BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19888_g1_i4 len=2221 path=[133:0-129 5571:130-130 5587:131-132
265:133-2220]

Length=2221
                                                                      Score     E

ref|XP_006337998.1|  PREDICTED: uncharacterized protein LOC102593...    716   0.0      
ref|XP_006337997.1|  PREDICTED: uncharacterized protein LOC102593...    716   0.0      
ref|XP_006337996.1|  PREDICTED: uncharacterized protein LOC102593...    715   0.0      
ref|XP_009779747.1|  PREDICTED: uncharacterized protein LOC104228898    691   0.0      
ref|XP_011100723.1|  PREDICTED: uncharacterized protein LOC105178863    611   0.0      
gb|EYU33072.1|  hypothetical protein MIMGU_mgv1a005230mg                450   1e-146   
gb|EYU33069.1|  hypothetical protein MIMGU_mgv1a005486mg                446   3e-145   
ref|XP_010671796.1|  PREDICTED: uncharacterized protein LOC104888...    382   4e-118   
ref|XP_010102899.1|  hypothetical protein L484_005961                   364   2e-113   
ref|XP_010024816.1|  PREDICTED: uncharacterized protein LOC104415...    360   7e-112   
ref|XP_007035875.1|  Agenet domain-containing protein, putative i...    360   1e-111   
ref|XP_007035880.1|  Agenet domain-containing protein, putative i...    360   2e-111   
ref|XP_007035878.1|  Agenet domain-containing protein, putative i...    359   4e-111   
gb|KHG07312.1|  Adenine deaminase                                       340   2e-104   
gb|KCW61332.1|  hypothetical protein EUGRSUZ_H04076                     330   9e-102   
ref|XP_010524742.1|  PREDICTED: uncharacterized protein LOC104802712    330   2e-100   
ref|XP_002519274.1|  RNA binding protein, putative                      325   4e-98    Ricinus communis
ref|XP_004229100.1|  PREDICTED: uncharacterized protein LOC101259...    315   2e-96    
ref|XP_010024818.1|  PREDICTED: uncharacterized protein LOC104415...    313   3e-94    
ref|XP_010319219.1|  PREDICTED: uncharacterized protein LOC101259...    300   3e-91    
ref|XP_010319222.1|  PREDICTED: uncharacterized protein LOC101259364    289   2e-88    
ref|XP_010671798.1|  PREDICTED: uncharacterized protein LOC104888...    282   3e-82    
ref|XP_004486526.1|  PREDICTED: uncharacterized protein LOC101492...    276   7e-81    
ref|XP_004486525.1|  PREDICTED: uncharacterized protein LOC101492...    276   1e-80    
gb|KFK38113.1|  hypothetical protein AALP_AA3G071200                    275   3e-80    
emb|CDP16821.1|  unnamed protein product                                273   1e-79    
ref|XP_008223470.1|  PREDICTED: uncharacterized protein LOC103323261    275   1e-79    
ref|NP_187304.1|  agenet domain-containing protein                      274   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010544152.1|  PREDICTED: uncharacterized protein LOC104816857    269   1e-77    
ref|XP_006407936.1|  hypothetical protein EUTSA_v10020690mg             268   2e-77    
ref|XP_010553710.1|  PREDICTED: uncharacterized protein LOC104823...    265   3e-76    
ref|XP_010553711.1|  PREDICTED: uncharacterized protein LOC104823...    265   3e-76    
ref|XP_010475763.1|  PREDICTED: uncharacterized protein LOC104755123    265   6e-76    
ref|XP_010475764.1|  PREDICTED: uncharacterized protein LOC104755...    265   9e-76    
ref|XP_010475765.1|  PREDICTED: uncharacterized protein LOC104755...    265   1e-75    
ref|XP_010441337.1|  PREDICTED: uncharacterized protein LOC104724...    260   2e-74    
ref|XP_003594681.1|  RNA binding protein                                259   6e-74    
ref|XP_002882477.1|  agenet domain-containing protein                   258   6e-74    
ref|XP_006417584.1|  hypothetical protein EUTSA_v10009728mg             259   1e-73    
emb|CDY64778.1|  BnaC08g50050D                                          259   1e-73    
gb|KFK43230.1|  hypothetical protein AALP_AA1G097000                    259   2e-73    
ref|XP_002892499.1|  agenet domain-containing protein                   259   2e-73    
ref|XP_006307268.1|  hypothetical protein CARUB_v10008882mg             258   3e-73    
gb|KFK41896.1|  hypothetical protein AALP_AA2G186200                    254   1e-72    
ref|NP_172403.3|  agenet domain-containing protein                      256   1e-72    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44256.1|  unknown protein                                        256   2e-72    Arabidopsis thaliana [mouse-ear cress]
gb|KFK43229.1|  hypothetical protein AALP_AA1G097000                    257   2e-72    
ref|XP_008340577.1|  PREDICTED: uncharacterized protein LOC103403512    247   1e-71    
emb|CDX94986.1|  BnaC05g06850D                                          253   2e-71    
ref|XP_009118323.1|  PREDICTED: uncharacterized protein LOC103843357    250   2e-70    
gb|AAD18097.1|  T31J12.4                                                249   9e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489699.1|  PREDICTED: uncharacterized protein LOC104767362    247   2e-69    
emb|CDX93511.1|  BnaA06g05370D                                          245   1e-68    
ref|XP_009148183.1|  PREDICTED: uncharacterized protein LOC103871658    243   8e-68    
gb|KFK38112.1|  hypothetical protein AALP_AA3G071100                    240   1e-67    
ref|XP_002316056.2|  hypothetical protein POPTR_0010s15910g             240   1e-67    Populus trichocarpa [western balsam poplar]
ref|XP_011092174.1|  PREDICTED: uncharacterized protein LOC105172443    234   1e-66    
ref|XP_006297650.1|  hypothetical protein CARUB_v10013669mg             238   2e-66    
ref|XP_010938198.1|  PREDICTED: uncharacterized protein LOC105057314    236   5e-66    
ref|XP_010464225.1|  PREDICTED: uncharacterized protein LOC104744821    236   1e-65    
gb|KHG16120.1|  hypothetical protein F383_01239                         231   7e-65    
ref|XP_007221606.1|  hypothetical protein PRUPE_ppa026926mg             225   2e-63    
ref|XP_007035879.1|  Agenet domain-containing protein, putative i...    223   1e-61    
ref|XP_010441411.1|  PREDICTED: uncharacterized protein LOC104724...    224   1e-61    
ref|XP_010674562.1|  PREDICTED: uncharacterized protein LOC104890683    218   7e-61    
ref|XP_008793358.1|  PREDICTED: uncharacterized protein LOC103709675    221   1e-60    
emb|CDY06353.1|  BnaA09g48500D                                          222   3e-60    
ref|XP_007145017.1|  hypothetical protein PHAVU_007G202900g             215   7e-60    
ref|XP_006382365.1|  hypothetical protein POPTR_0005s01460g             216   8e-60    
ref|XP_010652537.1|  PREDICTED: uncharacterized protein LOC100243428    230   1e-59    
ref|XP_006433561.1|  hypothetical protein CICLE_v10001744mg             214   1e-59    
ref|XP_006472232.1|  PREDICTED: uncharacterized protein LOC102630729    214   5e-59    
emb|CDP15234.1|  unnamed protein product                                212   7e-59    
ref|XP_006433562.1|  hypothetical protein CICLE_v10001744mg             213   9e-59    
ref|XP_009382482.1|  PREDICTED: uncharacterized protein LOC103970431    216   1e-58    
gb|KDP23367.1|  hypothetical protein JCGZ_23200                         213   1e-58    
ref|XP_011038968.1|  PREDICTED: uncharacterized protein LOC105135...    211   1e-57    
ref|XP_011038969.1|  PREDICTED: uncharacterized protein LOC105135...    211   1e-57    
ref|XP_011038967.1|  PREDICTED: uncharacterized protein LOC105135...    210   1e-57    
ref|XP_002277366.3|  PREDICTED: uncharacterized protein LOC100266...    209   3e-57    Vitis vinifera
ref|XP_010659717.1|  PREDICTED: uncharacterized protein LOC100266...    208   4e-57    
emb|CBI39618.3|  unnamed protein product                                208   4e-57    
ref|XP_010659718.1|  PREDICTED: uncharacterized protein LOC100266...    207   4e-57    
ref|XP_002512533.1|  hypothetical protein RCOM_1435690                  207   2e-56    Ricinus communis
gb|KCW45884.1|  hypothetical protein EUGRSUZ_L00253                     205   3e-56    
gb|EYU38408.1|  hypothetical protein MIMGU_mgv1a009346mg                206   3e-56    
ref|XP_010039538.1|  PREDICTED: uncharacterized protein LOC104428...    206   4e-56    
ref|XP_010039536.1|  PREDICTED: uncharacterized protein LOC104428...    206   4e-56    
ref|XP_010247734.1|  PREDICTED: uncharacterized protein LOC104590698    202   3e-55    
ref|XP_003555795.1|  PREDICTED: uncharacterized protein LOC100805605    201   2e-54    
ref|XP_004230328.1|  PREDICTED: uncharacterized protein LOC101255538    201   2e-54    
gb|KHN02811.1|  hypothetical protein glysoja_043259                     201   5e-54    
ref|XP_009595575.1|  PREDICTED: uncharacterized protein LOC104091847    198   2e-53    
ref|XP_009779475.1|  PREDICTED: uncharacterized protein LOC104228663    194   4e-52    
gb|ACR38755.1|  unknown                                                 197   1e-51    Zea mays [maize]
ref|XP_006375718.1|  hypothetical protein POPTR_0013s00840g             194   1e-51    
ref|XP_007031194.1|  Agenet domain-containing protein, putative         193   3e-51    
ref|NP_001151949.1|  RNA binding protein                                195   4e-51    Zea mays [maize]
ref|XP_010092962.1|  hypothetical protein L484_018899                   189   1e-50    
gb|KCW61329.1|  hypothetical protein EUGRSUZ_H04076                     184   1e-49    
gb|KCW61331.1|  hypothetical protein EUGRSUZ_H04076                     184   7e-49    
ref|XP_004309084.1|  PREDICTED: uncharacterized protein LOC101298667    184   1e-48    
ref|XP_007220527.1|  hypothetical protein PRUPE_ppa009113mg             184   1e-48    
ref|XP_002440532.1|  hypothetical protein SORBIDRAFT_09g002650          188   1e-48    Sorghum bicolor [broomcorn]
ref|XP_004960400.1|  PREDICTED: uncharacterized protein LOC101759...    187   2e-48    
ref|XP_007051196.1|  Domain of Uncharacterized protein function 7...    193   2e-48    
ref|XP_008234600.1|  PREDICTED: uncharacterized protein LOC103333529    183   2e-48    
ref|XP_007051195.1|  Domain of Uncharacterized protein function 7...    192   7e-48    
ref|XP_007051194.1|  Domain of Uncharacterized protein function 7...    191   9e-48    
ref|XP_004960399.1|  PREDICTED: uncharacterized protein LOC101759...    184   3e-47    
emb|CBI36980.3|  unnamed protein product                                189   1e-46    
gb|ACF82602.1|  unknown                                                 173   7e-45    Zea mays [maize]
ref|XP_009361222.1|  PREDICTED: uncharacterized protein LOC103951536    172   9e-45    
ref|XP_009351875.1|  PREDICTED: uncharacterized protein LOC103943322    172   2e-44    
ref|XP_008376873.1|  PREDICTED: uncharacterized protein LOC103439...    171   3e-44    
ref|XP_008376872.1|  PREDICTED: uncharacterized protein LOC103439...    171   4e-44    
gb|EPS73094.1|  hypothetical protein M569_01661                         170   5e-44    
ref|XP_006654960.1|  PREDICTED: uncharacterized protein LOC102704061    171   7e-44    
gb|KHG00643.1|  Myosin-2                                                178   2e-43    
gb|AFW82724.1|  hypothetical protein ZEAMMB73_548849                    166   6e-43    
gb|KDP28289.1|  hypothetical protein JCGZ_14060                         176   9e-43    
gb|EEC78467.1|  hypothetical protein OsI_18337                          170   2e-42    Oryza sativa Indica Group [Indian rice]
ref|XP_003569071.1|  PREDICTED: uncharacterized protein LOC100841...    169   4e-42    
ref|XP_010231824.1|  PREDICTED: uncharacterized protein LOC100841...    169   4e-42    
ref|XP_010495955.1|  PREDICTED: uncharacterized protein LOC104773104    164   6e-42    
ref|XP_006386703.1|  hypothetical protein POPTR_0002s193002g            166   4e-41    
dbj|BAK02951.1|  predicted protein                                      166   5e-41    
gb|EMS58750.1|  hypothetical protein TRIUR3_15613                       164   6e-41    
gb|KDO81633.1|  hypothetical protein CISIN_1g019553mg                   160   3e-40    
gb|EEE62223.1|  hypothetical protein OsJ_17010                          162   4e-40    Oryza sativa Japonica Group [Japonica rice]
gb|KDO86910.1|  hypothetical protein CISIN_1g002548mg                   164   7e-40    
ref|XP_009611102.1|  PREDICTED: uncharacterized protein LOC104104...    167   8e-40    
ref|XP_009611101.1|  PREDICTED: uncharacterized protein LOC104104...    167   8e-40    
ref|XP_011002743.1|  PREDICTED: uncharacterized protein LOC105109...    166   9e-40    
ref|XP_011002742.1|  PREDICTED: uncharacterized protein LOC105109...    166   9e-40    
gb|KDO86909.1|  hypothetical protein CISIN_1g002548mg                   164   1e-39    
ref|XP_010322317.1|  PREDICTED: uncharacterized protein LOC101262...    167   1e-39    
ref|XP_004229374.1|  PREDICTED: uncharacterized protein LOC101262...    167   1e-39    
gb|KDO86907.1|  hypothetical protein CISIN_1g002548mg                   165   1e-39    
ref|XP_009758791.1|  PREDICTED: uncharacterized protein LOC104211...    166   2e-39    
ref|XP_011002741.1|  PREDICTED: uncharacterized protein LOC105109...    166   2e-39    
ref|XP_009758789.1|  PREDICTED: uncharacterized protein LOC104211...    166   2e-39    
ref|XP_007205992.1|  hypothetical protein PRUPE_ppa012230mg             154   2e-39    
ref|XP_011002740.1|  PREDICTED: uncharacterized protein LOC105109...    166   2e-39    
ref|XP_009758790.1|  PREDICTED: uncharacterized protein LOC104211...    166   2e-39    
gb|KDO86908.1|  hypothetical protein CISIN_1g002548mg                   164   2e-39    
ref|XP_011079521.1|  PREDICTED: uncharacterized protein LOC105163...    166   3e-39    
ref|XP_011079520.1|  PREDICTED: uncharacterized protein LOC105163...    166   3e-39    
gb|EMT13245.1|  hypothetical protein F775_31527                         159   4e-39    
ref|XP_008381758.1|  PREDICTED: uncharacterized protein LOC103444582    156   5e-39    
ref|XP_008246167.1|  PREDICTED: uncharacterized protein LOC103344338    152   6e-39    
gb|KDO86904.1|  hypothetical protein CISIN_1g002548mg                   165   6e-39    
gb|KDO86906.1|  hypothetical protein CISIN_1g002548mg                   165   6e-39    
ref|XP_006444549.1|  hypothetical protein CICLE_v10018775mg             165   7e-39    
ref|XP_006349168.1|  PREDICTED: uncharacterized protein LOC102593...    164   1e-38    
ref|XP_006349167.1|  PREDICTED: uncharacterized protein LOC102593...    164   1e-38    
gb|KCW84862.1|  hypothetical protein EUGRSUZ_B01689                     149   4e-38    
gb|AAU44232.1|  hypothetical protein                                    157   5e-38    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008388457.1|  PREDICTED: uncharacterized protein LOC103450836    150   5e-38    
ref|XP_009373309.1|  PREDICTED: uncharacterized protein LOC103962335    149   7e-38    
ref|XP_004505515.1|  PREDICTED: uncharacterized protein LOC101489110    152   1e-37    
ref|XP_010679472.1|  PREDICTED: uncharacterized protein LOC104894...    161   1e-37    
ref|XP_010679471.1|  PREDICTED: uncharacterized protein LOC104894...    161   1e-37    
