPNG------ESLGLAVSRAFGDYCLKDFGLVSVPAVTYRKITEKDQFLILA  291

Query  1060  TDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             TDG+WDV++N EAVEIV    +R +SAKRLVE A+  W+R RR IAMDD+SA+CLFFH
Sbjct  292   TDGMWDVMTNDEAVEIVRGVRDRRKSAKRLVERAMILWRRKRRSIAMDDISALCLFFH  349



>ref|XP_008450566.1| PREDICTED: probable protein phosphatase 2C 34 [Cucumis melo]
Length=375

 Score =   387 bits (994),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/358 (54%), Positives = 257/358 (72%), Gaps = 18/358 (5%)
 Frame = +1

Query  199   FNGFAKTISKKSGRKNSREDV--GREAANALAKEARKNELILSTSGFVNAISSHNCASLH  372
             FN   K+I+ K  R +    V  GREAA A+AK A+K +LI+  SG +N   S N  S  
Sbjct  13    FNELTKSITSKKWRNSENASVVSGREAAEAMAKSAKKKDLIIHGSGSINIDGSSNFVSSF  72

Query  373   SRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKA  552
             S++G+KG NQD  IVWEEFG Q+DMIFCGVFDGHGPWGH VAK+VRE +P +LLCNW++A
Sbjct  73    SKRGEKGINQDCCIVWEEFGCQKDMIFCGVFDGHGPWGHFVAKKVRESMPIALLCNWEEA  132

Query  553   LAHNMDNLGFD------NCLLDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTALTVVKQ  708
             L     +   +      N   ++W++S+I+AC+ VDQ+LE  ++  +F+SGTTAL++V+Q
Sbjct  133   LVQTSLHQQLELNSTKTNLHFNLWERSYIEACAVVDQELERHRKIDTFHSGTTALSIVRQ  192

Query  709   GDVMVVANVGDSRAVLATADDDGN--LVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDE  882
             GD +V+AN+GDSRAVLAT  +DGN  L  +QLT+D KPNLP E ERI +  GRV+   DE
Sbjct  193   GDTIVIANLGDSRAVLATTSNDGNSMLSPIQLTIDFKPNLPQEAERITQCNGRVFCLQDE  252

Query  883   PGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILAT  1062
             PG  R+W+PN       + PGL++SR+FGD+ +K FGLIS P+ T R++T +D F ILAT
Sbjct  253   PGTQRLWLPNG------KTPGLSISRSFGDFCVKHFGLISMPDVTQRSVTNKDLFVILAT  306

Query  1063  DGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             DG+WDVVSNQEAV+IV S  +R +SA+RLV++A CAWK+ R GIA DDMS I L+ H+
Sbjct  307   DGIWDVVSNQEAVQIVHSTVDRKKSAQRLVDYATCAWKQKRPGIAADDMSVIVLYLHS  364



>ref|XP_006855364.1| hypothetical protein AMTR_s00057p00118530 [Amborella trichopoda]
 gb|ERN16831.1| hypothetical protein AMTR_s00057p00118530 [Amborella trichopoda]
Length=398

 Score =   386 bits (991),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 196/374 (52%), Positives = 263/374 (70%), Gaps = 30/374 (8%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M QFS ++ G  K+ S K+ +    ++ GRE A  LA+ A+KN  +L +   +N+ + H 
Sbjct  1     MDQFSHIYYGVMKSFSVKNKKLRCPKEEGREVAETLARGAKKNSQLLCS---LNSSNPH-  56

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
               S+ S++GKKG NQD  +VWEEFG Q+DM+FCGVFDGHGPWGH ++++VR+ +P +LLC
Sbjct  57    -VSVFSQRGKKGINQDCTVVWEEFGCQKDMVFCGVFDGHGPWGHYISRKVRDWMPPTLLC  115

Query  538   NWQKALAHN---------MDNLGFD------NCL--LDVWKQSHIKACSEVDQQLEQQAG  666
              WQ+ LA N            +G D      +C+   D+WKQS ++  + +D++L +  G
Sbjct  116   QWQEILALNHLTSNVKKPCKTVGNDVKFGGMDCIEAFDIWKQSFLRTSALIDEELHRHRG  175

Query  667   --SFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERER  840
               S+YSGTTA+T+VKQGD++VVANVGDSRAVL T  DDGNL AVQLTVDLKPNLP E  R
Sbjct  176   IDSYYSGTTAVTIVKQGDLIVVANVGDSRAVLGTTSDDGNLAAVQLTVDLKPNLPQEAAR  235

Query  841   IMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTF  1020
             I    GRV+   DEPGV RVW+PN       E PGLA+SRAFGDY +KDFGLIS PE T+
Sbjct  236   IRHCNGRVYCLPDEPGVNRVWLPNE------ESPGLAMSRAFGDYCLKDFGLISVPEVTY  289

Query  1021  RNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAM  1200
             R++T  D+F +LA+DGVWDV+SNQEAVEI++S+P+R  +AKRLVE AV AW+  + G+A+
Sbjct  290   RHLTNNDRFLLLASDGVWDVLSNQEAVEIIASSPQRETAAKRLVECAVKAWRWKKPGLAV  349

Query  1201  DDMSAICLFFHNKL  1242
             DD +A+C +  N L
Sbjct  350   DDCAAVCFYLDNFL  363



>gb|KEH37183.1| catalytic/protein phosphatase type 2C [Medicago truncatula]
Length=385

 Score =   381 bits (979),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 190/340 (56%), Positives = 244/340 (72%), Gaps = 14/340 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV   SL N  ++T+S    +   ++D  R+   A+AKEA+KNE++LS+SG V +  S+N
Sbjct  1     MVSIPSLVNFISRTMSSNKDKSYGKDDDARKVVEAMAKEAKKNEMLLSSSGIVKSDKSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              + + +++G+KG NQD  IVWEEFG QED+I CGVFDGHGPWGH V+KRVR+++P  LL 
Sbjct  61    FSCVFTKKGQKGFNQDCLIVWEEFGCQEDIILCGVFDGHGPWGHFVSKRVRKMLPKFLLF  120

Query  538   NWQKALAHNMDNLGF----DNCL--LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTAL  693
             NWQ+ LA    +L F    D  L   D+WKQS+IK  + +DQ L++  G  SF SGTTAL
Sbjct  121   NWQENLAEKSLDLSFKMETDMNLHEYDIWKQSYIKTFAAIDQDLKRHTGIDSFQSGTTAL  180

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             TV+KQG+ +++ANVGDSRAVLAT  ++G L  +QLT DLKPNLP E ERIM S GRV+  
Sbjct  181   TVIKQGEYLIIANVGDSRAVLATTSENGTLTPIQLTTDLKPNLPNEAERIMESNGRVFCM  240

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGVYRVWMPN       + PGLA+SRAFGDY +KDFGLIS P+ T R +T  DQF I
Sbjct  241   EDEPGVYRVWMPNG------KSPGLAISRAFGDYCVKDFGLISVPDVTQRKLTTMDQFVI  294

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAW  1173
             LATDGVWDV+SNQ AV+IV+S P R ++A RLV+ A   W
Sbjct  295   LATDGVWDVISNQVAVKIVASTPNREKAADRLVKCARHEW  334



>gb|KDO81765.1| hypothetical protein CISIN_1g015633mg [Citrus sinensis]
Length=296

 Score =   378 bits (970),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 183/283 (65%), Positives = 226/283 (80%), Gaps = 14/283 (5%)
 Frame = +1

Query  412   IVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKALAHN--MDNLGFD  585
             ++ +EFG Q DM+FCG+FDGHGPWGH VAK+VRE +PSSLLCNWQ+ LA    + ++  D
Sbjct  6     VLEQEFGCQADMMFCGIFDGHGPWGHFVAKKVRESMPSSLLCNWQETLAEASLLPDIDLD  65

Query  586   N----CLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTALTVVKQGDVMVVANVGDSR  747
             +       ++WK S++K C+ VDQ+LEQ  Q  SFYSGTTALT+V+QG+ ++VANVGDSR
Sbjct  66    SDKKTHRFNIWKHSYVKTCAAVDQELEQHRQIDSFYSGTTALTIVRQGEFIMVANVGDSR  125

Query  748   AVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGV  927
             AVLAT  +DG+LV VQLTVD KPNLP E ERI++ KGRV+  +DEPGV+RVW+PN     
Sbjct  126   AVLATTSEDGSLVPVQLTVDFKPNLPYEAERIIQCKGRVFCLEDEPGVHRVWLPNE----  181

Query  928   AVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEI  1107
               E PGLA+SRAFGDY +KD+GLIS PE T R+IT RDQF +LATDGVWDV+SNQEA++I
Sbjct  182   --ECPGLAMSRAFGDYCVKDYGLISVPEVTQRHITSRDQFVVLATDGVWDVISNQEAIQI  239

Query  1108  VSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             VSS P R +SAKRLVE AV AWKR R+GIAMDD+SAICLFFH+
Sbjct  240   VSSTPNRAKSAKRLVECAVHAWKRKRKGIAMDDISAICLFFHS  282



>ref|XP_006433477.1| hypothetical protein CICLE_v10001565mg [Citrus clementina]
 gb|ESR46717.1| hypothetical protein CICLE_v10001565mg [Citrus clementina]
Length=296

 Score =   377 bits (969),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 183/283 (65%), Positives = 226/283 (80%), Gaps = 14/283 (5%)
 Frame = +1

Query  412   IVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKALAHN--MDNLGFD  585
             ++ +EFG Q DM+FCG+FDGHGPWGH VAK+VRE +PSSLLCNWQ+ LA    + ++  D
Sbjct  6     VLEQEFGCQADMMFCGIFDGHGPWGHFVAKKVRESMPSSLLCNWQETLAEASLLPDIDLD  65

Query  586   NCL----LDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTALTVVKQGDVMVVANVGDSR  747
             +       ++WK S++K C+ VDQ+LEQ  Q  SFYSGTTALT+V+QG+ ++VANVGDSR
Sbjct  66    SDKKTHGFNIWKHSYVKTCAAVDQELEQHRQIDSFYSGTTALTIVRQGEFIMVANVGDSR  125

Query  748   AVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGV  927
             AVLAT  +DG+LV VQLTVD KPNLP E ERI++ KGRV+  +DEPGV+RVW+PN     
Sbjct  126   AVLATTSEDGSLVPVQLTVDFKPNLPYEAERIIQCKGRVFCLEDEPGVHRVWLPNE----  181

Query  928   AVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEI  1107
               E PGLA+SRAFGDY +KD+GLIS PE T R+IT RDQF +LATDGVWDV+SNQEA++I
Sbjct  182   --ECPGLAMSRAFGDYCVKDYGLISVPEVTQRHITSRDQFVVLATDGVWDVISNQEAIQI  239

Query  1108  VSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             VSS P R +SAKRLVE AV AWKR R+GIAMDD+SAICLFFH+
Sbjct  240   VSSTPNRAKSAKRLVECAVHAWKRKRKGIAMDDISAICLFFHS  282



>dbj|BAH20266.1| AT3G05640 [Arabidopsis thaliana]
Length=305

 Score =   377 bits (968),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 188/303 (62%), Positives = 230/303 (76%), Gaps = 9/303 (3%)
 Frame = +1

Query  334   VNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRE  513
             + A  S+N AS+ SR+G+KG NQD AIVWE +G QEDMIFCG+FDGHGPWGH V+K+VR 
Sbjct  1     IYADGSNNLASVFSRRGEKGVNQDCAIVWEGYGCQEDMIFCGIFDGHGPWGHFVSKQVRN  60

Query  514   LVPSSLLCNWQKALAHN-MDNLGFDNCLLDVWKQSHIKACSEVDQQLE--QQAGSFYSGT  684
              +P SLLCNW++ L+   +     +     +WK S +K C  VD +LE  ++  SF SGT
Sbjct  61    SMPISLLCNWRETLSQTTIAEPDKELQRFAIWKYSFLKTCEAVDLELEHHRKIDSFNSGT  120

Query  685   TALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRV  864
             TALT+V+QGDV+ +ANVGDSRAVLAT  D+G+LVAVQLTVD KPNLP E ERI+   GRV
Sbjct  121   TALTIVRQGDVIYIANVGDSRAVLATVSDEGSLVAVQLTVDFKPNLPQEEERIIGCNGRV  180

Query  865   WSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQ  1044
             +   DEPGV+RVW P        E PGLA+SRAFGDY IKD+GL+S PE T R+I+ RDQ
Sbjct  181   FCLQDEPGVHRVWQP------VDESPGLAMSRAFGDYCIKDYGLVSVPEVTQRHISIRDQ  234

Query  1045  FAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICL  1224
             F ILATDGVWDV+SNQEA++IVSS  ER ++AKRLV+ AV AW R RRGIAMDD+SA+CL
Sbjct  235   FIILATDGVWDVISNQEAIDIVSSTAERAKAAKRLVQQAVRAWNRKRRGIAMDDISAVCL  294

Query  1225  FFH  1233
             FFH
Sbjct  295   FFH  297



>emb|CDX95903.1| BnaC05g36540D [Brassica napus]
Length=351

 Score =   378 bits (971),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 193/358 (54%), Positives = 253/358 (71%), Gaps = 15/358 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSR-EDVGREAANALAKEARKNELILSTSGFVNAISSH  354
             MV   +  +G A+++S K G+  S  ED G+E A ++ K ++KN   L +SGFV++ +S 
Sbjct  1     MVLLPAFLDGLARSVSMKKGKYLSEDEDGGKEIAKSMMKYSKKNSTFLGSSGFVSSETSK  60

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
                S+ + +G+KG NQDRAIVWE FG QED+ FCG+FDGHGPWGH + KRV++L P+SLL
Sbjct  61    RFTSICTNRGEKGINQDRAIVWEGFGSQEDITFCGMFDGHGPWGHKITKRVKKLFPASLL  120

Query  535   CNWQKALAHNMDNLGFDNCL--LDVWKQSHIKACS--EVDQQLEQQAGSFYSGTTALTVV  702
             C WQ+ LA    +     C    D+WKQ  +K  S  ++D ++     S+ SG TALT +
Sbjct  121   CQWQQTLASLSSS---PECFSPFDLWKQPCMKTFSIIDLDLKIHPSIDSYCSGCTALTAI  177

Query  703   KQGDVMVVANVGDSRAVLATADDDG-NLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDD  879
              QGD +VVAN GDSRAV+AT  DDG  LV VQL+VD KPN+P E ERI +S GR++  DD
Sbjct  178   LQGDHLVVANAGDSRAVIATTSDDGVGLVPVQLSVDFKPNIPEEAERIKQSDGRLFCLDD  237

Query  880   EPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILA  1059
             EPGVYRV MPN   G ++   GLAVSRAFGDY +KDFGL+SEPE T+R IT +DQF ILA
Sbjct  238   EPGVYRVGMPN---GRSL---GLAVSRAFGDYCLKDFGLVSEPEVTYRKITSKDQFLILA  291

Query  1060  TDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             TDG+WDV++N EAVEI     +R +SA+RLV+ A+  W++ RR IAMDD+SA+CLFFH
Sbjct  292   TDGMWDVMTNDEAVEIARGVKDRRKSAERLVKKAMMLWRKKRRSIAMDDISALCLFFH  349



>ref|XP_003568624.1| PREDICTED: probable protein phosphatase 2C 48 [Brachypodium distachyon]
Length=341

 Score =   377 bits (969),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/358 (55%), Positives = 253/358 (71%), Gaps = 25/358 (7%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M Q SSL  G A+++S           +GRE   A  +E   N  +L TSG +    S  
Sbjct  1     MRQISSLLQGLARSMS-----------LGREKKGADEEE---NGTVLRTSGALWGEGSQT  46

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A+  SR+G KG NQD +IVWE FG QED IFCG+FDGHG WGH V+K VRE +P+SLLC
Sbjct  47    LAAACSRRGDKGTNQDCSIVWEGFGCQEDTIFCGIFDGHGQWGHYVSKAVRESLPASLLC  106

Query  538   NWQKA--LAHNMD-NLGFDNCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTALTVV  702
              WQ+A  LA  +D      +C  D+W++S++ A + VD++L +  +  +  SGTTAL+V+
Sbjct  107   RWQEAMALASLIDGEKKLSDCHFDLWRESYLAAAAAVDEELRRNRRLDAVNSGTTALSVI  166

Query  703   KQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDE  882
             KQG+++V+ NVGDSRAVLAT  DDG++ AVQLTVD KPNLP E+ERIM+ KGRV   DDE
Sbjct  167   KQGELLVIVNVGDSRAVLATTSDDGSVAAVQLTVDFKPNLPQEKERIMQCKGRVHCLDDE  226

Query  883   PGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILAT  1062
             PGV+RVW+P+       E PGLA+SRAFGDY +K +G+IS PE T R I+ RDQF ILAT
Sbjct  227   PGVHRVWLPDR------EAPGLAMSRAFGDYCVKAYGVISAPEVTQRTISDRDQFVILAT  280

Query  1063  DGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             DGVWDV+SN+EAV IV++  +R ++AKRLVE AV AW+R RRG A+DD SAICLFFH+
Sbjct  281   DGVWDVISNEEAVRIVAATVDREKAAKRLVECAVRAWRRKRRGFAVDDCSAICLFFHS  338



>ref|XP_002440955.1| hypothetical protein SORBIDRAFT_09g017821 [Sorghum bicolor]
 gb|EES19385.1| hypothetical protein SORBIDRAFT_09g017821 [Sorghum bicolor]
Length=353

 Score =   377 bits (969),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 201/363 (55%), Positives = 250/363 (69%), Gaps = 23/363 (6%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTIS--KKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISS  351
             M Q SSL  G A+++S  ++  RK      G     A+         +L TSG +    S
Sbjct  1     MRQISSLLQGLARSLSVGREKDRKGDGGAGGDGGKTAMPA-------VLRTSGTLWGEGS  53

Query  352   HNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSL  531
                A++ SR+G+KG NQD +IVWE FG QED IFCG+FDGHGPWGH VAK VR+ +P SL
Sbjct  54    ETFAAVCSRRGEKGINQDCSIVWEGFGCQEDTIFCGIFDGHGPWGHYVAKAVRDSLPPSL  113

Query  532   LCNWQKALAH----NMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             LC+WQ+ALA     + +     +C LD+WKQS++ AC+ VD +L +  +  +  SG TAL
Sbjct  114   LCHWQEALALASLIDGEKKRLSDCQLDLWKQSYVAACAAVDDELRRSRRFDAVQSGCTAL  173

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGN--LVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             ++VKQGD+MVVANVGDSRAVL T  DDG   + AVQLTVD KPNLP E+ERI R  G+V+
Sbjct  174   SIVKQGDLMVVANVGDSRAVLGTTSDDGGGAIAAVQLTVDFKPNLPQEKERIRRCNGQVY  233

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
                DEPGV+RVW PN       E PGLA+SRAFGDY +KD+G+IS PE T R IT  DQF
Sbjct  234   CLADEPGVHRVWQPNR------ESPGLAMSRAFGDYCVKDYGVISVPEVTQRRITTGDQF  287

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              ILATDGVWDV+SN EAV IV+  P+R ++AKRLVE AV AW+R RRG A+DD SAICLF
Sbjct  288   VILATDGVWDVLSNDEAVRIVAGTPDREKAAKRLVECAVHAWRRRRRGFAVDDCSAICLF  347

Query  1228  FHN  1236
             FH+
Sbjct  348   FHS  350



>gb|KGN66023.1| hypothetical protein Csa_1G568520 [Cucumis sativus]
Length=370

 Score =   378 bits (970),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 253/359 (70%), Gaps = 19/359 (5%)
 Frame = +1

Query  199   FNGFAKTISKKSGRKNSREDV--GREAANALAKEARKNELILSTSGFVNAISSHNCASLH  372
             FN   K+++ K  R +    V  GRE+A A+AK A+K +LI+  SG +N   S N  S  
Sbjct  13    FNKLTKSLTPKKWRNSENASVVSGRESAEAMAKSAKKKDLIIHGSGSINIDGSSNFVSSF  72

Query  373   SRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKA  552
             S++G+KG NQD  IVWEEFG Q+DMIFCGVFDGHGPWGH VAK VRE +P +LLCNW++A
Sbjct  73    SKRGEKGINQDCCIVWEEFGCQKDMIFCGVFDGHGPWGHFVAKEVRESMPIALLCNWEEA  132

Query  553   LA-------HNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVK  705
             L        H   N    N   ++W++S+I+AC+ VD +LE+     +F+SGTTAL++V+
Sbjct  133   LVQTSLLHPHLELNSTKTNLHFNLWERSYIEACAVVDPELERHPKIDTFHSGTTALSIVR  192

Query  706   QGDVMVVANVGDSRAVLATADDDGN--LVAVQLTVDLKPNLPGERERIMRSKGRVWSSDD  879
             QG+ +V+AN+GDSRAVLAT+ +DGN  L  +QLT+D KPNLP E ERI +  GRV+   D
Sbjct  193   QGETIVIANLGDSRAVLATSSNDGNSMLSPIQLTIDFKPNLPQEAERITQCNGRVFCLQD  252

Query  880   EPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILA  1059
             EPG  R+W+PN       + PGL++SR+FGD+  K FGLIS  + T R++T +D F ILA
Sbjct  253   EPGTQRLWLPNG------KMPGLSISRSFGDFCFKHFGLISMSDVTQRSVTNKDLFVILA  306

Query  1060  TDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             TDG+WDVVSNQEAV+IV S  +R +SA+RLV++A CAWKR R  IAMDDMS I L+ H+
Sbjct  307   TDGIWDVVSNQEAVQIVHSTIDRKKSARRLVDYATCAWKRKRPRIAMDDMSVIVLYLHS  365



>ref|XP_009146057.1| PREDICTED: probable protein phosphatase 2C 41 [Brassica rapa]
Length=351

 Score =   377 bits (968),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/356 (54%), Positives = 254/356 (71%), Gaps = 11/356 (3%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSR-EDVGREAANALAKEARKNELILSTSGFVNAISSH  354
             MV   +  +G A+++S K G+  S  ED G+E A ++ K ++KN  +L +SGFV++ +S 
Sbjct  1     MVLLPAFLDGLARSVSMKKGKYLSENEDGGKEIAKSMMKNSKKNSTLLGSSGFVSSETSK  60

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
                S+ + +G+KG NQDRAIVWE FG QED+ FCG+FDGHGPWGH + KRV++L P+SLL
Sbjct  61    RFTSICTNRGEKGINQDRAIVWEGFGCQEDITFCGMFDGHGPWGHKITKRVKKLFPASLL  120

Query  535   CNWQKALAHNMDNLGFDNCLLDVWKQSHIKACS--EVDQQLEQQAGSFYSGTTALTVVKQ  708
             C WQ+ LA    +    +   D+WKQ+ +K  S  ++D ++     S+ SG TALT + Q
Sbjct  121   CQWQQTLASLSSSPECSS-PFDLWKQACMKTFSIIDLDLKIHPSIDSYCSGCTALTAILQ  179

Query  709   GDVMVVANVGDSRAVLATADDDG-NLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEP  885
             GD +VVAN GDSRAV+AT  DDG  LV VQL+VD KPN+P E ERI +S GR++  DDEP
Sbjct  180   GDHLVVANAGDSRAVIATTSDDGVGLVPVQLSVDFKPNIPEEAERIKQSDGRLFCLDDEP  239

Query  886   GVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATD  1065
             GVYRV MPN   G ++   GLAVSRAFGDY +KDFGL+SEPE T+R IT +DQF ILATD
Sbjct  240   GVYRVGMPN---GRSL---GLAVSRAFGDYCLKDFGLVSEPEVTYRKITSKDQFLILATD  293

Query  1066  GVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             G+WDV+ N EAVEIV    +R +SA+RLV+ A+  W++ R  IAMDD+SA+CLFFH
Sbjct  294   GMWDVMKNDEAVEIVRGVKDRKKSAERLVKKAMMLWRKKRSSIAMDDISALCLFFH  349



>ref|XP_004135769.1| PREDICTED: probable protein phosphatase 2C 73-like [Cucumis sativus]
Length=365

 Score =   377 bits (969),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 253/359 (70%), Gaps = 19/359 (5%)
 Frame = +1

Query  199   FNGFAKTISKKSGRKNSREDV--GREAANALAKEARKNELILSTSGFVNAISSHNCASLH  372
             FN   K+++ K  R +    V  GRE+A A+AK A+K +LI+  SG +N   S N  S  
Sbjct  8     FNKLTKSLTPKKWRNSENASVVSGRESAEAMAKSAKKKDLIIHGSGSINIDGSSNFVSSF  67

Query  373   SRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKA  552
             S++G+KG NQD  IVWEEFG Q+DMIFCGVFDGHGPWGH VAK VRE +P +LLCNW++A
Sbjct  68    SKRGEKGINQDCCIVWEEFGCQKDMIFCGVFDGHGPWGHFVAKEVRESMPIALLCNWEEA  127

Query  553   LA-------HNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVK  705
             L        H   N    N   ++W++S+I+AC+ VD +LE+     +F+SGTTAL++V+
Sbjct  128   LVQTSLLHPHLELNSTKTNLHFNLWERSYIEACAVVDPELERHPKIDTFHSGTTALSIVR  187

Query  706   QGDVMVVANVGDSRAVLATADDDGN--LVAVQLTVDLKPNLPGERERIMRSKGRVWSSDD  879
             QG+ +V+AN+GDSRAVLAT+ +DGN  L  +QLT+D KPNLP E ERI +  GRV+   D
Sbjct  188   QGETIVIANLGDSRAVLATSSNDGNSMLSPIQLTIDFKPNLPQEAERITQCNGRVFCLQD  247

Query  880   EPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILA  1059
             EPG  R+W+PN       + PGL++SR+FGD+  K FGLIS  + T R++T +D F ILA
Sbjct  248   EPGTQRLWLPNG------KMPGLSISRSFGDFCFKHFGLISMSDVTQRSVTNKDLFVILA  301

Query  1060  TDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             TDG+WDVVSNQEAV+IV S  +R +SA+RLV++A CAWKR R  IAMDDMS I L+ H+
Sbjct  302   TDGIWDVVSNQEAVQIVHSTIDRKKSARRLVDYATCAWKRKRPRIAMDDMSVIVLYLHS  360



>dbj|BAJ89888.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97612.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=338

 Score =   375 bits (962),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 191/360 (53%), Positives = 251/360 (70%), Gaps = 32/360 (9%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNE--LILSTSGFVNAISS  351
             M Q SSL  G A+++                   AL KE ++ E   +L TSG +    S
Sbjct  1     MRQLSSLLQGLARSM-------------------ALGKERKEEEQGTVLRTSGTLWGEGS  41

Query  352   HNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSL  531
                A++ SR+G+KG NQD ++VWE FG QED IFCG+FDGHG WGH V+K VR+ +P SL
Sbjct  42    ETFAAVWSRRGEKGTNQDCSVVWEGFGCQEDTIFCGIFDGHGQWGHYVSKAVRDSLPPSL  101

Query  532   LCNWQKALAHNMDNLG---FDNCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTALT  696
             LC WQ+A+A      G     +C  D+WKQS++ A + VD++L +  +  +  SG+TAL+
Sbjct  102   LCRWQEAVALTSLIDGEKKLGDCQFDLWKQSYLAAAAAVDEELRRSRRLDAVNSGSTALS  161

Query  697   VVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSD  876
             +VK+GD MV+ANVGDSRAVL T  DDG++ AVQLT+D KPNLP E+ RI++ KGRV+  D
Sbjct  162   IVKKGDTMVIANVGDSRAVLGTMSDDGSIAAVQLTIDFKPNLPQEKARIVQCKGRVYCHD  221

Query  877   DEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAIL  1056
             DEPG++RVW+P+       E PGLA+SRAFGDY +KD+G+IS PE T R I  RDQF IL
Sbjct  222   DEPGMHRVWLPDR------EAPGLAMSRAFGDYCVKDYGVISAPEVTQRRINARDQFVIL  275

Query  1057  ATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             ATDGVWDV+SN+EAV+IV+  P+R ++AKRLV+ AV AW+R RRG A+DD SAICLFFH+
Sbjct  276   ATDGVWDVISNEEAVQIVAGTPDREKAAKRLVQCAVRAWRRKRRGYAVDDCSAICLFFHS  335



>dbj|BAJ94796.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=338

 Score =   374 bits (961),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 191/360 (53%), Positives = 251/360 (70%), Gaps = 32/360 (9%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNE--LILSTSGFVNAISS  351
             M Q SSL  G A+++                   AL KE ++ E   +L TSG +    S
Sbjct  1     MRQLSSLLQGLARSM-------------------ALGKERKEEEQGTVLRTSGTLWGEGS  41

Query  352   HNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSL  531
                A++ SR+G+KG NQD ++VWE FG QED IFCG+FDGHG WGH V+K VR+ +P SL
Sbjct  42    ETFAAVWSRRGEKGTNQDCSVVWEGFGCQEDTIFCGIFDGHGQWGHYVSKAVRDSLPPSL  101