ref|XP_002320282.2|  hypothetical protein POPTR_0014s11310g             158   8e-37    Populus trichocarpa [western balsam poplar]
ref|XP_011040897.1|  PREDICTED: uncharacterized protein LOC105137...    157   2e-36    
ref|XP_011040888.1|  PREDICTED: uncharacterized protein LOC105137...    157   2e-36    
ref|XP_009337627.1|  PREDICTED: uncharacterized protein LOC103930067    145   4e-36    
emb|CAN64022.1|  hypothetical protein VITISV_005264                     155   1e-35    Vitis vinifera
ref|XP_004302288.1|  PREDICTED: uncharacterized protein LOC101303...    142   2e-35    
ref|XP_010544951.1|  PREDICTED: uncharacterized protein LOC104817...    154   2e-35    
ref|XP_010544954.1|  PREDICTED: uncharacterized protein LOC104817...    154   2e-35    
ref|XP_010544955.1|  PREDICTED: uncharacterized protein LOC104817...    153   3e-35    
ref|XP_010523907.1|  PREDICTED: uncharacterized protein LOC104802...    152   4e-35    
ref|XP_010523906.1|  PREDICTED: uncharacterized protein LOC104802...    152   5e-35    
ref|XP_010523908.1|  PREDICTED: uncharacterized protein LOC104802...    152   5e-35    
ref|XP_006344851.1|  PREDICTED: uncharacterized protein LOC102580710    140   5e-35    
ref|XP_004295045.1|  PREDICTED: uncharacterized protein LOC101297044    147   6e-35    
ref|XP_008370599.1|  PREDICTED: uncharacterized protein LOC103434067    142   6e-35    
ref|XP_004302287.1|  PREDICTED: uncharacterized protein LOC101303...    142   7e-35    
ref|XP_010918488.1|  PREDICTED: uncharacterized protein LOC105042...    150   2e-34    
ref|XP_010918489.1|  PREDICTED: uncharacterized protein LOC105042...    150   3e-34    
ref|XP_007220929.1|  hypothetical protein PRUPE_ppa024896mg             145   3e-34    
ref|XP_010918487.1|  PREDICTED: uncharacterized protein LOC105042846    150   3e-34    
gb|KCW73282.1|  hypothetical protein EUGRSUZ_E01742                     143   6e-34    
ref|XP_010058576.1|  PREDICTED: uncharacterized protein LOC104446420    142   1e-33    
ref|XP_008234132.1|  PREDICTED: uncharacterized protein LOC103333120    145   3e-33    
ref|XP_002515642.1|  RNA binding protein, putative                      145   7e-33    Ricinus communis
ref|XP_009389242.1|  PREDICTED: uncharacterized protein LOC103975857    145   1e-32    
ref|XP_008796800.1|  PREDICTED: uncharacterized protein LOC103712141    145   2e-32    
emb|CDP15931.1|  unnamed protein product                                136   8e-32    
ref|XP_010094401.1|  hypothetical protein L484_018768                   142   1e-31    
ref|XP_008801740.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    142   2e-31    
emb|CDP17048.1|  unnamed protein product                                141   3e-31    
ref|XP_008231801.1|  PREDICTED: uncharacterized protein LOC103330974    140   5e-31    
ref|XP_007221152.1|  hypothetical protein PRUPE_ppa019997mg             135   1e-30    
ref|XP_009363752.1|  PREDICTED: uncharacterized protein LOC103953...    137   3e-30    
ref|XP_008234138.1|  PREDICTED: uncharacterized protein LOC103333...    137   3e-30    
ref|XP_008234140.1|  PREDICTED: uncharacterized protein LOC103333...    137   4e-30    
ref|XP_009363751.1|  PREDICTED: uncharacterized protein LOC103953...    137   4e-30    
ref|XP_009363750.1|  PREDICTED: uncharacterized protein LOC103953...    137   4e-30    
ref|XP_009363749.1|  PREDICTED: uncharacterized protein LOC103953...    137   4e-30    
ref|XP_008234137.1|  PREDICTED: uncharacterized protein LOC103333...    137   4e-30    
gb|KDP23273.1|  hypothetical protein JCGZ_23106                         136   8e-30    
ref|XP_008357090.1|  PREDICTED: uncharacterized protein LOC103420823    132   3e-29    
ref|XP_007220857.1|  hypothetical protein PRUPE_ppa020851mg             134   3e-29    
ref|XP_008376961.1|  PREDICTED: uncharacterized protein LOC103440055    132   6e-29    
ref|XP_008364899.1|  PREDICTED: uncharacterized protein LOC103428564    132   1e-28    
gb|EYU30207.1|  hypothetical protein MIMGU_mgv1a001520mg                131   3e-28    
ref|XP_006397916.1|  hypothetical protein EUTSA_v10001340mg             131   3e-28    
ref|XP_004309005.1|  PREDICTED: uncharacterized protein LOC101295578    130   3e-28    
ref|XP_002515641.1|  RNA binding protein, putative                      129   1e-27    Ricinus communis
ref|XP_006844135.1|  hypothetical protein AMTR_s00006p00258650          121   7e-27    
gb|KEH43116.1|  agenet domain protein                                   119   8e-27    
ref|XP_004242152.2|  PREDICTED: uncharacterized protein LOC101251391    124   9e-27    
ref|XP_010109156.1|  hypothetical protein L484_017096                   122   2e-26    
gb|KHN12842.1|  hypothetical protein glysoja_029376                     117   5e-26    
ref|XP_006407953.1|  hypothetical protein EUTSA_v10020194mg             124   5e-26    
emb|CDP16825.1|  unnamed protein product                                114   6e-26    
ref|XP_009362735.1|  PREDICTED: uncharacterized protein LOC103952...    124   6e-26    
gb|KFK37490.1|  hypothetical protein AALP_AA4G264100                    124   6e-26    
ref|XP_009362736.1|  PREDICTED: uncharacterized protein LOC103952...    124   7e-26    
ref|XP_002880288.1|  predicted protein                                  124   7e-26    
ref|XP_009362734.1|  PREDICTED: uncharacterized protein LOC103952...    124   7e-26    
ref|XP_009362737.1|  PREDICTED: uncharacterized protein LOC103952...    124   7e-26    
ref|XP_009362733.1|  PREDICTED: uncharacterized protein LOC103952...    124   8e-26    
ref|XP_009362732.1|  PREDICTED: uncharacterized protein LOC103952...    124   8e-26    
ref|XP_010279118.1|  PREDICTED: uncharacterized protein LOC104613117    114   1e-25    
ref|XP_010914642.1|  PREDICTED: uncharacterized protein LOC105039...    123   2e-25    
ref|XP_010914641.1|  PREDICTED: uncharacterized protein LOC105039...    123   2e-25    
ref|XP_006845091.1|  hypothetical protein AMTR_s00005p00132140          114   2e-25    
gb|KFK32129.1|  hypothetical protein AALP_AA6G201900                    122   2e-25    
emb|CDY62325.1|  BnaC04g52330D                                          119   4e-25    
ref|XP_010413097.1|  PREDICTED: uncharacterized protein LOC104699491    116   8e-25    
ref|XP_004309006.1|  PREDICTED: uncharacterized protein LOC101295872    118   9e-25    
ref|XP_006304409.1|  hypothetical protein CARUB_v10010977mg             119   2e-24    
gb|KFK37491.1|  hypothetical protein AALP_AA4G264200                    119   2e-24    
ref|XP_006414695.1|  hypothetical protein EUTSA_v10027168mg             111   1e-23    
ref|XP_010518416.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    115   2e-23    
ref|NP_173976.1|  agenet domain-containing protein                      115   2e-23    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010506754.1|  PREDICTED: uncharacterized protein LOC104783...    115   3e-23    
ref|XP_010506753.1|  PREDICTED: uncharacterized protein LOC104783...    115   3e-23    
gb|ABK25452.1|  unknown                                                 109   3e-23    Picea sitchensis
ref|XP_006293780.1|  hypothetical protein CARUB_v10022757mg             114   6e-23    
ref|XP_007132858.1|  hypothetical protein PHAVU_011G130600g             106   8e-23    
ref|XP_004242269.1|  PREDICTED: uncharacterized protein LOC101264736    107   9e-23    
emb|CDY05259.1|  BnaC05g45440D                                          114   1e-22    
gb|ABR17839.1|  unknown                                                 110   2e-22    Picea sitchensis
emb|CDY61949.1|  BnaAnng18040D                                          110   2e-22    
emb|CDY61948.1|  BnaAnng18030D                                          110   2e-22    
ref|XP_009138620.1|  PREDICTED: uncharacterized protein LOC103862697    109   3e-22    
ref|XP_004242143.1|  PREDICTED: uncharacterized protein LOC101248787    105   3e-22    
ref|XP_004242144.1|  PREDICTED: uncharacterized protein LOC101249095    105   4e-22    
ref|NP_182245.1|  uncharacterized protein                               111   5e-22    Arabidopsis thaliana [mouse-ear cress]
emb|CDY24697.1|  BnaA05g30960D                                          111   5e-22    
ref|XP_009129664.1|  PREDICTED: uncharacterized protein LOC103854477    111   5e-22    
ref|NP_172609.1|  plant-specific DUF724 family protein                  110   8e-22    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189769.1|  uncharacterized protein                            110   9e-22    
gb|AAF16647.1|AC011661_25  T23J18.9                                     110   1e-21    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002283128.1|  PREDICTED: uncharacterized protein LOC100257263    103   1e-21    Vitis vinifera
ref|XP_002892155.1|  hypothetical protein ARALYDRAFT_311431             109   2e-21    
ref|XP_006347380.1|  PREDICTED: uncharacterized protein LOC102598825    103   2e-21    
ref|XP_010462891.1|  PREDICTED: uncharacterized protein LOC104743519    108   2e-21    
gb|EMT23637.1|  hypothetical protein F775_01266                         109   3e-21    
ref|XP_002890652.1|  agenet domain-containing protein                   108   4e-21    
gb|EYU46836.1|  hypothetical protein MIMGU_mgv1a022506mg                101   6e-21    
ref|XP_009795661.1|  PREDICTED: uncharacterized protein LOC104242333    102   9e-21    
ref|XP_006397915.1|  hypothetical protein EUTSA_v10001344mg             107   1e-20    
ref|XP_006348866.1|  PREDICTED: uncharacterized protein LOC102598950  99.8    1e-20    
ref|XP_004243789.1|  PREDICTED: uncharacterized protein LOC101257089  99.4    2e-20    
ref|XP_006402387.1|  hypothetical protein EUTSA_v10005813mg             106   2e-20    
ref|XP_011079522.1|  PREDICTED: uncharacterized protein LOC105163...    106   2e-20    
ref|XP_006402388.1|  hypothetical protein EUTSA_v10005813mg             106   2e-20    
ref|XP_003539990.1|  PREDICTED: uncharacterized protein LOC100805...  99.0    3e-20    
ref|XP_002876670.1|  agenet domain-containing protein                   105   4e-20    
ref|XP_007159047.1|  hypothetical protein PHAVU_002G204200g           98.2    5e-20    
emb|CDY18856.1|  BnaAnng03210D                                          104   1e-19    
ref|XP_006303834.1|  hypothetical protein CARUB_v10012522mg             102   3e-19    
ref|XP_006839151.1|  hypothetical protein AMTR_s00097p00022440        97.1    3e-19    
ref|XP_009759468.1|  PREDICTED: uncharacterized protein LOC104212000  95.1    4e-19    
ref|XP_007033654.1|  Uncharacterized protein isoform 1                  101   5e-19    
ref|XP_004164661.1|  PREDICTED: uncharacterized protein LOC101232605  97.8    5e-19    
ref|XP_004242149.1|  PREDICTED: uncharacterized protein LOC101250519  96.3    5e-19    
ref|XP_010034450.1|  PREDICTED: uncharacterized protein LOC104423688  95.1    7e-19    
ref|XP_009124967.1|  PREDICTED: uncharacterized protein LOC103850016  97.4    1e-18    
ref|XP_009614121.1|  PREDICTED: uncharacterized protein LOC104107105  94.0    1e-18    
ref|XP_002892643.1|  predicted protein                                  100   1e-18    
ref|XP_009611103.1|  PREDICTED: uncharacterized protein LOC104104...    100   2e-18    
gb|EEC68051.1|  hypothetical protein OsI_35889                          100   2e-18    
gb|KFK28464.1|  hypothetical protein AALP_AA8G517400                    100   2e-18    
gb|KFK28465.1|  hypothetical protein AALP_AA8G517400                    100   3e-18    
emb|CDY18855.1|  BnaAnng03200D                                        99.8    3e-18    
ref|XP_009758792.1|  PREDICTED: uncharacterized protein LOC104211...  99.4    4e-18    
ref|XP_011044211.1|  PREDICTED: uncharacterized protein LOC105139466  92.8    5e-18    
ref|XP_010099389.1|  hypothetical protein L484_004816                 92.4    5e-18    
gb|KDO44637.1|  hypothetical protein CISIN_1g038506mg                 92.4    6e-18    
ref|XP_010481842.1|  PREDICTED: uncharacterized protein LOC104760590  98.2    7e-18    
ref|XP_008358234.1|  PREDICTED: uncharacterized protein LOC103421972  95.1    9e-18    
ref|XP_006442515.1|  hypothetical protein CICLE_v10023940mg           91.7    1e-17    
ref|XP_010413291.1|  PREDICTED: uncharacterized protein LOC104699...  97.4    1e-17    
ref|XP_010413290.1|  PREDICTED: uncharacterized protein LOC104699...  97.4    1e-17    
ref|XP_004136149.1|  PREDICTED: uncharacterized protein LOC101218122  97.4    2e-17    
gb|KGN45035.1|  hypothetical protein Csa_7G412860                     97.4    2e-17    
ref|XP_008451447.1|  PREDICTED: uncharacterized protein LOC103492...  97.4    2e-17    
ref|XP_008451446.1|  PREDICTED: uncharacterized protein LOC103492...  97.1    2e-17    
ref|XP_008451445.1|  PREDICTED: uncharacterized protein LOC103492...  97.1    2e-17    
ref|XP_007221528.1|  hypothetical protein PRUPE_ppa019960mg           94.7    2e-17    
gb|KDP30488.1|  hypothetical protein JCGZ_16167                       90.5    2e-17    
gb|EYU29540.1|  hypothetical protein MIMGU_mgv1a018116mg              90.5    2e-17    
emb|CDP06005.1|  unnamed protein product                              90.5    3e-17    
ref|XP_009779536.1|  PREDICTED: uncharacterized protein LOC104228711  90.9    4e-17    
ref|XP_006290646.1|  hypothetical protein CARUB_v10016738mg           95.9    5e-17    
ref|XP_006290647.1|  hypothetical protein CARUB_v10016738mg           95.9    5e-17    
ref|XP_008227829.1|  PREDICTED: uncharacterized protein LOC103327...  95.5    6e-17    
ref|XP_010512617.1|  PREDICTED: uncharacterized protein LOC104788...  95.5    7e-17    
ref|XP_010512618.1|  PREDICTED: uncharacterized protein LOC104788...  95.5    7e-17    
gb|AAX94920.1|  Agenet domain, putative                               95.9    7e-17    
ref|XP_004236411.1|  PREDICTED: uncharacterized protein LOC101263599  89.7    7e-17    
ref|XP_004242533.1|  PREDICTED: uncharacterized protein LOC101261039  90.1    7e-17    
ref|XP_008370610.1|  PREDICTED: uncharacterized protein LOC103434077  90.5    8e-17    
ref|XP_010468968.1|  PREDICTED: uncharacterized protein LOC104749...  95.1    8e-17    
emb|CAB71890.1|  putative protein                                     95.1    8e-17    
ref|XP_006414794.1|  hypothetical protein EUTSA_v10027025mg           94.7    8e-17    
ref|NP_001190163.1|  DUF724 family protein                            95.1    9e-17    
ref|XP_010468969.1|  PREDICTED: uncharacterized protein LOC104749...  94.7    9e-17    
ref|NP_191789.2|  DUF724 family protein                               94.7    9e-17    
ref|XP_004288549.1|  PREDICTED: uncharacterized protein LOC101309389  94.7    1e-16    
emb|CDY21151.1|  BnaA01g33820D                                        94.0    1e-16    
ref|XP_008227828.1|  PREDICTED: uncharacterized protein LOC103327...  94.7    1e-16    
gb|KFK37489.1|  hypothetical protein AALP_AA4G264000                  94.7    1e-16    
ref|XP_008227830.1|  PREDICTED: uncharacterized protein LOC103327...  94.7    1e-16    
ref|XP_008381448.1|  PREDICTED: uncharacterized protein LOC103444...  94.7    1e-16    
emb|CDP15932.1|  unnamed protein product                              89.4    1e-16    
ref|XP_008381447.1|  PREDICTED: uncharacterized protein LOC103444...  94.4    1e-16    
ref|XP_008381445.1|  PREDICTED: uncharacterized protein LOC103444...  94.4    1e-16    
ref|XP_008381446.1|  PREDICTED: uncharacterized protein LOC103444...  94.4    1e-16    
ref|XP_010689921.1|  PREDICTED: uncharacterized protein LOC104903572  88.6    1e-16    
ref|XP_002313640.2|  agenet domain-containing family protein          87.8    2e-16    
ref|XP_009338250.1|  PREDICTED: uncharacterized protein LOC103930617  89.4    2e-16    
ref|XP_006344852.1|  PREDICTED: uncharacterized protein LOC102581047  89.7    2e-16    
ref|XP_003607577.1|  hypothetical protein MTR_4g079830                87.8    3e-16    
ref|XP_009363109.1|  PREDICTED: uncharacterized protein LOC103953...  93.6    3e-16    
ref|XP_009363111.1|  PREDICTED: uncharacterized protein LOC103953...  93.6    3e-16    
ref|XP_009363110.1|  PREDICTED: uncharacterized protein LOC103953...  93.6    3e-16    
ref|XP_009363112.1|  PREDICTED: uncharacterized protein LOC103953...  93.6    3e-16    
ref|XP_009594108.1|  PREDICTED: uncharacterized protein LOC104090656  88.2    3e-16    
ref|XP_002540140.1|  conserved hypothetical protein                   87.8    3e-16    
ref|XP_006341670.1|  PREDICTED: uncharacterized protein LOC102586547  87.8    4e-16    
emb|CDX67889.1|  BnaA07g19290D                                        90.1    7e-16    
ref|XP_009104380.1|  PREDICTED: uncharacterized protein LOC103830354  91.3    7e-16    
ref|XP_002540178.1|  hypothetical protein RCOM_2136480                86.7    9e-16    
ref|XP_006349169.1|  PREDICTED: uncharacterized protein LOC102593...  91.7    1e-15    
ref|XP_010474951.1|  PREDICTED: uncharacterized protein LOC104754452  90.9    1e-15    
ref|XP_010522105.1|  PREDICTED: uncharacterized protein LOC104800847  85.5    1e-15    
ref|XP_009616497.1|  PREDICTED: uncharacterized protein LOC104109022  89.0    2e-15    
gb|KDP39534.1|  hypothetical protein JCGZ_02554                       84.7    2e-15    
ref|XP_009102095.1|  PREDICTED: uncharacterized protein LOC103828232  89.4    3e-15    
emb|CDY11412.1|  BnaA09g39780D                                        89.4    3e-15    
ref|NP_171829.1|  uncharacterized protein                             89.7    3e-15    
tpg|DAA42131.1|  TPA: hypothetical protein ZEAMMB73_941777            87.4    4e-15    
ref|XP_010239180.1|  PREDICTED: uncharacterized protein LOC100838506  89.7    4e-15    
emb|CDX80090.1|  BnaA05g00660D                                        89.4    5e-15    
gb|KFK35414.1|  hypothetical protein AALP_AA5G281400                  89.4    5e-15    
ref|XP_010322322.1|  PREDICTED: uncharacterized protein LOC101262...  89.4    5e-15    
gb|KFK35413.1|  hypothetical protein AALP_AA5G281400                  89.4    5e-15    
ref|XP_003519928.1|  PREDICTED: putative F-box/LRR-repeat protein...  88.2    6e-15    
ref|XP_009771323.1|  PREDICTED: uncharacterized protein LOC104221882  86.3    2e-14    
gb|KFK28462.1|  hypothetical protein AALP_AA8G517400                  87.8    2e-14    
ref|XP_010421186.1|  PREDICTED: uncharacterized protein LOC104706675  87.0    2e-14    
ref|XP_004487943.1|  PREDICTED: uncharacterized protein LOC101493132  82.0    2e-14    
ref|XP_011040903.1|  PREDICTED: uncharacterized protein LOC105137...  87.4    2e-14    
ref|XP_008343181.1|  PREDICTED: uncharacterized protein LOC103405...  87.4    2e-14    
ref|XP_008343179.1|  PREDICTED: uncharacterized protein LOC103405...  87.4    2e-14    
ref|XP_008343180.1|  PREDICTED: uncharacterized protein LOC103405...  87.4    2e-14    
ref|XP_008670788.1|  PREDICTED: uncharacterized protein LOC103648066  87.4    3e-14    
emb|CDP17049.1|  unnamed protein product                              82.4    3e-14    
ref|XP_009367196.1|  PREDICTED: uncharacterized protein LOC103956...  87.0    3e-14    
ref|XP_009367195.1|  PREDICTED: uncharacterized protein LOC103956...  87.0    3e-14    
ref|XP_009367194.1|  PREDICTED: uncharacterized protein LOC103956...  87.0    3e-14    
ref|XP_002463479.1|  hypothetical protein SORBIDRAFT_01g000510        87.4    3e-14    
ref|XP_009367193.1|  PREDICTED: uncharacterized protein LOC103956...  87.0    3e-14    
ref|XP_007027043.1|  Agenet domain-containing protein, putative       81.3    3e-14    
ref|XP_008376877.1|  PREDICTED: uncharacterized protein LOC103439...  80.9    5e-14    
ref|XP_002515242.1|  hypothetical protein RCOM_1345950                85.5    6e-14    
ref|XP_003617225.1|  hypothetical protein MTR_5g089250                80.9    6e-14    
ref|XP_003617216.1|  hypothetical protein MTR_5g089140                80.5    7e-14    
ref|XP_004505492.1|  PREDICTED: uncharacterized protein LOC101509104  80.5    8e-14    
ref|XP_008376878.1|  PREDICTED: uncharacterized protein LOC103439...  79.3    1e-13    
ref|XP_007218960.1|  hypothetical protein PRUPE_ppa003563mg           84.7    1e-13    
gb|KHN16044.1|  hypothetical protein glysoja_012020                   79.3    1e-13    
ref|XP_004305020.1|  PREDICTED: uncharacterized protein LOC101303540  79.7    2e-13    
ref|XP_004305220.1|  PREDICTED: uncharacterized protein LOC101296025  79.7    2e-13    
emb|CDY34425.1|  BnaC01g22080D                                        84.0    2e-13    
emb|CDY72353.1|  BnaAnng40780D                                        82.0    2e-13    
ref|XP_003617223.1|  hypothetical protein MTR_5g089220                78.6    4e-13    
ref|XP_002522579.1|  RNA binding protein, putative                    79.0    4e-13    
gb|KFK37488.1|  hypothetical protein AALP_AA4G263800                  82.8    5e-13    
ref|XP_009614120.1|  PREDICTED: uncharacterized protein LOC104107104  76.6    1e-12    
ref|NP_172123.1|  plant Tudor-like protein                            76.6    1e-12    
ref|XP_010454665.1|  PREDICTED: uncharacterized protein LOC104736393  81.3    1e-12    
ref|XP_010506751.1|  PREDICTED: uncharacterized protein LOC104783...  79.3    2e-12    
ref|XP_010506749.1|  PREDICTED: uncharacterized protein LOC104783...  79.3    2e-12    
ref|XP_006304456.1|  hypothetical protein CARUB_v10011095mg           76.3    2e-12    
ref|XP_002892335.1|  agenet domain-containing protein                 76.3    2e-12    
ref|XP_006287347.1|  hypothetical protein CARUB_v10000545mg           80.5    2e-12    
ref|XP_006287346.1|  hypothetical protein CARUB_v10000545mg           80.5    2e-12    
ref|XP_010237642.1|  PREDICTED: uncharacterized protein LOC100840...  80.9    3e-12    
ref|XP_003577462.2|  PREDICTED: uncharacterized protein LOC100840...  80.5    3e-12    
ref|XP_010030208.1|  PREDICTED: uncharacterized protein LOC104420...  80.1    3e-12    
ref|XP_010030206.1|  PREDICTED: uncharacterized protein LOC104420...  80.1    3e-12    
ref|XP_010030207.1|  PREDICTED: uncharacterized protein LOC104420...  80.1    3e-12    
gb|KDO77855.1|  hypothetical protein CISIN_1g047914mg                 75.5    3e-12    
ref|NP_197769.1|  uncharacterized protein                             79.7    4e-12    
gb|ABD65016.1|  Agenet domain containing protein                      80.5    4e-12    
gb|EAY81288.1|  hypothetical protein OsI_36466                        80.1    4e-12    
ref|XP_009116904.1|  PREDICTED: uncharacterized protein LOC103842051  79.7    4e-12    
ref|XP_008367314.1|  PREDICTED: uncharacterized protein LOC103430946  76.3    5e-12    
ref|XP_004292576.1|  PREDICTED: uncharacterized protein LOC101306790  75.5    6e-12    
ref|XP_002874148.1|  predicted protein                                79.0    6e-12    
emb|CDY64580.1|  BnaCnng44160D                                        75.9    9e-12    
emb|CDY62324.1|  BnaC04g52320D                                        77.8    1e-11    
ref|XP_002455773.1|  hypothetical protein SORBIDRAFT_03g024845        78.6    1e-11    
ref|XP_009775588.1|  PREDICTED: uncharacterized protein LOC104225...  77.8    2e-11    
ref|XP_009775589.1|  PREDICTED: uncharacterized protein LOC104225...  77.8    2e-11    
ref|XP_004980606.1|  PREDICTED: uncharacterized protein LOC101781984  78.2    2e-11    
gb|ADE76852.1|  unknown                                               73.9    3e-11    
ref|XP_002438961.1|  hypothetical protein SORBIDRAFT_10g029020        77.4    3e-11    
gb|ABK23036.1|  unknown                                               73.9    3e-11    
ref|XP_008370612.1|  PREDICTED: uncharacterized protein LOC103434079  73.6    4e-11    
ref|XP_003607590.1|  hypothetical protein MTR_4g079980                72.8    4e-11    
ref|XP_006287283.1|  hypothetical protein CARUB_v10000478mg           76.3    6e-11    
ref|XP_010034449.1|  PREDICTED: uncharacterized protein LOC104423687  72.4    6e-11    
emb|CDY27128.1|  BnaA08g07660D                                        75.5    7e-11    
ref|XP_007208398.1|  hypothetical protein PRUPE_ppa026646mg           72.0    8e-11    
ref|XP_006663377.1|  PREDICTED: uncharacterized protein LOC102701394  75.9    1e-10    
emb|CDX76625.1|  BnaC08g32110D                                        75.5    1e-10    
ref|XP_007025383.1|  RNA binding protein, putative                    71.2    1e-10    
gb|KFK42954.1|  hypothetical protein AALP_AA1G060700                  70.9    1e-10    
ref|XP_009128700.1|  PREDICTED: uncharacterized protein LOC103853...  74.7    1e-10    
ref|XP_010457761.1|  PREDICTED: uncharacterized protein LOC104739186  70.5    2e-10    
emb|CDY09978.1|  BnaC08g44730D                                        72.4    2e-10    
ref|XP_002874150.1|  agenet domain-containing protein                 74.7    2e-10    
ref|XP_010486016.1|  PREDICTED: uncharacterized protein LOC104764220  70.5    2e-10    
ref|XP_009128698.1|  PREDICTED: uncharacterized protein LOC103853...  74.3    2e-10    
ref|XP_009142551.1|  PREDICTED: uncharacterized protein LOC103866...  73.9    2e-10    
emb|CDX93978.1|  BnaC04g21370D                                        74.7    2e-10    
dbj|BAJ95690.1|  predicted protein                                    74.7    2e-10    
gb|KFK28463.1|  hypothetical protein AALP_AA8G517400                  74.3    2e-10    
ref|XP_010475364.1|  PREDICTED: uncharacterized protein LOC104754792  70.1    2e-10    
ref|XP_009142552.1|  PREDICTED: uncharacterized protein LOC103866...  73.6    2e-10    
emb|CDY12364.1|  BnaC08g08410D                                        73.6    3e-10    
ref|XP_003605202.1|  F-box/LRR-repeat protein                         73.6    3e-10    
ref|XP_009128699.1|  PREDICTED: uncharacterized protein LOC103853...  73.6    3e-10    
ref|XP_009629887.1|  PREDICTED: uncharacterized protein LOC104119...  73.6    4e-10    
ref|XP_009629884.1|  PREDICTED: uncharacterized protein LOC104119...  73.6    4e-10    
ref|XP_009629886.1|  PREDICTED: uncharacterized protein LOC104119...  73.2    5e-10    
ref|XP_009629883.1|  PREDICTED: uncharacterized protein LOC104119...  73.2    5e-10    
emb|CDY20203.1|  BnaC09g30360D                                        70.1    5e-10    
emb|CDX80091.1|  BnaA05g00650D                                        72.0    6e-10    
ref|XP_008800757.1|  PREDICTED: uncharacterized protein LOC103715...  72.8    7e-10    
ref|XP_009118543.1|  PREDICTED: uncharacterized protein LOC103843558  68.9    7e-10    
ref|XP_008800756.1|  PREDICTED: uncharacterized protein LOC103715...  72.8    7e-10    
emb|CDY06207.1|  BnaA09g49960D                                        68.6    8e-10    
gb|KHG26281.1|  Nicotianamine synthase 9                              68.6    9e-10    
ref|XP_008679661.1|  PREDICTED: uncharacterized protein LOC103654...  72.4    9e-10    
ref|XP_006417933.1|  hypothetical protein EUTSA_v10009453mg           68.6    9e-10    
ref|XP_009605811.1|  PREDICTED: uncharacterized protein LOC104100307  67.4    1e-09    
ref|XP_009629885.1|  PREDICTED: uncharacterized protein LOC104119...  72.0    1e-09    
ref|XP_008679659.1|  PREDICTED: uncharacterized protein LOC103654...  72.0    1e-09    
ref|XP_007025384.1|  RNA binding-like protein                         70.9    1e-09    
ref|XP_008679660.1|  PREDICTED: uncharacterized protein LOC103654...  72.0    2e-09    
ref|XP_008246362.1|  PREDICTED: uncharacterized protein LOC103344545  67.8    2e-09    
ref|XP_003600726.1|  hypothetical protein MTR_3g065560                67.8    2e-09    
ref|XP_010270209.1|  PREDICTED: uncharacterized protein LOC104606611  71.2    2e-09    
emb|CDX95289.1|  BnaC09g15810D                                        70.5    2e-09    
gb|ABK23760.1|  unknown                                               67.4    4e-09    
emb|CDX89140.1|  BnaA04g00460D                                        70.1    5e-09    
ref|XP_002512655.1|  hypothetical protein RCOM_1438130                67.0    5e-09    
ref|XP_009138730.1|  PREDICTED: uncharacterized protein LOC103862...  70.1    5e-09    
ref|XP_009138728.1|  PREDICTED: uncharacterized protein LOC103862...  70.1    5e-09    
ref|XP_007027044.1|  Plant Tudor-like protein, putative               65.9    5e-09    
ref|XP_009138727.1|  PREDICTED: uncharacterized protein LOC103862...  69.7    6e-09    
ref|XP_010064290.1|  PREDICTED: uncharacterized protein LOC104451290  65.1    6e-09    
ref|XP_010237645.1|  PREDICTED: uncharacterized protein LOC100824...  70.1    6e-09    
ref|XP_010237644.1|  PREDICTED: uncharacterized protein LOC100824...  70.1    6e-09    
ref|XP_010069757.1|  PREDICTED: uncharacterized protein LOC104456624  69.7    6e-09    
ref|XP_010237643.1|  PREDICTED: uncharacterized protein LOC100824...  69.7    7e-09    
ref|XP_008388931.1|  PREDICTED: uncharacterized protein LOC103451289  66.6    7e-09    
emb|CDY64100.1|  BnaC09g53110D                                        69.3    9e-09    
ref|XP_008246361.1|  PREDICTED: uncharacterized protein LOC103344544  65.5    1e-08    
ref|XP_002978150.1|  hypothetical protein SELMODRAFT_417830           67.8    1e-08    
ref|XP_002966414.1|  hypothetical protein SELMODRAFT_85351            65.1    2e-08    
gb|EMS53495.1|  hypothetical protein TRIUR3_31735                     68.6    2e-08    
ref|XP_008802278.1|  PREDICTED: uncharacterized protein LOC103716...  66.2    2e-08    
gb|ABD33110.1|  Cyclin-like F-box; Agenet                             67.4    2e-08    
ref|XP_003605155.1|  NBS-containing resistance-like protein           67.4    3e-08    
ref|XP_006848990.1|  hypothetical protein AMTR_s00028p00081930        67.4    3e-08    
ref|XP_003605086.1|  F-box/LRR-repeat protein                         67.0    3e-08    
gb|AES87283.2|  agenet domain protein                                 67.0    4e-08    
gb|KHN32945.1|  hypothetical protein glysoja_009936                   67.4    4e-08    
ref|XP_006597606.1|  PREDICTED: uncharacterized protein LOC100812434  67.4    4e-08    