Query  532   LCNWQKALAHNMDNLG---FDNCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTALT  696
             LC WQ+A+A      G     +C  D+WKQS++ A + VD++L +  +  +  SG+TAL+
Sbjct  102   LCRWQEAVALTSLIDGEKKLGDCQFDLWKQSYLAAAAAVDEELRRSHRLDAVNSGSTALS  161

Query  697   VVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSD  876
             +VK+GD MV+ANVGDSRAVL T  DDG++ AVQLT+D KPNLP E+ RI++ KGRV+  D
Sbjct  162   IVKKGDTMVIANVGDSRAVLGTMSDDGSIAAVQLTIDFKPNLPQEKARIVQCKGRVYCHD  221

Query  877   DEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAIL  1056
             DEPG++RVW+P+       E PGLA+SRAFGDY +KD+G+IS PE T R I  RDQF IL
Sbjct  222   DEPGMHRVWLPDR------EAPGLAMSRAFGDYCVKDYGVISAPEVTQRRINARDQFVIL  275

Query  1057  ATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             ATDGVWDV+SN+EAV+IV+  P+R ++AKRLV+ AV AW+R RRG A+DD SAICLFFH+
Sbjct  276   ATDGVWDVISNEEAVQIVAGTPDREKAAKRLVQCAVRAWRRKRRGYAVDDCSAICLFFHS  335



>ref|XP_004157287.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 73-like [Cucumis sativus]
Length=365

 Score =   375 bits (963),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 190/359 (53%), Positives = 252/359 (70%), Gaps = 19/359 (5%)
 Frame = +1

Query  199   FNGFAKTISKKSGRKNSREDV--GREAANALAKEARKNELILSTSGFVNAISSHNCASLH  372
             FN   K+++ K  R +    V  GRE+A A+AK A+K +LI+  SG +N   S N  S  
Sbjct  8     FNKLTKSLTPKKWRNSENASVVSGRESAEAMAKSAKKKDLIIHGSGSINIDGSSNFVSSF  67

Query  373   SRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKA  552
             S++G+KG NQD  IVWEEFG Q+DMIFCGVFDGHGPWGH VAK VRE +P +LLCNW++A
Sbjct  68    SKRGEKGINQDCCIVWEEFGCQKDMIFCGVFDGHGPWGHFVAKEVRESMPIALLCNWEEA  127

Query  553   LA-------HNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVK  705
             L        H   N    N   ++W++S+I+AC+ VD +LE+     +F+SGTTAL++V+
Sbjct  128   LVQTSLLHPHLELNSTKTNLHFNLWERSYIEACAVVDPELERHPKIDTFHSGTTALSIVR  187

Query  706   QGDVMVVANVGDSRAVLATADDDGN--LVAVQLTVDLKPNLPGERERIMRSKGRVWSSDD  879
             QG+ +V+AN+GDSRAVLAT+ +DGN  L  +QLT+D KPNLP E ERI +  GR +   D
Sbjct  188   QGETIVIANLGDSRAVLATSSNDGNSMLSPIQLTIDFKPNLPQEAERITQCNGRXFCLQD  247

Query  880   EPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILA  1059
             EPG  R+W+PN       + PGL++SR+FGD+  K FGLIS  + T R++T +D F ILA
Sbjct  248   EPGTQRLWLPNG------KMPGLSISRSFGDFCFKHFGLISMSDVTQRSVTNKDLFVILA  301

Query  1060  TDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             TDG+WDVVSNQEAV+IV S  +R +SA+RLV++A CAWKR R  IAMDDMS I L+ H+
Sbjct  302   TDGIWDVVSNQEAVQIVHSTIDRKKSARRLVDYATCAWKRKRPRIAMDDMSVIVLYLHS  360



>emb|CDX92097.1| BnaA05g23100D [Brassica napus]
Length=351

 Score =   373 bits (958),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 191/358 (53%), Positives = 252/358 (70%), Gaps = 15/358 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSR-EDVGREAANALAKEARKNELILSTSGFVNAISSH  354
             MV   +  +G A+++S K G+  S  ED G+E A ++ K ++KN  +L +SGFV++ +S 
Sbjct  1     MVLLPAFLDGLARSVSMKKGKYLSEYEDGGKEIAKSMMKNSKKNSTLLGSSGFVSSETSK  60

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
                S+ + +G+KG NQDRAIVWE FG QED+ FCG+FDGHG WGH + KRV+ L P+SLL
Sbjct  61    RFTSICTNRGEKGINQDRAIVWEGFGCQEDITFCGMFDGHGAWGHKITKRVKRLFPASLL  120

Query  535   CNWQKALAHNMDNLGFDNCL--LDVWKQSHIKACS--EVDQQLEQQAGSFYSGTTALTVV  702
             C WQ+ LA    +     C    D+WKQ+ +K  S  ++D ++     S+ SG TALT +
Sbjct  121   CQWQQTLASLSSS---PECFSPFDLWKQACMKTFSIIDLDLKIHPSIDSYCSGCTALTAI  177

Query  703   KQGDVMVVANVGDSRAVLATADDDG-NLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDD  879
              QGD +VVAN GDSRAV+AT  DDG  LV VQL+VD KPN+P E ERI +S GR++  DD
Sbjct  178   LQGDHLVVANAGDSRAVIATTSDDGVGLVPVQLSVDFKPNIPEEAERIKQSDGRLFCLDD  237

Query  880   EPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILA  1059
             EPG+YRV MPN   G ++   GLAVSRAFGDY +KDFGL+SEPE T+R IT +DQF ILA
Sbjct  238   EPGMYRVGMPN---GRSL---GLAVSRAFGDYCLKDFGLVSEPEVTYRKITSKDQFLILA  291

Query  1060  TDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             TDG+WDV+ N EAVEIV    +R +SA+RLV+ A+  W++ R  IAMDD+SA+CLFFH
Sbjct  292   TDGMWDVMKNDEAVEIVRGVKDRKKSAERLVKKAMMLWRKKRSSIAMDDISALCLFFH  349



>dbj|BAK07762.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=340

 Score =   372 bits (956),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 192/358 (54%), Positives = 248/358 (69%), Gaps = 26/358 (7%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M Q SS+  G A+++S    RK + E  G                +L +SG +    S  
Sbjct  1     MRQISSMLQGLARSMSLGKERKEAEEGHG---------------TVLRSSGTLWGEGSET  45

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A++ SR+G+KG NQD +IVWE +G Q+D IFCGVFDGHG WGH VAK VRE +P SLLC
Sbjct  46    FAAVCSRRGEKGTNQDTSIVWEGYGCQDDTIFCGVFDGHGQWGHYVAKAVRESLPQSLLC  105

Query  538   NWQKALAHNMDNLG---FDNCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTALTVV  702
              WQ+A+A      G     +C  D+ KQS++ A + VD++L +  +  +  SG TAL++V
Sbjct  106   RWQEAVALTSLIDGEKKLSDCQFDLLKQSYLAAAAAVDEELRRNRRLDAVNSGCTALSIV  165

Query  703   KQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDE  882
             KQG++MV+ANVGDSRAVLAT  DDG++ AVQLTVD KP+LP E+ RIM+ KGRV    DE
Sbjct  166   KQGELMVIANVGDSRAVLATTSDDGDVTAVQLTVDFKPDLPQEKARIMQCKGRVHCLGDE  225

Query  883   PGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILAT  1062
             PGV+RVW+P+       E PGLA+SRAFGDY +KD G+IS PE T R +T RDQF ILAT
Sbjct  226   PGVHRVWLPDR------EAPGLAMSRAFGDYCVKDCGVISAPEVTQRRVTARDQFVILAT  279

Query  1063  DGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             DGVWDV+SN+EAV IV++ P+R ++AKRLVE AV  W+R RRGIA+DD SA+CLFFH+
Sbjct  280   DGVWDVLSNEEAVRIVAATPDREKAAKRLVECAVRGWRRKRRGIAVDDCSAVCLFFHS  337



>ref|NP_001151041.1| catalytic/ protein phosphatase type 2C [Zea mays]
 gb|ACG41393.1| catalytic/ protein phosphatase type 2C [Zea mays]
Length=351

 Score =   369 bits (947),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 201/360 (56%), Positives = 248/360 (69%), Gaps = 22/360 (6%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M Q SSL  G A+++S   GR   R+  G  A +   K A     +L TSG +    S  
Sbjct  1     MRQISSLLQGLARSLS--VGRDRDRDRKGNGAGDG--KTA--VPAVLRTSGTLWGDGSDT  54

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A++ SR+G+KG NQD +IVWE FG QE  IFCG+FDGHGPWGH VAK VR+ +P SLLC
Sbjct  55    FAAVCSRRGEKGINQDCSIVWEGFGCQEGTIFCGIFDGHGPWGHYVAKVVRDSLPPSLLC  114

Query  538   NWQKALA------HNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             +WQ+ALA           LG  +C  D+WK+S++ AC+ VD +L +  +  +  SG TAL
Sbjct  115   HWQEALALASLIDDGKKKLG--DCQFDLWKRSYVAACAAVDDELRRSRRLDAVQSGCTAL  172

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             ++VKQGD+MVVANVGDSRAVL T   DG +VAVQLTVDLKPNLP E+ERI R  G+V+  
Sbjct  173   SIVKQGDLMVVANVGDSRAVLGTTYGDGTIVAVQLTVDLKPNLPQEKERIRRCNGQVYCL  232

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGV+RVW P+       E PGLA+SRAFGDY +KD G+IS PE T R I   DQF I
Sbjct  233   ADEPGVHRVWQPSR------ESPGLAMSRAFGDYCVKDCGVISTPEVTQRRIGASDQFVI  286

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDGVWDV+SN EAV+IV+   +R ++AKRLVE AV AW+R RR IA+DD SAICLFFH
Sbjct  287   LATDGVWDVLSNDEAVQIVAGTLDRAKAAKRLVECAVRAWRRKRRDIAVDDCSAICLFFH  346



>gb|EPS69184.1| hypothetical protein M569_05582 [Genlisea aurea]
Length=372

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/369 (51%), Positives = 254/369 (69%), Gaps = 22/369 (6%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKK---SGRKNSREDVGREAANALAKEARKNELILSTSGFVNAIS  348
             M + SS+ N   +++S K       +S    GREA  A+A++A+K ELIL  SG +    
Sbjct  1     MGRISSMLNEITRSLSVKRTTGNSSSSTSPNGREAVEAMARDAKKKELILMNSGMIKGER  60

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             SHN  +L S++G+KG NQD  IVWEEFG QEDM FCG+FDGHG WGH VAKRV   +PS 
Sbjct  61    SHNLTALFSKRGEKGINQDSCIVWEEFGCQEDMTFCGIFDGHGTWGHHVAKRVGHSMPSF  120

Query  529   LLCNWQKAL--------AHNMDNLGFDNCLL---DVWKQSHIKACSEVDQQLEQQA--GS  669
             LLCNWQ+ L        + N      +   L    +WK+S+++ C+ +DQ L +     S
Sbjct  121   LLCNWQQQLAEAAAAAASMNQQEAEEEEEELRRFTLWKRSYLRTCAALDQDLHRHPRIDS  180

Query  670   FYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMR  849
             F+SG+TAL++VKQG+ + +ANVGDSRAVL T  DDG+L A+QLTVD+KP+LP E +RI  
Sbjct  181   FHSGSTALSIVKQGNDVFLANVGDSRAVLGTVSDDGSLTALQLTVDMKPDLPEEAQRINE  240

Query  850   SKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNI  1029
             SKGRV+   DEPGV+R+W P+       E PGL++SRAFGDY +K FGLIS P+ T R I
Sbjct  241   SKGRVFCLKDEPGVHRMWSPHD------ESPGLSISRAFGDYCMKSFGLISVPQVTHRKI  294

Query  1030  TFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDM  1209
             + +D+F ++ATDGVWDV+SNQE+V IV+++PE  +SAK LV+ A  AW+R R+ +AMDD+
Sbjct  295   SSKDRFIVMATDGVWDVISNQESVAIVAASPEPAKSAKLLVKSAAKAWRRKRKKVAMDDI  354

Query  1210  SAICLFFHN  1236
             SAI LF H+
Sbjct  355   SAIVLFLHS  363



>ref|XP_004494568.1| PREDICTED: probable protein phosphatase 2C 73-like isoform X3 
[Cicer arietinum]
Length=313

 Score =   366 bits (939),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 180/317 (57%), Positives = 234/317 (74%), Gaps = 21/317 (7%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+FNG A++ S K GR+NS     REA  A+AKEA+KN+L+L +SG VN   S+N
Sbjct  2     MGHLSSMFNGLARSFSLKKGRRNSVRCERREAVEAMAKEAKKNDLMLCSSGTVNVDGSNN  61

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD  IVWEEFG QEDMIFCG+FDGHGPWGH VAKRVRE +P SLLC
Sbjct  62    FASVFSKRGQKGVNQDCCIVWEEFGCQEDMIFCGIFDGHGPWGHFVAKRVRESMPRSLLC  121

Query  538   NWQKALAHNM---DNLGFDNC----------LLDVWKQSHIKACSEVDQQLE--QQAGSF  672
             NWQ+ LA      D+   D+             ++WK S++K C+ +DQ+LE  ++  +F
Sbjct  122   NWQETLASQSSLDDDKDIDHVKAVATDNKQHRFNIWKHSYLKTCASIDQELEHNRKIDTF  181

Query  673   YSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRS  852
             YSGTTAL++V+QG+++++ANVGDSRAVLAT  D+G+L+AVQLTVD KPNLP E ERIM  
Sbjct  182   YSGTTALSIVRQGELIMIANVGDSRAVLATTSDNGSLIAVQLTVDFKPNLPQEAERIMEC  241

Query  853   KGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNIT  1032
             +GRV+  +DEPGV+R+W+P+       E PGLA+SRAFGDY IK++GLIS PE T+RNIT
Sbjct  242   QGRVFCLEDEPGVHRLWLPDG------ESPGLAMSRAFGDYCIKEYGLISVPEVTYRNIT  295

Query  1033  FRDQFAILATDGVWDVV  1083
              +D F +LATDGV  +V
Sbjct  296   TQDHFLVLATDGVRTLV  312



>ref|XP_003568623.1| PREDICTED: probable protein phosphatase 2C 48 [Brachypodium distachyon]
Length=340

 Score =   366 bits (939),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 195/358 (54%), Positives = 249/358 (70%), Gaps = 26/358 (7%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M Q SS+  G A++++    +K   ++ G                +L TSG +    S  
Sbjct  1     MRQISSMLQGLARSLAVGKEKKGGGDEKG---------------TVLRTSGTLWGEGSET  45

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A++ SR+G+KG NQD ++VWE FG QED IFCGVFDGHG WGH VAK VRE +P SLL 
Sbjct  46    FAAVCSRRGEKGINQDCSVVWEGFGCQEDGIFCGVFDGHGQWGHYVAKAVRESLPPSLLR  105

Query  538   NWQKA--LAHNMD-NLGFDNCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTALTVV  702
              WQ+A  LA  +D      +  LD+W+QS++ A + VD++L +  +  +  SG TAL+VV
Sbjct  106   RWQEAVALASLIDGEKKLSDYQLDLWRQSYLAAAAAVDEELRRSRRLDAVNSGCTALSVV  165

Query  703   KQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDE  882
             KQGD++V+ANVGDSRAVLAT  DDG + AVQLTVD KPNLP E+ERIM  KGRV    DE
Sbjct  166   KQGDLLVIANVGDSRAVLATTADDGGVAAVQLTVDFKPNLPKEKERIMECKGRVHCLRDE  225

Query  883   PGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILAT  1062
             PGV+RVW+P+       E PGLA+SRAFGDY +KD+G+IS PE T   I+ RDQF ILAT
Sbjct  226   PGVHRVWLPDR------EAPGLAMSRAFGDYCVKDYGVISAPEVTQWRISGRDQFVILAT  279

Query  1063  DGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             DGVWDV+SN+EAV IV++ P+R ++AKRLVE AV AW+R RRGIA+DD SAICLFFH+
Sbjct  280   DGVWDVLSNEEAVRIVAATPDREKAAKRLVECAVRAWRRKRRGIAVDDCSAICLFFHS  337



>ref|NP_001241841.1| putative protein phosphatase 2C family protein [Zea mays]
 gb|ACN36173.1| unknown [Zea mays]
 gb|AFW77678.1| putative protein phosphatase 2C family protein [Zea mays]
 gb|AIB06011.1| orphans transcription factor, partial [Zea mays]
 gb|AIG52094.1| 2C-type protein phosphatase protein [Zea mays]
Length=353

 Score =   366 bits (939),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 198/362 (55%), Positives = 248/362 (69%), Gaps = 24/362 (7%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNEL--ILSTSGFVNAISS  351
             M Q SSL  G A+++S    R   R+  G  A +      RK  +  +L TSG +    S
Sbjct  1     MRQISSLLQGLARSLSVGRDRDRDRDRKGNGAGD------RKTAVPAVLRTSGTLWGDGS  54

Query  352   HNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSL  531
                A++ SR+G+KG NQD +IVWE FG QE  IFCG+FDGHG WGH VAK VR+ +P SL
Sbjct  55    DTFAAVCSRRGEKGINQDCSIVWEGFGCQEGTIFCGIFDGHGQWGHYVAKAVRDSLPPSL  114

Query  532   LCNWQKALA------HNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTT  687
             LC+WQ+ALA           LG  +C  D+WK+S++ AC+ VD +L +  +  +  SG T
Sbjct  115   LCHWQEALALASLIDDGEKKLG--DCQFDLWKRSYVAACAAVDDELRRSRRLDAVQSGCT  172

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             AL++VKQGD+M+VANVGDSRAVL T  DDG + AVQLTVDLKPNLP E+ERI R  G+V+
Sbjct  173   ALSIVKQGDLMIVANVGDSRAVLGTTSDDGAIAAVQLTVDLKPNLPQEKERIRRCNGQVY  232

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
                DEPGV+RVW P+       E PGLA+SRAFGDY +KD G+IS PE T + I+  DQF
Sbjct  233   CLADEPGVHRVWQPSR------ESPGLAMSRAFGDYCVKDCGVISTPEVTQKRISSSDQF  286

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              ILATDGVWDV+SN EAV IV+  P+R ++AKRLVE AV AW+R RR IA+DD SAICLF
Sbjct  287   IILATDGVWDVLSNDEAVHIVAGTPDRAKAAKRLVECAVRAWRRKRRDIAVDDCSAICLF  346

Query  1228  FH  1233
             FH
Sbjct  347   FH  348



>ref|XP_004150097.1| PREDICTED: probable protein phosphatase 2C 73-like [Cucumis sativus]
 ref|XP_004168356.1| PREDICTED: probable protein phosphatase 2C 73-like [Cucumis sativus]
 gb|KGN47415.1| hypothetical protein Csa_6G315640 [Cucumis sativus]
Length=349

 Score =   360 bits (923),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 240/354 (68%), Gaps = 14/354 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV F  +     + +S K  +KN+ ED G +    + KE RKN+ ++  SG V      +
Sbjct  1     MVVFPEVIEEMVRNMSIK--KKNNNEDDGNK--EKIGKEGRKNKSMICLSGSVKTSKFED  56

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G KG NQD  ++WE+ G Q D++ CG+FDGHGPWGH+++K+VR+ +PS LL 
Sbjct  57    MASVCSKRGNKGINQDSLVLWEDLGCQGDVVLCGMFDGHGPWGHMISKQVRKSLPSQLLT  116

Query  538   NWQKALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQA--GSFYSGTTALTVVKQG  711
             N Q+ L+   D         ++WKQS +K  + +D++L+Q     SFYSGTTALTVVKQG
Sbjct  117   NIQQNLSMQTDQTHL--FPFNLWKQSCLKTYATIDEELKQHPRIDSFYSGTTALTVVKQG  174

Query  712   DVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGV  891
               +VVAN GDSRAVLA   DDG L ++QL+VD +PNLP E ERI +SKG+V    DEPGV
Sbjct  175   RHLVVANAGDSRAVLAVTSDDGCLKSIQLSVDFRPNLPEEAERIKQSKGKVLCLKDEPGV  234

Query  892   YRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGV  1071
             YRVW P+         PGLA+SRAFGDY  K +GLIS P+ + R IT +DQF I+ATDGV
Sbjct  235   YRVWTPDSGT------PGLAISRAFGDYCSKQYGLISVPDVSHRVITTKDQFVIVATDGV  288

Query  1072  WDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             WDV+SNQEAV IVS+ P R  SAKRLV+ A  AWK  +RG A DDMSAICLFFH
Sbjct  289   WDVMSNQEAVHIVSTTPNREMSAKRLVDCAARAWKSKKRGFARDDMSAICLFFH  342



>ref|NP_001055303.1| Os05g0358500 [Oryza sativa Japonica Group]
 sp|Q6L482.1|P2C48_ORYSJ RecName: Full=Probable protein phosphatase 2C 48; Short=OsPP2C48 
[Oryza sativa Japonica Group]
 gb|AAT38039.1| putative protein phosphatase 2C [Oryza sativa Japonica Group]
 gb|AAV43855.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17217.1| Os05g0358500 [Oryza sativa Japonica Group]
 gb|EAY97700.1| hypothetical protein OsI_19622 [Oryza sativa Indica Group]
Length=353

 Score =   359 bits (922),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 248/363 (68%), Gaps = 23/363 (6%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SSL  G A+++S    RK    D G+ AA            +L TSG +    S  
Sbjct  1     MRHISSLLQGLARSLSVGKERKGGDGDDGKAAAATATA-------VLRTSGTLWGEGSET  53

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A++ SR+G+KG NQD +IV E FG +E  + CG+FDGHG WGH VAK VRE +P +LL 
Sbjct  54    FAAVCSRRGEKGINQDCSIVCEGFGCEEGSVLCGIFDGHGQWGHYVAKAVRESLPPALLR  113

Query  538   NWQKA--LAHNMD--NLGFDNCLLDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTALTV  699
              W++A  LA  +D        C  D+W+QS++ AC+ VD +L   ++  + +SG TAL++
Sbjct  114   RWREAVTLAALIDGGEKRLCECRPDLWRQSYLAACAAVDAELRASRRLDAVHSGCTALSL  173

Query  700   VKQGDVMVVANVGDSRAVLATAD-DDGN---LVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             VK GD++VVANVGDSRAVLATA  DDG    L AVQLTVD KPNLP ERERIM   GRV 
Sbjct  174   VKHGDLLVVANVGDSRAVLATASPDDGGGARLAAVQLTVDFKPNLPQERERIMECNGRVQ  233

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
                DEPGV+RVW P+       EGPGLA+SRAFGDY +KD+G+IS PE T R IT +D F
Sbjct  234   CLADEPGVHRVWRPDR------EGPGLAMSRAFGDYCVKDYGVISAPEVTHRRITAQDHF  287

Query  1048  AILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLF  1227
              ILATDGVWDVVSN+EAV+IV+SAPER ++AKRLVE AV AW+R RRGIA+DD SAICLF
Sbjct  288   VILATDGVWDVVSNEEAVQIVASAPEREKAAKRLVEFAVRAWRRKRRGIAVDDCSAICLF  347

Query  1228  FHN  1236
             FH+
Sbjct  348   FHS  350



>ref|XP_004494569.1| PREDICTED: probable protein phosphatase 2C 73-like isoform X4 
[Cicer arietinum]
Length=287

 Score =   353 bits (907),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 170/281 (60%), Positives = 217/281 (77%), Gaps = 21/281 (7%)
 Frame = +1

Query  445   MIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKALAHNM---DNLGFDNC--------  591
             MIFCG+FDGHGPWGH VAKRVRE +P SLLCNWQ+ LA      D+   D+         
Sbjct  1     MIFCGIFDGHGPWGHFVAKRVRESMPRSLLCNWQETLASQSSLDDDKDIDHVKAVATDNK  60

Query  592   --LLDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTALTVVKQGDVMVVANVGDSRAVLA  759
                 ++WK S++K C+ +DQ+LE  ++  +FYSGTTAL++V+QG+++++ANVGDSRAVLA
Sbjct  61    QHRFNIWKHSYLKTCASIDQELEHNRKIDTFYSGTTALSIVRQGELIMIANVGDSRAVLA  120

Query  760   TADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEG  939
             T  D+G+L+AVQLTVD KPNLP E ERIM  +GRV+  +DEPGV+R+W+P+       E 
Sbjct  121   TTSDNGSLIAVQLTVDFKPNLPQEAERIMECQGRVFCLEDEPGVHRLWLPDG------ES  174

Query  940   PGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSA  1119
             PGLA+SRAFGDY IK++GLIS PE T+RNIT +D F +LATDGVWDV+SN+EAVEIVSS 
Sbjct  175   PGLAMSRAFGDYCIKEYGLISVPEVTYRNITTQDHFLVLATDGVWDVISNEEAVEIVSST  234

Query  1120  PERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHNKL  1242
              ++ +SAKRLVE AV AWKR RRGIA+DD+SAICLF H+ L
Sbjct  235   EDKAKSAKRLVECAVHAWKRKRRGIAIDDISAICLFLHSPL  275



>gb|EMS64498.1| putative protein phosphatase 2C 48 [Triticum urartu]
Length=391

 Score =   356 bits (913),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 192/389 (49%), Positives = 253/389 (65%), Gaps = 60/389 (15%)
 Frame = +1

Query  175   KMVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNE--LILSTSGFVNAIS  348
             +M Q SSL  G A+++                   AL KE ++ E   +L TSG +    
Sbjct  24    RMRQLSSLLQGLARSM-------------------ALGKERKEEEQGTVLRTSGTLRGEG  64

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S   A++ SR+G+KG NQD ++VWE FG QED IFCG+FDGHG WGH V+K VR+ +P S
Sbjct  65    SGTLAAVWSRRGEKGTNQDCSVVWEGFGCQEDTIFCGIFDGHGQWGHYVSKAVRDSLPPS  124

Query  529   LLCNWQKALA-HNMDNLGFDNC--LLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             LL  WQ+A+   ++ N     C    D+WKQS++ A + VD++L +  +  +  SG+TAL
Sbjct  125   LLRRWQEAVTLASLINGEKKLCDSQFDLWKQSYLAAAAAVDEELRRSRRLDAVNSGSTAL  184

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             +++K+GD MV+ANVGDSRAVL T  DDG++ AVQLTVD KPNLP E+ RI++ KGRV+  
Sbjct  185   SIIKKGDTMVIANVGDSRAVLGTTSDDGSIAAVQLTVDFKPNLPQEKARIVQCKGRVYCD  244

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             +DEPGV+RVW+P+       E PGLA+SRAFGDY +KD+G+IS PE T R IT RDQF I
Sbjct  245   EDEPGVHRVWLPDR------EAPGLAMSRAFGDYCVKDYGVISAPEVTQRRITARDQFVI  298

Query  1054  LATDGV----------------------------WDVVSNQEAVEIVSSAPERGESAKRL  1149
             LATDGV                            WDVVSN+EAV+IV++ PER ++AKRL
Sbjct  299   LATDGVSSQPPFYALAVGTILLHRLMVVEKWRQVWDVVSNEEAVQIVAATPEREKAAKRL  358

Query  1150  VEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             V+ AV AW+R RRG A+DD SAICLFFH+
Sbjct  359   VQWAVRAWRRKRRGYAVDDCSAICLFFHH  387



>ref|XP_010524559.1| PREDICTED: probable protein phosphatase 2C 41 isoform X1 [Tarenaya 
hassleriana]
Length=386

 Score =   353 bits (906),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 194/377 (51%), Positives = 256/377 (68%), Gaps = 16/377 (4%)
 Frame = +1

Query  118   EQLT*LCWLN-KE*SKIRAEKMVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKE  294
              QL  +C  N +E   I  +KMV   S  +G A+  S K  RKN  E+   +       +
Sbjct  20    HQLHNICNQNIEEEPLILPKKMVFLPSFLDGLARNASMKR-RKNIMEEERGKYIAEEMAK  78

Query  295   ARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGH  474
               K +    +SG V +  S   AS+ S++G+KG NQDRAIVWE FG Q+D+IFCG++DGH
Sbjct  79    EAKKKATACSSGTVRSECSKRFASVFSQRGEKGINQDRAIVWEGFGCQDDIIFCGMYDGH  138

Query  475   GPWGHLVAKRVRELVPSSLLCNWQKALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLE  654
             GPWGH++AKRV+   PSSLLC+WQ+ L+ + +     +   D+WK+S++KA S VD  L+
Sbjct  139   GPWGHVIAKRVKRSFPSSLLCHWQQILSSSPEY----SSPFDIWKESYLKAFSAVDLHLK  194

Query  655   --QQAGSFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDG-NLVAVQLTVDLKPNLP  825
                   S+ SG TAL+ V QG+ +V+AN GDSRAV+AT    G  LV VQL+VD KPN+P
Sbjct  195   LLPSIDSYRSGCTALSAVLQGNHLVIANAGDSRAVIATNSGFGYGLVPVQLSVDFKPNIP  254