>ref|XP_006337998.1| PREDICTED: uncharacterized protein LOC102593605 isoform X3 [Solanum 
tuberosum]
Length=724

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/631 (58%), Positives = 448/631 (71%), Gaps = 8/631 (1%)
 Frame = -3

Query  2042  FNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHL  1863
             FNKGD VEVL  + F IW PA VLR +  K  R GQIYVEF+T   ++    RR EYV+ 
Sbjct  94    FNKGDAVEVLKTNPFTIWLPATVLRSTPCKKTRNGQIYVEFQTHYCEESSGSRR-EYVNA  152

Query  1862  SAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVE  1683
               VRPAPP E   YF+VG++ +VFY+ +GWR+G VD+ILENSMY V L D    E VKVE
Sbjct  153   GDVRPAPPPELHRYFKVGDNVEVFYKEKGWRKGKVDDILENSMYFVLL-DGVEEEIVKVE  211

Query  1682  QWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSK  1503
             QW LRV+R W DG W+PPLE     QQ  QK   +  +   GVKLRI C+R S    FS+
Sbjct  212   QWGLRVYRVWDDGSWLPPLE----FQQIPQKNIPEVELKSRGVKLRIMCSR-SWKETFSE  266

Query  1502  EMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCP  1323
              M VEVK DKEG   SW+ + ++E +G  K LV+YQ LKT +G+ +L EEVDASCIRPCP
Sbjct  267   GMSVEVKRDKEGCYGSWHTAAIVESVGYDKFLVEYQKLKTVNGSQFLKEEVDASCIRPCP  326

Query  1322  PEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQE  1143
             PEI     F+ LD+VDAW+ +GWWEGH+ +VLG  KY+VC  +  E L FE S LRP QE
Sbjct  327   PEIQSFHQFEHLDRVDAWLNDGWWEGHIKEVLGGLKYIVCLTTTEEELVFEHSMLRPRQE  386

Query  1142  WKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHG  963
             W    W  A + D  RSSSD+ L SK +K++ K   +   PKFSKGM VE  S EEGY G
Sbjct  387   WVKEKWFTAREFDKTRSSSDMTLKSKELKIRIKCSGRTSKPKFSKGMRVEVRSDEEGYQG  446

Query  962   SWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEV  783
             SWYTAVI DSIG +KFL+EY TLRT+DESEPLKEKAD  +IRPCPP+I R DRFKM EEV
Sbjct  447   SWYTAVIVDSIGEHKFLVEYLTLRTEDESEPLKEKADVSDIRPCPPVIQRIDRFKMLEEV  506

Query  782   DAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNN  603
             DAWYNEGWW GLI K+LDGL Y+VYFWTTNEE+ F H  +RPHQEWID KW IAF K + 
Sbjct  507   DAWYNEGWWVGLICKILDGLKYMVYFWTTNEELVFDHFTLRPHQEWIDGKWVIAFMKKSK  566

Query  602   NLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEF  423
                  K   ++R +GG+AS T FC+GAKVEV+ DEEG QGSWYPA I+R +GNGKYL+++
Sbjct  567   LQVKSKLN-LKRQNGGVASHTNFCVGAKVEVRSDEEGYQGSWYPATIVRPLGNGKYLLQY  625

Query  422   RTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGA  243
             +TL+ D  TDLL +E DA+ +RPS  ++Q+ D+FRPL+EVDAW + GW  GQVC+VL G+
Sbjct  626   QTLETDDETDLLTEEVDAIFIRPSPLVIQQADQFRPLDEVDAWHDGGWWAGQVCKVLIGS  685

Query  242   KYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              Y V FRT NEILEF+H  LR  Q W++G W
Sbjct  686   NYTVYFRTANEILEFQHSDLRPRQNWLDGEW  716


 Score =   306 bits (784),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 190/497 (38%), Positives = 268/497 (54%), Gaps = 46/497 (9%)
 Frame = -3

Query  2063  AMSAEAQFNKGDRVEVLMRDN---FPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDP  1893
             + S +  F++G  VEV  RD    +  W  AA++     ++    +  VE++ L + +  
Sbjct  257   SRSWKETFSEGMSVEV-KRDKEGCYGSWHTAAIV-----ESVGYDKFLVEYQKLKTVNGS  310

Query  1892  MKRRKEYVHLSAVRPAPPGEPCCY-FRVGESADVFYENRGWRRGTVDEILENSMYMVALG  1716
              +  KE V  S +RP PP     + F   +  D +  N GW  G + E+L    Y+V L 
Sbjct  311   -QFLKEEVDASCIRPCPPEIQSFHQFEHLDRVDAWL-NDGWWEGHIKEVLGGLKYIVCLT  368

Query  1715  DEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKC  1536
               +  E +  E   LR  ++W    W    E  +       + S D  +    +K+RIKC
Sbjct  369   TTE--EELVFEHSMLRPRQEWVKEKWFTAREFDKT------RSSSDMTLKSKELKIRIKC  420

Query  1535  TRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIE  1356
             +  +   KFSK M VEV+ D+EG++ SWY +V+++ +G  K LV+Y  L+T+D ++ L E
Sbjct  421   SGRTSKPKFSKGMRVEVRSDEEGYQGSWYTAVIVDSIGEHKFLVEYLTLRTEDESEPLKE  480

Query  1355  EVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
             + D S IRPCPP I RI  FK+L++VDAW   GWW G + K+L   KYMV F + NE L 
Sbjct  481   KADVSDIRPCPPVIQRIDRFKMLEEVDAWYNEGWWVGLICKILDGLKYMVYFWTTNEELV  540

Query  1175  FEASDLRPHQEWKNNNWVAA----------TKIDLPRSSSDVMLNskvvkvkskSDRKAL  1026
             F+   LRPHQEW +  WV A          +K++L R +  V                A 
Sbjct  541   FDHFTLRPHQEWIDGKWVIAFMKKSKLQVKSKLNLKRQNGGV----------------AS  584

Query  1025  GPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAF  846
                F  G  VE  S EEGY GSWY A I   +G  K+LL+YQTL TDDE++ L E+ DA 
Sbjct  585   HTNFCVGAKVEVRSDEEGYQGSWYPATIVRPLGNGKYLLQYQTLETDDETDLLTEEVDAI  644

Query  845   NIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHG  666
              IRP P +I + D+F+  +EVDAW++ GWW G + KVL G NY VYF T NE +EF H  
Sbjct  645   FIRPSPLVIQQADQFRPLDEVDAWHDGGWWAGQVCKVLIGSNYTVYFRTANEILEFQHSD  704

Query  665   IRPHQEWIDKKWDIAFR  615
             +RP Q W+D +W  A R
Sbjct  705   LRPRQNWLDGEWIAAKR  721



>ref|XP_006337997.1| PREDICTED: uncharacterized protein LOC102593605 isoform X2 [Solanum 
tuberosum]
Length=725

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/633 (58%), Positives = 449/633 (71%), Gaps = 12/633 (2%)
 Frame = -3

Query  2042  FNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHL  1863
             FNKGD VEVL  + F IW PA VLR +  K  R GQIYVEF+T   ++    RR EYV+ 
Sbjct  94    FNKGDAVEVLKTNPFTIWLPATVLRSTPCKKTRNGQIYVEFQTHYCEESSGSRR-EYVNA  152

Query  1862  SAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVES--VK  1689
               VRPAPP E   YF+VG++ +VFY+ +GWR+G VD+ILENSMY V L   D VE   VK
Sbjct  153   GDVRPAPPPELHRYFKVGDNVEVFYKEKGWRKGKVDDILENSMYFVLL---DGVEEEIVK  209

Query  1688  VEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKF  1509
             VEQW LRV+R W DG W+PPLE     QQ  QK   +  +   GVKLRI C+R S    F
Sbjct  210   VEQWGLRVYRVWDDGSWLPPLE----FQQIPQKNIPEVELKSRGVKLRIMCSR-SWKETF  264

Query  1508  SKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRP  1329
             S+ M VEVK DKEG   SW+ + ++E +G  K LV+YQ LKT +G+ +L EEVDASCIRP
Sbjct  265   SEGMSVEVKRDKEGCYGSWHTAAIVESVGYDKFLVEYQKLKTVNGSQFLKEEVDASCIRP  324

Query  1328  CPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPH  1149
             CPPEI     F+ LD+VDAW+ +GWWEGH+ +VLG  KY+VC  +  E L FE S LRP 
Sbjct  325   CPPEIQSFHQFEHLDRVDAWLNDGWWEGHIKEVLGGLKYIVCLTTTEEELVFEHSMLRPR  384

Query  1148  QEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGY  969
             QEW    W  A + D  RSSSD+ L SK +K++ K   +   PKFSKGM VE  S EEGY
Sbjct  385   QEWVKEKWFTAREFDKTRSSSDMTLKSKELKIRIKCSGRTSKPKFSKGMRVEVRSDEEGY  444

Query  968   HGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFE  789
              GSWYTAVI DSIG +KFL+EY TLRT+DESEPLKEKAD  +IRPCPP+I R DRFKM E
Sbjct  445   QGSWYTAVIVDSIGEHKFLVEYLTLRTEDESEPLKEKADVSDIRPCPPVIQRIDRFKMLE  504

Query  788   EVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKS  609
             EVDAWYNEGWW GLI K+LDGL Y+VYFWTTNEE+ F H  +RPHQEWID KW IAF K 
Sbjct  505   EVDAWYNEGWWVGLICKILDGLKYMVYFWTTNEELVFDHFTLRPHQEWIDGKWVIAFMKK  564

Query  608   NNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLV  429
             +      K   ++R +GG+AS T FC+GAKVEV+ DEEG QGSWYPA I+R +GNGKYL+
Sbjct  565   SKLQVKSKLN-LKRQNGGVASHTNFCVGAKVEVRSDEEGYQGSWYPATIVRPLGNGKYLL  623

Query  428   EFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLE  249
             +++TL+ D  TDLL +E DA+ +RPS  ++Q+ D+FRPL+EVDAW + GW  GQVC+VL 
Sbjct  624   QYQTLETDDETDLLTEEVDAIFIRPSPLVIQQADQFRPLDEVDAWHDGGWWAGQVCKVLI  683

Query  248   GAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             G+ Y V FRT NEILEF+H  LR  Q W++G W
Sbjct  684   GSNYTVYFRTANEILEFQHSDLRPRQNWLDGEW  716


 Score =   306 bits (784),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 190/497 (38%), Positives = 268/497 (54%), Gaps = 46/497 (9%)
 Frame = -3

Query  2063  AMSAEAQFNKGDRVEVLMRDN---FPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDP  1893
             + S +  F++G  VEV  RD    +  W  AA++     ++    +  VE++ L + +  
Sbjct  257   SRSWKETFSEGMSVEV-KRDKEGCYGSWHTAAIV-----ESVGYDKFLVEYQKLKTVNGS  310

Query  1892  MKRRKEYVHLSAVRPAPPGEPCCY-FRVGESADVFYENRGWRRGTVDEILENSMYMVALG  1716
              +  KE V  S +RP PP     + F   +  D +  N GW  G + E+L    Y+V L 
Sbjct  311   -QFLKEEVDASCIRPCPPEIQSFHQFEHLDRVDAWL-NDGWWEGHIKEVLGGLKYIVCLT  368

Query  1715  DEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKC  1536
               +  E +  E   LR  ++W    W    E  +       + S D  +    +K+RIKC
Sbjct  369   TTE--EELVFEHSMLRPRQEWVKEKWFTAREFDKT------RSSSDMTLKSKELKIRIKC  420

Query  1535  TRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIE  1356
             +  +   KFSK M VEV+ D+EG++ SWY +V+++ +G  K LV+Y  L+T+D ++ L E
Sbjct  421   SGRTSKPKFSKGMRVEVRSDEEGYQGSWYTAVIVDSIGEHKFLVEYLTLRTEDESEPLKE  480

Query  1355  EVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
             + D S IRPCPP I RI  FK+L++VDAW   GWW G + K+L   KYMV F + NE L 
Sbjct  481   KADVSDIRPCPPVIQRIDRFKMLEEVDAWYNEGWWVGLICKILDGLKYMVYFWTTNEELV  540

Query  1175  FEASDLRPHQEWKNNNWVAA----------TKIDLPRSSSDVMLNskvvkvkskSDRKAL  1026
             F+   LRPHQEW +  WV A          +K++L R +  V                A 
Sbjct  541   FDHFTLRPHQEWIDGKWVIAFMKKSKLQVKSKLNLKRQNGGV----------------AS  584

Query  1025  GPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAF  846
                F  G  VE  S EEGY GSWY A I   +G  K+LL+YQTL TDDE++ L E+ DA 
Sbjct  585   HTNFCVGAKVEVRSDEEGYQGSWYPATIVRPLGNGKYLLQYQTLETDDETDLLTEEVDAI  644

Query  845   NIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHG  666
              IRP P +I + D+F+  +EVDAW++ GWW G + KVL G NY VYF T NE +EF H  
Sbjct  645   FIRPSPLVIQQADQFRPLDEVDAWHDGGWWAGQVCKVLIGSNYTVYFRTANEILEFQHSD  704

Query  665   IRPHQEWIDKKWDIAFR  615
             +RP Q W+D +W  A R
Sbjct  705   LRPRQNWLDGEWIAAKR  721



>ref|XP_006337996.1| PREDICTED: uncharacterized protein LOC102593605 isoform X1 [Solanum 
tuberosum]
Length=736

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/633 (58%), Positives = 449/633 (71%), Gaps = 12/633 (2%)
 Frame = -3

Query  2042  FNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHL  1863
             FNKGD VEVL  + F IW PA VLR +  K  R GQIYVEF+T   ++    RR EYV+ 
Sbjct  94    FNKGDAVEVLKTNPFTIWLPATVLRSTPCKKTRNGQIYVEFQTHYCEESSGSRR-EYVNA  152

Query  1862  SAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVES--VK  1689
               VRPAPP E   YF+VG++ +VFY+ +GWR+G VD+ILENSMY V L   D VE   VK
Sbjct  153   GDVRPAPPPELHRYFKVGDNVEVFYKEKGWRKGKVDDILENSMYFVLL---DGVEEEIVK  209

Query  1688  VEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKF  1509
             VEQW LRV+R W DG W+PPLE     QQ  QK   +  +   GVKLRI C+R S    F
Sbjct  210   VEQWGLRVYRVWDDGSWLPPLE----FQQIPQKNIPEVELKSRGVKLRIMCSR-SWKETF  264

Query  1508  SKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRP  1329
             S+ M VEVK DKEG   SW+ + ++E +G  K LV+YQ LKT +G+ +L EEVDASCIRP
Sbjct  265   SEGMSVEVKRDKEGCYGSWHTAAIVESVGYDKFLVEYQKLKTVNGSQFLKEEVDASCIRP  324

Query  1328  CPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPH  1149
             CPPEI     F+ LD+VDAW+ +GWWEGH+ +VLG  KY+VC  +  E L FE S LRP 
Sbjct  325   CPPEIQSFHQFEHLDRVDAWLNDGWWEGHIKEVLGGLKYIVCLTTTEEELVFEHSMLRPR  384

Query  1148  QEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGY  969
             QEW    W  A + D  RSSSD+ L SK +K++ K   +   PKFSKGM VE  S EEGY
Sbjct  385   QEWVKEKWFTAREFDKTRSSSDMTLKSKELKIRIKCSGRTSKPKFSKGMRVEVRSDEEGY  444

Query  968   HGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFE  789
              GSWYTAVI DSIG +KFL+EY TLRT+DESEPLKEKAD  +IRPCPP+I R DRFKM E
Sbjct  445   QGSWYTAVIVDSIGEHKFLVEYLTLRTEDESEPLKEKADVSDIRPCPPVIQRIDRFKMLE  504

Query  788   EVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKS  609
             EVDAWYNEGWW GLI K+LDGL Y+VYFWTTNEE+ F H  +RPHQEWID KW IAF K 
Sbjct  505   EVDAWYNEGWWVGLICKILDGLKYMVYFWTTNEELVFDHFTLRPHQEWIDGKWVIAFMKK  564

Query  608   NNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLV  429
             +      K   ++R +GG+AS T FC+GAKVEV+ DEEG QGSWYPA I+R +GNGKYL+
Sbjct  565   SKLQVKSKLN-LKRQNGGVASHTNFCVGAKVEVRSDEEGYQGSWYPATIVRPLGNGKYLL  623

Query  428   EFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLE  249
             +++TL+ D  TDLL +E DA+ +RPS  ++Q+ D+FRPL+EVDAW + GW  GQVC+VL 
Sbjct  624   QYQTLETDDETDLLTEEVDAIFIRPSPLVIQQADQFRPLDEVDAWHDGGWWAGQVCKVLI  683

Query  248   GAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             G+ Y V FRT NEILEF+H  LR  Q W++G W
Sbjct  684   GSNYTVYFRTANEILEFQHSDLRPRQNWLDGEW  716


 Score =   306 bits (783),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 190/497 (38%), Positives = 268/497 (54%), Gaps = 46/497 (9%)
 Frame = -3

Query  2063  AMSAEAQFNKGDRVEVLMRDN---FPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDP  1893
             + S +  F++G  VEV  RD    +  W  AA++     ++    +  VE++ L + +  
Sbjct  257   SRSWKETFSEGMSVEV-KRDKEGCYGSWHTAAIV-----ESVGYDKFLVEYQKLKTVNGS  310

Query  1892  MKRRKEYVHLSAVRPAPPGEPCCY-FRVGESADVFYENRGWRRGTVDEILENSMYMVALG  1716
              +  KE V  S +RP PP     + F   +  D +  N GW  G + E+L    Y+V L 
Sbjct  311   -QFLKEEVDASCIRPCPPEIQSFHQFEHLDRVDAWL-NDGWWEGHIKEVLGGLKYIVCLT  368

Query  1715  DEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKC  1536
               +  E +  E   LR  ++W    W    E  +       + S D  +    +K+RIKC
Sbjct  369   TTE--EELVFEHSMLRPRQEWVKEKWFTAREFDKT------RSSSDMTLKSKELKIRIKC  420

Query  1535  TRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIE  1356
             +  +   KFSK M VEV+ D+EG++ SWY +V+++ +G  K LV+Y  L+T+D ++ L E
Sbjct  421   SGRTSKPKFSKGMRVEVRSDEEGYQGSWYTAVIVDSIGEHKFLVEYLTLRTEDESEPLKE  480

Query  1355  EVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
             + D S IRPCPP I RI  FK+L++VDAW   GWW G + K+L   KYMV F + NE L 
Sbjct  481   KADVSDIRPCPPVIQRIDRFKMLEEVDAWYNEGWWVGLICKILDGLKYMVYFWTTNEELV  540

Query  1175  FEASDLRPHQEWKNNNWVAA----------TKIDLPRSSSDVMLNskvvkvkskSDRKAL  1026
             F+   LRPHQEW +  WV A          +K++L R +  V                A 
Sbjct  541   FDHFTLRPHQEWIDGKWVIAFMKKSKLQVKSKLNLKRQNGGV----------------AS  584

Query  1025  GPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAF  846
                F  G  VE  S EEGY GSWY A I   +G  K+LL+YQTL TDDE++ L E+ DA 
Sbjct  585   HTNFCVGAKVEVRSDEEGYQGSWYPATIVRPLGNGKYLLQYQTLETDDETDLLTEEVDAI  644

Query  845   NIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHG  666
              IRP P +I + D+F+  +EVDAW++ GWW G + KVL G NY VYF T NE +EF H  
Sbjct  645   FIRPSPLVIQQADQFRPLDEVDAWHDGGWWAGQVCKVLIGSNYTVYFRTANEILEFQHSD  704

Query  665   IRPHQEWIDKKWDIAFR  615
             +RP Q W+D +W  A R
Sbjct  705   LRPRQNWLDGEWIAAKR  721



>ref|XP_009779747.1| PREDICTED: uncharacterized protein LOC104228898 [Nicotiana sylvestris]
Length=637

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/640 (56%), Positives = 447/640 (70%), Gaps = 16/640 (3%)
 Frame = -3

Query  2066  HAMSAEAQFNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             H  +    FNKGD VEVL    F IW+PA +LR +  +N   GQIYVEF+TL +++   +
Sbjct  4     HTSTTPQCFNKGDAVEVLKTQPFTIWYPATILRSTPTRN---GQIYVEFQTL-NEEPSGR  59

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDED  1707
             RR+EY++   +RP PP E   YF+VG++ +V YE +GWR+G V+ ILENSMY+V+L +  
Sbjct  60    RRREYINACDIRPTPPIELHRYFKVGDNVEVLYEGKGWRKGKVNGILENSMYLVSLVEV-  118

Query  1706  AVESVKVEQWQLRVHRDWKDGCWVPP-LEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTR  1530
                 VK EQW LR +RDW DG WVPP L   ++ Q  Q     D  +   GVKLRIKC+R
Sbjct  119   ---VVKAEQWGLRFYRDWDDGSWVPPPLHLQKLPQNIQ-----DVDLKSRGVKLRIKCSR  170

Query  1529  GSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEV  1350
              S +  FS+ M VEVK DKEGF  SW+ +V+++ +G  K LV+YQ LK  +G+ +L EEV
Sbjct  171   -SWMGTFSEGMSVEVKRDKEGFRGSWHNAVIVKSVGYDKYLVEYQTLKAVNGSQFLKEEV  229

Query  1349  DASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFE  1170
             DASCIRPCPPEIH   PF+ LDKVDAW  +GWWEGH+ +VLG   Y VC  S  E L FE
Sbjct  230   DASCIRPCPPEIHSFHPFEPLDKVDAWFIDGWWEGHIREVLGGLMYEVCLLSTEEELVFE  289

Query  1169  ASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEA  990
              S LRPHQEW    WV A + D+ RSSSD+ L SK +K+K K   K   PKFSK M VE 
Sbjct  290   HSMLRPHQEWIKEKWVTAREFDMTRSSSDMNLKSKDLKIKIKCSGKTSEPKFSKEMRVEV  349

Query  989   TSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRF  810
              S EEGY GSWY AVI +SIG +KFL+EY TLRT+DESEPLKE ADA +IRPCPP+I R 
Sbjct  350   KSDEEGYKGSWYAAVIIESIGQHKFLVEYLTLRTEDESEPLKEMADASDIRPCPPVIDRI  409

Query  809   DRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             DRFKM EEVDAWYN+GWW G+I K+LDGL Y+VYFWTTNEE+ F H  +RPHQEWID KW
Sbjct  410   DRFKMLEEVDAWYNDGWWVGIICKILDGLKYMVYFWTTNEELVFDHFTLRPHQEWIDGKW  469

Query  629   DIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLI  450
              IAFRK       P  G ++  +GG+A  T F +GAKVE K DEE  +GSWYPA I+R +
Sbjct  470   VIAFRKKPKVQVKPGLGKLKGLNGGVARRTKFSVGAKVEAKRDEESYRGSWYPATIVRHL  529

Query  449   GNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVG  270
             GNGKYL+ ++TL+ D  TDLL +EADAL +RP  P+ Q+ D F PL+EVDAW N GW  G
Sbjct  530   GNGKYLLRYQTLETDDETDLLTEEADALCIRP-PPVTQQPDIFWPLDEVDAWYNGGWWAG  588

Query  269   QVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             QVC+VL+G+ Y V F+ +NEILE +H  LR HQ W++G W
Sbjct  589   QVCKVLDGSNYTVYFKMSNEILEIQHSDLRPHQHWLDGKW  628


 Score =   318 bits (814),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 201/480 (42%), Positives = 271/480 (56%), Gaps = 22/480 (5%)
 Frame = -3

Query  2048  AQFNKGDRVEVLM-RDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEY  1872
               F++G  VEV   ++ F   +  AV+  SV  ++      VE++TL + +   +  KE 
Sbjct  174   GTFSEGMSVEVKRDKEGFRGSWHNAVIVKSVGYDK----YLVEYQTLKAVNGS-QFLKEE  228

Query  1871  VHLSAVRPAPPGEPCCY-FRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVES  1695
             V  S +RP PP     + F   +  D ++ + GW  G + E+L   MY V L   +  E 
Sbjct  229   VDASCIRPCPPEIHSFHPFEPLDKVDAWFID-GWWEGHIREVLGGLMYEVCLLSTE--EE  285

Query  1694  VKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVR  1515
             +  E   LR H++W    WV   E          + S D  +    +K++IKC+  +   
Sbjct  286   LVFEHSMLRPHQEWIKEKWVTAREFDMT------RSSSDMNLKSKDLKIKIKCSGKTSEP  339

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCI  1335
             KFSKEM VEVK D+EG++ SWYA+V++E +G  K LV+Y  L+T+D ++ L E  DAS I
Sbjct  340   KFSKEMRVEVKSDEEGYKGSWYAAVIIESIGQHKFLVEYLTLRTEDESEPLKEMADASDI  399

Query  1334  RPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLR  1155
             RPCPP I RI  FK+L++VDAW  +GWW G + K+L   KYMV F + NE L F+   LR
Sbjct  400   RPCPPVIDRIDRFKMLEEVDAWYNDGWWVGIICKILDGLKYMVYFWTTNEELVFDHFTLR  459

Query  1154  PHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEE  975
             PHQEW +  WV A      R    V +   + K+K  +   A   KFS G  VEA   EE
Sbjct  460   PHQEWIDGKWVIAF-----RKKPKVQVKPGLGKLKGLNGGVARRTKFSVGAKVEAKRDEE  514

Query  974   GYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKM  795
              Y GSWY A I   +G  K+LL YQTL TDDE++ L E+ADA  IRP PP+  + D F  
Sbjct  515   SYRGSWYPATIVRHLGNGKYLLRYQTLETDDETDLLTEEADALCIRP-PPVTQQPDIFWP  573

Query  794   FEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFR  615
              +EVDAWYN GWW G + KVLDG NY VYF  +NE +E  H  +RPHQ W+D KW  A R
Sbjct  574   LDEVDAWYNGGWWAGQVCKVLDGSNYTVYFKMSNEILEIQHSDLRPHQHWLDGKWIAAKR  633



>ref|XP_011100723.1| PREDICTED: uncharacterized protein LOC105178863 [Sesamum indicum]
Length=628

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/637 (50%), Positives = 418/637 (66%), Gaps = 17/637 (3%)
 Frame = -3

Query  2051  EAQFNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMK-RRKE  1875
             +    KG+++EV  +    +W+P+  LR S+       Q YV+F+TL   +  M   R+E
Sbjct  3     QKSLKKGEKIEVRKQIGDVVWYPSTFLRSSL------NQTYVQFDTLSEMEGSMSPLRRE  56

Query  1874  YVHLSAVRPAPPGEPCCYFRVGESADVF-YENRGWRRGTVDEILENSMYMVALGDEDAVE  1698
             YV    VRPAPP E   YF+VGE  + F  E +GWR+ TV  ILE S Y V+   E    
Sbjct  57    YVSPVDVRPAPPLELHRYFKVGEIVEGFCREKKGWRKATVAAILEKSRYAVSFEGEGQKG  116

Query  1697  SV-KVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSC  1521
             S+ ++EQW+LR  R+W DG W PP    +V     Q KS +  +   G+ LRIKC+  + 
Sbjct  117   SLAEMEQWELRAVREWADGSWSPPFRLEEV----LQNKSSESEVKSRGLILRIKCSGKAS  172

Query  1520  VRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDAS  1341
               +F++ M VEVK D+EGF+ SW+ +V+++ L N K LV+Y+ L+T++ T+ L EEVD S
Sbjct  173   GMQFNEGMLVEVKSDEEGFQGSWFTAVIVKPLANDKFLVEYRTLRTENKTELLKEEVDIS  232

Query  1340  CIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
             CI+ CPP I R+ PF  L++VDAW  +GWWEGH+ +V    KYMV F + +E + FE   
Sbjct  233   CIKHCPPSIQRVKPFDYLERVDAWYNDGWWEGHIVQVSNGCKYMVQFTNTDEKMVFEHCK  292

Query  1160  LRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSF  981
             LRPHQEW +  WV   K++L    +DV L S  VK+K K   KA  P F  GM+VE  S 
Sbjct  293   LRPHQEWTDGKWVVVPKVNL----ADVSLKSNKVKLKRKHSGKASEPTFRDGMMVEVKSD  348

Query  980   EEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRF  801
             EEGY GSWYTAVI  S+  +K+L+EYQTL+TDDES+ L+EKA A  IRPCPP I R DRF
Sbjct  349   EEGYQGSWYTAVIVCSLCRDKYLVEYQTLKTDDESDLLREKAFASYIRPCPPKIVRVDRF  408

Query  800   KMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
             KM EEVDAWYN+GWW GL+SKVLDGL Y VYFWTTNEE+   H  +RPHQEWI  KW +A
Sbjct  409   KMLEEVDAWYNDGWWVGLVSKVLDGLKYAVYFWTTNEELILKHFNLRPHQEWIGGKWIVA  468

Query  620   FRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNG  441
             FR+ +  +   K G  +  + G+  +     G KVEVK DE+G +GSWYPA I + IG+ 
Sbjct  469   FRRKSKLVVKNKLGKYKGENDGLGLDPNLINGMKVEVKSDEQGYRGSWYPAAIAKSIGSS  528

Query  440   KYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVC  261
             KYLVE++TLK D GT L  +EADAL +RP  P++QR DRF+  EEVDAW N+GW VGQ+C
Sbjct  529   KYLVEYQTLKTDDGTQLHKEEADALCIRPCPPVVQRKDRFKHFEEVDAWYNDGWWVGQIC  588

Query  260   EVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +VL+G KY V F +T E LEF+H  LR HQ+WI G W
Sbjct  589   KVLKGRKYLVYFNSTTETLEFQHSELRPHQDWIRGQW  625


 Score =   170 bits (430),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 112/319 (35%), Positives = 161/319 (50%), Gaps = 29/319 (9%)
 Frame = -3

Query  2057  SAEAQFNKGDRVEVLMRDNF--PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKR  1884
             ++E  F  G  VEV   +      W+ A ++    R      +  VE++TL +DD+    
Sbjct  332   ASEPTFRDGMMVEVKSDEEGYQGSWYTAVIVCSLCR-----DKYLVEYQTLKTDDESDLL  386

Query  1883  RKEYVHLSAVRPAPPG-EPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDED  1707
             R E    S +RP PP       F++ E  D +Y N GW  G V ++L+   Y V     +
Sbjct  387   R-EKAFASYIRPCPPKIVRVDRFKMLEEVDAWY-NDGWWVGLVSKVLDGLKYAVYFWTTN  444

Query  1706  AVESVKVEQWQLRVHRDWKDGCWVPPLEESQ---VDQQYQQKKSEDFLMTPSGVKLRIKC  1536
               E + ++ + LR H++W  G W+          V  +  + K E+      G+ L    
Sbjct  445   --EELILKHFNLRPHQEWIGGKWIVAFRRKSKLVVKNKLGKYKGEN-----DGLGLDPNL  497

Query  1535  TRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIE  1356
               G         M VEVK D++G+  SWY + + + +G+ K LV+YQ LKTDDGT    E
Sbjct  498   ING---------MKVEVKSDEQGYRGSWYPAAIAKSIGSSKYLVEYQTLKTDDGTQLHKE  548

Query  1355  EVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
             E DA CIRPCPP + R   FK  ++VDAW  +GWW G + KVL   KY+V F S  E L 
Sbjct  549   EADALCIRPCPPVVQRKDRFKHFEEVDAWYNDGWWVGQICKVLKGRKYLVYFNSTTETLE  608

Query  1175  FEASDLRPHQEWKNNNWVA  1119
             F+ S+LRPHQ+W    WV+
Sbjct  609   FQHSELRPHQDWIRGQWVS  627



>gb|EYU33072.1| hypothetical protein MIMGU_mgv1a005230mg [Erythranthe guttata]
Length=492

 Score =   450 bits (1157),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 246/502 (49%), Positives = 321/502 (64%), Gaps = 21/502 (4%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETL--CSDDDPMK  1887
             MS+E   NKG ++EV M+++  IW+ A  LR S  K      I+V+F+TL   ++D    
Sbjct  1     MSSEL-LNKGAKIEVRMQNDGVIWYTATFLRSSTTK------IFVQFDTLRESAEDPESP  53

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENR-GWRRGTVDEILENSMYMVALGDE  1710
              R++YV    +RPA P E   Y +VGES + F   R GWRRG V EILE S Y V+  + 
Sbjct  54    LRRDYVSPGDIRPAQPPEIHRYLKVGESVEGFCRERMGWRRGKVVEILECSRYTVSFDEG  113

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTR  1530
                E   +EQW+LR  R+W DG W PP    QV    QQ KS D  +   G+ L+IKC+R
Sbjct  114   SLAE---MEQWELRAVREWIDGSWAPPFRLQQV---LQQNKSSDSQVKSRGLVLKIKCSR  167

Query  1529  GSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGN-GKLLVQYQDLKTDDGTDYLIEE  1353
              +   KF++ M VEVK D+EGF  SW+ +V+ + LGN  K LV+Y+ LKT+D T+ L EE
Sbjct  168   KAPEAKFNEGMLVEVKSDEEGFRGSWFTAVIGKTLGNNSKFLVEYRTLKTEDKTELLKEE  227

Query  1352  VDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTF  1173
             VD SCIRPCPP I ++ P+  L++VDAW  +GWWEG++ +V    KYMV F +M E + F
Sbjct  228   VDVSCIRPCPPVIQQVKPYDFLERVDAWYNDGWWEGYIVQVFNACKYMVRFTNMEEEMVF  287

Query  1172  EASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVE  993
             E   LR HQ+W ++ W+AA+K++L    +D  L S+  K+K K    A  P F  GM VE
Sbjct  288   EHCKLRLHQDWVDDKWLAASKVNL----ADENLKSRKGKLKRKHSGNAWEPTFWNGMTVE  343

Query  992   ATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHR  813
               S EEGY GSWYTAVI  S+  N FL+EY+TL+T+DE+E L+EKA A  IRPCPP I R
Sbjct  344   VKSDEEGYQGSWYTAVIIGSLCNNMFLVEYKTLKTEDETELLREKAFASYIRPCPPEITR  403

Query  812   FDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKK  633
              DR+KM E+VDAWYNEGWW GLISKVLD L Y VYFWTTNEEI   H  +RPHQEW++ K
Sbjct  404   VDRYKMLEKVDAWYNEGWWVGLISKVLDDLKYSVYFWTTNEEIILEHRSLRPHQEWVNGK  463

Query  632   WDIAFRKSNNNLPNPKPGIMRR  567
             W ++F     N    + G  R+
Sbjct  464   WIVSFGDLLENAGRAEVGSTRK  485


 Score =   321 bits (822),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 196/468 (42%), Positives = 277/468 (59%), Gaps = 23/468 (5%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKT---DDGTDYLIEEVDAS  1341
              +K   +EV+   +G    WY +  +      K+ VQ+  L+    D  +    + V   
Sbjct  6     LNKGAKIEVRMQNDGV--IWYTATFLRS-STTKIFVQFDTLRESAEDPESPLRRDYVSPG  62