Query  826   GERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISE  1005
              E ERI +S+GRV   +DEPG+YR+ MPN       + PGLAVSRAFGDY +KDFGLIS+
Sbjct  255   EEAERIKKSEGRVLCREDEPGIYRMCMPN------RDSPGLAVSRAFGDYCLKDFGLISK  308

Query  1006  PEFTFRNITFRDQFAILATDGVWDVVSNQEAVEI-VSSAPERGESAKRLVEHAVCAWKRT  1182
             P+ T+R IT +DQF ILATDGVWDV+SN+EAVEI V S  +R +SAKRLV+ A   W++ 
Sbjct  309   PDVTYREITDKDQFLILATDGVWDVMSNEEAVEIVVGSVTDRTKSAKRLVKRATRLWQKK  368

Query  1183  RRGIAMDDMSAICLFFH  1233
             RR +AMDD+SA+CLFFH
Sbjct  369   RRDVAMDDISALCLFFH  385



>ref|XP_010524561.1| PREDICTED: probable protein phosphatase 2C 41 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010524562.1| PREDICTED: probable protein phosphatase 2C 41 isoform X2 [Tarenaya 
hassleriana]
Length=346

 Score =   350 bits (897),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 187/356 (53%), Positives = 246/356 (69%), Gaps = 15/356 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             MV   S  +G A+  S K  RKN  E+   +       +  K +    +SG V +  S  
Sbjct  1     MVFLPSFLDGLARNASMKR-RKNIMEEERGKYIAEEMAKEAKKKATACSSGTVRSECSKR  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQDRAIVWE FG Q+D+IFCG++DGHGPWGH++AKRV+   PSSLLC
Sbjct  60    FASVFSQRGEKGINQDRAIVWEGFGCQDDIIFCGMYDGHGPWGHVIAKRVKRSFPSSLLC  119

Query  538   NWQKALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTALTVVKQG  711
             +WQ+ L+ + +     +   D+WK+S++KA S VD  L+      S+ SG TAL+ V QG
Sbjct  120   HWQQILSSSPEY----SSPFDIWKESYLKAFSAVDLHLKLLPSIDSYRSGCTALSAVLQG  175

Query  712   DVMVVANVGDSRAVLATADDDG-NLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPG  888
             + +V+AN GDSRAV+AT    G  LV VQL+VD KPN+P E ERI +S+GRV   +DEPG
Sbjct  176   NHLVIANAGDSRAVIATNSGFGYGLVPVQLSVDFKPNIPEEAERIKKSEGRVLCREDEPG  235

Query  889   VYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDG  1068
             +YR+ MPN +       PGLAVSRAFGDY +KDFGLIS+P+ T+R IT +DQF ILATDG
Sbjct  236   IYRMCMPNRD------SPGLAVSRAFGDYCLKDFGLISKPDVTYREITDKDQFLILATDG  289

Query  1069  VWDVVSNQEAVEI-VSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             VWDV+SN+EAVEI V S  +R +SAKRLV+ A   W++ RR +AMDD+SA+CLFFH
Sbjct  290   VWDVMSNEEAVEIVVGSVTDRTKSAKRLVKRATRLWQKKRRDVAMDDISALCLFFH  345



>ref|XP_006297925.1| hypothetical protein CARUB_v10013967mg [Capsella rubella]
 gb|EOA30823.1| hypothetical protein CARUB_v10013967mg [Capsella rubella]
Length=306

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 221/308 (72%), Gaps = 16/308 (5%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SS+FNG A++ S K  +  + +   +EAA+ +A+EA+K ELIL +SG +NA  S+N
Sbjct  1     MGHLSSMFNGLARSFSIKKAKSKNGQSYAKEAADEMAREAKKKELILRSSGCINADGSNN  60

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ SR+G+KG NQD AIVW+ FG QEDMIFCG+FDGHGPWGH V+K+VR  +P SLLC
Sbjct  61    LASVFSRRGEKGVNQDCAIVWDRFGNQEDMIFCGIFDGHGPWGHFVSKQVRNSMPISLLC  120

Query  538   NWQKALAH--------NMDNLGFDNCLLDVWKQSHIKACSEVDQQLE--QQAGSFYSGTT  687
             NW++ L+         ++D          +WK S++K C  VD++LE  ++  SF SGTT
Sbjct  121   NWKETLSQTTLAEPETDLDESDKKLQRFAIWKYSYLKTCEAVDRELEHHRKIDSFNSGTT  180

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             ALTVV+QG+V+ +ANVGDSRAVLAT  D+G+LV VQLTVD KPNLP E ERI+R  GRV+
Sbjct  181   ALTVVRQGEVIYIANVGDSRAVLATVSDEGSLVPVQLTVDFKPNLPQEEERIIRCNGRVF  240

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
                DEPGV+RVW P        E PGLA+SRAFGDY IK++GL+S PE T R+I+ RDQF
Sbjct  241   CLQDEPGVHRVWQPEE------EYPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISTRDQF  294

Query  1048  AILATDGV  1071
              ILATDGV
Sbjct  295   VILATDGV  302



>ref|XP_008458396.1| PREDICTED: probable protein phosphatase 2C 73 [Cucumis melo]
Length=351

 Score =   344 bits (883),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/312 (56%), Positives = 217/312 (70%), Gaps = 10/312 (3%)
 Frame = +1

Query  304   NELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPW  483
             N+ ++  SG        + AS+ S++G KG NQD  ++WE+FG Q D++ CG+FDGHGPW
Sbjct  43    NKSMICLSGSFKTSKFEDMASVCSKRGNKGINQDSLVLWEDFGCQADVVLCGMFDGHGPW  102

Query  484   GHLVAKRVRELVPSSLLCNWQKALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQA  663
             GH+++K+VR+ +PS LL N QK L+   D         ++WKQS +K  + +D++L+Q  
Sbjct  103   GHMISKQVRKSLPSQLLTNIQKNLSMQTDQTHLFP--FNLWKQSCLKTYAAIDEELKQHP  160

Query  664   --GSFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERE  837
                SFYSGTTALTVVKQG  +VVAN GDSRAVLA   DDG L  VQL+VD +PNLP E E
Sbjct  161   RIDSFYSGTTALTVVKQGRHLVVANAGDSRAVLAVTSDDGCLKPVQLSVDFRPNLPEEAE  220

Query  838   RIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFT  1017
             RI +SKG+V    DEPGVYRVW P+         PGLA+SRAFGDY  K +GLIS P+ +
Sbjct  221   RIKQSKGKVLCLKDEPGVYRVWTPDSGT------PGLAISRAFGDYCSKQYGLISVPDVS  274

Query  1018  FRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIA  1197
              R IT  DQF I+ATDGVWDV+SNQEAV IVS+ P R  SAKRLV+ A  AWK  +RG A
Sbjct  275   HRVITMEDQFVIVATDGVWDVMSNQEAVHIVSTTPNREMSAKRLVDCAARAWKSKKRGFA  334

Query  1198  MDDMSAICLFFH  1233
              DDMSAICLFFH
Sbjct  335   RDDMSAICLFFH  346



>ref|XP_007031062.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
 gb|EOY11564.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
Length=296

 Score =   339 bits (870),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 173/302 (57%), Positives = 217/302 (72%), Gaps = 27/302 (9%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M  FSS+FNG A++ S + G KNS  D GREAA A+AK+A+KN+LIL +SGFVN   S+N
Sbjct  1     MRHFSSMFNGLARSFSIRRG-KNSENDDGREAAEAMAKDAKKNDLILRSSGFVNVDGSNN  59

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              AS+ S++G+KG NQD             M+FCG+FDGHGPWGH VAK+VRE +PSSLLC
Sbjct  60    LASVFSKRGRKGVNQDY------------MLFCGIFDGHGPWGHFVAKKVRESLPSSLLC  107

Query  538   NWQKALAHNMDNLGFD------NCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTAL  693
             +WQ+ LA    +   D      +   D+WK S++K C+ VDQ+L+Q  +  SFYSGTTAL
Sbjct  108   HWQETLAQTSLDPDIDLESDKKHQRFDIWKHSYLKTCAAVDQELQQYRKIDSFYSGTTAL  167

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+V+QGD+M VAN+GDSRAVLAT  DDG+LV VQLTVD KPNLP E ERI++ KGRV+  
Sbjct  168   TIVRQGDLMYVANIGDSRAVLATTSDDGDLVPVQLTVDFKPNLPQEAERIIQCKGRVFCL  227

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEPGV+RVW+P+       E PGLA+SRAFGDY IK++GLIS PE T R IT RDQF  
Sbjct  228   HDEPGVHRVWLPDE------ESPGLAMSRAFGDYCIKEYGLISVPEVTQRQITSRDQFVY  281

Query  1054  LA  1059
              +
Sbjct  282   FS  283



>gb|EMT18540.1| Putative protein phosphatase 2C 48 [Aegilops tauschii]
Length=377

 Score =   335 bits (859),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 187/398 (47%), Positives = 244/398 (61%), Gaps = 70/398 (18%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNE--LILSTSGFVNAISS  351
             M Q SSL    A+++                   AL KE ++ E   +L TSG +    S
Sbjct  1     MWQLSSLLQRLARSM-------------------ALGKERKEEEQGTVLRTSGTLRGEGS  41

Query  352   HNCASLHSRQGKKGANQDRAIVWEE-----------------------------------  426
                A++ SR+G+KG NQD ++VWE                                    
Sbjct  42    GTFAAVWSRRGEKGTNQDCSVVWEASGYDCDGRKRCIAYIALPVVCVNKDRLHEKRKIST  101

Query  427   ---FGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKA--LAHNMD-NLGFDN  588
                FG Q+D IFCG+FDGHG WGH V+K VR+ +P SLLC W +A  LA  +D      +
Sbjct  102   KRGFGCQDDTIFCGIFDGHGQWGHYVSKAVRDSLPPSLLCRWHEAVSLASLIDGEKKLCD  161

Query  589   CLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTTALTVVKQGDVMVVANVGDSRAVLAT  762
                D+WKQS++ A + VD +L +  +  +  SG+TAL++VK+GD M +ANVGDSRAVL T
Sbjct  162   SHFDLWKQSYLAAAAAVDDELRRSRRLDAVNSGSTALSIVKKGDTMGIANVGDSRAVLGT  221

Query  763   ADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGP  942
               DDG++ AVQLTVD KPNLP E+ RI++ KGRV   DDEPGV+RVW+P+       E P
Sbjct  222   MSDDGSVAAVQLTVDFKPNLPQEKARIVQCKGRVHCHDDEPGVHRVWLPHR------EAP  275

Query  943   GLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAP  1122
             GLA+SRAFGDY +KD+G+IS PE T R I  RDQF ILATDGVWDVVSN+EAV+IV++ P
Sbjct  276   GLAMSRAFGDYCVKDYGVISAPEVTQRRIAARDQFVILATDGVWDVVSNEEAVQIVAATP  335

Query  1123  ERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             +R ++A  LV+ AV AW+R RRG A+DD SAICLF H+
Sbjct  336   DREKAANHLVQCAVRAWRRKRRGYAVDDCSAICLFLHH  373



>ref|NP_001030713.1| putative protein phosphatase 2C [Arabidopsis thaliana]
 gb|AEE75868.1| putative protein phosphatase 2C [Arabidopsis thaliana]
Length=315

 Score =   327 bits (837),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 216/302 (72%), Gaps = 11/302 (4%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSR-EDVGREAANALAKEARKNELILSTSGFVNAISSH  354
             MV   +  +G A+T+S K G+K S  ED GRE A ++ K+++KN  +L TSGFV++ SS 
Sbjct  1     MVLLPAFLDGLARTVSTKKGKKLSEDEDGGREIAKSMIKDSKKNSTLLGTSGFVSSESSK  60

Query  355   NCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL  534
                S+ S +G+KG NQDRAIVWE FG QED+ FCG+FDGHGPWGH++AKRV++  PSSLL
Sbjct  61    RFTSICSNRGEKGINQDRAIVWEGFGCQEDITFCGMFDGHGPWGHVIAKRVKKSFPSSLL  120

Query  535   CNWQKALAHNMDNLGFDNCLLDVWKQSHIKACS--EVDQQLEQQAGSFYSGTTALTVVKQ  708
             C WQ+ LA    +    +   D+WKQ+ +K  S  ++D ++     S+ SG TALT V Q
Sbjct  121   CQWQQTLASLSSSPECSS-PFDLWKQACLKTFSIIDLDLKISPSIDSYCSGCTALTAVLQ  179

Query  709   GDVMVVANVGDSRAVLATADDDGN-LVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEP  885
             GD +V+AN GDSRAV+AT  DDGN LV VQL+VD KPN+P E ERI +S GR++  DDEP
Sbjct  180   GDHLVIANAGDSRAVIATTSDDGNGLVPVQLSVDFKPNIPEEAERIKQSDGRLFCLDDEP  239

Query  886   GVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATD  1065
             GVYRV M  PNGG      GLAVSRAFGDY +KDFGL+SEPE T+R IT +DQF ILATD
Sbjct  240   GVYRVGM--PNGGSL----GLAVSRAFGDYCLKDFGLVSEPEVTYRKITDKDQFLILATD  293

Query  1066  GV  1071
             GV
Sbjct  294   GV  295



>ref|XP_002986464.1| hypothetical protein SELMODRAFT_235030 [Selaginella moellendorffii]
 gb|EFJ12321.1| hypothetical protein SELMODRAFT_235030 [Selaginella moellendorffii]
Length=468

 Score =   316 bits (809),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 162/346 (47%), Positives = 220/346 (64%), Gaps = 22/346 (6%)
 Frame = +1

Query  241   KNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIVW  420
             ++SR+ + REA   LA EA+ ++ +    G +    S N   L S+QG+KG NQD  I W
Sbjct  19    RSSRKTLKREAKEVLAVEAKNDQQLACFPGRLCTNGSSNSCCLFSQQGRKGVNQDAMIAW  78

Query  421   EEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKALAHNMDNLGFDNC---  591
             E F  +ED  FCGVFDGHGP+GHLVA+RVR+ +P  L+ NWQ++     D +   +    
Sbjct  79    ESFASREDTAFCGVFDGHGPYGHLVARRVRDSLPLKLVLNWQESECAKNDEIKIPSKRND  138

Query  592   -----------LLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVVAN  732
                        L   WK  H+KA   +D++L+       F SGTTA+TV+KQG  + + N
Sbjct  139   EEGDEAAAEYDLFCTWKDLHLKAFKVMDRELQVHPSIDCFCSGTTAVTVLKQGQDLFIGN  198

Query  733   VGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPN  912
             VGDSRA+L T  +DG+  AV LTVDLKPNLP E ERI + KGRV++  DEP V+RVW+P+
Sbjct  199   VGDSRAILGTTAEDGSFSAVPLTVDLKPNLPKEAERIRQCKGRVFALHDEPEVHRVWLPH  258

Query  913   PNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQ  1092
              N       PGLA++RAFGD+ +KDFG+I+ PE  +R ++ RD+F +LATDGVWDV+SN+
Sbjct  259   ENS------PGLAMARAFGDFCLKDFGVIAVPEVYYRRLSDRDKFVVLATDGVWDVLSNE  312

Query  1093  EAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             E V I+SS P R  +A+ LVE AV AW        +DD +A+CLF 
Sbjct  313   EVVNIISSHPTRSTAARTLVEAAVHAWMLKYPTSKIDDCAAVCLFL  358



>ref|XP_002978948.1| hypothetical protein SELMODRAFT_153020 [Selaginella moellendorffii]
 gb|EFJ19905.1| hypothetical protein SELMODRAFT_153020 [Selaginella moellendorffii]
Length=470

 Score =   316 bits (809),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 162/346 (47%), Positives = 220/346 (64%), Gaps = 22/346 (6%)
 Frame = +1

Query  241   KNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIVW  420
             ++SR+ + REA   LA EA+ ++ +    G +    S N   L S+QG+KG NQD  I W
Sbjct  19    RSSRKTLKREAKEVLAVEAKNDQQLACFPGRLCTNGSSNSCCLFSQQGRKGVNQDAMIAW  78

Query  421   EEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKALAHNMDNLGFDNC---  591
             E F  +ED  FCGVFDGHGP+GHLVA+RVR+ +P  L+ NWQ++     D +   +    
Sbjct  79    ESFASREDTAFCGVFDGHGPYGHLVARRVRDSLPLKLVLNWQESECAKNDEIKIPSKRND  138

Query  592   -----------LLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVVAN  732
                        L   WK  H+KA   +D++L+       F SGTTA+TV+KQG  + + N
Sbjct  139   EEGDEAAAEYDLFCTWKDLHLKAFKVMDRELQVHPSIDCFCSGTTAVTVLKQGQDLFIGN  198

Query  733   VGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPN  912
             VGDSRA+L T  +DG+  AV LTVDLKPNLP E ERI + KGRV++  DEP V+RVW+P+
Sbjct  199   VGDSRAILGTTAEDGSFSAVPLTVDLKPNLPKEAERIRQCKGRVFALHDEPEVHRVWLPH  258

Query  913   PNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQ  1092
              N       PGLA++RAFGD+ +KDFG+I+ PE  +R ++ RD+F +LATDGVWDV+SN+
Sbjct  259   ENS------PGLAMARAFGDFCLKDFGVIAVPEVYYRRLSDRDKFVVLATDGVWDVLSNE  312

Query  1093  EAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             E V I+SS P R  +A+ LVE AV AW        +DD +A+CLF 
Sbjct  313   EVVNIISSHPTRSTAARTLVEAAVHAWMLKYPTSKIDDCAAVCLFL  358



>gb|EMT22010.1| Putative protein phosphatase 2C 48 [Aegilops tauschii]
Length=327

 Score =   310 bits (794),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 223/385 (58%), Gaps = 92/385 (24%)
 Frame = +1

Query  169   AEKMVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAIS  348
             A +M Q SSL  G A+ ++ K                   KE      +L  SG +    
Sbjct  2     AARMRQLSSLLQGLARLMAGKE-----------------RKEEDPQGTVLRMSGTLRGEG  44

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S   A++ SR+G+KG NQD ++VWE FG Q+D +FCG+FDGHG WGH V+K VR+ +PSS
Sbjct  45    SGTLAAVWSRRGEKGTNQDCSVVWEGFGCQDDTVFCGIFDGHGQWGHYVSKAVRDSLPSS  104

Query  529   LLCNWQKALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQAGSFYSGTTALTVVKQ  708
             L                                         ++  +  SG+TAL++VK+
Sbjct  105   LF----------------------------------------RRLDAVNSGSTALSIVKK  124

Query  709   GDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPG  888
             G++MV+ANVGDSRAVL T  DDG++ AVQLTVD KPNLP E+ RI++ KGRV   +DEPG
Sbjct  125   GNMMVIANVGDSRAVLGTTSDDGSIAAVQLTVDFKPNLPQEKARIVQCKGRVHCHEDEPG  184

Query  889   VYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDG  1068
             V+RVW+P+       E PGLA+SRAFGDY +KD+G+IS PE T R IT RDQF ILATDG
Sbjct  185   VHRVWLPDR------EAPGLAMSRAFGDYCVKDYGVISAPEVTQRKITARDQFVILATDG  238

Query  1069  -----------------------------VWDVVSNQEAVEIVSSAPERGESAKRLVEHA  1161
                                          VWDVV+N+EAV+IV+  PER ++AKRLV+ A
Sbjct  239   VRDKFLLSMVVPFLCALPHHLMDVEKWGQVWDVVTNEEAVQIVADTPEREKAAKRLVQCA  298

Query  1162  VCAWKRTRRGIAMDDMSAICLFFHN  1236
             V AW+R RRG A+DD SAICLF H+
Sbjct  299   VRAWRRKRRGYAVDDCSAICLFLHH  323



>ref|XP_006655232.1| PREDICTED: probable protein phosphatase 2C 48-like [Oryza brachyantha]
Length=293

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 181/358 (51%), Positives = 215/358 (60%), Gaps = 73/358 (20%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
             M   SSL  G A+++S    RK   +D                  +L  SG V    S  
Sbjct  1     MRHISSLLQGLARSLSVGKERKAGDDDA---------------TAVLRASGAVWGEGSET  45

Query  358   CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
              A++ SR+G+KG NQD +IV E FG +E  +FCG+FDGHG WGH VAK VRE +P +LL 
Sbjct  46    LAAVCSRRGEKGINQDCSIVCEGFGCEEGSVFCGIFDGHGQWGHYVAKAVRESLPPALL-  104

Query  538   NWQKALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQAGSFYSGTTALTVVKQGDV  717
                                                            G TAL+VVKQGD+
Sbjct  105   ----------------------------------------------RGCTALSVVKQGDL  118

Query  718   MVVANVGDSRAVLATADDDGNLVA-----VQLTVDLKPNLPGERERIMRSKGRVWSSDDE  882
             +VVANVGDSRAVL TA DD +  +     VQLTVD KPNLP ERERIM   GRV    DE
Sbjct  119   LVVANVGDSRAVLGTAADDDDAASGAVAAVQLTVDFKPNLPQERERIMECNGRVQCLADE  178

Query  883   PGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILAT  1062
             PGV+RVW P+       EGPGLA+SRAFGDY +KD G+IS PE T R IT RDQF ILAT
Sbjct  179   PGVHRVWRPDR------EGPGLAMSRAFGDYCVKDCGVISAPEVTQRRITGRDQFVILAT  232

Query  1063  DGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             DGVWDVVSN+EAV+IV++APER ++AKRLVE AV AW+R RRGIA+DD SAICLFFH+
Sbjct  233   DGVWDVVSNEEAVQIVATAPEREKAAKRLVEFAVRAWRRKRRGIAVDDCSAICLFFHS  290



>ref|XP_010027087.1| PREDICTED: probable protein phosphatase 2C 41 [Eucalyptus grandis]
Length=294

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 162/275 (59%), Positives = 195/275 (71%), Gaps = 16/275 (6%)
 Frame = +1

Query  178  MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
            MV   +  +G AKTIS + G K+   DVGREAAN LAKEAR+NE ILS++  V    S  
Sbjct  18   MVLLPTFLDGLAKTISSRKG-KSCPCDVGREAANTLAKEARRNESILSSTAAVKISKSSR  76

Query  358  CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
             AS  S++G+KG NQD  I+WEEFG QEDM FCGVFDGHGPWGH VAKRVREL+PS LLC
Sbjct  77   LASACSKRGRKGVNQDCFILWEEFGCQEDMTFCGVFDGHGPWGHAVAKRVRELLPSFLLC  136

Query  538  NWQKALAHNMDN-----LGFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTA  690
             WQ+AL           + FD  L   D+WKQS +K  + VDQ+L+  +   +F SGTTA
Sbjct  137  KWQEALGVGSSQDWNFEMEFDANLQHFDIWKQSFLKTYAAVDQELKLHRSIDTFCSGTTA  196

Query  691  LTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWS  870
             T+VKQG+ +++AN+GDSRAVLAT DDDG+LV +QLT+D KPNLP E ERI +SKGRV+ 
Sbjct  197  STIVKQGENLLIANIGDSRAVLATTDDDGSLVPLQLTIDFKPNLPQEAERIKQSKGRVFC  256

Query  871  SDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDY  975
            S DEPG+YRVWMPN       E  GLAVS AFGDY
Sbjct  257  SHDEPGLYRVWMPND------ETLGLAVSSAFGDY  285



>gb|EYU39712.1| hypothetical protein MIMGU_mgv1a008325mg [Erythranthe guttata]
Length=377

 Score =   309 bits (791),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 161/337 (48%), Positives = 214/337 (64%), Gaps = 45/337 (13%)
 Frame = +1

Query  331   FVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVR  510
             F+N   S + ASL ++QGKKG NQD  +VWE FG + D +FCGVFDGHGP+GH+VAKRVR
Sbjct  2     FLNG--SSDVASLFTQQGKKGTNQDAMVVWENFGSRTDTVFCGVFDGHGPYGHMVAKRVR  59

Query  511   ELVPSSLLCNWQ---------------------------KALAHN---MDNLGFDNCL--  594
             + +P  L+ NW+                             L+ N   M ++  +  L  
Sbjct  60    DSLPLMLIANWEVNNIKSGEILREVSLNTTESLSTEEASSCLSANEEVMSSIDSEEALKQ  119

Query  595   ---LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVVANVGDSRAVLA  759
                    K+S + A   +D++L        FYSGTTA+T VKQG  +V+ NVGDSRAVLA
Sbjct  120   QGVFQALKKSFLNAFKVMDRELRMYTNIDCFYSGTTAVTFVKQGQHLVIGNVGDSRAVLA  179

Query  760   TADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEG  939
             T D++  L AVQLTVDLKPNLP E ERI + KGRV++  DEP V RVW+PN N       
Sbjct  180   TRDENNKLTAVQLTVDLKPNLPAEEERIRKCKGRVFALQDEPEVARVWLPNNNS------  233

Query  940   PGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSA  1119
             PGLA++RAFGD+ +KDFGLIS PE ++R+IT +D+F +LATDG+WDV+SN+E V+IVSS 
Sbjct  234   PGLAMARAFGDFCLKDFGLISVPEISYRHITNKDEFVVLATDGIWDVLSNKEVVKIVSSC  293

Query  1120  PERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             P R ++A+ +VE AV AW+       +DD + +CLF 
Sbjct  294   PSRSQAARAVVETAVRAWRSKYPTSKVDDCAVVCLFL  330



>ref|XP_002992818.1| hypothetical protein SELMODRAFT_187001 [Selaginella moellendorffii]
 gb|EFJ06108.1| hypothetical protein SELMODRAFT_187001 [Selaginella moellendorffii]
Length=463

 Score =   308 bits (790),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 164/357 (46%), Positives = 228/357 (64%), Gaps = 31/357 (9%)
 Frame = +1

Query  232   SGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRA  411
             SGRK+ +++     A     + R   L L T    +  +S++ A L ++QG+KG NQD  
Sbjct  15    SGRKDRKKEAREALAAEARHDQR---LALVTGRICSNGASNSAACLFTQQGRKGVNQDAM  71

Query  412   IVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKAL-AHNMDNLGFDN  588
             IVWE F  ++D  FCGVFDGHGP+GHLVA+RVR+ +PS LL  WQ+A  + N+ + G   
Sbjct  72    IVWESFCSRKDTTFCGVFDGHGPYGHLVARRVRDSLPSKLLAYWQEATESKNLSDGGESE  131

Query  589   C-------------------LLDVWKQSHIKACSEVDQQLEQQA--GSFYSGTTALTVVK  705
                                 +  VWK++H+K+   +D+ L        F SGTTA+T++K
Sbjct  132   KAEEQVLPGSDSGEEAQEPEMFKVWKETHLKSYKVMDKDLRVHPIIDCFCSGTTAVTLIK  191

Query  706   QGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEP  885
             QGD +V+ NVGDSRAV+ +  DD ++ AVQLTVDLKPNLP E ERI + KGRV++  DEP
Sbjct  192   QGDELVLGNVGDSRAVMGSRADDNSIRAVQLTVDLKPNLPEEAERIRQCKGRVFALHDEP  251

Query  886   GVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATD  1065
              V RVW+P+ N       PGLA++RAFGD+ +KDFG+I+ PE ++  IT RDQF +LATD
Sbjct  252   EVARVWLPHDNS------PGLAMARAFGDFCLKDFGVIAVPEVSYYRITERDQFVVLATD  305

Query  1066  GVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             GVWDV+SN+E V+IV++AP +  SA+ LVE AV AW+       MDD + +CL+ + 
Sbjct  306   GVWDVLSNEEVVKIVATAPTKTTSARSLVESAVRAWRLKYPTSKMDDCAVVCLYLNK  362



>ref|XP_002987553.1| hypothetical protein SELMODRAFT_183192 [Selaginella moellendorffii]
 gb|EFJ11389.1| hypothetical protein SELMODRAFT_183192 [Selaginella moellendorffii]
Length=464

 Score =   308 bits (788),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 164/357 (46%), Positives = 227/357 (64%), Gaps = 31/357 (9%)
 Frame = +1

Query  232   SGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRA  411
             SGRK+ + +     A     + R   L L T    +  +S++ A L ++QG+KG NQD  
Sbjct  15    SGRKDRKREAREALAAEARHDQR---LALVTGRICSNGASNSAACLFTQQGRKGVNQDAM  71

Query  412   IVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKAL-AHNMDNLGFDN  588
             IVWE F  ++D  FCGVFDGHGP+GHLVA+RVR+ +PS LL  WQ+A  + N+ + G   
Sbjct  72    IVWESFCSRKDTTFCGVFDGHGPYGHLVARRVRDSLPSKLLAYWQEATESKNLSDGGESE  131

Query  589   C-------------------LLDVWKQSHIKACSEVDQQLEQQA--GSFYSGTTALTVVK  705
                                 +  VWK++H+K+   +D+ L        F SGTTA+T++K
Sbjct  132   KAEEQVLPGSDSGEEAQEPEMFKVWKETHLKSYKVMDKDLRVHPIIDCFCSGTTAVTLIK  191