Query  1340  CIRPC-PPEIHRISPFKLLDKVDAWVGN--GWWEGHVSKVLGDAKYMVCF--GSMNELLT  1176
              IRP  PPEIHR    K+ + V+ +     GW  G V ++L  ++Y V F  GS+ E+  
Sbjct  63    DIRPAQPPEIHRY--LKVGESVEGFCRERMGWRRGKVVEILECSRYTVSFDEGSLAEM--  118

Query  1175  FEASDLRPHQEWKNNNWVAATKIDL---PRSSSDVMLNskvvkvkskSDRKALGPKFSKG  1005
              E  +LR  +EW + +W    ++        SSD  + S+ + +K K  RKA   KF++G
Sbjct  119   -EQWELRAVREWIDGSWAPPFRLQQVLQQNKSSDSQVKSRGLVLKIKCSRKAPEAKFNEG  177

Query  1004  MLVEATSFEEGYHGSWYTAVIFDSIGPN-KFLLEYQTLRTDDESEPLKEKADAFNIRPCP  828
             MLVE  S EEG+ GSW+TAVI  ++G N KFL+EY+TL+T+D++E LKE+ D   IRPCP
Sbjct  178   MLVEVKSDEEGFRGSWFTAVIGKTLGNNSKFLVEYRTLKTEDKTELLKEEVDVSCIRPCP  237

Query  827   PLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQE  648
             P+I +   +   E VDAWYN+GWWEG I +V +   Y+V F    EE+ F H  +R HQ+
Sbjct  238   PVIQQVKPYDFLERVDAWYNDGWWEGYIVQVFNACKYMVRFTNMEEEMVFEHCKLRLHQD  297

Query  647   WIDKKWDIAFRK--SNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWY  474
             W+D KW  A +   ++ NL + K  + R+HSG  A E TF  G  VEVK DEEG QGSWY
Sbjct  298   WVDDKWLAASKVNLADENLKSRKGKLKRKHSGN-AWEPTFWNGMTVEVKSDEEGYQGSWY  356

Query  473   PALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAW  294
              A+I+  + N  +LVE++TLK +  T+LL ++A A  +RP  P + RVDR++ LE+VDAW
Sbjct  357   TAVIIGSLCNNMFLVEYKTLKTEDETELLREKAFASYIRPCPPEITRVDRYKMLEKVDAW  416

Query  293   SNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              N GW VG + +VL+  KY V F TTNE +   H  LR HQEW+NG W
Sbjct  417   YNEGWWVGLISKVLDDLKYSVYFWTTNEEIILEHRSLRPHQEWVNGKW  464



>gb|EYU33069.1| hypothetical protein MIMGU_mgv1a005486mg [Erythranthe guttata]
Length=482

 Score =   446 bits (1147),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 242/485 (50%), Positives = 315/485 (65%), Gaps = 21/485 (4%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETL--CSDDDPMK  1887
             MS+E   NKG ++EV M+++  IW+ A  LR S  K      I+V+F+TL   ++D    
Sbjct  1     MSSEL-LNKGAKIEVRMQNDGVIWYTATFLRSSTTK------IFVQFDTLRESAEDPESP  53

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENR-GWRRGTVDEILENSMYMVALGDE  1710
              R++YV    +RPA P E   Y +VGES + F   R GWRRG V EILE S Y V+  + 
Sbjct  54    LRRDYVSPGDIRPAQPPEIHRYLKVGESVEGFCRERMGWRRGKVVEILECSRYTVSFDEG  113

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTR  1530
                E   +EQW+LR  R+W DG W PP    QV     Q KS D  +   G+ L+IKC+R
Sbjct  114   SLAE---MEQWELRAVREWIDGSWAPPFRLQQV---LHQNKSSDSQVKSRGLVLKIKCSR  167

Query  1529  GSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGN-GKLLVQYQDLKTDDGTDYLIEE  1353
              +   KF++ M VEVK D+EGF  SW+ +V+ + LGN  K LV+Y+ LKT+D T+ L EE
Sbjct  168   KAPEAKFNEGMLVEVKSDEEGFRGSWFTAVIGKTLGNNSKFLVEYRTLKTEDKTELLKEE  227

Query  1352  VDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTF  1173
             VD SCIRPCPP I ++ P+  L++VDAW  +GWWEG++ +V    KYMV F +M E + F
Sbjct  228   VDVSCIRPCPPVIQQVKPYDFLERVDAWYNDGWWEGYIVQVFNACKYMVRFTNMEEEMVF  287

Query  1172  EASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVE  993
             E   LR HQ+W ++ W+AA+K++L    +D  L S+  K+K K    A  P F  GM VE
Sbjct  288   EHCKLRLHQDWVDDKWLAASKVNL----ADENLKSRNGKLKRKHSGNAWEPTFWNGMTVE  343

Query  992   ATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHR  813
               S EEGY GSWYTAVI  S+  N FL+EY+TL+T+DE+E L+EKA A  IRPCPP I R
Sbjct  344   VKSDEEGYQGSWYTAVIIGSLCNNMFLVEYKTLKTEDETELLREKAFASYIRPCPPEITR  403

Query  812   FDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKK  633
              DR+KM E+VDAWYNEGWW GLISKVLD L Y VYFWTTNEEI   H  +RPHQEW++ K
Sbjct  404   VDRYKMLEKVDAWYNEGWWVGLISKVLDDLKYSVYFWTTNEEIILEHRSLRPHQEWVNGK  463

Query  632   WDIAF  618
             W ++F
Sbjct  464   WIVSF  468


 Score =   319 bits (817),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 195/468 (42%), Positives = 276/468 (59%), Gaps = 23/468 (5%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKT---DDGTDYLIEEVDAS  1341
              +K   +EV+   +G    WY +  +      K+ VQ+  L+    D  +    + V   
Sbjct  6     LNKGAKIEVRMQNDGV--IWYTATFLRS-STTKIFVQFDTLRESAEDPESPLRRDYVSPG  62

Query  1340  CIRPC-PPEIHRISPFKLLDKVDAWVGN--GWWEGHVSKVLGDAKYMVCF--GSMNELLT  1176
              IRP  PPEIHR    K+ + V+ +     GW  G V ++L  ++Y V F  GS+ E+  
Sbjct  63    DIRPAQPPEIHRY--LKVGESVEGFCRERMGWRRGKVVEILECSRYTVSFDEGSLAEM--  118

Query  1175  FEASDLRPHQEWKNNNWVAATKIDL---PRSSSDVMLNskvvkvkskSDRKALGPKFSKG  1005
              E  +LR  +EW + +W    ++        SSD  + S+ + +K K  RKA   KF++G
Sbjct  119   -EQWELRAVREWIDGSWAPPFRLQQVLHQNKSSDSQVKSRGLVLKIKCSRKAPEAKFNEG  177

Query  1004  MLVEATSFEEGYHGSWYTAVIFDSIGPN-KFLLEYQTLRTDDESEPLKEKADAFNIRPCP  828
             MLVE  S EEG+ GSW+TAVI  ++G N KFL+EY+TL+T+D++E LKE+ D   IRPCP
Sbjct  178   MLVEVKSDEEGFRGSWFTAVIGKTLGNNSKFLVEYRTLKTEDKTELLKEEVDVSCIRPCP  237

Query  827   PLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQE  648
             P+I +   +   E VDAWYN+GWWEG I +V +   Y+V F    EE+ F H  +R HQ+
Sbjct  238   PVIQQVKPYDFLERVDAWYNDGWWEGYIVQVFNACKYMVRFTNMEEEMVFEHCKLRLHQD  297

Query  647   WIDKKWDIAFRK--SNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWY  474
             W+D KW  A +   ++ NL +    + R+HSG  A E TF  G  VEVK DEEG QGSWY
Sbjct  298   WVDDKWLAASKVNLADENLKSRNGKLKRKHSGN-AWEPTFWNGMTVEVKSDEEGYQGSWY  356

Query  473   PALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAW  294
              A+I+  + N  +LVE++TLK +  T+LL ++A A  +RP  P + RVDR++ LE+VDAW
Sbjct  357   TAVIIGSLCNNMFLVEYKTLKTEDETELLREKAFASYIRPCPPEITRVDRYKMLEKVDAW  416

Query  293   SNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              N GW VG + +VL+  KY V F TTNE +   H  LR HQEW+NG W
Sbjct  417   YNEGWWVGLISKVLDDLKYSVYFWTTNEEIILEHRSLRPHQEWVNGKW  464



>ref|XP_010671796.1| PREDICTED: uncharacterized protein LOC104888492 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010671797.1| PREDICTED: uncharacterized protein LOC104888492 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=657

 Score =   382 bits (980),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 230/591 (39%), Positives = 324/591 (55%), Gaps = 37/591 (6%)
 Frame = -3

Query  1874  YVHLSAVRPAPPGEPCC---YFRVGESADVFYENRGWRRGTVDEIL-ENSMYMVALGDED  1707
             +V    +RP PP         F + E  DV  +   W +GT+  IL E   Y+V +   D
Sbjct  82    FVDSGDIRPVPPENDVTDGRKFEIHEKVDVLRDG-CWMKGTILGILYEGLKYLVEIDGGD  140

Query  1706  AVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSG----------  1557
              V  ++V +  LRVHRDW DG W PP +  Q   +   K  ++ +  P            
Sbjct  141   DV-PIEVGRSCLRVHRDWCDGFWNPPFDYVQ---RNSVKMEQNAICKPETITEVRTHANS  196

Query  1556  --VKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKT  1383
               VKLR K        KFS +  VEVK D++G++ SWY ++V+   G GK LV+YQ LKT
Sbjct  197   RKVKLRFKGAERLLKAKFSPKTAVEVKSDQDGYQGSWYTAIVVGSAGVGKFLVEYQTLKT  256

Query  1382  DDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVC  1203
             DD  + L E  +   IRPCPPEI R   +   ++VDAW  +GWWEG + +VL D KY+V 
Sbjct  257   DDEMELLKEVANEQDIRPCPPEIPRHHRYTAHEEVDAWYNDGWWEGVIYEVLDDWKYIVF  316

Query  1202  FGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALG  1023
             F S +E L ++  +LRPHQ W +  WV A    LP S +++            +  +AL 
Sbjct  317   FASTSEKLVYQHPNLRPHQNWVDGKWVLA----LPNSINEMNF----------ASEEALR  362

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFN  843
               F +GML+E  + + G   SWYTA I   +   KFL+EY +L+T+DE   L+ +  A +
Sbjct  363   ENFREGMLIEVRNDDAGDTCSWYTATIIGFVEKKKFLVEYDSLKTNDEKHTLRREVSAID  422

Query  842   IRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGI  663
             +RP PP    F R+K  EEVDAW + GWW G +S+VL+   Y+V F +  ++ E+ H  +
Sbjct  423   VRPLPPCNLHFGRYKCSEEVDAWRDGGWWVGAVSEVLNRNKYIVQFSSAGDKWEYDHMSL  482

Query  662   RPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQG  483
             RPHQ+WID KW I     +++L        RR +   A + +F  G  VEVK +E G +G
Sbjct  483   RPHQDWIDGKW-ITHEHRSSDLKLRTSSSERRCAQSEA-DRSFGKGTTVEVKSNEPGYEG  540

Query  482   SWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEV  303
             SWY A+I+R    G YLVE+ TLK +   + L +E +A ++RP  P ++    +  LE+V
Sbjct  541   SWYTAVIVRSTRKGTYLVEYLTLKTEDERESLREETEAQNIRPCPPKIEVSGCYFLLEKV  600

Query  302   DAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             DAW N+GW  G + +VL   KY V F T+ E LEF    LR  QEWING W
Sbjct  601   DAWYNDGWWEGVISKVLADKKYMVYFETSREELEFDDVYLRTRQEWINGRW  651


 Score =   275 bits (702),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 168/440 (38%), Positives = 242/440 (55%), Gaps = 33/440 (8%)
 Frame = -3

Query  1412  LLVQYQDLKTDDGTDYLIEEVDASCIRPCPPE--IHRISPFKLLDKVDAWVGNGWWEGHV  1239
              +VQYQ    D     ++  VD+  IRP PPE  +     F++ +KVD      W +G +
Sbjct  68    FMVQYQTHLND-----IVYFVDSGDIRPVPPENDVTDGRKFEIHEKVDVLRDGCWMKGTI  122

Query  1238  SKVLGDA-KYMVCFGSMNEL-LTFEASDLRPHQEWKNNNW-------------VAATKID  1104
               +L +  KY+V     +++ +    S LR H++W +  W             +    I 
Sbjct  123   LGILYEGLKYLVEIDGGDDVPIEVGRSCLRVHRDWCDGFWNPPFDYVQRNSVKMEQNAIC  182

Query  1103  LPRSSSDVML--NskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSI  930
              P + ++V    NS+ VK++ K   + L  KFS    VE  S ++GY GSWYTA++  S 
Sbjct  183   KPETITEVRTHANSRKVKLRFKGAERLLKAKFSPKTAVEVKSDQDGYQGSWYTAIVVGSA  242

Query  929   GPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEG  750
             G  KFL+EYQTL+TDDE E LKE A+  +IRPCPP I R  R+   EEVDAWYN+GWWEG
Sbjct  243   GVGKFLVEYQTLKTDDEMELLKEVANEQDIRPCPPEIPRHHRYTAHEEVDAWYNDGWWEG  302

Query  749   LISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMR  570
             +I +VLD   Y+V+F +T+E++ + H  +RPHQ W+D KW +A   S N +       +R
Sbjct  303   VIYEVLDDWKYIVFFASTSEKLVYQHPNLRPHQNWVDGKWVLALPNSINEMNFASEEALR  362

Query  569   RHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDL  390
              +         F  G  +EV++D+ G+  SWY A I+  +   K+LVE+ +LK +     
Sbjct  363   EN---------FREGMLIEVRNDDAGDTCSWYTATIIGFVEKKKFLVEYDSLKTNDEKHT  413

Query  389   LVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNE  210
             L +E  A+ VRP  P      R++  EEVDAW + GW VG V EVL   KY V F +  +
Sbjct  414   LRREVSAIDVRPLPPCNLHFGRYKCSEEVDAWRDGGWWVGAVSEVLNRNKYIVQFSSAGD  473

Query  209   ILEFRHHGLRLHQEWINGAW  150
               E+ H  LR HQ+WI+G W
Sbjct  474   KWEYDHMSLRPHQDWIDGKW  493


 Score =   266 bits (679),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 167/458 (36%), Positives = 239/458 (52%), Gaps = 37/458 (8%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCY-FR  1815
             W+ A V+  +       G+  VE++TL +DD+ M+  KE  +   +RP PP  P  + + 
Sbjct  233   WYTAIVVGSA-----GVGKFLVEYQTLKTDDE-MELLKEVANEQDIRPCPPEIPRHHRYT  286

Query  1814  VGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWV  1635
               E  D +Y N GW  G + E+L++  Y+V        E +  +   LR H++W DG WV
Sbjct  287   AHEEVDAWY-NDGWWEGVIYEVLDDWKYIVFFAS--TSEKLVYQHPNLRPHQNWVDGKWV  343

Query  1634  PPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERS  1455
               L  S  +  +  +++           LR           F + M +EV+ D  G   S
Sbjct  344   LALPNSINEMNFASEEA-----------LR---------ENFREGMLIEVRNDDAGDTCS  383

Query  1454  WYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVD  1275
             WY + ++  +   K LV+Y  LKT+D    L  EV A  +RP PP       +K  ++VD
Sbjct  384   WYTATIIGFVEKKKFLVEYDSLKTNDEKHTLRREVSAIDVRPLPPCNLHFGRYKCSEEVD  443

Query  1274  AWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPR  1095
             AW   GWW G VS+VL   KY+V F S  +   ++   LRPHQ+W +  W+         
Sbjct  444   AWRDGGWWVGAVSEVLNRNKYIVQFSSAGDKWEYDHMSLRPHQDWIDGKWITH-----EH  498

Query  1094  SSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKF  915
              SSD+ L +   + +    +      F KG  VE  S E GY GSWYTAVI  S     +
Sbjct  499   RSSDLKLRTSSSERRCA--QSEADRSFGKGTTVEVKSNEPGYEGSWYTAVIVRSTRKGTY  556

Query  914   LLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKV  735
             L+EY TL+T+DE E L+E+ +A NIRPCPP I     + + E+VDAWYN+GWWEG+ISKV
Sbjct  557   LVEYLTLKTEDERESLREETEAQNIRPCPPKIEVSGCYFLLEKVDAWYNDGWWEGVISKV  616

Query  734   LDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
             L    Y+VYF T+ EE+EF    +R  QEWI+ +W  A
Sbjct  617   LADKKYMVYFETSREELEFDDVYLRTRQEWINGRWIAA  654


 Score =   172 bits (436),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 115/330 (35%), Positives = 168/330 (51%), Gaps = 28/330 (8%)
 Frame = -3

Query  2078  VPETHAMSAEA---QFNKGDRVEVLMRD--NFPIWFPAAVLRPSVRKNQRAGQIYVEFET  1914
             + E +  S EA    F +G  +EV   D  +   W+ A ++    +K     +  VE+++
Sbjct  350   INEMNFASEEALRENFREGMLIEVRNDDAGDTCSWYTATIIGFVEKK-----KFLVEYDS  404

Query  1913  LCSDDDPMKRRKEYVHLSAVRPAPPGE-PCCYFRVGESADVFYENRGWRRGTVDEILENS  1737
             L ++D+    R+E V    VRP PP       ++  E  D  + + GW  G V E+L  +
Sbjct  405   LKTNDEKHTLRRE-VSAIDVRPLPPCNLHFGRYKCSEEVDA-WRDGGWWVGAVSEVLNRN  462

Query  1736  MYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSG  1557
              Y+V      A +  + +   LR H+DW DG W+             + +S D  +  S 
Sbjct  463   KYIVQFSS--AGDKWEYDHMSLRPHQDWIDGKWIT-----------HEHRSSDLKLRTSS  509

Query  1556  VKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD  1377
              + R  C +    R F K   VEVK ++ G+E SWY +V++     G  LV+Y  LKT+D
Sbjct  510   SERR--CAQSEADRSFGKGTTVEVKSNEPGYEGSWYTAVIVRSTRKGTYLVEYLTLKTED  567

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
               + L EE +A  IRPCPP+I     + LL+KVDAW  +GWWEG +SKVL D KYMV F 
Sbjct  568   ERESLREETEAQNIRPCPPKIEVSGCYFLLEKVDAWYNDGWWEGVISKVLADKKYMVYFE  627

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATKI  1107
             +  E L F+   LR  QEW N  W+AA K+
Sbjct  628   TSREELEFDDVYLRTRQEWINGRWIAANKV  657



>ref|XP_010102899.1| hypothetical protein L484_005961 [Morus notabilis]
 gb|EXB94367.1| hypothetical protein L484_005961 [Morus notabilis]
Length=501

 Score =   364 bits (934),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 219/509 (43%), Positives = 287/509 (56%), Gaps = 46/509 (9%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEVLMRDNFPI--WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             MS  + FN GD+VEV    +     ++PA VLR   +       + VE+ T  S  +  +
Sbjct  1     MSPSSPFNNGDQVEVSKPGHSSTGPYYPATVLRSPAKSKT---LVLVEYLTRRSPGN-HR  56

Query  1886  RRKEYVHLSAVRPAPPGEPC--CYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGD  1713
             R +E+V    VRPAPP E    C FR G+  D F  +  W RGTV  +LE+SMY V   D
Sbjct  57    RLREFVDRENVRPAPPPERSRRC-FRAGDDVDAFLRDSWWFRGTVAGVLEDSMYSVLFPD  115

Query  1712  EDAVESVKVEQWQLRVHRDWKD---GCWVPPLEESQ------------------VDQQYQ  1596
               A   +   QW LR+HR+W     G WVPPLE+ Q                  V     
Sbjct  116   A-ARREIVCRQWNLRLHREWNGRDGGSWVPPLEDDQGNLLKWNSVLFVLVLAFMVSGDRL  174

Query  1595  QKKSEDFLMTPSG-------VKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVV  1437
              KK  D    P         VKL+    +     KF     VEV  ++EG+++SWY + +
Sbjct  175   NKKLLDMQTMPCTRKVKERTVKLKFVLRKKPLEVKFETGATVEVTSEEEGYKKSWYVAKI  234

Query  1436  MEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNG  1257
             +  +G+ K LV++++L TDDGT  L EE DA  +RP PP +  ++ FK L+KVDAW  +G
Sbjct  235   IGSIGSNKFLVEHRNLVTDDGTQPLREEADARHVRPEPPLLLAVNHFKKLEKVDAWYNDG  294

Query  1256  WWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVM  1077
             WWEG + KV    +Y+V F + NE L F+ SDLR HQ+W N  W+ + K D    SS   
Sbjct  295   WWEGVIFKVQTGRQYVVYFSTTNEELVFKHSDLRLHQDWINGKWMISPKED----SSAWT  350

Query  1076  LNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQT  897
             + S  + ++ K D+    P FSKGM VE  S +EGY GSWYTA I  S   +KFL+EY+T
Sbjct  351   VKSSGINLELKDDK----PTFSKGMKVEIRSDDEGYQGSWYTAKIVGSSRNDKFLVEYET  406

Query  896   LRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNY  717
             LRTDDE++PLKE  DA NIRPCPP I R   F + E +DAWYN+GWW G IS +L G  Y
Sbjct  407   LRTDDETKPLKEVVDATNIRPCPPEIQRLYPFAVSENIDAWYNDGWWVGRISNILAGSKY  466

Query  716   VVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             VVYFWT NE  EF H  +RPH+EW+D KW
Sbjct  467   VVYFWTINEAFEFDHCNLRPHKEWVDGKW  495


 Score =   298 bits (763),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 186/486 (38%), Positives = 257/486 (53%), Gaps = 41/486 (8%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGK--LLVQYQDLKTDDGTDYLIEEVDASCIRPCPP  1320
             VEV          +Y + V+      K  +LV+Y   ++      L E VD   +RP PP
Sbjct  13    VEVSKPGHSSTGPYYPATVLRSPAKSKTLVLVEYLTRRSPGNHRRLREFVDRENVRPAPP  72

Query  1319  EIHRISPFKLLDKVDAWVGNGWW-EGHVSKVLGDAKYMVCF-GSMNELLTFEASDLRPHQ  1146
                    F+  D VDA++ + WW  G V+ VL D+ Y V F  +    +     +LR H+
Sbjct  73    PERSRRCFRAGDDVDAFLRDSWWFRGTVAGVLEDSMYSVLFPDAARREIVCRQWNLRLHR  132

Query  1145  EWKNNN---WVAATK-------------------------------IDLPRSSSDVMLNs  1068
             EW   +   WV   +                               +D+        +  
Sbjct  133   EWNGRDGGSWVPPLEDDQGNLLKWNSVLFVLVLAFMVSGDRLNKKLLDMQTMPCTRKVKE  192

Query  1067  kvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRT  888
             + VK+K    +K L  KF  G  VE TS EEGY  SWY A I  SIG NKFL+E++ L T
Sbjct  193   RTVKLKFVLRKKPLEVKFETGATVEVTSEEEGYKKSWYVAKIIGSIGSNKFLVEHRNLVT  252

Query  887   DDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVY  708
             DD ++PL+E+ADA ++RP PPL+   + FK  E+VDAWYN+GWWEG+I KV  G  YVVY
Sbjct  253   DDGTQPLREEADARHVRPEPPLLLAVNHFKKLEKVDAWYNDGWWEGVIFKVQTGRQYVVY  312

Query  707   FWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCI  528
             F TTNEE+ F H  +R HQ+WI+ KW I+ ++ ++       GI          + TF  
Sbjct  313   FSTTNEELVFKHSDLRLHQDWINGKWMISPKEDSSAWTVKSSGINLELKD---DKPTFSK  369

Query  527   GAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSA  348
             G KVE++ D+EG QGSWY A I+    N K+LVE+ TL+ D  T  L +  DA ++RP  
Sbjct  370   GMKVEIRSDDEGYQGSWYTAKIVGSSRNDKFLVEYETLRTDDETKPLKEVVDATNIRPCP  429

Query  347   PILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQE  168
             P +QR+  F   E +DAW N+GW VG++  +L G+KY V F T NE  EF H  LR H+E
Sbjct  430   PEIQRLYPFAVSENIDAWYNDGWWVGRISNILAGSKYVVYFWTINEAFEFDHCNLRPHKE  489

Query  167   WINGAW  150
             W++G W
Sbjct  490   WVDGKW  495


 Score =   176 bits (446),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 110/319 (34%), Positives = 168/319 (53%), Gaps = 28/319 (9%)
 Frame = -3

Query  2051  EAQFNKGDRVEVLMRDNF--PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRK  1878
             E +F  G  VEV   +      W+ A ++  S+  N+      VE   L +DD     R+
Sbjct  207   EVKFETGATVEVTSEEEGYKKSWYVAKII-GSIGSNK----FLVEHRNLVTDDGTQPLRE  261

Query  1877  EYVHLSAVRPAPPGEPCC-YFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAV  1701
             E      VRP PP      +F+  E  D +Y N GW  G + ++     Y+V     +  
Sbjct  262   E-ADARHVRPEPPLLLAVNHFKKLEKVDAWY-NDGWWEGVIFKVQTGRQYVVYFSTTN--  317

Query  1700  ESVKVEQWQLRVHRDWKDGCW-VPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGS  1524
             E +  +   LR+H+DW +G W + P E+S             + +  SG+ L +K  + +
Sbjct  318   EELVFKHSDLRLHQDWINGKWMISPKEDSSA-----------WTVKSSGINLELKDDKPT  366

Query  1523  CVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDA  1344
                 FSK M VE++ D EG++ SWY + ++    N K LV+Y+ L+TDD T  L E VDA
Sbjct  367   ----FSKGMKVEIRSDDEGYQGSWYTAKIVGSSRNDKFLVEYETLRTDDETKPLKEVVDA  422

Query  1343  SCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEAS  1164
             + IRPCPPEI R+ PF + + +DAW  +GWW G +S +L  +KY+V F ++NE   F+  
Sbjct  423   TNIRPCPPEIQRLYPFAVSENIDAWYNDGWWVGRISNILAGSKYVVYFWTINEAFEFDHC  482

Query  1163  DLRPHQEWKNNNWVAATKI  1107
             +LRPH+EW +  WV A+ +
Sbjct  483   NLRPHKEWVDGKWVHASMV  501


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 65/135 (48%), Gaps = 6/135 (4%)
 Frame = -3

Query  554  IASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGK--YLVEFRTLKCDFGTDLLVQ  381
            ++  + F  G +VEV      + G +YPA +LR     K   LVE+ T +       L +
Sbjct  1    MSPSSPFNNGDQVEVSKPGHSSTGPYYPATVLRSPAKSKTLVLVEYLTRRSPGNHRRLRE  60

Query  380  EADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRV-GQVCEVLEGAKYRVNF--RTTNE  210
              D  +VRP+ P  +    FR  ++VDA+  + W   G V  VLE + Y V F      E
Sbjct  61   FVDRENVRPAPPPERSRRCFRAGDDVDAFLRDSWWFRGTVAGVLEDSMYSVLFPDAARRE  120

Query  209  ILEFRHHGLRLHQEW  165
            I+  R   LRLH+EW
Sbjct  121  IV-CRQWNLRLHREW  134



>ref|XP_010024816.1| PREDICTED: uncharacterized protein LOC104415255 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010024817.1| PREDICTED: uncharacterized protein LOC104415255 isoform X1 [Eucalyptus 
grandis]
Length=484

 Score =   360 bits (923),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 215/495 (43%), Positives = 293/495 (59%), Gaps = 30/495 (6%)
 Frame = -3

Query  2048  AQFNKGDRVEVLMRDNFP----IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRR  1881
             + F K D VE+L   + P      +PA VLR   R  +    I+VE+ TL  D       
Sbjct  6     SSFAKDDAVEILRPGSAPGLRGALYPATVLRSPARAKK---LIFVEYLTLSGDGGGGGPE  62

Query  1880  ------KEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVAL  1719
                   +EYV L+  RP PP      FRVGE  D F E+ GW  G + EI E+S Y+VA+
Sbjct  63    GERPRLREYVDLARARPVPPRVMHERFRVGEEVDAFRED-GWHFGEIREIREDSRYLVAV  121

Query  1718  GDEDAVESVKVEQWQLRVHRDWK-DGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRI  1542
             G     E V+  Q +LR HR+W  DG W PPL   ++     Q+KS    + P  +K +I
Sbjct  122   GG--GSEEVEFGQRELRRHREWSGDGVWTPPLAGGEL-----QEKSSTMELKPFKIKFKI  174

Query  1541  KCTRGSCVR--KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTD  1368
                +G+ +   +F K   VEV  D++G+E SW+++ V++ +GN K LV+Y  LKTDD T+
Sbjct  175   GLDKGTSLPPPEFGKGKTVEVSSDEKGYEGSWFSATVIDYIGNDKYLVEYLTLKTDDETE  234

Query  1367  YLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMN  1188
              L EE  +  IRP PP +     FK LDKVDAW  +GWW G +SKVL  ++Y+V F + N
Sbjct  235   PLREEAYSRYIRPYPPYLP-ARRFKQLDKVDAWYNDGWWVGVISKVLKGSQYIVYFSTSN  293

Query  1187  ELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSK  1008
             E L F  S+LR HQ+W +  WV A++     +S++V L    ++ K++     +  KFSK
Sbjct  294   EELIFNESNLRLHQDWSDGKWVIASR----DNSTEVALRIASLRGKTEFGDANIKVKFSK  349

Query  1007  GMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCP  828
             GM VE    E+GY   W+ AVI D+IG +KFL+EYQTL+TDDE+E LKE A++ +IRP P
Sbjct  350   GMKVEVRINEDGYMDCWFPAVIIDTIG-DKFLVEYQTLQTDDETELLKEVAESSHIRPFP  408

Query  827   PLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQE  648
             P I     F   E VDAWYN+GWW G IS++L GL Y VYF T++EE+EF HH +RPHQE
Sbjct  409   PDIKCAHTFAQDEMVDAWYNDGWWVGHISQILGGLKYKVYFMTSSEELEFEHHNLRPHQE  468

Query  647   WIDKKWDIAFRKSNN  603
             WI  +W I  R S +
Sbjct  469   WIGGRWIITSRGSRS  483


 Score =   309 bits (791),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 186/470 (40%), Positives = 273/470 (58%), Gaps = 19/470 (4%)
 Frame = -3

Query  1511  FSKEMPVEV--KGDKEGFERSWYASVVMEVLGNGK--LLVQYQDLKTDDGTDY-------  1365
             F+K+  VE+   G   G   + Y + V+      K  + V+Y  L  D G          
Sbjct  8     FAKDDAVEILRPGSAPGLRGALYPATVLRSPARAKKLIFVEYLTLSGDGGGGGPEGERPR  67

Query  1364  LIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNE  1185
             L E VD +  RP PP +     F++ ++VDA+  +GW  G + ++  D++Y+V  G  +E
Sbjct  68    LREYVDLARARPVPPRVMH-ERFRVGEEVDAFREDGWHFGEIREIREDSRYLVAVGGGSE  126

Query  1184  LLTFEASDLRPHQEWKNNN-WVAA-TKIDLPRSSSDVMLNskvvkvkskSDRKAL--GPK  1017
              + F   +LR H+EW  +  W       +L   SS + L    +K K   D+      P+
Sbjct  127   EVEFGQRELRRHREWSGDGVWTPPLAGGELQEKSSTMELKPFKIKFKIGLDKGTSLPPPE  186

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             F KG  VE +S E+GY GSW++A + D IG +K+L+EY TL+TDDE+EPL+E+A +  IR
Sbjct  187   FGKGKTVEVSSDEKGYEGSWFSATVIDYIGNDKYLVEYLTLKTDDETEPLREEAYSRYIR  246

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             P PP +    RFK  ++VDAWYN+GWW G+ISKVL G  Y+VYF T+NEE+ F    +R 
Sbjct  247   PYPPYLPA-RRFKQLDKVDAWYNDGWWVGVISKVLKGSQYIVYFSTSNEELIFNESNLRL  305

Query  656   HQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIAS-ETTFCIGAKVEVKDDEEGNQGS  480
             HQ+W D KW IA R ++  +      +  +   G A+ +  F  G KVEV+ +E+G    
Sbjct  306   HQDWSDGKWVIASRDNSTEVALRIASLRGKTEFGDANIKVKFSKGMKVEVRINEDGYMDC  365

Query  479   WYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVD  300
             W+PA+I+  IG+ K+LVE++TL+ D  T+LL + A++  +RP  P ++    F   E VD
Sbjct  366   WFPAVIIDTIGD-KFLVEYQTLQTDDETELLKEVAESSHIRPFPPDIKCAHTFAQDEMVD  424

Query  299   AWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             AW N+GW VG + ++L G KY+V F T++E LEF HH LR HQEWI G W
Sbjct  425   AWYNDGWWVGHISQILGGLKYKVYFMTSSEELEFEHHNLRPHQEWIGGRW  474



>ref|XP_007035875.1| Agenet domain-containing protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007035876.1| Agenet domain-containing protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007035877.1| Agenet domain-containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY06801.1| Agenet domain-containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY06802.1| Agenet domain-containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY06803.1| Agenet domain-containing protein, putative isoform 1 [Theobroma 
cacao]
Length=527

 Score =   360 bits (925),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 215/484 (44%), Positives = 292/484 (60%), Gaps = 23/484 (5%)
 Frame = -3

Query  2051  EAQFNKGDRVEVLMRDNFPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMKRRKE  1875
             + Q +KGDRVEV  R N   ++ A VLR PSV    R   ++VE+E +   ++  K  KE
Sbjct  65    QGQISKGDRVEV-KRPN-GAYYAATVLRFPSV---TRKNTVFVEYEVI---NEGTKHVKE  116