Query  706   QGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEP  885
             QGD +V+ NVGDSRAV+ +  DD ++ AVQLTVDLKPNLP E ERI + KGRV++  DEP
Sbjct  192   QGDELVLGNVGDSRAVMGSRADDNSIRAVQLTVDLKPNLPEEAERIRQCKGRVFALHDEP  251

Query  886   GVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATD  1065
              V RVW+P+ N       PGLA++RAFGD+ +KDFG+I+ PE ++  IT RDQF +LATD
Sbjct  252   EVARVWLPHDNS------PGLAMARAFGDFCLKDFGVIAVPEVSYYRITERDQFVVLATD  305

Query  1066  GVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             GVWDV+SN+E V+IV++AP +  SA+ LVE AV AW+       MDD + +CL+ + 
Sbjct  306   GVWDVLSNEEVVKIVATAPTKTTSARSLVESAVRAWRLKYPTSKMDDCAVVCLYLNK  362



>ref|XP_010549876.1| PREDICTED: probable protein phosphatase 2C 33 [Tarenaya hassleriana]
Length=565

 Score =   309 bits (792),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 173/381 (45%), Positives = 232/381 (61%), Gaps = 37/381 (10%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIV  417
             RKNS++   R  +   + + R+ E +    G +    S   ASL ++QGKKG NQD  IV
Sbjct  117   RKNSKK---RPGSRNSSFDYRREEPLHRIPGRMFLNGSSEIASLFTQQGKKGLNQDAMIV  173

Query  418   WEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQ-KALAHNMDNLGF----  582
             WE FG + D IF GVFDGHGP+GHLVAKRVR+ +P  L  +W+ KA   +    G     
Sbjct  174   WENFGSRADTIFTGVFDGHGPYGHLVAKRVRDSLPLKLSAHWEAKAPVEDALKAGMNSKD  233

Query  583   -------------------DNC--LLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTAL  693
                                ++C  +    K+S +KA   +D++L+  A    F SGTTA+
Sbjct  234   AAFVSAEEESRPSVDLDDTEDCPEIFRTLKESFLKAFKVMDRELKFHANVDCFCSGTTAV  293

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+VKQG  +VV NVGDSRAVL T +D+  LVAVQLTVDLKPNLP E ERI + +GRV++ 
Sbjct  294   TLVKQGRYLVVGNVGDSRAVLGTRNDENALVAVQLTVDLKPNLPAEAERIRKCRGRVFAL  353

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
              DEP V RVW+PN +       PGLA++RAFGD+ +KDFGLIS P+ +FR +T RD+F +
Sbjct  354   QDEPEVSRVWLPNNDS------PGLAMARAFGDFCLKDFGLISVPDVSFRRLTERDEFIV  407

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             LATDG+WDV+SN+E VEIV+S P RG +A+ LVE AV AW+       +DD + +CLF  
Sbjct  408   LATDGIWDVLSNEEVVEIVASVPARGSAARALVETAVRAWRYKYPTSKVDDCAVVCLFLD  467

Query  1234  NKLIV*rrrrrrLHDMMQKQP  1296
             +  +V            Q +P
Sbjct  468   SNSMVTSTASVTGPKRQQAKP  488



>ref|XP_008244425.1| PREDICTED: probable protein phosphatase 2C 33 [Prunus mume]
Length=409

 Score =   304 bits (778),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 167/350 (48%), Positives = 224/350 (64%), Gaps = 29/350 (8%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELIL---STSGFVNAISSHNCASLHSRQGKKGANQDR  408
             ++  R   G  +A A+A  +   E+ L       F+N   S + ASL  +QGKKG NQD 
Sbjct  40    KRRKRRVTGNSSATAVAPPSNNLEMWLHRIPGRQFLNG--SSDFASLFCKQGKKGVNQDA  97

Query  409   AIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNW-------------QK  549
              I WE FG   D IFCGVFDGHGP+GH+VAK+VR+ +P  L   W               
Sbjct  98    MIAWENFG-SPDTIFCGVFDGHGPFGHVVAKKVRDALPLKLTSQWVLTNNAKKGAADDTN  156

Query  550   ALAHNMDNLGFDNC-LLDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTALTVVKQGDVM  720
               A   D+   D+C L    K S +KA   +D++L+   +   + SGTTA+T+VKQG  +
Sbjct  157   ETASYQDHKDNDHCELFMTLKDSFLKAFKVMDKELKLHPRIDCYCSGTTAVTLVKQGQDL  216

Query  721   VVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRV  900
             V+ANVGDSRA+L T D+DG+LVAVQLTVDLKPNLP E ERIMR KGRV++  +EP V RV
Sbjct  217   VIANVGDSRALLGTRDEDGSLVAVQLTVDLKPNLPRETERIMRCKGRVFALQNEPEVARV  276

Query  901   WMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDV  1080
             W+PN N       PGLA++RAFGD+ +KDFGLIS P+ ++R +T +D+F +LATDG+WDV
Sbjct  277   WLPNSN------SPGLAMARAFGDFCLKDFGLISVPDISYRRLTEKDEFVVLATDGIWDV  330

Query  1081  VSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             +SN+E V+IV+ AP R  +A+ LVE A  AW+     + +DD + +CLF 
Sbjct  331   LSNEEVVKIVALAP-RASAARALVESATRAWRSKYPYVKVDDCAVVCLFL  379



>ref|XP_011084661.1| PREDICTED: probable protein phosphatase 2C 33 [Sesamum indicum]
Length=485

 Score =   305 bits (780),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 165/366 (45%), Positives = 224/366 (61%), Gaps = 44/366 (12%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIV  417
             RK S+  +G   ++    + R+ E +  T G +    S   ASL ++QGKKG NQD  IV
Sbjct  23    RKGSKRRLGSRNSSF---DYRREEQLHRTPGRMFLNGSSEIASLFTQQGKKGTNQDAMIV  79

Query  418   WEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQ-----------------  546
             WE FG ++D +FCGVFDGHGP+GH+VAKRVR+ +P  L  +W+                 
Sbjct  80    WENFGSRKDTVFCGVFDGHGPYGHMVAKRVRDSLPLKLNAHWEANNKSDEILREVSLNTT  139

Query  547   ---------------KALAH-NMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQAG--SF  672
                            +A A  ++   G D  +    K+S +KA   +D++L   A    F
Sbjct  140   GSLCTEDTSFLSADEEARASIDVGETGKDTDVFQTLKESFLKAFKVMDRELRMYANIDCF  199

Query  673   YSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRS  852
              SGTTA+T+VKQ   +V+ NVGDSRAVL T D++ +L AVQLTVDLKPNLP E ERI + 
Sbjct  200   CSGTTAVTMVKQDQDLVIGNVGDSRAVLGTRDENNSLTAVQLTVDLKPNLPAEEERIRKC  259

Query  853   KGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNIT  1032
             KGRV++  DEP V RVW+PN N       PGLA++RAFGD+ +K+FGLIS PE ++R IT
Sbjct  260   KGRVFALQDEPDVARVWLPNSNA------PGLAMARAFGDFCLKEFGLISVPEISYRQIT  313

Query  1033  FRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMS  1212
              +D+F +LATDG+WDV+SN+E V+IV S P R  +A+ LVE AV AW+       +DD +
Sbjct  314   DKDEFVVLATDGIWDVLSNEEVVDIVGSCPSRSYAARTLVESAVKAWRSKYPTSKIDDCA  373

Query  1213  AICLFF  1230
              +CLF 
Sbjct  374   VVCLFL  379



>dbj|BAJ34625.1| unnamed protein product [Thellungiella halophila]
Length=256

 Score =   296 bits (758),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 154/263 (59%), Positives = 189/263 (72%), Gaps = 14/263 (5%)
 Frame = +1

Query  460   VFDGHGPWGHLVAKRVRELVPSSLLCNWQKALAHNMDNLGFDNCL--LDVWKQSHIKACS  633
             +FDGHGPWGH+++KRV++  PSSLLC WQ+ LA    +     C    D+WKQS +K  S
Sbjct  1     MFDGHGPWGHVISKRVKKSFPSSLLCQWQQTLASLSSS---PECFSPFDLWKQSCLKTFS  57

Query  634   --EVDQQLEQQAGSFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGN-LVAVQLTV  804
               ++D ++     S+ SG TALT V QGD +VVAN GDSRAV+AT  DDGN LV VQL+V
Sbjct  58    IIDLDLKINPSIDSYCSGCTALTAVLQGDHLVVANAGDSRAVIATTSDDGNGLVPVQLSV  117

Query  805   DLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIK  984
             D KPN+P E ERI +S GR++   DEPGVYRV MPN       E  GLAVSRAFGDY +K
Sbjct  118   DFKPNIPEEAERIKQSDGRLFCLADEPGVYRVGMPNG------ESLGLAVSRAFGDYCLK  171

Query  985   DFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAV  1164
             DFGL+S P  T+R IT +DQF ILATDG+WDV++N EAVEIV    +R +SAKRLVE A+
Sbjct  172   DFGLVSVPAVTYRKITEKDQFLILATDGMWDVMTNDEAVEIVRGVRDRRKSAKRLVERAM  231

Query  1165  CAWKRTRRGIAMDDMSAICLFFH  1233
               W+R RR IAMDD+SA+CLFFH
Sbjct  232   ILWRRKRRSIAMDDISALCLFFH  254



>ref|XP_002325473.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|ABK95223.1| unknown [Populus trichocarpa]
 gb|EEE99854.1| phosphatase 2C family protein [Populus trichocarpa]
Length=493

 Score =   303 bits (775),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 227/371 (61%), Gaps = 44/371 (12%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIV  417
             RKNS++   R  +   + + R+ E +    G +    S + ASL ++QGKKG NQD  IV
Sbjct  27    RKNSKK---RPGSRNSSFDYRREEPLHRIPGRLFLNGSSDIASLFTQQGKKGTNQDAMIV  83

Query  418   WEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKALAH------------  561
             WE FG + D +FCGVFDGHGP+GH+VAKRVR+ +P  L  +W+  +A             
Sbjct  84    WENFGSRRDAVFCGVFDGHGPYGHMVAKRVRDSLPLKLTAHWEVNVASEDVLREISLNTT  143

Query  562   ---NMDNLGFDNC------------------LLDVWKQSHIKACSEVDQQLEQQAG--SF  672
                N ++  F +                   +    K+S +KA   +D++L        F
Sbjct  144   GSMNSEDTSFISADDESRASVDLEDAEKHPEIFQTLKESFLKAFKIMDRELRVHTNIDCF  203

Query  673   YSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRS  852
              SGTTA+T+VKQG  +V+ NVGDSRAVL T D D +LVAVQLTVDLKPNLP E ERI + 
Sbjct  204   CSGTTAVTLVKQGQYLVLGNVGDSRAVLGTRDKDDSLVAVQLTVDLKPNLPVEAERIRKC  263

Query  853   KGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNIT  1032
             +GRV++  DEP V RVW+PN +       PGLA++RAFGD+ +KDFGLIS P+ ++R +T
Sbjct  264   RGRVFALQDEPEVSRVWLPNNDS------PGLAMARAFGDFCLKDFGLISVPDISYRCLT  317

Query  1033  FRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMS  1212
              +D+F +LATDG+WDV+SN+E V+IV S P R  +AK LVE AV AW+       +DD +
Sbjct  318   EKDEFIVLATDGIWDVLSNKEVVDIVGSVPSRSSAAKTLVELAVRAWRYKYPTSKIDDCA  377

Query  1213  AICLFFHNKLI  1245
              +CLF ++  I
Sbjct  378   VVCLFLNSNDI  388



>ref|XP_009416608.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
Length=431

 Score =   300 bits (769),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 159/334 (48%), Positives = 211/334 (63%), Gaps = 42/334 (13%)
 Frame = +1

Query  331   FVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVR  510
             F+N  SS   ASL ++QGKKG NQD  IVWE FG + D +FCGVFDGHGP GH+VA++VR
Sbjct  52    FLNGASS--AASLFTQQGKKGTNQDAMIVWENFGNRSDTVFCGVFDGHGPNGHMVARKVR  109

Query  511   ELVPSSLLCNWQ------KALAHNMDNLGF--------------------------DNCL  594
             +++P  L  +W+      + + +N+ N G                           D+  
Sbjct  110   DILPLKLCASWEANTGNDEVIENNIGNPGSVISEETSSVFLNEESRALTGFEETDKDSET  169

Query  595   LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVVANVGDSRAVLATAD  768
             L   + S +KA   VD++L         YSGTTA+T+VKQG  +V+ NVGDSRAVL T D
Sbjct  170   LTTLEDSFLKAFRVVDKELRLHPDIECIYSGTTAVTLVKQGQDLVIGNVGDSRAVLGTRD  229

Query  769   DDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGL  948
              + +L+ VQLTVDLKPNLP E ERI R +GRV++  DEP V RVW+PN      ++ PGL
Sbjct  230   HNNSLIPVQLTVDLKPNLPREAERIRRCRGRVFALRDEPEVARVWLPN------IDSPGL  283

Query  949   AVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPER  1128
             A++RA GD+ +K FGLIS PE T+R +T +D+F +LATDGVWDV+SNQE VEIV +AP R
Sbjct  284   AMARALGDFCLKKFGLISVPEITYRRVTEKDEFIVLATDGVWDVLSNQEVVEIVDTAPTR  343

Query  1129  GESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
               +A+ LVE AV AW+       +DD + +CLF 
Sbjct  344   SSAARYLVETAVRAWRIKYPTSKIDDCAVVCLFL  377



>emb|CDY33350.1| BnaC05g12330D [Brassica napus]
Length=480

 Score =   301 bits (772),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 152/317 (48%), Positives = 206/317 (65%), Gaps = 28/317 (9%)
 Frame = +1

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S   A L+++QG KG NQD  +VWE F  + D + CGVFDGHGP+GH+VAKRVR+++P +
Sbjct  61    SSELACLYTQQGSKGTNQDAMLVWENFCSRSDTVLCGVFDGHGPFGHMVAKRVRDMLPFT  120

Query  529   LLCNWQKALAHNM-------------------DNLGFDNCLLDVWKQSHIKACSEVDQQL  651
             L    +K L  +                    D L      L + K++ +K C ++D++L
Sbjct  121   LSTQLKKTLGMDSTSVINSATCIDEEQWCEKEDKLPLPEMYLPL-KRALLKTCQQMDKEL  179

Query  652   EQQA--GSFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLP  825
             +       F SGTT++TV+KQG  +VV N+GDSRAVLAT DDD  L+AVQLT+DLKP+LP
Sbjct  180   KMHPTINCFCSGTTSVTVIKQGKHLVVGNIGDSRAVLATRDDDNALIAVQLTIDLKPDLP  239

Query  826   GERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISE  1005
              E  RI + KGRV++  DEP V RVW+PN +       PGLA++RAFGD+ +KD+GLIS 
Sbjct  240   SESARIQKCKGRVFALQDEPEVARVWLPNSDS------PGLAMARAFGDFCLKDYGLISV  293

Query  1006  PEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTR  1185
             P+  +R +T RDQF ILATDGVWDV+SN+EAV+IV+SAP R  +A+ LV  AV AW+   
Sbjct  294   PDINYRRLTERDQFIILATDGVWDVLSNKEAVDIVASAPSRNTAARALVCTAVRAWRLKY  353

Query  1186  RGIAMDDMSAICLFFHN  1236
                  DD + +CLF  +
Sbjct  354   PTSKNDDCAVVCLFLED  370



>ref|XP_008777864.1| PREDICTED: probable protein phosphatase 2C 33 isoform X1 [Phoenix 
dactylifera]
Length=498

 Score =   302 bits (773),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 161/336 (48%), Positives = 215/336 (64%), Gaps = 43/336 (13%)
 Frame = +1

Query  331   FVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVR  510
             F+N  SS   ASL ++QGKKG NQD  IVWE FG + D +FCGVFDGHGP+GH+VA++VR
Sbjct  56    FLNGASS--VASLFTQQGKKGTNQDAMIVWENFGSRADTVFCGVFDGHGPYGHMVARKVR  113

Query  511   ELVPSSLL-----------CNWQKALAHN--MDNLGFDNCLLD-----------------  600
             + +P  L            C     ++H+  M++    +  LD                 
Sbjct  114   DSLPLKLSTHLEVNVGSDDCREGSIISHSGSMNSEETSSICLDEGSGVSTDIEEKDKHPE  173

Query  601   ---VWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVVANVGDSRAVLATA  765
                  K+S +KA   +D++L+       F SGTTA+T+VKQG+ +V+ NVGDSRAVL T 
Sbjct  174   IFMTLKESFVKAFKVMDKELKLHPNINCFCSGTTAVTMVKQGEDLVIGNVGDSRAVLGTR  233

Query  766   DDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPG  945
             D +  L+AVQLTVDLKPNLP E ERI + KGRV++  DEPGV RVW+PN N       PG
Sbjct  234   DKNDCLIAVQLTVDLKPNLPREAERIRKCKGRVFALQDEPGVARVWLPNSNS------PG  287

Query  946   LAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPE  1125
             LA++RAFGD+ +KDFGLIS PE ++R +T RD+F +LATDGVWDV+SN+E V+IV+S P 
Sbjct  288   LAMARAFGDFCLKDFGLISVPEVSYRRVTERDEFIVLATDGVWDVLSNKEVVDIVASTPA  347

Query  1126  RGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             R  +A+ LVE AV AW+       +DD + +CLF +
Sbjct  348   RSSAARSLVESAVRAWRLKYPTSKIDDCAVVCLFLN  383



>ref|XP_008441722.1| PREDICTED: probable protein phosphatase 2C 33 [Cucumis melo]
 ref|XP_008441723.1| PREDICTED: probable protein phosphatase 2C 33 [Cucumis melo]
Length=485

 Score =   301 bits (772),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 161/341 (47%), Positives = 213/341 (62%), Gaps = 48/341 (14%)
 Frame = +1

Query  316   LSTSGFVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLV  495
             L T+GF +       ASL ++QGKKG NQD  IVWE FG + D IFCGVFDGHGP+GH+V
Sbjct  53    LFTNGFTDM------ASLFTQQGKKGTNQDAMIVWENFGSRTDTIFCGVFDGHGPYGHMV  106

Query  496   AKRVRELVPSSLLCNWQKALAHN-------MDNLGFDNC---------------------  591
             AK+VR+ +P  L  +W+  L  +       ++N G  N                      
Sbjct  107   AKKVRDSLPLRLSAHWEVNLTTDDVHREISLNNTGSMNSDEATSFVSADEEFRASIDVDG  166

Query  592   ------LLDVWKQSHIKACSEVDQQL--EQQAGSFYSGTTALTVVKQGDVMVVANVGDSR  747
                   +    K+S +KA   +D +L   Q   SF SGTTA+T+VKQG  +V+ NVGDSR
Sbjct  167   TEKQPEIFHTLKESFLKAFRVMDWELRMHQTIDSFCSGTTAVTIVKQGQDLVIGNVGDSR  226

Query  748   AVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGV  927
             AVL   D   +LV +QLTVDLKPNLP E ERI + +GRV++  DEP V RVW+PN N   
Sbjct  227   AVLGMRDKGDSLVPIQLTVDLKPNLPAEAERIRKCRGRVFALQDEPDVARVWLPNSN---  283

Query  928   AVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEI  1107
                 PGLA++RAFGD+ +KDFGLIS PE ++R +T +D+F +LATDG+WDV+SN+E V+I
Sbjct  284   ---SPGLAMARAFGDFCLKDFGLISVPEISYRRLTEKDEFIVLATDGIWDVLSNKEVVDI  340

Query  1108  VSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             V+SAP+R  +A+ LVE AV AWK       +DD + +CLF 
Sbjct  341   VASAPKRTTAARTLVETAVKAWKHKYPTSKIDDCAVVCLFL  381



>gb|KCW61207.1| hypothetical protein EUGRSUZ_H03968, partial [Eucalyptus grandis]
Length=302

 Score =   295 bits (755),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 190/269 (71%), Gaps = 16/269 (6%)
 Frame = +1

Query  178  MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHN  357
            MV   +  +G AKTIS + G K+   DVGREAAN LAKEAR+NE ILS++  V    S  
Sbjct  40   MVLLPTFLDGLAKTISSRKG-KSCPCDVGREAANTLAKEARRNESILSSTAAVKISKSSR  98

Query  358  CASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC  537
             AS  S++G+KG NQD  I+WEEFG QEDM FCGVFDGHGPWGH VAKRVREL+PS LLC
Sbjct  99   LASACSKRGRKGVNQDCFILWEEFGCQEDMTFCGVFDGHGPWGHAVAKRVRELLPSFLLC  158

Query  538  NWQKALAHNMDN-----LGFDNCL--LDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTA  690
             WQ+AL           + FD  L   D+WKQS +K  + VDQ+L+  +   +F SGTTA
Sbjct  159  KWQEALGVGSSQDWNFEMEFDANLQHFDIWKQSFLKTYAAVDQELKLHRSIDTFCSGTTA  218

Query  691  LTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWS  870
             T+VKQG+ +++AN+GDSRAVLAT DDDG+LV +QLT+D KPNLP E ERI +SKGRV+ 
Sbjct  219  STIVKQGENLLIANIGDSRAVLATTDDDGSLVPLQLTIDFKPNLPQEAERIKQSKGRVFC  278

Query  871  SDDEPGVYRVWMPNPNGGVAVEGPGLAVS  957
            S DEPG+YRVWMPN       E  GLAVS
Sbjct  279  SHDEPGLYRVWMPND------ETLGLAVS  301



>gb|KHG03244.1| putative phosphatase 2C 33 -like protein [Gossypium arboreum]
Length=483

 Score =   301 bits (771),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 168/363 (46%), Positives = 227/363 (63%), Gaps = 41/363 (11%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIV  417
             ++NSR+ +G   ++    E RK+E +    G      S + ASL ++QGKKG NQD  IV
Sbjct  27    KRNSRKRLGSRGSSF---EYRKDEALHRIPGRFFLNGSTDVASLFTQQGKKGTNQDAMIV  83

Query  418   WEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKAL--------------  555
             WE FG + D +FCG+FDGHGP+GHLVAKRVR+ +P  L  +W+  +              
Sbjct  84    WENFGSRTDTVFCGIFDGHGPYGHLVAKRVRDHLPVKLSAHWEANVSSEDVFRDFGLGSM  143

Query  556   -AHNMDNLGFDN---------------CLLDVWKQSHIKACSEVDQQLEQQAG--SFYSG  681
              + +M  L  D                 + +  K+S +KA   +D++L       SF SG
Sbjct  144   TSEDMSLLSVDKESRPSIDFLESEKHPDIFETLKESFLKAFKAMDRELRVHPSIDSFCSG  203

Query  682   TTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGR  861
             TTA+T+VKQG  +V+ NVGDSRAVL T D +  L AVQLTVDLKPNLP E ERI R KGR
Sbjct  204   TTAVTLVKQGPYLVIGNVGDSRAVLGTRDKNNMLTAVQLTVDLKPNLPAEAERIRRCKGR  263

Query  862   VWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRD  1041
             V++  DEP V RVW+PN       + PGLA++RAFGD+ +KDFGLIS PE T+R++T  D
Sbjct  264   VFALHDEPEVTRVWLPNN------DSPGLAMARAFGDFCLKDFGLISVPEITYRHLTEND  317

Query  1042  QFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAIC  1221
             +F +LATDG+WDV+SN+EAVEI++SAP R  +A+ LVE A+ AW+       +DD + +C
Sbjct  318   EFVVLATDGIWDVLSNEEAVEIIASAPARSSAARALVEVAIRAWRYKYPTSKVDDCAVVC  377

Query  1222  LFF  1230
             LF 
Sbjct  378   LFL  380



>gb|KDP26876.1| hypothetical protein JCGZ_18034 [Jatropha curcas]
Length=495

 Score =   301 bits (771),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 164/367 (45%), Positives = 221/367 (60%), Gaps = 41/367 (11%)
 Frame = +1

Query  235   GRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAI  414
             G K  R    R  +   + + R+ E +    G +    S N ASL ++QGKKG NQD  I
Sbjct  23    GIKKRRNPKRRPGSRNSSFDYRREEPLHRIPGRLFLNGSSNIASLFTQQGKKGTNQDAMI  82

Query  415   VWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQ---------------K  549
             VWE FG + D +FCGVFDGHGP+GH+VAKRVR+ +P  L  +W+                
Sbjct  83    VWENFGSRTDTVFCGVFDGHGPYGHMVAKRVRDHLPLKLSAHWEVNITSEDVLKEISVNT  142

Query  550   ALAHNMDNLGFDNC------------------LLDVWKQSHIKACSEVDQQLEQQAG--S  669
               + N ++  F +                   +    K+S +KA   +D++L   A    
Sbjct  143   TASMNSEDQSFISADEESRASLDLDEPEKQPEIFQTLKESFLKAFKVMDRELRVHANIDC  202

Query  670   FYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMR  849
             + SGTTA+T++KQG  +VV NVGDSRAVL T D D +LVA+QLTVDLKPNLP E ERI +
Sbjct  203   YCSGTTAVTLIKQGHYLVVGNVGDSRAVLGTRDKDDSLVAIQLTVDLKPNLPAEAERIRK  262

Query  850   SKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNI  1029
              KGRV++  DEP V RVW+PN       + PGLA++RAFGD+ +KDFGLIS P+ + R +
Sbjct  263   CKGRVFALQDEPEVARVWLPN------NDSPGLAMARAFGDFCLKDFGLISVPDISCRRL  316

Query  1030  TFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDM  1209
             T  D+F +LATDGVWDV+SN+E V+IV+SAP R  +A+ LVE AV AW+       +DD 
Sbjct  317   TENDEFIVLATDGVWDVLSNKEVVDIVASAPTRSSAARALVESAVRAWRYKYPTSKVDDC  376

Query  1210  SAICLFF  1230
             + +CLF 
Sbjct  377   AVVCLFL  383



>ref|XP_004497423.1| PREDICTED: probable protein phosphatase 2C 33-like [Cicer arietinum]
Length=358

 Score =   296 bits (759),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 149/294 (51%), Positives = 206/294 (70%), Gaps = 19/294 (6%)
 Frame = +1

Query  361   ASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCN  540
             ASL  +QG+KG NQD  ++WE F   +D + CGVFDGHGP+GH+VAK+VR+ +P  L+  
Sbjct  53    ASLFCKQGRKGINQDAMLLWENFCLMKDSVLCGVFDGHGPFGHVVAKKVRDSLPLKLMDE  112

Query  541   WQKALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQQL--EQQAGSFYSGTTALTVVKQGD  714
             W  +  H+   L          K+S +KA   +D++L    +  ++ SGTTA+T++K+G 
Sbjct  113   WNLSGGHHCSTL----------KESFLKASKSMDRELSLHHRKDAYASGTTAVTLLKKGY  162

Query  715   VMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVY  894
              +V+ANVGDSRAVL T D +G+L+A+QLT DLKPNLP E ERI   KGRV++ D+E GV 
Sbjct  163   ELVIANVGDSRAVLGTKDPNGSLIALQLTTDLKPNLPREAERIRLCKGRVFAHDNESGVA  222

Query  895   RVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVW  1074
             RVW+PN      V+ PGLA++RAFGD+ +KDFGLIS P+ ++  ++ +DQF +LATDGVW
Sbjct  223   RVWLPN------VDSPGLAMARAFGDFCLKDFGLISVPDISYHRLSEQDQFVVLATDGVW  276

Query  1075  DVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             DV+SN++ V+IV+SAP R  +AK LVE AV AW+        DD SA+CLFFH+
Sbjct  277   DVLSNKQVVDIVASAP-RSSAAKVLVESAVQAWRTKLPTSNPDDCSAVCLFFHS  329



>ref|XP_010673906.1| PREDICTED: probable protein phosphatase 2C 33 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010673907.1| PREDICTED: probable protein phosphatase 2C 33 [Beta vulgaris 
subsp. vulgaris]
Length=472

 Score =   300 bits (769),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 157/365 (43%), Positives = 227/365 (62%), Gaps = 43/365 (12%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIV  417
             RKNS++  G  +++    + +K++ +    G V    +   ASL+++QG+KG NQD  +V
Sbjct  26    RKNSKKRFGSRSSSF---DYKKDDHLSKIPGRVFFNGATEVASLYTQQGRKGTNQDAMVV  82

Query  418   WEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQ---------KALAHNMD  570
             WE F  + D IFCGVFDGHGP+GHLVAKRVR+ +P  L   W+         + ++ N  
Sbjct  83    WENFCSRNDTIFCGVFDGHGPYGHLVAKRVRDSLPQKLNAQWEVNTKSEEVLREISLNCS  142

Query  571   NLGFDNC-----------------------LLDVWKQSHIKACSEVDQQLEQQAG--SFY  675
             ++  +                         + ++ K+S +KA   +D++L   AG   F 
Sbjct  143   SVNSEEASFISADEESRVSVDLEETDKEPEIFEILKESFLKAFRIMDRELRVHAGVDCFC  202

Query  676   SGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSK  855
             SGTTA+T++KQG  +V+ NVGDSRAVL T D D  LVAVQLTVDLKPNLP E ERI + +
Sbjct  203   SGTTAVTLIKQGQDLVIGNVGDSRAVLGTRDTDNTLVAVQLTVDLKPNLPAEAERIKKCR  262

Query  856   GRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITF  1035
             GRV++  DEP V RVW+PN       + PGLA++RAFGD+ +KD+GLI+ P+ ++R +T 
Sbjct  263   GRVFALQDEPDVARVWLPNN------DSPGLAMARAFGDFCLKDYGLIAVPDISYRRLTE  316

Query  1036  RDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSA  1215
              D+F +LATDG+WDV+SN++ V IV++AP R  +A+ +VE AV AWK       +DD + 
Sbjct  317   MDEFIVLATDGIWDVLSNKDVVNIVAAAPTRSTAARAVVETAVRAWKMKYPTSKIDDCAV  376

Query  1216  ICLFF  1230
             +CLF 
Sbjct  377   VCLFL  381



>ref|XP_009415101.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009415102.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
Length=412

 Score =   298 bits (764),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 213/333 (64%), Gaps = 40/333 (12%)
 Frame = +1

Query  331   FVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVR  510
             F+N  SS   ASL SRQGKKG NQD  IVWE FG + D +FCGVFDGHGP GH+VAK+VR
Sbjct  53    FLNGASS--AASLFSRQGKKGINQDAMIVWENFGCRSDTVFCGVFDGHGPNGHMVAKKVR  110

Query  511   ELVPSSLLCNWQ----------KALAHNMDN---------------LGFDNCL-----LD  600
             +++P  L   W+            L+ +MD+               +GF + +     + 
Sbjct  111   DILPLKLRARWEVNIGDDECKENNLSKSMDSEETSSVCLNEEFRASIGFKDLIKRSEIIA  170

Query  601   VWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDD  774
               +   +KA  +VD++L        FYSGTTA+T+VKQG  +V+ NVGDSRAVL T D +
Sbjct  171   TLRDPFLKAFRKVDKELRLHPDIDCFYSGTTAVTLVKQGQDLVIGNVGDSRAVLGTRDQN  230

Query  775   GNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAV  954
               LVAVQLTVDLKPNLP E ERI R +GRV++  DEP V R+W+PN N       PGLA+
Sbjct  231   NTLVAVQLTVDLKPNLPREAERIRRCRGRVFALRDEPEVARLWLPNAN------SPGLAM  284

Query  955   SRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGE  1134
             +RAFGD+ +KDFGLIS PE ++R IT +D+F +LATDGVWDV+SN+E V+IV+ A  R  
Sbjct  285   ARAFGDFCLKDFGLISVPEISYRRITEKDEFIVLATDGVWDVLSNKEVVDIVAMASTRSS  344

Query  1135  SAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             +A+ +VE A  AW+       +DD + +CLF +
Sbjct  345   AARYVVESAGRAWRLRYPTSRVDDCAVVCLFLN  377



>ref|XP_009149058.1| PREDICTED: probable protein phosphatase 2C 6 [Brassica rapa]
Length=482

 Score =   300 bits (769),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 206/318 (65%), Gaps = 29/318 (9%)
 Frame = +1

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S   A L+++QG KG NQD  +VWE F  + D + CGVFDGHGP+GH+VA+RVR+++P +
Sbjct  61    SSESACLYTQQGSKGTNQDAMLVWENFCSRSDTVLCGVFDGHGPFGHMVARRVRDMLPFT  120

Query  529   LLCNWQKALAHNM--------------------DNLGFDNCLLDVWKQSHIKACSEVDQQ  648
             L    +K L  +                     D L      L + K++ +K C ++D++
Sbjct  121   LSTQLKKTLGMDSTSVINSATCIDEEEQWCEKDDKLPLPQMYLPL-KRALLKTCQQMDKE  179

Query  649   LEQQA--GSFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNL  822
             L+       F SGTT++TV+KQG  +VV N+GDSRAVLAT DD+  L+AVQLT+DLKP+L
Sbjct  180   LKMHPTINCFCSGTTSVTVIKQGKDLVVGNIGDSRAVLATRDDENALIAVQLTIDLKPDL  239

Query  823   PGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLIS  1002
             P E  RI R KGRV++  DEP V RVW+PN +       PGLA++RAFGD+ +KD+GLIS
Sbjct  240   PSESARIQRCKGRVFALQDEPEVARVWLPNSDS------PGLAMARAFGDFCLKDYGLIS  293

Query  1003  EPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRT  1182
              P+  +R +T RDQF ILATDGVWDV+SN+EAV+IV+SAP R  +A+ LV  AV AW+  
Sbjct  294   VPDINYRRLTERDQFIILATDGVWDVLSNKEAVDIVASAPSRNTAARALVCTAVRAWRLK  353

Query  1183  RRGIAMDDMSAICLFFHN  1236
                   DD + +CLF  +
Sbjct  354   YPTSKNDDCAVVCLFLED  371



>ref|XP_003627112.1| Protein phosphatase 2c [Medicago truncatula]
 gb|AET01588.1| phosphatase 2C family protein [Medicago truncatula]
Length=373

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 213/304 (70%), Gaps = 12/304 (4%)
 Frame = +1

Query  331   FVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVR  510
             F+N  SSH  ASL  +QG+KG NQD  ++WE FG  ED++FCGVFDGHGP+GH+VAK+VR
Sbjct  48    FLNG-SSH-VASLCCKQGRKGINQDAMLLWENFGSMEDVVFCGVFDGHGPFGHVVAKKVR  105

Query  511   ELVPSSLLCNWQKALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQ--AGSFYSGT  684
                P  L+  W   L  + +N  ++N   ++ ++S +KA   +D +L+ Q    S+ SGT
Sbjct  106   NSFPLKLMEEWNSCLRDDYNNNNYNNNHFEILRESFLKASKFMDNELKLQYFMESYGSGT  165

Query  685   TALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRV  864
             TA+T++K+GD +V ANVGDSRAVL T D +G+L+A+QLT DLKPNLP E  RI   KGRV
Sbjct  166   TAVTLLKKGDKLVTANVGDSRAVLGTLDPNGSLIALQLTTDLKPNLPREATRIRICKGRV  225

Query  865   WSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQ  1044
             ++ D++  V R+W+PN       + PGLA+SRAFGD+ +KD GLIS PE ++  IT  DQ
Sbjct  226   FALDNDSAVPRLWLPN------ADSPGLAMSRAFGDFVLKDSGLISVPEVSYHRITDHDQ  279

Query  1045  FAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICL  1224
             F +LATDGVWDV+SN + V IV+SAP R  +AK +VE AV AWK T+     DD SA+CL
Sbjct  280   FVVLATDGVWDVLSNNQVVNIVASAP-RSSAAKLVVEAAVQAWK-TKIPSKPDDCSAVCL  337

Query  1225  FFHN  1236
             FFH+
Sbjct  338   FFHS  341



>emb|CDY35072.1| BnaA06g10820D [Brassica napus]
Length=482

 Score =   300 bits (767),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 206/318 (65%), Gaps = 29/318 (9%)
 Frame = +1

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S   A L+++QG KG NQD  +VWE F  + D + CGVFDGHGP+GH+VA+RVR+++P +
Sbjct  61    SSESACLYTQQGSKGTNQDAMLVWENFCSRSDTVLCGVFDGHGPFGHMVARRVRDMLPFT  120

Query  529   LLCNWQKALAHNM--------------------DNLGFDNCLLDVWKQSHIKACSEVDQQ  648
             L    +K L  +                     D L      L + K++ +K C ++D++
Sbjct  121   LSTQLKKTLGMDSTSVINSATCIDEEEQWCEKDDKLPLPQMYLPL-KRALLKTCQQMDKE  179

Query  649   LEQQA--GSFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNL  822
             L+       F SGTT++TV+KQG  +VV N+GDSRAVLAT DD+  L+AVQLT+DLKP+L
Sbjct  180   LKMHPTINCFCSGTTSVTVIKQGKDLVVGNIGDSRAVLATRDDENALIAVQLTIDLKPDL  239

Query  823   PGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLIS  1002
             P E  RI R KGRV++  DEP V RVW+PN +       PGLA++RAFGD+ +KD+GLIS
Sbjct  240   PSESARIQRCKGRVFALQDEPEVARVWLPNSDS------PGLAMARAFGDFCLKDYGLIS  293

Query  1003  EPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRT  1182
              P+  +R +T RDQF ILATDGVWDV+SN+EAV+IV+SAP R  +A+ LV  AV AW+  
Sbjct  294   VPDINYRRLTERDQFIILATDGVWDVLSNKEAVDIVASAPSRNTAARALVCTAVRAWRLK  353

Query  1183  RRGIAMDDMSAICLFFHN  1236
                   DD + +CLF  +
Sbjct  354   YPTSKNDDCAVVCLFLED  371



>ref|XP_007222732.1| hypothetical protein PRUPE_ppa006494mg [Prunus persica]
 gb|EMJ23931.1| hypothetical protein PRUPE_ppa006494mg [Prunus persica]
Length=409

 Score =   297 bits (761),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 164/348 (47%), Positives = 220/348 (63%), Gaps = 25/348 (7%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELILS-TSGFVNAISSHNCASLHSRQGKKGANQDRAI  414
             ++  R   G  +A  +A  +   E+ L    G      S + ASL  +QGKKG NQD  I
Sbjct  40    KRRKRRVTGNSSATVVAPPSNNLEMWLHRVPGRQFQNGSSDFASLFCKQGKKGVNQDAMI  99

Query  415   VWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNW-------------QKAL  555
              WE FG   D IFCGVFDGHGP+GH+VAK+VR+ +P  L   W                 
Sbjct  100   AWENFG-SPDTIFCGVFDGHGPFGHVVAKKVRDALPLKLTSQWVLTNNAKKGAADDTNEA  158

Query  556   AHNMDNLGFDNC-LLDVWKQSHIKACSEVDQQLE--QQAGSFYSGTTALTVVKQGDVMVV  726
             A   D+   ++C L    K S +KA   +D++L+   +   + SGTTA+T+VKQG  +V+
Sbjct  159   ASYQDHKDNEHCELFVTLKDSFLKAFKVMDKELKLHPRIDCYCSGTTAVTLVKQGQDLVI  218

Query  727   ANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWM  906
             ANVGDSRA+L T D+DG+LVAVQLTVDLKPNLP E ERIMR KGRV++  +EP V RVW+
Sbjct  219   ANVGDSRALLGTRDEDGSLVAVQLTVDLKPNLPREAERIMRCKGRVFALQNEPEVARVWL  278

Query  907   PNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVS  1086
             PN N       PGLA++RAFGD+ +KDFGLIS P+ ++R +T  D+F +LATDG+WDV+S
Sbjct  279   PNSN------SPGLAMARAFGDFCLKDFGLISVPDISYRRLTENDEFVVLATDGIWDVLS  332

Query  1087  NQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             N+E V+IV+ AP R  +A+ LVE A  AW+     + +DD + +CLF 
Sbjct  333   NEEVVKIVALAP-RASAARALVESATRAWRSKYPYVKVDDCAVVCLFL  379



>gb|EYU39458.1| hypothetical protein MIMGU_mgv1a005481mg [Erythranthe guttata]
Length=482

 Score =   299 bits (766),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 160/342 (47%), Positives = 213/342 (62%), Gaps = 37/342 (11%)
 Frame = +1

Query  298   RKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHG  477
             R  E +  T G +    S + ASL ++QG+KG NQD  IVWE FG + D +FCGVFDGHG
Sbjct  42    RSEEQLHRTPGRMFLNGSSDTASLFTQQGRKGTNQDAMIVWENFGSRTDTVFCGVFDGHG  101

Query  478   PWGHLVAKRVRELVPSSLLCNWQKALAHN------MDNLGFDNCLLD-------------  600
             P+GH+VAKRVR+ +P  L  +W+  + ++        N     C  D             
Sbjct  102   PYGHMVAKRVRDCLPLKLSSHWEVNIKNDEILRDVSLNTSSSRCSEDASFFSADTEVARA  161

Query  601   ----------VWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVVANVGDS  744
                         K+S +KA   +D++L+  A    F SGTTA+T+VKQG  +++ NVGDS
Sbjct  162   SIDEQPEVFHTLKESFLKAYKVMDRELKMYANIDCFCSGTTAVTMVKQGQDLIIGNVGDS  221

Query  745   RAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGG  924
             RAVLAT D++  L AVQLTVDLKPNLPGE ERI + KGRV++  DEP V RVW+PN +  
Sbjct  222   RAVLATRDENNLLTAVQLTVDLKPNLPGEAERIRKCKGRVFALHDEPEVARVWLPNND--  279

Query  925   VAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVE  1104
                  PGLA++RAFGD+ +KDFGLIS PE ++R IT +D+F +LATDG+WDV+SN+E V+
Sbjct  280   ----SPGLAMARAFGDFCLKDFGLISVPEVSYRRITDKDEFIVLATDGIWDVLSNKEVVD  335

Query  1105  IVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             IV S   R  +AK LVE AV  W+       +DD + +CLF 
Sbjct  336   IVESCSTRSSAAKSLVECAVRGWRSKYPTSKVDDCAVVCLFL  377



>ref|XP_002514837.1| protein phosphatase-2c, putative [Ricinus communis]
 gb|EEF47391.1| protein phosphatase-2c, putative [Ricinus communis]
Length=499

 Score =   300 bits (767),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 163/366 (45%), Positives = 226/366 (62%), Gaps = 44/366 (12%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIV  417
             +KNS++   R  +   + + R+ E +    G +    S + ASL ++QG+KG NQD  IV
Sbjct  27    KKNSKK---RPGSRNSSFDYRREEPLHRIPGRLFLNGSSDIASLFTQQGRKGTNQDAMIV  83

Query  418   WEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQ---------------KA  552
             WE FG + D +FCGVFDGHGP+GH+VAKRVR+ +P  L  +W+                A
Sbjct  84    WENFGSRTDTVFCGVFDGHGPYGHMVAKRVRDHLPLKLSAHWEVNITSEDVLKEISLNTA  143

Query  553   LAHNMDNLGFDNC------------------LLDVWKQSHIKACSEVDQQLEQQAG--SF  672
              + N ++  F +                   +    K+S +KA   +D++L   A    F
Sbjct  144   GSMNSEDTTFVSADEESRASVDLDDTVKHPEIFQTLKESFLKAFKVMDRELRIHANIDCF  203

Query  673   YSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRS  852
              SGTTA+T++KQG  +VV NVGDSRAVL T D D +LVAVQLTVDLKPNLP E ERI + 
Sbjct  204   CSGTTAVTLIKQGRNLVVGNVGDSRAVLGTRDKDDSLVAVQLTVDLKPNLPAEAERIRKC  263

Query  853   KGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNIT  1032
             KGRV++  DEP V RVW+PN       + PGLA++RAFGD+ +KDFGLIS P+ +FR ++
Sbjct  264   KGRVFALQDEPEVARVWLPNN------DSPGLAMARAFGDFCLKDFGLISVPDVSFRRLS  317

Query  1033  FRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMS  1212
              +D+F +LATDG+WDV+SN+E V+IV+S P R  +A+ LVE AV AW+       +DD +
Sbjct  318   EKDEFIVLATDGIWDVLSNKEVVDIVASVPTRPSAARALVESAVRAWRYKYPTSKVDDCA  377

Query  1213  AICLFF  1230
              +CLF 
Sbjct  378   VVCLFL  383



>ref|XP_011013066.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 33 [Populus euphratica]
Length=493

 Score =   300 bits (767),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 162/368 (44%), Positives = 225/368 (61%), Gaps = 44/368 (12%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIV  417
             RKNS++   R  +   + + R+ E +    G +    S + ASL ++QGKKG NQD  IV
Sbjct  27    RKNSKK---RPGSRNSSFDYRREEPLHRIPGRLFLNGSSDIASLFTQQGKKGTNQDAMIV  83

Query  418   WEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKAL--------------  555
             WE FG + D +FCGVFDGHGP+GH+VAKRVR+ +P  L  +W+  +              
Sbjct  84    WENFGSRRDAVFCGVFDGHGPYGHMVAKRVRDSLPLKLTTHWEVNITSEDVLREISLNTT  143

Query  556   -AHNMDNLGFDNC------------------LLDVWKQSHIKACSEVDQQLEQQAG--SF  672
              + N ++  F +                   +    K+S +KA   +D++L        F
Sbjct  144   GSMNSEDTSFISADDESRASVDLEDAEKHPEIFQTLKESFLKAFKVMDRELRVHTNIDCF  203

Query  673   YSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRS  852
              SGTTA+T+VKQG  +V+ NVGDSRAVL T D D +LVAVQLTVDLKPNLP E ERI + 
Sbjct  204   CSGTTAVTLVKQGQYLVLGNVGDSRAVLGTRDKDDSLVAVQLTVDLKPNLPVEAERIRKC  263

Query  853   KGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNIT  1032
             +GRV++  DEP V RVW+PN +       PGLA++RAF D+ +KDFGLIS P+ ++R +T
Sbjct  264   RGRVFALQDEPEVARVWLPNNDS------PGLAMARAFXDFCLKDFGLISVPDISYRCLT  317

Query  1033  FRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMS  1212
              +D+F +LATDG+WDV+SN+E V+IV S P R  +AK LVE AV AW+       +DD +
Sbjct  318   EKDEFIVLATDGIWDVLSNKEVVDIVGSVPSRSSAAKTLVELAVRAWRYKYPTSKIDDCA  377

Query  1213  AICLFFHN  1236
              +CLF ++
Sbjct  378   VVCLFLNS  385



>ref|XP_006416840.1| hypothetical protein EUTSA_v10007474mg [Eutrema salsugineum]
 gb|ESQ35193.1| hypothetical protein EUTSA_v10007474mg [Eutrema salsugineum]
Length=490

 Score =   299 bits (766),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 153/323 (47%), Positives = 211/323 (65%), Gaps = 33/323 (10%)
 Frame = +1

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S   A L+++QGKKG NQD  +VWE F  + D +FCGVFDGHGP+GH+VA+RVR+++P +
Sbjct  61    SSEMACLYTQQGKKGTNQDAMLVWENFCSRRDTVFCGVFDGHGPFGHMVAQRVRDILPFT  120

Query  529   LLCNWQKA--LAHNMDNLGFDN---------CLLD--------------VWKQSHIKACS  633
             L    + A  +  +  N G D+         C L                 K++ +K C 
Sbjct  121   LSTQLKMASVMEQSSSNDGLDSATCIDEEQWCELQPSEKDGKLLPEMYLSLKRALLKTCQ  180

Query  634   EVDQQLEQQA--GSFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVD  807
             ++D++L+       F SGTT++TV+KQG  +VV N+GDSRAVLAT D+D  L+AVQLT+D
Sbjct  181   QMDKELKMHPTINCFCSGTTSVTVIKQGKDLVVGNIGDSRAVLATRDEDNALIAVQLTID  240

Query  808   LKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKD  987
             LKP+LP E  RI + KGRV++  DEP V RVW+PN N       PGLA++RAFGD+ +KD
Sbjct  241   LKPDLPSESARIQKCKGRVFALQDEPEVARVWLPNSNS------PGLAMARAFGDFCLKD  294

Query  988   FGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVC  1167
             +GLIS P+  +R +T RDQF ILATDGVWDV+SN+EAV+IV+SAP R  +A+ +V+ AV 
Sbjct  295   YGLISVPDINYRCLTERDQFIILATDGVWDVLSNKEAVDIVASAPCRNTAARAVVDTAVR  354

Query  1168  AWKRTRRGIAMDDMSAICLFFHN  1236
             AW+        DD + +CLF  +
Sbjct  355   AWRLKYPTSKNDDCAVVCLFLED  377



>emb|CBI17615.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   298 bits (764),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 168/369 (46%), Positives = 231/369 (63%), Gaps = 47/369 (13%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELILSTSG--FVNAISSHNCASLHSRQGKKGANQDRA  411
             RKNS+  +G   ++    ++R+ E +    G  F+N  S  + ASL ++QGKKG NQD  
Sbjct  26    RKNSKRRLGSRTSSF---DSRREEQLHKIPGRMFLNGAS--DFASLFTQQGKKGTNQDAM  80

Query  412   IVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKAL------------  555
             IVWE FG + D +FCGVFDGHGP+GH+VAKRVR+ +P  L  +W+  +            
Sbjct  81    IVWENFGSRTDTVFCGVFDGHGPYGHMVAKRVRDSLPLKLSAHWEVNINEDVLKEISLNT  140

Query  556   --AHNMDNLGFDNC------------------LLDVWKQSHIKACSEVDQQLEQQAG--S  669
               + N ++  F +                   +    K+S +KA   +D++L        
Sbjct  141   TGSMNSEDTAFISADEESRPSIDLEETEKQPEIFQALKESFLKAFKVMDRELRMHTNIDC  200

Query  670   FYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMR  849
             F SGTTA+T+VKQG  +V+ NVGDSRAVL T D DG LVA+QLTVDLKPNLPGE ERI R
Sbjct  201   FCSGTTAVTLVKQGQDLVIGNVGDSRAVLGTRDKDGYLVAIQLTVDLKPNLPGEAERIRR  260

Query  850   SKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNI  1029
              KGRV++  DEP V RVW+PN       + PGLA++RAFGD+ +KDFGLIS PE ++R +
Sbjct  261   FKGRVFALQDEPEVARVWLPNN------DSPGLAMARAFGDFCLKDFGLISVPEISYRRL  314

Query  1030  TFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDM  1209
             + +D+F +LATDGVWDV+SN+E V+IV+SA  R  +A+ LVE AV AW+       +DD 
Sbjct  315   SEKDEFVVLATDGVWDVLSNKEVVDIVASASSRSTAARTLVETAVRAWRLKYPTSKVDDC  374

Query  1210  SAICLFFHN  1236
             + +CLF ++
Sbjct  375   AVVCLFLNS  383



>ref|XP_002277393.1| PREDICTED: probable protein phosphatase 2C 33 [Vitis vinifera]
Length=486

 Score =   299 bits (765),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 168/369 (46%), Positives = 231/369 (63%), Gaps = 47/369 (13%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELILSTSG--FVNAISSHNCASLHSRQGKKGANQDRA  411
             RKNS+  +G   ++    ++R+ E +    G  F+N  S  + ASL ++QGKKG NQD  
Sbjct  26    RKNSKRRLGSRTSSF---DSRREEQLHKIPGRMFLNGAS--DFASLFTQQGKKGTNQDAM  80

Query  412   IVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKAL------------  555
             IVWE FG + D +FCGVFDGHGP+GH+VAKRVR+ +P  L  +W+  +            
Sbjct  81    IVWENFGSRTDTVFCGVFDGHGPYGHMVAKRVRDSLPLKLSAHWEVNINEDVLKEISLNT  140

Query  556   --AHNMDNLGFDNC------------------LLDVWKQSHIKACSEVDQQLEQQAG--S  669
               + N ++  F +                   +    K+S +KA   +D++L        
Sbjct  141   TGSMNSEDTAFISADEESRPSIDLEETEKQPEIFQALKESFLKAFKVMDRELRMHTNIDC  200

Query  670   FYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMR  849
             F SGTTA+T+VKQG  +V+ NVGDSRAVL T D DG LVA+QLTVDLKPNLPGE ERI R
Sbjct  201   FCSGTTAVTLVKQGQDLVIGNVGDSRAVLGTRDKDGYLVAIQLTVDLKPNLPGEAERIRR  260

Query  850   SKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNI  1029
              KGRV++  DEP V RVW+PN +       PGLA++RAFGD+ +KDFGLIS PE ++R +
Sbjct  261   FKGRVFALQDEPEVARVWLPNND------SPGLAMARAFGDFCLKDFGLISVPEISYRRL  314

Query  1030  TFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDM  1209
             + +D+F +LATDGVWDV+SN+E V+IV+SA  R  +A+ LVE AV AW+       +DD 
Sbjct  315   SEKDEFVVLATDGVWDVLSNKEVVDIVASASSRSTAARTLVETAVRAWRLKYPTSKVDDC  374

Query  1210  SAICLFFHN  1236
             + +CLF ++
Sbjct  375   AVVCLFLNS  383



>ref|XP_010247822.1| PREDICTED: probable protein phosphatase 2C 33 [Nelumbo nucifera]
Length=476

 Score =   298 bits (762),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 162/377 (43%), Positives = 225/377 (60%), Gaps = 54/377 (14%)
 Frame = +1

Query  205   GFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQG  384
             G  K + K+ G +NS  D            +R+ E +    G +    + + ASL ++QG
Sbjct  79    GKRKNLRKRPGMRNSSFD------------SRREEQLHRIPGRMFISGASDVASLFTQQG  126

Query  385   KKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQ------  546
             KKG NQD  IVWE FG + D +FCGVFDGHGP+GH+VA+RVR+ +P  L  +W+      
Sbjct  127   KKGVNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVARRVRDSLPLKLSAHWEVNIRSE  186

Query  547   ---------------------------KALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQ  645
                                          ++ +++        L + K+S +KA   +D+
Sbjct  187   DGSREISSSVMGSMSSEETSYMYTEEKSRISVDLEEKKHPEIFLTL-KESFLKAFKVMDK  245

Query  646   QLEQQAG--SFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPN  819
             +L        F SGTTA+T+VKQG  +V+ NVGDSRAVL T D D +L+A+QLTVDLKPN
Sbjct  246   ELRLHPNIDCFCSGTTAVTLVKQGQDLVIGNVGDSRAVLGTRDQDNSLIAIQLTVDLKPN  305

Query  820   LPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLI  999
             LP E ERI + KGRV++  DEP V RVW+PN +       PGLA++RAFGD+ +KDFGLI
Sbjct  306   LPREAERIQQCKGRVFALQDEPEVVRVWLPNNDS------PGLAMARAFGDFCLKDFGLI  359

Query  1000  SEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKR  1179
             S PE ++R +T +D+F +LATDGVWDV+SN+E V+IV+SAP R  +A+ LVE AV  W+ 
Sbjct  360   SLPEISYRRLTEKDEFIVLATDGVWDVLSNKEVVDIVASAPVRSSAARALVESAVRTWRF  419

Query  1180  TRRGIAMDDMSAICLFF  1230
                   +DD + +CLF 
Sbjct  420   KYPNSKIDDCAVVCLFL  436



>ref|XP_004249060.1| PREDICTED: probable protein phosphatase 2C 65 [Solanum lycopersicum]
Length=436

 Score =   296 bits (757),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/295 (51%), Positives = 202/295 (68%), Gaps = 14/295 (5%)
 Frame = +1

Query  364   SLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNW  543
             S++S+QGKKG NQD   VWE FGGQ+ MIFCGVFDGHGP GH VA+ VR+ +PS L  + 
Sbjct  66    SMYSQQGKKGINQDAMTVWENFGGQKGMIFCGVFDGHGPSGHKVARYVRDTLPSKL--SS  123

Query  544   QKALAHNMDNLGFD----NCLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVK  705
                ++ N  +   D    N + D WK   I +  E+D++LE      S+ SGTTA+T+VK
Sbjct  124   SNVISANRWDAEKDDESNNPVFDAWKDKFIMSFKEMDEELEGDGSIESYCSGTTAVTLVK  183

Query  706   QGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEP  885
             QG+ ++V N+GDSRA++ T DD   LVA QLTVDLKPNLP E ERI   +GRV + ++EP
Sbjct  184   QGEHLIVGNLGDSRAIICTRDDKNELVAKQLTVDLKPNLPAEYERIKSCEGRVMAMEEEP  243

Query  886   GVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATD  1065
              +YRVWMP+       + PGLA++RAFGD+ +KDFGLIS PE  +R +T +D+F +LA+D
Sbjct  244   NIYRVWMPDQ------DCPGLAMARAFGDFCLKDFGLISVPEVYYRKLTEKDEFIVLASD  297

Query  1066  GVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             G+WDV+SN E + IV+SA +R  +A+ +V HAV AWK       +DD + +CLF 
Sbjct  298   GLWDVLSNNEVIRIVASARKRSIAARLVVHHAVRAWKYKYPCAKVDDCAVVCLFL  352



>ref|XP_011077163.1| PREDICTED: probable protein phosphatase 2C 33 [Sesamum indicum]
 ref|XP_011077165.1| PREDICTED: probable protein phosphatase 2C 33 [Sesamum indicum]
Length=494

 Score =   298 bits (762),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 167/348 (48%), Positives = 220/348 (63%), Gaps = 45/348 (13%)
 Frame = +1

Query  298   RKNELILSTSG--FVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDG  471
             R+ E +  T G  F+N  S    ASL+++QGKKG NQD  IVWE FG + D +FCGVFDG
Sbjct  40    RREEHLHRTPGRMFLNGCS--EIASLYTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDG  97

Query  472   HGPWGHLVAKRVRELVPSSLLCNWQKALAHN-------MDNLG----FDNCLL-------  597
             HGP+GHLVAKRVR+ +P  L  +W+  +  +       ++  G     D  LL       
Sbjct  98    HGPYGHLVAKRVRDSLPLKLSAHWEVNIKSDEVLREVSLNTTGGLYSEDTSLLSADDEAR  157

Query  598   ------------DVW---KQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVV  726
                         DV+   K+S +KA   +D++L   A    F SGTTA+T+VKQG  +V+
Sbjct  158   ASVDAEETGKQPDVFQTLKESFLKAFKAMDRELRMYANIDCFCSGTTAVTLVKQGQDLVI  217

Query  727   ANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWM  906
              NVGDSRAVLAT D++  L AVQLTVDLKPNLP E ERI + KGRV++  DEP V RVW+
Sbjct  218   GNVGDSRAVLATRDENNLLTAVQLTVDLKPNLPAEAERIRKCKGRVFALHDEPEVARVWL  277

Query  907   PNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVS  1086
             PN +       PGLA++RAFGD+ +K+FGLIS PE ++R IT +D+F +LATDG+WDV+S
Sbjct  278   PNNDS------PGLAMARAFGDFCLKEFGLISVPEISYRCITDKDEFIVLATDGIWDVLS  331

Query  1087  NQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             N+E VE+V S   R  +A+ LVE AV AWK       +DD + +CLF 
Sbjct  332   NKEVVEVVGSCRARSNAARTLVESAVRAWKTKYPTSKVDDCAVVCLFL  379



>gb|KHG26837.1| putative phosphatase 2C 33 -like protein [Gossypium arboreum]
Length=487

 Score =   297 bits (761),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 165/366 (45%), Positives = 228/366 (62%), Gaps = 46/366 (13%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELILSTSG-FVNAISSHNCASLHSRQGKKGANQDRAI  414
             R+NSR+ +G   ++    +  K E +  T   F+N   S++ ASL ++QGKKG NQD  I
Sbjct  27    RRNSRKVLGSRISSF---DYWKEEPLHRTGQLFLNG--SNDVASLFTQQGKKGTNQDAMI  81

Query  415   VWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKALAH-------NMDN  573
             +WE FG + D +FCGVFDGHGP+GH+VAKRVR+ +P  L  +W+ + +        N++ 
Sbjct  82    IWENFGSRTDTVFCGVFDGHGPYGHMVAKRVRDHLPLKLNAHWEVSKSGEDALREINLNT  141

Query  574   LGFDNC-------------------------LLDVWKQSHIKACSEVDQQLEQQAG--SF  672
              G  N                          +    K+S +KA   +D+ L   A    F
Sbjct  142   AGSMNSETSFLTADEESRASVDLEETEKFPEIFQTLKESFLKAFKVMDRDLRTHASIDCF  201

Query  673   YSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRS  852
              SGTTA+T+VKQG  +V+ NVGDSRAVL T D D +L+AVQLTVDLKPNLP E ERI + 
Sbjct  202   CSGTTAVTLVKQGPHIVIGNVGDSRAVLGTRDKDNSLIAVQLTVDLKPNLPAEAERIRKY  261

Query  853   KGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNIT  1032
             KGRV++  DEP V RVW+PN N       PGLA++RAFGD+ +KDFGLIS PE ++ +++
Sbjct  262   KGRVFALKDEPEVARVWLPNSN------APGLAMARAFGDFCLKDFGLISVPEISYWHVS  315

Query  1033  FRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMS  1212
              +D+F +LATDG+WDV+SN+E V+IV+S   R  +A+ LVE AV AW+       +DD +
Sbjct  316   EKDEFIVLATDGIWDVLSNKEVVDIVASCRARTSAARALVETAVRAWRYKYPTSKVDDCA  375

Query  1213  AICLFF  1230
              +CLFF
Sbjct  376   VVCLFF  381



>gb|ABR16400.1| unknown [Picea sitchensis]
Length=523

 Score =   298 bits (763),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 154/336 (46%), Positives = 214/336 (64%), Gaps = 46/336 (14%)
 Frame = +1

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S + A + ++QG+KG NQD  +VWEEFG  +D +FCGVFDGHGP+GHLVAKRVR+ +PS 
Sbjct  62    SSDIACMFTQQGRKGTNQDAMVVWEEFGSNKDTVFCGVFDGHGPFGHLVAKRVRDSLPSK  121

Query  529   LLCNWQ-------------------------KALAHNMDN-------------LGFDNCL  594
             L  +W+                         +  +  MD               G    +
Sbjct  122   LCSHWEAITRGDEGNNNIREAVSAVGSLNSDETASITMDEEWKEAEGEDTEGLTGKAPDM  181

Query  595   LDVWKQSHIKACSEVDQQL--EQQAGSFYSGTTALTVVKQGDVMVVANVGDSRAVLATAD  768
             L  WK+S +KA   +D++L        F SGTTA+T++KQG+ +V+ NVGDSRA+L T D
Sbjct  182   LTAWKESFLKAFKVMDKELRFHPTIDCFCSGTTAVTLLKQGEDLVMGNVGDSRAILGTRD  241

Query  769   DDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGL  948
             +D +L+AVQLTVDLKPNLP E ERI + KGRV++  DEP V RVW+P+       + PGL
Sbjct  242   NDNSLIAVQLTVDLKPNLPKEAERIKQFKGRVFALSDEPDVARVWLPHD------DSPGL  295

Query  949   AVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPER  1128
             A++RAFGD+ +KDFGLI+ P+ ++R +T RD+F +LATDGVWDV+SN+E V+IV+SAP +
Sbjct  296   AMARAFGDFCLKDFGLIAVPDISYRRLTQRDEFIVLATDGVWDVLSNKEVVDIVASAPTQ  355

Query  1129  GESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
               +A+ LVE AV AW+       +DD + +CLF  +
Sbjct  356   ATAARSLVEFAVRAWRLKYPTSKVDDCAVVCLFLSD  391



>gb|ACN40371.1| unknown [Picea sitchensis]
Length=523

 Score =   298 bits (762),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 154/336 (46%), Positives = 214/336 (64%), Gaps = 46/336 (14%)
 Frame = +1

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S + A + ++QG+KG NQD  +VWEEFG  +D +FCGVFDGHGP+GHLVAKRVR+ +PS 
Sbjct  62    SSDIACMFTQQGRKGTNQDAMVVWEEFGSNKDTVFCGVFDGHGPFGHLVAKRVRDSLPSK  121

Query  529   LLCNWQ-------------------------KALAHNMDN-------------LGFDNCL  594
             L  +W+                         +  +  MD               G    +
Sbjct  122   LCSHWEAITRGDEGNNNIREAVSAVGSLNSDETASITMDEEWKEAEGEDTEGLTGKAPDM  181

Query  595   LDVWKQSHIKACSEVDQQL--EQQAGSFYSGTTALTVVKQGDVMVVANVGDSRAVLATAD  768
             L  WK+S +KA   +D++L        F SGTTA+T++KQG+ +V+ NVGDSRA+L T D
Sbjct  182   LTAWKESFLKAFKVMDKELRFHPTIDCFCSGTTAVTLLKQGEDLVMGNVGDSRAILGTRD  241

Query  769   DDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGL  948
             +D +L+AVQLTVDLKPNLP E ERI + KGRV++  DEP V RVW+P+       + PGL
Sbjct  242   NDNSLIAVQLTVDLKPNLPKEAERIKQFKGRVFALSDEPDVARVWLPHD------DSPGL  295

Query  949   AVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPER  1128
             A++RAFGD+ +KDFGLI+ P+ ++R +T RD+F +LATDGVWDV+SN+E V+IV+SAP +
Sbjct  296   AMARAFGDFCLKDFGLIAVPDISYRRLTQRDEFIVLATDGVWDVLSNKEVVDIVASAPTQ  355

Query  1129  GESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
               +A+ LVE AV AW+       +DD + +CLF  +
Sbjct  356   ATAARSLVEFAVRAWRLKYPTSKVDDCAVVCLFLSD  391



>ref|XP_004296680.1| PREDICTED: probable protein phosphatase 2C 33-like [Fragaria 
vesca subsp. vesca]
Length=424

 Score =   295 bits (754),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 157/311 (50%), Positives = 208/311 (67%), Gaps = 23/311 (7%)
 Frame = +1

Query  331   FVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVR  510
             F+N  S  + ASL S+QGKKG NQD  I WE FG +ED IFCGVFDGHGP GH+VAK+VR
Sbjct  94    FLNGFS--DVASLFSKQGKKGVNQDAMIAWENFGSKEDTIFCGVFDGHGPSGHMVAKKVR  151

Query  511   ELVPSSLLCNW---------QKALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLE--Q  657
             + +P  +   W           A   N D+ G         K S +KA   +D++L+   
Sbjct  152   DSLPLKVSSQWVLNTTDANRAGASEENKDSHGE---FFATLKDSFLKAFKVMDKELKLHP  208

Query  658   QAGSFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERE  837
             +   + SGTTA+T+VKQG  +V+AN+GDSRAVL T D++G+LVAVQLTVDLKPNLP E E
Sbjct  209   RIDCYCSGTTAVTMVKQGQDLVIANIGDSRAVLGTRDEEGSLVAVQLTVDLKPNLPREAE  268

Query  838   RIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFT  1017
             RI   KGRV++  +EP V RVW+PN N       PGLA++RAFGD+ +KD+GLIS P+ +
Sbjct  269   RITLRKGRVFALHNEPDVSRVWLPNSN------SPGLAMARAFGDFCLKDYGLISVPDIS  322

Query  1018  FRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIA  1197
             +R +T +D+F +LATDG+WDV+SN+E VEIV+++P R  +A+ LVE A  AWK       
Sbjct  323   YRRLTDKDEFVVLATDGIWDVLSNKEVVEIVAASP-RPSAARALVELANRAWKFKYPYAK  381

Query  1198  MDDMSAICLFF  1230
              DD + +CLF 
Sbjct  382   TDDCAVVCLFL  392



>ref|XP_006363628.1| PREDICTED: probable protein phosphatase 2C 33-like [Solanum tuberosum]
Length=445

 Score =   295 bits (755),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 148/299 (49%), Positives = 203/299 (68%), Gaps = 20/299 (7%)
 Frame = +1

Query  364   SLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNW  543
             S++S+QGKKG NQD   VWE FGGQ+ M FCGVFDGHGP GH VA+ VR+ +PS L    
Sbjct  73    SMYSQQGKKGINQDAMTVWENFGGQKGMFFCGVFDGHGPSGHKVARYVRDSLPSKL----  128

Query  544   QKALAHNMDNLGFD--------NCLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTAL  693
               +   + +++ +D        N + D WK   IK+  E+D++LE      S+ SGTTA+
Sbjct  129   SSSNVISANDIRWDAEKDDESNNPIFDAWKDKFIKSFKEMDEELEGDGSIESYCSGTTAV  188

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+VKQG+ ++V N+GDSRA++ T DD   LVA QLTVDLKPNLP E ERI   +GRV + 
Sbjct  189   TLVKQGEHLIVGNLGDSRAIICTRDDKNELVAKQLTVDLKPNLPAEYERIKSCEGRVMAM  248

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             ++EP +YRVWMP+       + PGLA++RAFGD+ +KDFGLIS PE  +R +T +D+F +
Sbjct  249   EEEPNIYRVWMPDQ------DCPGLAMARAFGDFCLKDFGLISVPEVYYRKLTEKDEFIV  302

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             LA+DG+WDV+SN E + IV+SA +R  +A+ +V HAV AWK       +DD + +CLF 
Sbjct  303   LASDGLWDVLSNDEVIRIVASARKRSIAARLVVHHAVRAWKYKYPCAKVDDCAVVCLFL  361



>gb|ABR16508.1| unknown [Picea sitchensis]
Length=526

 Score =   297 bits (761),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 158/353 (45%), Positives = 225/353 (64%), Gaps = 40/353 (11%)
 Frame = +1

Query  286   AKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVF  465
             A EA+ +E I    G +    + N A + ++QG+KG NQD  +VWE+FG ++D +FCGVF
Sbjct  43    AAEAKADEQISRIPGRMFGNGASNVACMFTQQGRKGTNQDAMLVWEDFGSRKDTVFCGVF  102

Query  466   DGHGPWGHLVAKRVRELVPSSLLCNW----------------------QKALAHNMDNLG  579
             DGHGP+GHLVAK+VR+ +PS L   W                      +++L+  MD+  
Sbjct  103   DGHGPFGHLVAKKVRDSLPSKLSNQWEAEMKDDDSIKEANSTVGSMNSEESLSVTMDDEW  162

Query  580   FDNCLLD----------VWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMV  723
              ++  ++            K+S +KA   +D++L        F SGTTA+T+VKQG  +V
Sbjct  163   RESADMEEREKCPEIFLTLKESFLKAFKVMDKELRLHPTIDCFCSGTTAVTLVKQGQDLV  222

Query  724   VANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVW  903
             + NVGDSRAVL T   D +L AVQLTVDLKPNLP E ERI + KGRV++  DEP V RVW
Sbjct  223   IGNVGDSRAVLGTRVQDNSLSAVQLTVDLKPNLPREAERIRQCKGRVFALHDEPEVSRVW  282

Query  904   MPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVV  1083
             +P+       + PGLA++RAFGD+ +KDFGLI+ P+ ++R +T RD+F +LA+DGVWDV+
Sbjct  283   LPHN------DSPGLAMARAFGDFCLKDFGLIAVPDVSYRRLTERDEFIVLASDGVWDVL  336

Query  1084  SNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHNKL  1242
             SN+E V+IV+SAP +  +A+ LVE+AV AW+       +DD + +CLF +N L
Sbjct  337   SNKEVVDIVASAPSQTTAARALVEYAVRAWRLKYPTSKVDDCAVVCLFLNNSL  389



>ref|XP_004239696.1| PREDICTED: probable protein phosphatase 2C 33 [Solanum lycopersicum]
Length=470

 Score =   295 bits (756),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 174/377 (46%), Positives = 225/377 (60%), Gaps = 52/377 (14%)
 Frame = +1

Query  214   KTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKG  393
             K   K+SG +NS  D  +E            EL+    G +    S   ASL S+QGKKG
Sbjct  25    KNSKKRSGSRNSSFDFHKE------------ELLHRIPGRMFLNGSSEVASLFSQQGKKG  72

Query  394   ANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQ---------  546
              NQD  IVWE FG +ED +FCGVFDGHGP+GH+VAKRVR+ +P  L  +W+         
Sbjct  73    TNQDAMIVWENFGSREDTVFCGVFDGHGPFGHMVAKRVRDALPLKLSTHWEVNIKSEDVL  132

Query  547   KALAHNM----------------DNLGFD-----NCL--LDVWKQSHIKACSEVDQQLEQ  657
             + ++ N                   L  D     N L      K+S +KA   +D++L  
Sbjct  133   REISLNTGSSLYPEDAVLISAEESRLSIDVEETKNHLEVFQTLKESFLKAYKVMDRELRS  192

Query  658   QAG--SFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGE  831
                   F SGTTA+T+VKQG+ +V+ NVGDSRAVL T  +D +L AVQLTVDLKP+LP E
Sbjct  193   YTNIDCFCSGTTAVTLVKQGEHLVIGNVGDSRAVLGTRGEDDSLTAVQLTVDLKPDLPAE  252

Query  832   RERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPE  1011
              ERI + KGRV+S  DEP V RVWMPN N       PGLA++RAFGD+ +KDFG+IS PE
Sbjct  253   FERIRKCKGRVFSLQDEPDVARVWMPNSNS------PGLAMARAFGDFCLKDFGVISVPE  306

Query  1012  FTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRG  1191
              ++R ++ +D+F ILATDG+WDV+SN E V IV SA  R  +A+ LVE AV AWK T   
Sbjct  307   ISYRRLSEKDEFIILATDGIWDVLSNDEVVNIVDSASSRSSAARALVEEAVQAWKITYPT  366

Query  1192  IAMDDMSAICLFFHNKL  1242
               +DD + +CLF  + L
Sbjct  367   SKVDDCAVVCLFLDSNL  383



>ref|XP_010272535.1| PREDICTED: probable protein phosphatase 2C 66 [Nelumbo nucifera]
Length=507

 Score =   296 bits (758),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 214/330 (65%), Gaps = 38/330 (12%)
 Frame = +1

Query  331   FVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVR  510
             F+N   S + A L+++QGKKG NQD  +VWE FG ++D IFCGVFDGHGP+GH+VAK+VR
Sbjct  61    FLNG--SSDIACLYTQQGKKGTNQDAMLVWENFGSRDDTIFCGVFDGHGPYGHMVAKKVR  118

Query  511   ELVPSSLLCNW-------QKALAH---NMDNLG---FDN---CLLDV------------W  606
             + +P  L   W       Q  +A    N D  G    D+   C LD+             
Sbjct  119   DSLPLKLCTQWNANSSDCQNGIAPESINSDETGSISMDDEWCCSLDIDDTEKLPDLYQPL  178

Query  607   KQSHIKACSEVDQQLEQQA--GSFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGN  780
             KQS +K    +D++L+       F SGTTA+T+VKQG  +V+ NVGDSRAV+ T D + +
Sbjct  179   KQSILKTFRLMDKELKMHPTIDCFCSGTTAVTLVKQGQNLVIGNVGDSRAVMGTKDKENS  238

Query  781   LVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSR  960
             LVAVQLTVDLKPNLP E  RI + KGRV++  DEP V RVW+PN       + PGLA++R
Sbjct  239   LVAVQLTVDLKPNLPREAARIQQCKGRVFALQDEPEVARVWLPNN------DSPGLAMAR  292

Query  961   AFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESA  1140
             AFGD+ +KDFGLIS P+ ++R +T RDQF ILATDGVWDV+SN+E V+IV+SAP R  +A
Sbjct  293   AFGDFCLKDFGLISVPDVSYRRLTERDQFIILATDGVWDVLSNKEVVDIVASAPSRTTAA  352

Query  1141  KRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             + +V+ AV AW+        DD + +CLF 
Sbjct  353   RAVVDCAVRAWRLKFPTSKSDDCAVVCLFL  382



>ref|XP_009622508.1| PREDICTED: probable protein phosphatase 2C 65 [Nicotiana tomentosiformis]
Length=447

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/298 (49%), Positives = 201/298 (67%), Gaps = 16/298 (5%)
 Frame = +1

Query  364   SLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNW  543
             S++S+QGKKG NQD   VWE FGGQ+ M FCGVFDGHGP GH VA+ VR+ +PS +  ++
Sbjct  67    SMYSQQGKKGINQDAMTVWENFGGQKGMFFCGVFDGHGPSGHKVARYVRDFLPSKI-SSY  125

Query  544   QKALAHN-------MDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALT  696
                ++ N        D+    N     WK   +K+  E+DQ+LE      S+ SGTTA+T
Sbjct  126   NNEISTNSIRWDVEKDDDEAYNPYFAAWKDKFLKSFKEMDQELEGDGSIESYCSGTTAVT  185

Query  697   VVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSD  876
             +VKQG+ ++V N+GDSRA++ T DD   LV+ QLTVDLKPNLP E ERI   +GRV + +
Sbjct  186   LVKQGEHLIVGNLGDSRAIICTRDDKNELVSQQLTVDLKPNLPAEYERIRSCEGRVMAME  245

Query  877   DEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAIL  1056
             +EP VYRVWMP+       + PGLA++RAFGD+ +KDFGLIS PE  +R +T +D+F +L
Sbjct  246   EEPSVYRVWMPDQ------DCPGLAMARAFGDFCLKDFGLISVPEVYYRKLTEKDEFIVL  299

Query  1057  ATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             ATDG+WDV+SN E + IV++A +R  +A+ +V HAV AWK       +DD + +CLF 
Sbjct  300   ATDGLWDVLSNDEVIRIVATARKRSIAARLVVHHAVRAWKYKYPCAKIDDCAVVCLFL  357



>ref|XP_007139720.1| hypothetical protein PHAVU_008G053700g [Phaseolus vulgaris]
 gb|ESW11714.1| hypothetical protein PHAVU_008G053700g [Phaseolus vulgaris]
Length=490

 Score =   295 bits (755),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 160/366 (44%), Positives = 226/366 (62%), Gaps = 44/366 (12%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIV  417
             + NSR+ +G  A++    E  +NE +    G +    S   ASL ++QGKKG NQD  +V
Sbjct  25    KSNSRKRLGSRASSF---EYWRNEPLHRIPGRIFINGSTQVASLFTQQGKKGTNQDAMVV  81

Query  418   WEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKALAHN--MDNLGFDNC  591
             WE F  ++D IFCGVFDGHGP+GH+VAKRVR+++P +L  +W+  ++    +  +G +  
Sbjct  82    WENFCSRQDTIFCGVFDGHGPFGHMVAKRVRDVLPLNLNTHWELNVSGEEILKEIGINPA  141

Query  592   -------------------------------LLDVWKQSHIKACSEVDQQLE--QQAGSF  672
                                            +    K+S +KA   +D++L+  Q    F
Sbjct  142   GSMNIEEAASASADEDSRVSVDAEETEKHPKIFQTLKESFLKAFKVMDRELKTHQSIDCF  201

Query  673   YSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRS  852
              SGTTA+T++KQG  ++V NVGDSRAVL T + D +LVAVQLTVDLKPNLP E ERI   
Sbjct  202   CSGTTAVTLIKQGHDLIVGNVGDSRAVLGTREKDDSLVAVQLTVDLKPNLPAEEERIRSC  261

Query  853   KGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNIT  1032
             KGRV++  DEP V RVW+PN +       PGLA++RAFGD+ +KDFGLIS PE ++R +T
Sbjct  262   KGRVFALHDEPEVARVWLPNND------SPGLAMARAFGDFCLKDFGLISVPEVSYRRLT  315

Query  1033  FRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMS  1212
              +D+F +LATDG+WDV+SN+E V+IV++   R  +A+ LVE AV AW+       +DD +
Sbjct  316   EKDEFIVLATDGIWDVLSNKEVVDIVAATSRRSLAARALVESAVRAWRYKYPTSKVDDCA  375

Query  1213  AICLFF  1230
              +CLF 
Sbjct  376   VVCLFL  381



>ref|XP_006857543.1| hypothetical protein AMTR_s00061p00041440 [Amborella trichopoda]
 gb|ERN19010.1| hypothetical protein AMTR_s00061p00041440 [Amborella trichopoda]
Length=534

 Score =   296 bits (758),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 160/335 (48%), Positives = 212/335 (63%), Gaps = 42/335 (13%)
 Frame = +1

Query  331   FVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVR  510
             FVN  +   C  LH++QG+KG NQD  ++WE FG + D +FCGVFDGHGP+GH+VAK+VR
Sbjct  70    FVNGSTDFAC--LHTQQGRKGTNQDAMLIWENFGSRNDTVFCGVFDGHGPYGHMVAKKVR  127

Query  511   ELVPSSLLCNW------QKALAHN-----------MDNLGFDNCLLD-------------  600
             + +P  L  +W      Q  L  N             ++G D  L D             
Sbjct  128   DSLPLKLSKHWDANLGIQNGLHENGSLNGSMNSEETASIGMDEDLGDSIDADEYEKLPEI  187

Query  601   --VWKQSHIKACSEVDQQLEQQA--GSFYSGTTALTVVKQGDVMVVANVGDSRAVLATAD  768
                 +QS +KA   +D++L+       F SGTTA+T+VKQG  +V+ NVGDSRA+L T D
Sbjct  188   HMTLRQSFLKAFKVMDKELKLHPTIDCFCSGTTAVTLVKQGQDLVIGNVGDSRAILGTRD  247

Query  769   DDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGL  948
              D +L+AVQLTVDLKPNLP E ERI R KGRV++  DEP V RVW+PN +       PGL
Sbjct  248   QDDSLIAVQLTVDLKPNLPREAERIQRCKGRVFALQDEPEVARVWLPNNDS------PGL  301

Query  949   AVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPER  1128
             A++RAFGD+ +KDFGLIS P+ ++  IT RD+F +LATDGVWDV++N+E V+IV SAP R
Sbjct  302   AMARAFGDFCLKDFGLISVPDISYHRITERDEFIVLATDGVWDVLTNKEVVDIVWSAPSR  361

Query  1129  GESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
               +A+ LVE AV AW+        DD + +CLFF+
Sbjct  362   TTAARALVECAVRAWRLKFPTSKSDDCAVVCLFFN  396



>emb|CBI39869.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   293 bits (749),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/337 (47%), Positives = 214/337 (64%), Gaps = 43/337 (13%)
 Frame = +1

Query  331   FVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVR  510
             FVN  S+   ASL ++QGKKG NQD  +VWE F  + D IFCGVFDGHGP+GH+VAK+VR
Sbjct  2     FVNGAST--VASLFTQQGKKGTNQDAMLVWENFSSRSDTIFCGVFDGHGPYGHMVAKKVR  59

Query  511   ELVPSSLLCNWQ-----------------------KALAHNMDNLGFDNCLLD-------  600
             + +P  L   WQ                       +  + NMD+  +++  +D       
Sbjct  60    DCLPLILHTQWQANSNSDKKSDGKNGNAPEKTNLEETASLNMDDEYYESLEVDDNEKVPE  119

Query  601   ---VWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVVANVGDSRAVLATA  765
                  K+S +KA   +D++L+       F SGTTA+T+VKQG  +V+ N+GDSRAVLAT 
Sbjct  120   MYLPLKESFLKAFKLMDKELKLHPTIDCFCSGTTAVTLVKQGPNLVIGNIGDSRAVLATR  179

Query  766   DDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPG  945
             D + +L AVQLT+DLKPNLP E  RI + KGRV++  DEP V RVW+PN       + PG
Sbjct  180   DVENSLTAVQLTIDLKPNLPREAARIHQCKGRVFALQDEPEVARVWLPNS------DSPG  233

Query  946   LAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPE  1125
             LA++RAFGD+ +KDFGLIS P+  +R++T RD+F ILATDGVWDV+SN+EAV+IV+SAP 
Sbjct  234   LAMARAFGDFCLKDFGLISVPDIYYRHLTERDEFIILATDGVWDVLSNKEAVDIVASAPG  293

Query  1126  RGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
                +A+ LV+ AV AW+        DD + +CLF  +
Sbjct  294   HTTAARALVDCAVRAWRLKYPTSKNDDCAVVCLFLEH  330



>gb|KDO54036.1| hypothetical protein CISIN_1g011218mg [Citrus sinensis]
Length=456

 Score =   293 bits (751),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 166/366 (45%), Positives = 225/366 (61%), Gaps = 44/366 (12%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIV  417
             RK+SR+ +G    +    + R+ E +    G +    S   ASL ++QGKKG NQD  IV
Sbjct  27    RKSSRKKLGSRNPSF---DYRREEPLHRIPGRLFLNGSSEIASLFTQQGKKGTNQDAMIV  83

Query  418   WEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQ---------------KA  552
             WE F  + D IFCGVFDGHGP+GH+VAKRVR+ +P  L  +W+                A
Sbjct  84    WENFASRADTIFCGVFDGHGPYGHMVAKRVRDSLPLKLSSHWEVNITSEEVLREISINTA  143

Query  553   LAHNMDNLGFDNC------------------LLDVWKQSHIKACSEVDQQLEQQAG--SF  672
              + N ++  F +                        K+S +KA   +D++L   A    F
Sbjct  144   GSINSEDTSFVSADEEPRASADLEETEKFPEFFQTLKESFLKAFKVMDRELRMHATIDCF  203

Query  673   YSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRS  852
              SGTTA+T++KQG  +V+ NVGDSRAVL T D D +LVA+QLTVDLKPNLP E ERI + 
Sbjct  204   CSGTTAVTLIKQGQHLVIGNVGDSRAVLGTRDKDDSLVAMQLTVDLKPNLPAEAERIRKC  263

Query  853   KGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNIT  1032
             KGRV++  DEP V RVW+PN       + PGLA++RAFGD+ +KDFGLIS P+ ++R +T
Sbjct  264   KGRVFALHDEPEVARVWLPN------YDSPGLAMARAFGDFCLKDFGLISVPDISYRRLT  317

Query  1033  FRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMS  1212
              +D+F +LATDG+WDV+SN+E VEIV+SAP R  +A+ LVE AV AW+R      +DD +
Sbjct  318   DKDEFIVLATDGIWDVLSNEEVVEIVASAPARSSAARSLVESAVRAWRRKYPTSKVDDCA  377

Query  1213  AICLFF  1230
              +CLF 
Sbjct  378   VVCLFL  383



>gb|KDP22816.1| hypothetical protein JCGZ_00403 [Jatropha curcas]
Length=416

 Score =   292 bits (748),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/310 (48%), Positives = 209/310 (67%), Gaps = 22/310 (7%)
 Frame = +1

Query  364   SLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNW  543
             S++S+QGKKG NQD   VWEEF G +DM FCGVFDGHGP+GH V++ VR+ +PS L    
Sbjct  54    SMYSQQGKKGVNQDAMTVWEEFLGNKDMFFCGVFDGHGPYGHKVSRHVRDTLPSRLSAAI  113

Query  544   QKALAHNMDNLGFD-------------NCLLDVWKQSHIKACSEVDQQLEQQAG--SFYS  678
             + + A+N    G D             + LL   + S IK   E+D++L   A   SF S
Sbjct  114   KLSQANNF-RYGTDGNDGNGSKDGDQGSRLLSSLEASFIKCFKEMDEELSLDASIDSFCS  172

Query  679   GTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKG  858
             G+TA+TVVKQG+ ++V+N+GDSRAVL T  +   LV VQLTVDLKPN+  E ERI  SKG
Sbjct  173   GSTAVTVVKQGNHLIVSNLGDSRAVLCTRSNGNQLVPVQLTVDLKPNIASEAERIKNSKG  232

Query  859   RVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFR  1038
             R+++  +EP V+R+WMP+       + PGLA++RAFGD+ +KD+GLIS PE ++R +T  
Sbjct  233   RIFAMKEEPEVFRIWMPDE------DCPGLAMARAFGDFCLKDYGLISIPEVSYRRLTNN  286

Query  1039  DQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAI  1218
             D+F +LATDG+WDV+SN + + IV+SA +R  +AK LV++AV AWK    G  +DD + +
Sbjct  287   DEFVVLATDGIWDVLSNYDVIHIVASARKRSMAAKILVKYAVRAWKNKYPGCRVDDCAVV  346

Query  1219  CLFFHNKLIV  1248
             CLF  ++ ++
Sbjct  347   CLFLKSRTVL  356



>ref|XP_010928162.1| PREDICTED: probable protein phosphatase 2C 66 [Elaeis guineensis]
Length=558

 Score =   296 bits (758),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 166/366 (45%), Positives = 224/366 (61%), Gaps = 48/366 (13%)
 Frame = +1

Query  331   FVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVR  510
             F+N  S   C  L+++QGKKG NQD  IVWE F  + D IFCGVFDGHGP+GH+VAK+VR
Sbjct  106   FLNGTSEMAC--LYTQQGKKGTNQDAMIVWENFTSRSDTIFCGVFDGHGPFGHMVAKKVR  163

Query  511   ELVPSSLLCNWQKAL-AHNMD----NL------------GFDNCLLDVW-----------  606
             + +P  L   W+  +  HN      NL            G D    D W           
Sbjct  164   DCLPLKLCTEWRANVNGHNSPQQNGNLSRSMNSEESTFSGID----DEWGESIDENEKPP  219

Query  607   ------KQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVVANVGDSRAVLAT  762
                   KQS +KA   +D++L+  +    F SGTTA+TVVKQG  +++ NVGDSRA+L T
Sbjct  220   EIYIPLKQSFLKAFKLMDKELKLHSTIDCFCSGTTAVTVVKQGQDLIIGNVGDSRAILGT  279

Query  763   ADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGP  942
              D+D NLVAVQLTVDLKPNLP E  RI + KGRV++  DEP V R+W+PN       + P
Sbjct  280   RDEDDNLVAVQLTVDLKPNLPREAARIQQCKGRVFALLDEPEVARIWLPN------NDSP  333

Query  943   GLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAP  1122
             GLA++RAFGD+ +KD+GLIS P+ ++R++T +D+F +LATDGVWDV+SN+EAV+IV+SAP
Sbjct  334   GLAMARAFGDFCLKDYGLISVPDISYRHLTSKDEFIVLATDGVWDVLSNKEAVDIVASAP  393

Query  1123  ERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHNKLIV*rrrrrrLHDMMQKQPIT  1302
              R  +A+ LV+ AV AW+       +DD + +CLF          R     +M  +Q  T
Sbjct  394   TRASAARALVDCAVRAWRLKFPTSKIDDCAVVCLFLEPPSPSDPSRGSDFENMPTEQAET  453

Query  1303  TTLNAI  1320
               L ++
Sbjct  454   RVLGSV  459



>ref|XP_008648262.1| PREDICTED: putative protein phosphatase 2C family protein isoform 
X1 [Zea mays]
 gb|AFW77679.1| putative protein phosphatase 2C family protein [Zea mays]
Length=380

 Score =   291 bits (744),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 161/308 (52%), Positives = 204/308 (66%), Gaps = 24/308 (8%)
 Frame = +1

Query  178   MVQFSSLFNGFAKTISKKSGRKNSREDVGREAANALAKEARKNEL--ILSTSGFVNAISS  351
             M Q SSL  G A+++S    R   R+  G  A +      RK  +  +L TSG +    S
Sbjct  1     MRQISSLLQGLARSLSVGRDRDRDRDRKGNGAGD------RKTAVPAVLRTSGTLWGDGS  54

Query  352   HNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSL  531
                A++ SR+G+KG NQD +IVWE FG QE  IFCG+FDGHG WGH VAK VR+ +P SL
Sbjct  55    DTFAAVCSRRGEKGINQDCSIVWEGFGCQEGTIFCGIFDGHGQWGHYVAKAVRDSLPPSL  114

Query  532   LCNWQKALA------HNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQ--QAGSFYSGTT  687
             LC+WQ+ALA           LG  +C  D+WK+S++ AC+ VD +L +  +  +  SG T
Sbjct  115   LCHWQEALALASLIDDGEKKLG--DCQFDLWKRSYVAACAAVDDELRRSRRLDAVQSGCT  172

Query  688   ALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVW  867
             AL++VKQGD+M+VANVGDSRAVL T  DDG + AVQLTVDLKPNLP E+ERI R  G+V+
Sbjct  173   ALSIVKQGDLMIVANVGDSRAVLGTTSDDGAIAAVQLTVDLKPNLPQEKERIRRCNGQVY  232

Query  868   SSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQF  1047
                DEPGV+RVW P+       E PGLA+SRAFGDY +KD G+IS PE T + I+  DQF
Sbjct  233   CLADEPGVHRVWQPSR------ESPGLAMSRAFGDYCVKDCGVISTPEVTQKRISSSDQF  286

Query  1048  AILATDGV  1071
              ILATDGV
Sbjct  287   IILATDGV  294



>emb|CDX88554.1| BnaC06g39980D [Brassica napus]
Length=478

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 153/343 (45%), Positives = 219/343 (64%), Gaps = 35/343 (10%)
 Frame = +1

Query  307   ELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWG  486
             E +   SG + +  S   A L+++QGKKG NQD  +V+E F  ++D +FCGVFDGHGP+G
Sbjct  47    EGVQEVSGRLISNGSSEIACLYTQQGKKGTNQDAMLVFENFCSRDDTVFCGVFDGHGPFG  106

Query  487   HLVAKRVRELVPSSLLCNW-------QKALAHN-----------------MDNLGFDNCL  594
             H+VAK+VR+ +PS+L           Q +L +                  MD    +  L
Sbjct  107   HMVAKKVRDTLPSTLSTQLKLTSESEQNSLVNEKGVQIKCTEEEEAVTTTMDEQCDEQLL  166

Query  595   LDVW---KQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVVANVGDSRAVLA  759
              +++   K + +K+C ++D+ L+       F SGTT++T++KQG+ +VV N+GDSRAVLA
Sbjct  167   PEMYLPLKHALLKSCQQIDKDLKMHPTIDCFCSGTTSVTLIKQGEDLVVGNIGDSRAVLA  226

Query  760   TADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEG  939
             T D D  LVAVQLTVDLKP+LP E  RI + KGRV++  DEP V RVW+PN +       
Sbjct  227   TRDQDNALVAVQLTVDLKPDLPSESARIQKCKGRVFALQDEPEVARVWLPNSDS------  280

Query  940   PGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSA  1119
             PGLA++RAFGD+ +KD+GLIS P+  +R +T RDQF +LA+DGVWDV+SN+EAV+I++SA
Sbjct  281   PGLAMARAFGDFCLKDYGLISVPDINYRRLTERDQFIVLASDGVWDVLSNKEAVDIIASA  340

Query  1120  PERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHNKLIV  1248
             P R  +A+ LV+ AV +W+        DD + +CLF  +   V
Sbjct  341   PSRSTAARALVDTAVRSWRIKYPTSKNDDCTVVCLFLQDSSYV  383



>ref|XP_009800840.1| PREDICTED: probable protein phosphatase 2C 65 [Nicotiana sylvestris]
Length=446

 Score =   293 bits (749),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 145/298 (49%), Positives = 202/298 (68%), Gaps = 16/298 (5%)
 Frame = +1

Query  364   SLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNW  543
             S++S+QGKKG NQD   VWE FGGQ+ M FCGVFDGHGP GH VA+ VR+ +PS +  ++
Sbjct  67    SMYSQQGKKGINQDAMTVWENFGGQKGMFFCGVFDGHGPSGHKVARYVRDFLPSKI-SSY  125

Query  544   QKALAHN-------MDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALT  696
                ++ N        D+   DN     W+   +K+  E+D++LE      S+ SGTTA+T
Sbjct  126   NNEISTNSIRWDVEKDDSEADNPYFVAWRDKFLKSFKEMDEELEGDGSIESYCSGTTAVT  185

Query  697   VVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSD  876
             +VKQG+ ++V N+GDSRA++ T DD   LV+ QLTVDLKPNLP E ERI   +GRV + +
Sbjct  186   LVKQGEHLIVGNLGDSRAIICTRDDKNELVSEQLTVDLKPNLPAEYERIRSCEGRVMAME  245

Query  877   DEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAIL  1056
             +EP VYRVWMP+       + PGLA++RAFGD+ +KDFGLIS PE  +R +T +D+F +L
Sbjct  246   EEPSVYRVWMPDQ------DCPGLAMARAFGDFCLKDFGLISVPEVYYRKLTEKDEFIVL  299

Query  1057  ATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             A+DG+WDV+SN E + IV++A +R  +A+ +V HAV AWK       +DD + +CLF 
Sbjct  300   ASDGLWDVLSNDEVIRIVATARKRSIAARLVVHHAVRAWKYKYPCAKVDDCAVVCLFL  357



>ref|XP_010089720.1| putative protein phosphatase 2C 6 [Morus notabilis]
 gb|EXB38281.1| putative protein phosphatase 2C 6 [Morus notabilis]
Length=476

 Score =   293 bits (751),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 202/324 (62%), Gaps = 30/324 (9%)
 Frame = +1

Query  337   NAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVREL  516
             NA S      L+++QGKKG NQD  ++WE F  + D IFCGVFDGHGP+GH+VAK+VR+ 
Sbjct  37    NAASKTGTGCLYTQQGKKGTNQDAMLLWENFSSRSDTIFCGVFDGHGPFGHMVAKKVRDS  96

Query  517   VPSSLLCNWQKALAHNMDNLGFDNC-----LLDVW-----------------KQSHIKAC  630
             +P  L   W+    +   +   D       + D W                 +QS +KA 
Sbjct  97    LPIILSTQWKSHCKNETSDAAMDCAQTSPPMDDEWCEPLEQNENLPEMYVALRQSMLKAF  156

Query  631   SEVDQ--QLEQQAGSFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTV  804
               +D+  Q       F SGTTA+ +VKQG  +V+ NVGDSRAVL   D D  LVAVQLTV
Sbjct  157   KLMDKDLQFHPTIDCFCSGTTAIALVKQGQHLVIGNVGDSRAVLGMRDKDNALVAVQLTV  216

Query  805   DLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIK  984
             DLKP+LPGE  RI R KGRV++  DEP V RVW+PN       + PGLA++RAFGD+ +K
Sbjct  217   DLKPDLPGEAARIQRCKGRVFALQDEPEVARVWLPNN------DSPGLAMARAFGDFCLK  270

Query  985   DFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAV  1164
             DFGLIS P+  + +IT RD+F ILATDGVWDV+SN+EAV+IV+SAP R  +A+ LV+ AV
Sbjct  271   DFGLISVPDVYYHHITERDEFVILATDGVWDVLSNKEAVDIVASAPGRTTAARALVDCAV  330

Query  1165  CAWKRTRRGIAMDDMSAICLFFHN  1236
              AW+        DD + +CLF  N
Sbjct  331   RAWRLKYPTSKNDDCAVVCLFLEN  354



>ref|XP_010476727.1| PREDICTED: probable protein phosphatase 2C 6 [Camelina sativa]
Length=492

 Score =   293 bits (751),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 150/327 (46%), Positives = 207/327 (63%), Gaps = 41/327 (13%)
 Frame = +1

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S + A L+++QGKKG NQD  +VWE F  + D + CGVFDGHGP+GH+V+KRVR+++P +
Sbjct  63    SSDIACLYTQQGKKGTNQDAMLVWENFCSRSDTVLCGVFDGHGPFGHMVSKRVRDMLPFT  122

Query  529   L-----------------------------LCNWQKALAHNMDNLGFDNCLLDVWKQSHI  621
             L                             LC+ Q+      D        L + K++ +
Sbjct  123   LSTQLKTTSGTEQSGSKNGLEFASSVDEEQLCDLQQT---EKDEKLLPKMYLPL-KRALL  178

Query  622   KACSEVDQQLEQQA--GSFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQ  795
             K C ++D++L+       F SGTT++TV+KQG  +VV N+GDSRAVLAT D D  LVAVQ
Sbjct  179   KTCQQMDKELKMHPTINCFCSGTTSVTVIKQGKDLVVGNIGDSRAVLATIDQDNALVAVQ  238

Query  796   LTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDY  975
             LT+DLKP+LP E  RI + +GRV++  DEP V RVW+PN +       PGLA++RAFGD+
Sbjct  239   LTIDLKPDLPSESARIQKCRGRVFALQDEPEVARVWLPNSDS------PGLAMARAFGDF  292

Query  976   YIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVE  1155
              +KD+GLIS P+  +  +T RDQF ILATDGVWDV+SN+EAV+IV+SAP R  +A+ LV+
Sbjct  293   CLKDYGLISVPDINYHRLTERDQFIILATDGVWDVLSNKEAVDIVASAPSRNTAARSLVD  352

Query  1156  HAVCAWKRTRRGIAMDDMSAICLFFHN  1236
              AV AW+        DD + +CLF  +
Sbjct  353   TAVRAWRLKYPTSKNDDCAVVCLFLED  379



>ref|XP_001764661.1| predicted protein [Physcomitrella patens]
 gb|EDQ70643.1| predicted protein [Physcomitrella patens]
Length=490

 Score =   293 bits (751),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 156/370 (42%), Positives = 228/370 (62%), Gaps = 36/370 (10%)
 Frame = +1

Query  202   NGFAKTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQ  381
             NG  K   + SGRK+ + ++ ++   AL  E +++ ++  T G +  I +   A + ++Q
Sbjct  4     NGVEK---QPSGRKHRKREMQKQVVEALTAEGKRDLVLSMTPGRMVRIGATEAACVFTQQ  60

Query  382   GKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKALAH  561
             G+KG NQD  +VWE+F   ED +FCGVFDGHGP+GHLVAKRVR+ +PS L  ++   ++ 
Sbjct  61    GRKGTNQDAMLVWEKFASMEDTVFCGVFDGHGPFGHLVAKRVRDSLPSKLRTDYGSNVST  120

Query  562   NMDNLGFD-------------------------NCLLDVWKQSHIKACSEVDQQLEQQA-  663
               ++   D                           +   WK+SH+ A  E+DQ+L     
Sbjct  121   TYESAMSDAEEFSSRELSKELSVTEPQPIVIEPPAMFGPWKESHLLAFKEMDQELRMHPV  180

Query  664   -GSFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERER  840
                F SGTT +TV+KQG  +V+ NVGDSRA++ T D++G   +VQLTVDLKPNLP E ER
Sbjct  181   IDCFCSGTTTVTVLKQGKYLVIGNVGDSRAIMGTRDENGCWKSVQLTVDLKPNLPHEAER  240

Query  841   IMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTF  1020
             I   KGRV++  DEP V RVW+P  N       PGLA++RAFGD+ +KD+G+I+ P+ T+
Sbjct  241   IKECKGRVFALQDEPDVMRVWLPFDNS------PGLAMARAFGDFCLKDYGVIAVPDVTY  294

Query  1021  RNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAM  1200
             R +T RD+F ILATDG+WDV+SN+EAV++V++A  R  +A+ LVE AV  W+       +
Sbjct  295   REVTDRDKFLILATDGIWDVLSNEEAVQVVATATSRATAARSLVESAVRVWRLKYPTSKV  354

Query  1201  DDMSAICLFF  1230
             DD + + L+ 
Sbjct  355   DDCAVVVLYL  364



>ref|XP_006301326.1| hypothetical protein CARUB_v10021735mg [Capsella rubella]
 gb|EOA34224.1| hypothetical protein CARUB_v10021735mg [Capsella rubella]
Length=496

 Score =   293 bits (751),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 163/412 (40%), Positives = 242/412 (59%), Gaps = 61/412 (15%)
 Frame = +1

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S   A L+++QG+KG NQD  +V+E F  ++D +FCGVFDGHGP+GH+VAK+VR+ +P +
Sbjct  64    SSKVACLYTQQGRKGTNQDAMLVFENFCSRDDTVFCGVFDGHGPFGHMVAKKVRDTLPFT  123

Query  529   LLCNW------QKALAHNMDNLGFDN-------------------CLLDV----------  603
             L          +++L  N ++L                       C L+           
Sbjct  124   LSTQLKMTSESEQSLLVNENDLQIKGTEEEEVQKTESVTTMDEQWCELNPNESNDELPEM  183

Query  604   ---WKQSHIKACSEVDQQLEQQA--GSFYSGTTALTVVKQGDVMVVANVGDSRAVLATAD  768
                 K + +K+C ++D++L+       F SGTT++T++KQG+ +VV N+GDSRAVLAT D
Sbjct  184   YLPLKHALLKSCQQIDKELKMHPTIDCFCSGTTSVTLIKQGEDLVVGNIGDSRAVLATRD  243

Query  769   DDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGL  948
             +D  L+AVQLTVDLKP+LPGE  RI + KGRV++  DEP V RVW+PN +       PGL
Sbjct  244   EDNALIAVQLTVDLKPDLPGESARIQKCKGRVFALQDEPEVARVWLPNSDS------PGL  297

Query  949   AVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPER  1128
             A++RAFGD+ +KD+GLIS P+ ++R +T +DQF I+A+DGVWDV+SN+EAV+IV+SAP R
Sbjct  298   AMARAFGDFCLKDYGLISIPDISYRRLTEQDQFIIIASDGVWDVLSNKEAVDIVASAPSR  357

Query  1129  GESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHNKLIV*rrrrrrLHDMMQKQPITTT  1308
               +A+ LV+ AV +W+        DD + +CLF  +  +        +    +++PI + 
Sbjct  358   STAARALVDTAVRSWRIKYPTSKNDDCTVVCLFLQDSSVAMEVSSNAMKHSHKEEPIESV  417

Query  1309  LNAICKY*SE*IMVQTLQH*T*FPKPNLSVVSIPLYCIIHSN-FTNFLSLCI  1461
              N+I K   E + V+  +              IP  C I S   T  L+ CI
Sbjct  418   SNSISKEDDEIVPVKEEK--------------IPASCGIESKMMTMTLAECI  455



>gb|KHG02830.1| hypothetical protein F383_26202 [Gossypium arboreum]
 gb|KHG23855.1| hypothetical protein F383_10165 [Gossypium arboreum]
Length=515

 Score =   294 bits (752),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 155/336 (46%), Positives = 211/336 (63%), Gaps = 43/336 (13%)
 Frame = +1

Query  331   FVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVR  510
             F+N  SS  C  L+++QGKKG NQD  +VWE F  + D IFCGVFDGHGP+GH+VAK+VR
Sbjct  68    FLNGASSVAC--LYTQQGKKGTNQDAMLVWENFSSRSDAIFCGVFDGHGPYGHMVAKKVR  125

Query  511   ELVPSSLLCNWQKAL------------------AHNMDNLGFDNCLLDVW----------  606
             + +P  L   W+ +L                  + +  +L  D+   + W          
Sbjct  126   DSLPVILCTQWKASLTGEQSCLNKSENAPESTMSEDAASLSMDDECCESWEIEENEQLPE  185

Query  607   -----KQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVVANVGDSRAVLATA  765
                  KQS +KA   +D++L+       F SGTTA+T+VKQG  +V+ N+GDSRAVLA  
Sbjct  186   MYLPLKQSMLKAFKLMDKELKLHPAIDCFCSGTTAVTLVKQGLDLVIGNIGDSRAVLAMR  245

Query  766   DDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPG  945
             D D +L+AVQLTVDLKP+LP E  RI + +GRV++  DEP V RVW+PN +       PG
Sbjct  246   DKDNSLIAVQLTVDLKPDLPREAARIQQCRGRVFALQDEPEVARVWLPNNDS------PG  299

Query  946   LAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPE  1125
             LA++RAFGD+ +KDFGLIS P+  +R +T RD+F ILATDGVWDV+SN+EA++IV+SAP 
Sbjct  300   LAMARAFGDFCLKDFGLISVPDVFYRRLTERDEFVILATDGVWDVLSNKEAIDIVASAPS  359

Query  1126  RGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFH  1233
             R  +A+ LV+ A  AW+        DD + +CLF  
Sbjct  360   RSTAARALVDCATRAWRLKYPTSKNDDCAVVCLFLE  395



>ref|XP_007140186.1| hypothetical protein PHAVU_008G091200g [Phaseolus vulgaris]
 gb|ESW12180.1| hypothetical protein PHAVU_008G091200g [Phaseolus vulgaris]
Length=433

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 213/312 (68%), Gaps = 24/312 (8%)
 Frame = +1

Query  364   SLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLC--  537
             S++++QG+KG NQD   VWE++ G++D+IFCGVFDGHGP GH V++ +R+ +PS L    
Sbjct  51    SMYTQQGQKGVNQDAMAVWEDYAGEKDVIFCGVFDGHGPLGHKVSQFIRDNLPSKLSAAI  110

Query  538   --NWQKAL----AHNMDNLGFDNCL-------LDVWKQSHIKACSEVDQQL--EQQAGSF  672
               + QKA+    A++ D   FD+         L  W+   +K+ SE+D+ L  E    S+
Sbjct  111   EISQQKAIKFYDANDADTSSFDDGYDNSNQMSLASWEGCFLKSFSEMDEYLAREINTDSY  170

Query  673   YSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRS  852
              SG TA+T++KQGD ++V N+GDSRAVL T D D  L+AVQLTVDLKP +P E  RI+  
Sbjct  171   CSGCTAVTLIKQGDQLIVGNLGDSRAVLCTKDKD-QLIAVQLTVDLKPEIPSETSRIVNC  229

Query  853   KGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNIT  1032
             +GRV+++++EP VYR+WMP+ +       PGLA+SRAFGD+ +KD+GLIS P+  +R IT
Sbjct  230   EGRVFAAEEEPDVYRIWMPDDDC------PGLAMSRAFGDFCLKDYGLISVPDVFYRKIT  283

Query  1033  FRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMS  1212
              +DQF +LATDG+WDV++N E + IV+SAP R  +AK LV+ AV AW+    G  +DD +
Sbjct  284   PQDQFVVLATDGIWDVLTNHEVISIVASAPRRSVAAKLLVKRAVRAWRYKYPGSKVDDCA  343

Query  1213  AICLFFHNKLIV  1248
             AIC F   + ++
Sbjct  344   AICFFLDEQPVL  355



>gb|KDO54033.1| hypothetical protein CISIN_1g011218mg [Citrus sinensis]
 gb|KDO54034.1| hypothetical protein CISIN_1g011218mg [Citrus sinensis]
Length=491

 Score =   293 bits (750),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 166/366 (45%), Positives = 225/366 (61%), Gaps = 44/366 (12%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIV  417
             RK+SR+ +G    +    + R+ E +    G +    S   ASL ++QGKKG NQD  IV
Sbjct  27    RKSSRKKLGSRNPSF---DYRREEPLHRIPGRLFLNGSSEIASLFTQQGKKGTNQDAMIV  83

Query  418   WEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQ---------------KA  552
             WE F  + D IFCGVFDGHGP+GH+VAKRVR+ +P  L  +W+                A
Sbjct  84    WENFASRADTIFCGVFDGHGPYGHMVAKRVRDSLPLKLSSHWEVNITSEEVLREISINTA  143

Query  553   LAHNMDNLGFDNC------------------LLDVWKQSHIKACSEVDQQLEQQA--GSF  672
              + N ++  F +                        K+S +KA   +D++L   A    F
Sbjct  144   GSINSEDTSFVSADEEPRASADLEETEKFPEFFQTLKESFLKAFKVMDRELRMHATIDCF  203

Query  673   YSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRS  852
              SGTTA+T++KQG  +V+ NVGDSRAVL T D D +LVA+QLTVDLKPNLP E ERI + 
Sbjct  204   CSGTTAVTLIKQGQHLVIGNVGDSRAVLGTRDKDDSLVAMQLTVDLKPNLPAEAERIRKC  263

Query  853   KGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNIT  1032
             KGRV++  DEP V RVW+PN       + PGLA++RAFGD+ +KDFGLIS P+ ++R +T
Sbjct  264   KGRVFALHDEPEVARVWLPN------YDSPGLAMARAFGDFCLKDFGLISVPDISYRRLT  317

Query  1033  FRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMS  1212
              +D+F +LATDG+WDV+SN+E VEIV+SAP R  +A+ LVE AV AW+R      +DD +
Sbjct  318   DKDEFIVLATDGIWDVLSNEEVVEIVASAPARSSAARSLVESAVRAWRRKYPTSKVDDCA  377

Query  1213  AICLFF  1230
              +CLF 
Sbjct  378   VVCLFL  383



>ref|XP_008218455.1| PREDICTED: probable protein phosphatase 2C 33 [Prunus mume]
Length=506

 Score =   293 bits (751),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 167/376 (44%), Positives = 226/376 (60%), Gaps = 53/376 (14%)
 Frame = +1

Query  214   KTISKKSGRKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKG  393
             K+  KK G +NS  D  RE            E +    G +    S   ASL ++QGKKG
Sbjct  28    KSTKKKMGSRNSSFDYRRE------------EPLHRIPGRMFLNGSSEVASLFTQQGKKG  75

Query  394   ANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQKALAH----  561
              NQD  IVWE FG + D +FCGVFDGHGP+GH+VAKRVR+ +P  L  NW+  +      
Sbjct  76    TNQDAMIVWENFGSRTDTVFCGVFDGHGPFGHMVAKRVRDSLPLKLSANWEVTITSEEVL  135

Query  562   ---NMDNLGFDNC--------------------------LLDVWKQSHIKACSEVDQQLE  654
                +++N G  N                           +    K+S +KA   +D++L 
Sbjct  136   KEISLNNSGSLNSDGTPFVYVDEDFRASIDIEETDKHPEIFQTLKESFLKAFKIMDRELR  195

Query  655   QQAG--SFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPG  828
              Q     F SGTTA+T+VKQG  +++ NVGDSRAVL T D D  L+A+QLTVDLKPNLP 
Sbjct  196   TQPSIDCFCSGTTAVTLVKQGRDLIIGNVGDSRAVLCTRDKDDTLIAIQLTVDLKPNLPA  255

Query  829   ERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEP  1008
             E ERI + +GRV++  DEP V RVW+PN +       PGLA++RAFGD+ +KDFGLIS P
Sbjct  256   EAERIRKCRGRVFALQDEPEVSRVWLPNNDS------PGLAMARAFGDFCLKDFGLISVP  309

Query  1009  EFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRR  1188
             + +FR +T +D+F +LATDG+WDV+SN+E V+IV+SAP R  +A+ LVE AV AW++   
Sbjct  310   DISFRRLTEKDEFIVLATDGIWDVLSNKEVVDIVASAPARSSAARALVETAVRAWRQKYP  369

Query  1189  GIAMDDMSAICLFFHN  1236
                +DD + +CLF  +
Sbjct  370   TSKVDDCAVVCLFLDS  385



>ref|XP_006480437.1| PREDICTED: probable protein phosphatase 2C 33-like isoform X1 
[Citrus sinensis]
 ref|XP_006480438.1| PREDICTED: probable protein phosphatase 2C 33-like isoform X2 
[Citrus sinensis]
Length=491

 Score =   293 bits (749),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 166/366 (45%), Positives = 225/366 (61%), Gaps = 44/366 (12%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIV  417
             RK+SR+ +G    +    + R+ E +    G +    S   ASL ++QGKKG NQD  IV
Sbjct  27    RKSSRKKLGSRNPSF---DYRREEPLHRIPGRLFLNGSSEIASLFTQQGKKGTNQDAMIV  83

Query  418   WEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQ---------------KA  552
             WE F  + D IFCGVFDGHGP+GH+VAKRVR+ +P  L  +W+                A
Sbjct  84    WENFASRADTIFCGVFDGHGPYGHMVAKRVRDSLPLKLSSHWEVNITSEEVLREISINTA  143

Query  553   LAHNMDNLGFDNC------------------LLDVWKQSHIKACSEVDQQLEQQAG--SF  672
              + N ++  F +                        K+S +KA   +D++L   A    F
Sbjct  144   GSINSEDTSFVSADEEPRASADLEETEKFPEFFQTLKESFLKAFKVMDRELRMHATIDCF  203

Query  673   YSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRS  852
              SGTTA+T++KQG  +V+ NVGDSRAVL T D D +LVA+QLTVDLKPNLP E ERI + 
Sbjct  204   CSGTTAVTLIKQGQHLVIGNVGDSRAVLGTRDKDDSLVAMQLTVDLKPNLPAEAERIRKC  263

Query  853   KGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNIT  1032
             KGRV++  DEP V RVW+PN       + PGLA++RAFGD+ +KDFGLIS P+ ++R +T
Sbjct  264   KGRVFALHDEPEVARVWLPN------YDSPGLAMARAFGDFCLKDFGLISVPDISYRRLT  317

Query  1033  FRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMS  1212
              +D+F +LATDG+WDV+SN+E VEIV+SAP R  +A+ LVE AV AW+R      +DD +
Sbjct  318   DKDEFIVLATDGIWDVLSNEEVVEIVASAPARSSAARSLVESAVRAWRRKYPTSKVDDCA  377

Query  1213  AICLFF  1230
              +CLF 
Sbjct  378   VVCLFL  383



>ref|XP_006847475.1| hypothetical protein AMTR_s00163p00051750 [Amborella trichopoda]
 gb|ERN09056.1| hypothetical protein AMTR_s00163p00051750 [Amborella trichopoda]
Length=480

 Score =   292 bits (747),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 159/349 (46%), Positives = 219/349 (63%), Gaps = 40/349 (11%)
 Frame = +1

Query  292   EARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDG  471
             ++R+ E +    G +    S   ASL ++QG+KG NQD  IVWE FG + D +FCGVFDG
Sbjct  37    DSRRVEQLQRVPGRMFLNGSSKVASLFTQQGRKGTNQDAMIVWENFGSRTDTVFCGVFDG  96

Query  472   HGPWGHLVAKRVRELVPSSLLCNWQ------KALAHNMDNLGFDN-------CL------  594
             HGP+GH+VAKRVR+ +P  L  +W+      + L  N    G  N       CL      
Sbjct  97    HGPYGHMVAKRVRDSLPLKLSAHWEVNIGSEEGLRENSSISGSMNSEDSAFMCLDEESRD  156

Query  595   -LDV------------WKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVVA  729
              +D+             K S +KA   +D++L        F SGTTA+T+VKQG  +V+ 
Sbjct  157   SMDLEEKEKLAEIFMSLKDSFLKAFKVMDKELRLHPAIDCFCSGTTAVTLVKQGQDLVIG  216

Query  730   NVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMP  909
             N+GDSRA+L T D+D +L+AVQLTVDLKPNLP E ERI + +GRV++  DEP V RVW+P
Sbjct  217   NIGDSRAILGTRDEDDSLIAVQLTVDLKPNLPREAERIRQCRGRVFALQDEPEVARVWLP  276

Query  910   NPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSN  1089
             N +       PGLA++RAFGD+ +KD+GLIS P+ ++R +T RD+F +LATDGVWDV+SN
Sbjct  277   NNDS------PGLAMARAFGDFCLKDYGLISVPDVSYRRLTERDEFIVLATDGVWDVLSN  330

Query  1090  QEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
             +E V+IV+SA  R  +A+ LVE AV AW+       +DD + +CLF  +
Sbjct  331   KEVVDIVASAMTRTTAARSLVESAVRAWRYKYPTSKVDDCAVVCLFLDH  379



>ref|XP_001764662.1| predicted protein [Physcomitrella patens]
 gb|EDQ70644.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   289 bits (740),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/316 (48%), Positives = 214/316 (68%), Gaps = 19/316 (6%)
 Frame = +1

Query  331   FVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVR  510
             F N  SS+ C  + ++QG+KG NQD  +VWE +   ED +FCGVFDGHGP+GHLVA+RVR
Sbjct  9     FSNGASSNAC--IFTQQGRKGTNQDAMVVWENYASMEDTVFCGVFDGHGPYGHLVARRVR  66

Query  511   ELVPSSLLCNWQ------KALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQQLEQQAG--  666
             + VPS LL +        K ++ +    G ++ + DVWK++H+     +D++L    G  
Sbjct  67    DSVPSKLLQSTHSVNGEHKMVSTDTVEEGKEHPMFDVWKEAHLTGYRIMDKELRSHPGID  126

Query  667   SFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIM  846
              F SGTTA+TV+KQG  +V+ NVGDSRA+L T DD+G+  AVQLTVDLKPNLP E ERI 
Sbjct  127   CFCSGTTAVTVLKQGKHLVIGNVGDSRAILGTKDDNGSWKAVQLTVDLKPNLPREAERIR  186

Query  847   RSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRN  1026
             + +GRV++  DEP V RVW+P  +       PGLA++RAFGD+ +KD+G+I+ PE  +R 
Sbjct  187   QCRGRVFALHDEPEVPRVWLPFDDS------PGLAMARAFGDFCLKDYGVIAVPEMCYRQ  240

Query  1027  ITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDD  1206
             +T +DQF +LATDG+WDV+SN+E V++V+ AP R  +A+ LVE AV  W+       +DD
Sbjct  241   LTKQDQFIVLATDGIWDVLSNEEVVQVVAQAPTRATAARALVESAVRVWRLKYPTSKVDD  300

Query  1207  MSAICLF---FHNKLI  1245
              + +CL+    H+K +
Sbjct  301   CAVVCLYPNGTHDKYL  316



>ref|XP_003555649.1| PREDICTED: probable protein phosphatase 2C 33-like isoform X1 
[Glycine max]
 ref|XP_006606600.1| PREDICTED: probable protein phosphatase 2C 33-like isoform X2 
[Glycine max]
 gb|KHN27148.1| Hypothetical protein glysoja_032916 [Glycine soja]
Length=365

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 154/320 (48%), Positives = 207/320 (65%), Gaps = 34/320 (11%)
 Frame = +1

Query  331   FVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVR  510
             F+N   S   ASL  +QG+KG NQD  ++W+ F   +D +FCGVFDGHGP GH+VAK++R
Sbjct  46    FLNC--SSQVASLFCKQGRKGINQDAMLLWDNFSSNKDTVFCGVFDGHGPHGHMVAKKLR  103

Query  511   ELVPSSLLCNWQ---------------KALAHNMDNLGFDNCLLDVWKQSHIKACSEVDQ  645
             +  P  L+  W                   A    N+G         + S +KAC  +D+
Sbjct  104   DSFPLKLIAQWNLLHPNNNSSSNNNSDTPCAVAPGNIG-------TLRDSFVKACKVMDR  156

Query  646   QL--EQQAGSFYSGTTALTVVKQGDVMVVANVGDSRAVLATAD-DDGNLVAVQLTVDLKP  816
             +L  + Q     SG+T LT++KQG  +V+ANVGDSRAVLAT D  +G+LVAVQL+ D KP
Sbjct  157   ELKVQHQIDCSCSGSTGLTLLKQGQDLVIANVGDSRAVLATQDRSNGSLVAVQLSTDHKP  216

Query  817   NLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGL  996
             +LP E ERI   KGRV+S  +E G+ RVW+PN      ++ PGLA+SRAFGD+ +KDFG+
Sbjct  217   HLPREAERIRICKGRVFSIKNESGIPRVWLPN------IDSPGLAMSRAFGDFCLKDFGV  270

Query  997   ISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWK  1176
             IS P+F++  +T RDQF +LATDGVWDV+SN+EAV I+SSAP R  +A+ LVE A+ AWK
Sbjct  271   ISVPDFSYHRLTQRDQFVVLATDGVWDVLSNEEAVAIISSAP-RSSAARMLVEAAIHAWK  329

Query  1177  RTRRGIAMDDMSAICLFFHN  1236
                    +DD S +CLFFH+
Sbjct  330   TKLPLTKVDDCSVVCLFFHS  349



>ref|NP_178081.2| putative protein phosphatase 2C 18 [Arabidopsis thaliana]
 sp|Q8RXZ4.1|P2C18_ARATH RecName: Full=Probable protein phosphatase 2C 18; Short=AtPP2C18 
[Arabidopsis thaliana]
 gb|AAL85011.1| putative protein phosphatase-2C [Arabidopsis thaliana]
 gb|AAM45085.1| putative protein phosphatase-2C [Arabidopsis thaliana]
 gb|AEE36275.1| putative protein phosphatase 2C 18 [Arabidopsis thaliana]
Length=504

 Score =   292 bits (748),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 164/420 (39%), Positives = 238/420 (57%), Gaps = 69/420 (16%)
 Frame = +1

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S   A L+++QGKKG NQD  +V+E F  ++D +FCGVFDGHGP+GH+VAK+VR+ +P +
Sbjct  64    SSKIACLYTQQGKKGTNQDAMLVFENFCSRDDTVFCGVFDGHGPFGHMVAKKVRDTLPFT  123

Query  529   LLCNWQKALAHNMDNL----GFD-----------------------NCLLDVW-------  606
             LL   +     +  +L    GF                          + + W       
Sbjct  124   LLTQLKMTSESDQSSLVGANGFQIKCTEEEEVQTTESEQVQKTESVTTMDEQWCELNPNV  183

Query  607   ------------KQSHIKACSEVDQQLEQQA--GSFYSGTTALTVVKQGDVMVVANVGDS  744
                         K + +K+C ++D++L+       F SGTT++T++KQG+ +VV N+GDS
Sbjct  184   NNDELPEMYLPLKHAMLKSCQQIDKELKMHPTIDCFCSGTTSVTLIKQGEDLVVGNIGDS  243

Query  745   RAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGG  924
             RAVLAT D+D  L+AVQLT+DLKP+LPGE  RI + KGRV++  DEP V RVW+PN +  
Sbjct  244   RAVLATRDEDNALLAVQLTIDLKPDLPGESARIQKCKGRVFALQDEPEVARVWLPNSDS-  302

Query  925   VAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVE  1104
                  PGLA++RAFGD+ +KD+GLIS P+  +R +T RDQF ILA+DGVWDV+SN+EAV+
Sbjct  303   -----PGLAMARAFGDFCLKDYGLISVPDINYRRLTERDQFIILASDGVWDVLSNKEAVD  357

Query  1105  IVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHNKLIV*rrrrrrLHDMM  1284
             IV+SAP R  +A+ LV+ AV +W+        DD + +CLF  +  +          D  
Sbjct  358   IVASAPSRSTAARALVDTAVRSWRIKYPTSKNDDCTVVCLFLQDSSVAMEVSTNVKKDSP  417

Query  1285  QKQPITTTLNAICKY*SE*IMVQTLQH*T*FPKPNLSVVSIPLYCIIHSN-FTNFLSLCI  1461
             +++ I +  N+  K   E + V+  +              IP  C I S   T  L+ CI
Sbjct  418   KEESIESVTNSTSKEEDEIVPVKDEK--------------IPESCGIESKMMTMTLAECI  463



>ref|XP_010644704.1| PREDICTED: probable protein phosphatase 2C 6 [Vitis vinifera]
Length=511

 Score =   293 bits (749),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 158/337 (47%), Positives = 214/337 (64%), Gaps = 43/337 (13%)
 Frame = +1

Query  331   FVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVR  510
             FVN  S+   ASL ++QGKKG NQD  +VWE F  + D IFCGVFDGHGP+GH+VAK+VR
Sbjct  58    FVNGAST--VASLFTQQGKKGTNQDAMLVWENFSSRSDTIFCGVFDGHGPYGHMVAKKVR  115

Query  511   ELVPSSLLCNWQ-----------------------KALAHNMDNLGFDNCLLD-------  600
             + +P  L   WQ                       +  + NMD+  +++  +D       
Sbjct  116   DCLPLILHTQWQANSNSDKKSDGKNGNAPEKTNLEETASLNMDDEYYESLEVDDNEKVPE  175

Query  601   ---VWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVVANVGDSRAVLATA  765
                  K+S +KA   +D++L+       F SGTTA+T+VKQG  +V+ N+GDSRAVLAT 
Sbjct  176   MYLPLKESFLKAFKLMDKELKLHPTIDCFCSGTTAVTLVKQGPNLVIGNIGDSRAVLATR  235

Query  766   DDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPG  945
             D + +L AVQLT+DLKPNLP E  RI + KGRV++  DEP V RVW+PN       + PG
Sbjct  236   DVENSLTAVQLTIDLKPNLPREAARIHQCKGRVFALQDEPEVARVWLPNS------DSPG  289

Query  946   LAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPE  1125
             LA++RAFGD+ +KDFGLIS P+  +R++T RD+F ILATDGVWDV+SN+EAV+IV+SAP 
Sbjct  290   LAMARAFGDFCLKDFGLISVPDIYYRHLTERDEFIILATDGVWDVLSNKEAVDIVASAPG  349

Query  1126  RGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHN  1236
                +A+ LV+ AV AW+        DD + +CLF  +
Sbjct  350   HTTAARALVDCAVRAWRLKYPTSKNDDCAVVCLFLEH  386



>ref|XP_002889260.1| phosphatase 2C family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65519.1| phosphatase 2C family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   292 bits (747),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 165/420 (39%), Positives = 238/420 (57%), Gaps = 69/420 (16%)
 Frame = +1

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S   A L+++QGKKG NQD  +V+E F  ++D +FCGVFDGHGP+GH+VAK+VR+ +P +
Sbjct  61    SSKIACLYTQQGKKGTNQDAMLVFENFCSRDDTVFCGVFDGHGPFGHMVAKKVRDTLPFT  120

Query  529   LLCNWQKALAHNMDNLGFDNCLL---------------------------DVW-------  606
             L    + A   +  +L   N  L                           + W       
Sbjct  121   LSTQLKTASESDQSSLVGANGFLIKCTEEEEMQTTESEEVQKTESVTTMDEQWCELNPNE  180

Query  607   ------------KQSHIKACSEVDQQLEQQA--GSFYSGTTALTVVKQGDVMVVANVGDS  744
                         KQ+ +K+C ++D++L+       F SGTT++T++KQG+ +VV N+GDS
Sbjct  181   NNDELPEMYLPLKQALLKSCQQIDKELKMHPTIDCFCSGTTSVTLIKQGEDLVVGNIGDS  240

Query  745   RAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGG  924
             RAVLAT D+D  L+AVQLTVDLKP+LPGE  RI + KGRV++  DEP V RVW+PN +  
Sbjct  241   RAVLATRDEDNALLAVQLTVDLKPDLPGESARIQKCKGRVFALQDEPEVARVWLPNSDS-  299

Query  925   VAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVE  1104
                  PGLA++RAFGD+ +KD+GLIS P+  +R +T RDQF ILA+DGVWDV+SN+EAV+
Sbjct  300   -----PGLAMARAFGDFCLKDYGLISVPDINYRRLTERDQFIILASDGVWDVLSNKEAVD  354

Query  1105  IVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFFHNKLIV*rrrrrrLHDMM  1284
             IV+SAP R  +A+ LV+ AV +W+        DD + +CLF  +  +        +    
Sbjct  355   IVASAPSRNTAARALVDTAVRSWRIKYPTSKNDDCTVVCLFLQDSSVAMEVSSNVMKHSH  414

Query  1285  QKQPITTTLNAICKY*SE*IMVQTLQH*T*FPKPNLSVVSIPLYCIIHSN-FTNFLSLCI  1461
             +++ I +  N+  K   E + V+  +              IP  C I S   T  L+ CI
Sbjct  415   KEESIESVSNSTSKEEDEIVPVKDEK--------------IPASCGIESKMMTMTLAECI  460



>ref|XP_008384641.1| PREDICTED: probable protein phosphatase 2C 6 [Malus domestica]
Length=545

 Score =   293 bits (750),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 209/329 (64%), Gaps = 41/329 (12%)
 Frame = +1

Query  349   SHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSS  528
             S   A L+++QGKKG NQD  +VWE F  + D  FCGVFDGHGP+GH+VAK+VR+ +P  
Sbjct  71    SSKVACLYTQQGKKGTNQDAMLVWENFATRSDTTFCGVFDGHGPFGHMVAKKVRDSLPLI  130

Query  529   LLCNWQKALAHNMDNL-------GFDN-------CLLDVW-------------------K  609
             L   W+   + ++ NL       G  N        + D W                   K
Sbjct  131   LCTQWKANSSGDLSNLNKAENANGRSNFEEPVSPSIDDEWCESLEVKESEKLPEMYLPQK  190

Query  610   QSHIKACSEVDQQLEQQA--GSFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNL  783
             +S +KA   +D++L+       F SGTTA+T+VKQG  +V+ NVGDSRAVLAT DDD +L
Sbjct  191   KSFLKAFKLMDKELKLHPTIDCFCSGTTAVTLVKQGQNLVIGNVGDSRAVLATRDDDNSL  250

Query  784   VAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRA  963
             +AVQLTVDLKP+LP E  RI + KGRV++  DEP V RVW+PN +       PGLA++RA
Sbjct  251   IAVQLTVDLKPDLPAESARIHQCKGRVFALQDEPEVARVWLPNNDS------PGLAMARA  304

Query  964   FGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAK  1143
             FGD+ +KDFGLIS P+  +R++T RD+F ILATDGVWDV+SN+EAVEIV+SAP    +A+
Sbjct  305   FGDFCLKDFGLISVPDVCYRHLTERDEFIILATDGVWDVLSNKEAVEIVASAPGXTTAAR  364

Query  1144  RLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
              LVE AV AW+        DD + +CLF 
Sbjct  365   ALVECAVRAWRLKYPTSKNDDCAVVCLFL  393



>ref|XP_009406352.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   288 bits (737),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 212/334 (63%), Gaps = 42/334 (13%)
 Frame = +1

Query  331   FVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVR  510
             F+N  +S   ASL +++G+KG NQD  +VWE FG + D +FCGVFDGHGP GH VA++VR
Sbjct  6     FLNGATS--AASLFTQRGRKGINQDAMLVWENFGDRSDTVFCGVFDGHGPNGHKVARKVR  63

Query  511   ELVPSSLLCNWQKALAH----------------------NMD-----NLGFDNCL-----  594
             +++P  L  +W+  + +                      N++     ++GF+  +     
Sbjct  64    DILPLKLRASWEVYIGNDECRENNISSTRSMNSEETSSMNLNEESKASVGFEERVKHSET  123

Query  595   LDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVVANVGDSRAVLATAD  768
             L + K S +KA   VD++L        FYSGTTA+T+VKQG  +V+ NVGDSRAVL T D
Sbjct  124   LTILKDSFLKAFRIVDKELRLHPDIDCFYSGTTAVTLVKQGQDLVIGNVGDSRAVLGTRD  183

Query  769   DDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGL  948
                 LVAVQLTVDLKPNLP E ERI R +GRV++   EP V RVW+PN      ++ PGL
Sbjct  184   QHNTLVAVQLTVDLKPNLPREAERIRRCRGRVFALRGEPEVARVWLPN------IDSPGL  237

Query  949   AVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPER  1128
             A++RA GD+ +K+FGLIS PE ++R IT +D+F +LATDGVWDV+SN+E V+IVS+   R
Sbjct  238   AMARALGDFCLKNFGLISVPEISYRRITEKDEFIVLATDGVWDVLSNREVVKIVSTVSAR  297

Query  1129  GESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
               +A+ LVE AV AWK       +DD + +CLF 
Sbjct  298   SSAARILVESAVRAWKLKYPTSKIDDCAVVCLFL  331



>ref|XP_002526696.1| protein phosphatase-2c, putative [Ricinus communis]
 gb|EEF35718.1| protein phosphatase-2c, putative [Ricinus communis]
Length=463

 Score =   290 bits (743),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 147/325 (45%), Positives = 207/325 (64%), Gaps = 36/325 (11%)
 Frame = +1

Query  364   SLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNW  543
             S++S+QGKKG NQD   VWEEF G +DM FCGVFDGHGP+GH VA+ VR+ +PS L    
Sbjct  54    SMYSQQGKKGVNQDAMTVWEEFIGNKDMFFCGVFDGHGPYGHKVARHVRDTLPSRLSAAI  113

Query  544   QKALAHNMDNLGFDNC----------------------------LLDVWKQSHIKACSEV  639
             + + A+++     D                              LL  W+ S  K   ++
Sbjct  114   KLSQANSIKYGDTDTADGEDSDDSKSEGSKDGENSNSTNNKGTLLLSSWEASFFKCFKDM  173

Query  640   DQQLEQQAG--SFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLK  813
             D++L   A   SF SGTTA+TVVKQG+ +++AN+GDSRAVL T  +   LV VQLTVDLK
Sbjct  174   DEELSLDASIDSFCSGTTAVTVVKQGNHLIIANLGDSRAVLCTRSNKNQLVPVQLTVDLK  233

Query  814   PNLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFG  993
             PN+  E ERI    GRV++  +EP VYR+WMP+       + PGLA++RAFGD+ +KD+G
Sbjct  234   PNIASEAERIKNRNGRVFAMAEEPEVYRIWMPDE------DCPGLAMARAFGDFCLKDYG  287

Query  994   LISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAW  1173
             LIS PE ++R +T +D+F +LATDG+WDV+SN + + IV+SA +R  +AK L+++AV AW
Sbjct  288   LISTPEVSYRRLTNKDEFVVLATDGIWDVLSNYDVIRIVASARKRSMAAKMLIKYAVRAW  347

Query  1174  KRTRRGIAMDDMSAICLFFHNKLIV  1248
             +    G  +DD + ICLF  ++ ++
Sbjct  348   RNKYPGCRVDDCAVICLFLKSRTVL  372



>ref|XP_008388813.1| PREDICTED: probable protein phosphatase 2C 33 [Malus domestica]
Length=500

 Score =   291 bits (745),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 151/346 (44%), Positives = 213/346 (62%), Gaps = 41/346 (12%)
 Frame = +1

Query  298   RKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHG  477
             R+ E +    G +    S   ASL ++QGKKG NQD  IVWE F  + D +FCGVFDGHG
Sbjct  44    RREEQLHRIPGRMFLNGSSEAASLFTQQGKKGTNQDAMIVWENFCSRTDTVFCGVFDGHG  103

Query  478   PWGHLVAKRVRELVPSSLLCNWQKALAH---------------NMDNLGFDNC-------  591
             P+GH+VAKRVR+ +P  L  NW+  + +               N D+  F +        
Sbjct  104   PFGHMVAKRVRDSLPLKLSANWEVKITNDEVLKGISLNTAGSLNSDDTAFVSVDEDLRPS  163

Query  592   -----------LLDVWKQSHIKACSEVDQQLEQQAG--SFYSGTTALTVVKQGDVMVVAN  732
                        +L   ++S +KA   +D++L        F SGTTA+T++KQG  + + N
Sbjct  164   VDVDETEKNPEILQALRESFLKAFKVMDRELRTTPSIDCFCSGTTAVTLIKQGRDLFIGN  223

Query  733   VGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSSDDEPGVYRVWMPN  912
             VGDSRAVL T D D  L A+QLTVDLKP+LP E ERI + +GRV++  DEP V RVW+PN
Sbjct  224   VGDSRAVLCTRDRDDTLSAIQLTVDLKPSLPAEAERIRKCRGRVFALQDEPEVARVWLPN  283

Query  913   PNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAILATDGVWDVVSNQ  1092
              +       PGLA++RAFGD+ +KDFGLIS P+ ++R +T +D+F +LATDG+WDV+SN+
Sbjct  284   NDS------PGLAMARAFGDFCLKDFGLISVPDVSYRRLTEKDEFIVLATDGIWDVLSNK  337

Query  1093  EAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             E V+++++AP R  +A+ LVE AV AW++      +DD + +CLF 
Sbjct  338   EVVDVIATAPARPSAAQALVETAVRAWRQKYPTSKVDDCAVVCLFL  383



>ref|XP_010485598.1| PREDICTED: probable protein phosphatase 2C 33 isoform X1 [Camelina 
sativa]
 ref|XP_010485599.1| PREDICTED: probable protein phosphatase 2C 33 isoform X2 [Camelina 
sativa]
 ref|XP_010485600.1| PREDICTED: probable protein phosphatase 2C 33 isoform X1 [Camelina 
sativa]
 ref|XP_010485601.1| PREDICTED: probable protein phosphatase 2C 33 isoform X1 [Camelina 
sativa]
 ref|XP_010485602.1| PREDICTED: probable protein phosphatase 2C 33 isoform X1 [Camelina 
sativa]
 ref|XP_010485603.1| PREDICTED: probable protein phosphatase 2C 33 isoform X1 [Camelina 
sativa]
Length=494

 Score =   291 bits (745),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 161/378 (43%), Positives = 226/378 (60%), Gaps = 57/378 (15%)
 Frame = +1

Query  238   RKNSREDVGREAANALAKEARKNELILSTSGFVNAISSHNCASLHSRQGKKGANQDRAIV  417
             RKNS++   R  +   + + R+ E +    G +    S + A + ++QGKKG NQD  +V
Sbjct  27    RKNSKK---RPGSRNSSFDYRREEPLHHVPGRMFLNGSSDAACIFTQQGKKGPNQDAMVV  83

Query  418   WEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLLCNWQ---------KAL-----  555
             WE FG + D +FCGVFDGHGP+GH+VAKRVR+ +P  L   W+         KA+     
Sbjct  84    WENFGSRTDTVFCGVFDGHGPYGHMVAKRVRDNLPLKLSTYWEAKVPVEGVLKAITTDTV  143

Query  556   --AHNMDNLGFDNC-----------------------------LLDVWKQSHIKACSEVD  642
               A N++N   DN                              L    K+S +KA   +D
Sbjct  144   NNATNINN-SEDNTAAAASVSAEEEPRTSAKMEEEENMESHPELFQTLKESFLKAFKVMD  202

Query  643   QQLEQQAG--SFYSGTTALTVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKP  816
             ++L+       F SGTTA+T++KQG  +VV N+GDSRAV+ T D +  LV+VQLTVDLKP
Sbjct  203   RELKFHGSVDCFCSGTTAVTLIKQGQYLVVGNIGDSRAVMGTRDSNNALVSVQLTVDLKP  262

Query  817   NLPGERERIMRSKGRVWSSDDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGL  996
             NLP E ERI + +GRV++  DEP V RVW+PN       + PGLA++RAFGD+ +KDFGL
Sbjct  263   NLPAEAERIRKCRGRVFALRDEPEVCRVWLPN------CDSPGLAMARAFGDFCLKDFGL  316

Query  997   ISEPEFTFRNITFRDQFAILATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWK  1176
             IS P+ +FR +T +D+F +LATDG+WDV+SN + V IV+SAP R  +A+ +VE AV AW+
Sbjct  317   ISVPDVSFRRLTKKDEFIVLATDGIWDVLSNDDVVGIVASAPSRSTAARAIVESAVRAWR  376

Query  1177  RTRRGIAMDDMSAICLFF  1230
                    +DD +A+CL+ 
Sbjct  377   YKYPTSKVDDCAAVCLYL  394



>ref|XP_004249617.2| PREDICTED: probable protein phosphatase 2C 65 [Solanum lycopersicum]
Length=389

 Score =   288 bits (736),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 146/299 (49%), Positives = 200/299 (67%), Gaps = 17/299 (6%)
 Frame = +1

Query  367   LHSRQGKKGANQDRAIVWEEFGGQEDMIFCGVFDGHGPWGHLVAKRVRELVPSSLL----  534
             ++S+QGKKG NQD   VWE FGG++   FCGVFDGHGP GH VA+ VR+++PS +     
Sbjct  1     MYSQQGKKGINQDAMTVWENFGGEKGAFFCGVFDGHGPLGHKVARYVRDMLPSKISISLK  60

Query  535   -CNWQK-ALAHNMDN-LGFDN--CLLDVWKQSHIKACSEVDQQL--EQQAGSFYSGTTAL  693
              C+  K  +  N++N   FD    L D WK +++K+  E+D+QL  E    S+ SGTTA+
Sbjct  61    ECDINKNKIIENIENDEEFDQNFPLFDAWKSAYLKSFKEMDEQLGSEPSIESYSSGTTAV  120

Query  694   TVVKQGDVMVVANVGDSRAVLATADDDGNLVAVQLTVDLKPNLPGERERIMRSKGRVWSS  873
             T+ KQ + + + N+GDSRA++ T D+   LV+ QLTVDLKP+LP E ERI   KGRV + 
Sbjct  121   TLFKQREHLFIGNLGDSRAIICTRDEKNQLVSKQLTVDLKPHLPNEYERIKSCKGRVMAM  180

Query  874   DDEPGVYRVWMPNPNGGVAVEGPGLAVSRAFGDYYIKDFGLISEPEFTFRNITFRDQFAI  1053
             + EP VYRVWMP+       + PGLA++RAFGD+ +KD+GLIS PE  +R +T  D+F +
Sbjct  181   EQEPNVYRVWMPDE------DCPGLAMARAFGDFCLKDYGLISVPEVYYRKLTENDEFVV  234

Query  1054  LATDGVWDVVSNQEAVEIVSSAPERGESAKRLVEHAVCAWKRTRRGIAMDDMSAICLFF  1230
             LATDG+WDV++N E + IVS+  +R  +AK LVE AV AWK       +DD   +CLFF
Sbjct  235   LATDGIWDVLTNDEVIRIVSTTRKRSMAAKTLVECAVRAWKYKYPRAKIDDCGVVCLFF  293



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4424773723216