Query  1874  YVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVAL-GDEDAVE  1698
             YV LS +RP PP EP   F  G+S D  +EN GWR+G V +ILENS Y+V   G+ +  E
Sbjct  117   YVDLSNLRPLPPCEPNRCFVPGDSVDAHWEN-GWRKGVVKDILENSKYVVGFDGNGEKEE  175

Query  1697  SVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCV  1518
               ++EQ  LR+HR+W DG WVPP  E     Q  ++K + F      VK++I   + +  
Sbjct  176   ESEIEQCNLRLHREWDDGSWVPPFTELT---QSSKEKDDKF----RRVKVKIVFGKRAAD  228

Query  1517  RKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASC  1338
              K  K+  VEV  ++EGF  SW+++V++E + N K LV+   L+T+DG  +  EE +A  
Sbjct  229   AKLRKDDEVEVTREEEGFRGSWFSAVIVEYIRNDKYLVECTTLRTEDGMPFR-EEANACH  287

Query  1337  IRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDL  1158
             IRPCPPE+  I+ F L + VDAW  +GWW G +S VL   KY V F   NE L F+ S L
Sbjct  288   IRPCPPELSPIASFHLREVVDAWYNDGWWVGVISGVLAGPKYAVYFSQTNEELEFDHSYL  347

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFE  978
             R HQ+W N  W  A++     +S  ++ NS  +  K     K L  KF KGM VE  S E
Sbjct  348   RIHQDWINGKWTIASE----ETSRQLLTNSNKLLHKMAVKEKRLKAKFPKGMKVEVKSDE  403

Query  977   EGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFK  798
              G+ GSW++AVI DS+G +K+L+EY  L+T+D+   L+E+A A  IRP PP       ++
Sbjct  404   YGFEGSWFSAVIVDSLGNDKYLVEYLMLKTEDQEALLREEAYASYIRPHPPHAEHAYPYQ  463

Query  797   MFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAF  618
             + E VDAWYN+GWW G I KV  G  Y VYF TTNEE+EF H  +RPHQEWI+ KW IA 
Sbjct  464   LLENVDAWYNDGWWIGQIVKVFTGWRYTVYFRTTNEELEFEHGDLRPHQEWINGKWVIAS  523

Query  617   RKSN  606
             R ++
Sbjct  524   RDAS  527


 Score =   306 bits (784),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 194/458 (42%), Positives = 269/458 (59%), Gaps = 21/458 (5%)
 Frame = -3

Query  1484  KGDKEGFER---SWYASVVM---EVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCP  1323
             KGD+   +R   ++YA+ V+    V     + V+Y+ +  ++GT ++ E VD S +RP P
Sbjct  70    KGDRVEVKRPNGAYYAATVLRFPSVTRKNTVFVEYEVI--NEGTKHVKEYVDLSNLRPLP  127

Query  1322  P-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCF---GSMNELLTFEASDLR  1155
             P E +R   F   D VDA   NGW +G V  +L ++KY+V F   G   E    E  +LR
Sbjct  128   PCEPNRC--FVPGDSVDAHWENGWRKGVVKDILENSKYVVGFDGNGEKEEESEIEQCNLR  185

Query  1154  PHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEE  975
              H+EW + +WV     +L +SS +     + VKVK    ++A   K  K   VE T  EE
Sbjct  186   LHREWDDGSWVPPF-TELTQSSKEKDDKFRRVKVKIVFGKRAADAKLRKDDEVEVTREEE  244

Query  974   GYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKM  795
             G+ GSW++AVI + I  +K+L+E  TLRT+D   P +E+A+A +IRPCPP +     F +
Sbjct  245   GFRGSWFSAVIVEYIRNDKYLVECTTLRTED-GMPFREEANACHIRPCPPELSPIASFHL  303

Query  794   FEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFR  615
              E VDAWYN+GWW G+IS VL G  Y VYF  TNEE+EF H  +R HQ+WI+ KW IA  
Sbjct  304   REVVDAWYNDGWWVGVISGVLAGPKYAVYFSQTNEELEFDHSYLRIHQDWINGKWTIASE  363

Query  614   KSNNNLPNPKPGIMRRHSGGIASE---TTFCIGAKVEVKDDEEGNQGSWYPALILRLIGN  444
             +++  L      ++  H   +  +     F  G KVEVK DE G +GSW+ A+I+  +GN
Sbjct  364   ETSRQLLTNSNKLL--HKMAVKEKRLKAKFPKGMKVEVKSDEYGFEGSWFSAVIVDSLGN  421

Query  443   GKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQV  264
              KYLVE+  LK +    LL +EA A  +RP  P  +    ++ LE VDAW N+GW +GQ+
Sbjct  422   DKYLVEYLMLKTEDQEALLREEAYASYIRPHPPHAEHAYPYQLLENVDAWYNDGWWIGQI  481

Query  263   CEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              +V  G +Y V FRTTNE LEF H  LR HQEWING W
Sbjct  482   VKVFTGWRYTVYFRTTNEELEFEHGDLRPHQEWINGKW  519



>ref|XP_007035880.1| Agenet domain-containing protein, putative isoform 6 [Theobroma 
cacao]
 gb|EOY06806.1| Agenet domain-containing protein, putative isoform 6 [Theobroma 
cacao]
Length=540

 Score =   360 bits (924),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 215/481 (45%), Positives = 290/481 (60%), Gaps = 23/481 (5%)
 Frame = -3

Query  2051  EAQFNKGDRVEVLMRDNFPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMKRRKE  1875
             + Q +KGDRVEV  R N   ++ A VLR PSV    R   ++VE+E +   ++  K  KE
Sbjct  65    QGQISKGDRVEV-KRPN-GAYYAATVLRFPSV---TRKNTVFVEYEVI---NEGTKHVKE  116

Query  1874  YVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVAL-GDEDAVE  1698
             YV LS +RP PP EP   F  G+S D  +EN GWR+G V +ILENS Y+V   G+ +  E
Sbjct  117   YVDLSNLRPLPPCEPNRCFVPGDSVDAHWEN-GWRKGVVKDILENSKYVVGFDGNGEKEE  175

Query  1697  SVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCV  1518
               ++EQ  LR+HR+W DG WVPP  E     Q  ++K + F      VK++I   + +  
Sbjct  176   ESEIEQCNLRLHREWDDGSWVPPFTELT---QSSKEKDDKF----RRVKVKIVFGKRAAD  228

Query  1517  RKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASC  1338
              K  K+  VEV  ++EGF  SW+++V++E + N K LV+   L+T+DG  +  EE +A  
Sbjct  229   AKLRKDDEVEVTREEEGFRGSWFSAVIVEYIRNDKYLVECTTLRTEDGMPFR-EEANACH  287

Query  1337  IRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDL  1158
             IRPCPPE+  I+ F L + VDAW  +GWW G +S VL   KY V F   NE L F+ S L
Sbjct  288   IRPCPPELSPIASFHLREVVDAWYNDGWWVGVISGVLAGPKYAVYFSQTNEELEFDHSYL  347

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFE  978
             R HQ+W N  W  A++     +S  ++ NS  +  K     K L  KF KGM VE  S E
Sbjct  348   RIHQDWINGKWTIASE----ETSRQLLTNSNKLLHKMAVKEKRLKAKFPKGMKVEVKSDE  403

Query  977   EGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFK  798
              G+ GSW++AVI DS+G +K+L+EY  L+T+D+   L+E+A A  IRP PP       ++
Sbjct  404   YGFEGSWFSAVIVDSLGNDKYLVEYLMLKTEDQEALLREEAYASYIRPHPPHAEHAYPYQ  463

Query  797   MFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAF  618
             + E VDAWYN+GWW G I KV  G  Y VYF TTNEE+EF H  +RPHQEWI+ KW IA 
Sbjct  464   LLENVDAWYNDGWWIGQIVKVFTGWRYTVYFRTTNEELEFEHGDLRPHQEWINGKWVIAS  523

Query  617   R  615
             R
Sbjct  524   R  524


 Score =   306 bits (784),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 194/458 (42%), Positives = 269/458 (59%), Gaps = 21/458 (5%)
 Frame = -3

Query  1484  KGDKEGFER---SWYASVVM---EVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCP  1323
             KGD+   +R   ++YA+ V+    V     + V+Y+ +  ++GT ++ E VD S +RP P
Sbjct  70    KGDRVEVKRPNGAYYAATVLRFPSVTRKNTVFVEYEVI--NEGTKHVKEYVDLSNLRPLP  127

Query  1322  P-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCF---GSMNELLTFEASDLR  1155
             P E +R   F   D VDA   NGW +G V  +L ++KY+V F   G   E    E  +LR
Sbjct  128   PCEPNRC--FVPGDSVDAHWENGWRKGVVKDILENSKYVVGFDGNGEKEEESEIEQCNLR  185

Query  1154  PHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEE  975
              H+EW + +WV     +L +SS +     + VKVK    ++A   K  K   VE T  EE
Sbjct  186   LHREWDDGSWVPPF-TELTQSSKEKDDKFRRVKVKIVFGKRAADAKLRKDDEVEVTREEE  244

Query  974   GYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKM  795
             G+ GSW++AVI + I  +K+L+E  TLRT+D   P +E+A+A +IRPCPP +     F +
Sbjct  245   GFRGSWFSAVIVEYIRNDKYLVECTTLRTED-GMPFREEANACHIRPCPPELSPIASFHL  303

Query  794   FEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFR  615
              E VDAWYN+GWW G+IS VL G  Y VYF  TNEE+EF H  +R HQ+WI+ KW IA  
Sbjct  304   REVVDAWYNDGWWVGVISGVLAGPKYAVYFSQTNEELEFDHSYLRIHQDWINGKWTIASE  363

Query  614   KSNNNLPNPKPGIMRRHSGGIASE---TTFCIGAKVEVKDDEEGNQGSWYPALILRLIGN  444
             +++  L      ++  H   +  +     F  G KVEVK DE G +GSW+ A+I+  +GN
Sbjct  364   ETSRQLLTNSNKLL--HKMAVKEKRLKAKFPKGMKVEVKSDEYGFEGSWFSAVIVDSLGN  421

Query  443   GKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQV  264
              KYLVE+  LK +    LL +EA A  +RP  P  +    ++ LE VDAW N+GW +GQ+
Sbjct  422   DKYLVEYLMLKTEDQEALLREEAYASYIRPHPPHAEHAYPYQLLENVDAWYNDGWWIGQI  481

Query  263   CEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              +V  G +Y V FRTTNE LEF H  LR HQEWING W
Sbjct  482   VKVFTGWRYTVYFRTTNEELEFEHGDLRPHQEWINGKW  519


 Score =   183 bits (465),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 116/323 (36%), Positives = 163/323 (50%), Gaps = 25/323 (8%)
 Frame = -3

Query  2057  SAEAQFNKGDRVEVLMRDN--FPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDD-PMK  1887
             +A+A+  K D VEV   +      WF A ++     +  R  +  VE  TL ++D  P +
Sbjct  226   AADAKLRKDDEVEVTREEEGFRGSWFSAVIV-----EYIRNDKYLVECTTLRTEDGMPFR  280

Query  1886  RRKEYVHLSAVRPAPPG-EPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDE  1710
                   H   +RP PP   P   F + E  D +Y N GW  G +  +L    Y V     
Sbjct  281   EEANACH---IRPCPPELSPIASFHLREVVDAWY-NDGWWVGVISGVLAGPKYAVYFSQT  336

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTR  1530
             +  E ++ +   LR+H+DW +G W    EE+          S   L   + +  ++    
Sbjct  337   N--EELEFDHSYLRIHQDWINGKWTIASEET----------SRQLLTNSNKLLHKMAVKE  384

Query  1529  GSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEV  1350
                  KF K M VEVK D+ GFE SW+++V+++ LGN K LV+Y  LKT+D    L EE 
Sbjct  385   KRLKAKFPKGMKVEVKSDEYGFEGSWFSAVIVDSLGNDKYLVEYLMLKTEDQEALLREEA  444

Query  1349  DASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFE  1170
              AS IRP PP      P++LL+ VDAW  +GWW G + KV    +Y V F + NE L FE
Sbjct  445   YASYIRPHPPHAEHAYPYQLLENVDAWYNDGWWIGQIVKVFTGWRYTVYFRTTNEELEFE  504

Query  1169  ASDLRPHQEWKNNNWVAATKIDL  1101
               DLRPHQEW N  WV A+++ L
Sbjct  505   HGDLRPHQEWINGKWVIASRVRL  527



>ref|XP_007035878.1| Agenet domain-containing protein, putative isoform 4 [Theobroma 
cacao]
 gb|EOY06804.1| Agenet domain-containing protein, putative isoform 4 [Theobroma 
cacao]
Length=535

 Score =   359 bits (922),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 215/481 (45%), Positives = 290/481 (60%), Gaps = 23/481 (5%)
 Frame = -3

Query  2051  EAQFNKGDRVEVLMRDNFPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMKRRKE  1875
             + Q +KGDRVEV  R N   ++ A VLR PSV    R   ++VE+E +   ++  K  KE
Sbjct  65    QGQISKGDRVEV-KRPN-GAYYAATVLRFPSV---TRKNTVFVEYEVI---NEGTKHVKE  116

Query  1874  YVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVAL-GDEDAVE  1698
             YV LS +RP PP EP   F  G+S D  +EN GWR+G V +ILENS Y+V   G+ +  E
Sbjct  117   YVDLSNLRPLPPCEPNRCFVPGDSVDAHWEN-GWRKGVVKDILENSKYVVGFDGNGEKEE  175

Query  1697  SVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCV  1518
               ++EQ  LR+HR+W DG WVPP  E     Q  ++K + F      VK++I   + +  
Sbjct  176   ESEIEQCNLRLHREWDDGSWVPPFTELT---QSSKEKDDKF----RRVKVKIVFGKRAAD  228

Query  1517  RKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASC  1338
              K  K+  VEV  ++EGF  SW+++V++E + N K LV+   L+T+DG  +  EE +A  
Sbjct  229   AKLRKDDEVEVTREEEGFRGSWFSAVIVEYIRNDKYLVECTTLRTEDGMPFR-EEANACH  287

Query  1337  IRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDL  1158
             IRPCPPE+  I+ F L + VDAW  +GWW G +S VL   KY V F   NE L F+ S L
Sbjct  288   IRPCPPELSPIASFHLREVVDAWYNDGWWVGVISGVLAGPKYAVYFSQTNEELEFDHSYL  347

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFE  978
             R HQ+W N  W  A++     +S  ++ NS  +  K     K L  KF KGM VE  S E
Sbjct  348   RIHQDWINGKWTIASE----ETSRQLLTNSNKLLHKMAVKEKRLKAKFPKGMKVEVKSDE  403

Query  977   EGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFK  798
              G+ GSW++AVI DS+G +K+L+EY  L+T+D+   L+E+A A  IRP PP       ++
Sbjct  404   YGFEGSWFSAVIVDSLGNDKYLVEYLMLKTEDQEALLREEAYASYIRPHPPHAEHAYPYQ  463

Query  797   MFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAF  618
             + E VDAWYN+GWW G I KV  G  Y VYF TTNEE+EF H  +RPHQEWI+ KW IA 
Sbjct  464   LLENVDAWYNDGWWIGQIVKVFTGWRYTVYFRTTNEELEFEHGDLRPHQEWINGKWVIAS  523

Query  617   R  615
             R
Sbjct  524   R  524


 Score =   306 bits (783),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 194/458 (42%), Positives = 269/458 (59%), Gaps = 21/458 (5%)
 Frame = -3

Query  1484  KGDKEGFER---SWYASVVM---EVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCP  1323
             KGD+   +R   ++YA+ V+    V     + V+Y+ +  ++GT ++ E VD S +RP P
Sbjct  70    KGDRVEVKRPNGAYYAATVLRFPSVTRKNTVFVEYEVI--NEGTKHVKEYVDLSNLRPLP  127

Query  1322  P-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCF---GSMNELLTFEASDLR  1155
             P E +R   F   D VDA   NGW +G V  +L ++KY+V F   G   E    E  +LR
Sbjct  128   PCEPNRC--FVPGDSVDAHWENGWRKGVVKDILENSKYVVGFDGNGEKEEESEIEQCNLR  185

Query  1154  PHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEE  975
              H+EW + +WV     +L +SS +     + VKVK    ++A   K  K   VE T  EE
Sbjct  186   LHREWDDGSWVPPF-TELTQSSKEKDDKFRRVKVKIVFGKRAADAKLRKDDEVEVTREEE  244

Query  974   GYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKM  795
             G+ GSW++AVI + I  +K+L+E  TLRT+D   P +E+A+A +IRPCPP +     F +
Sbjct  245   GFRGSWFSAVIVEYIRNDKYLVECTTLRTED-GMPFREEANACHIRPCPPELSPIASFHL  303

Query  794   FEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFR  615
              E VDAWYN+GWW G+IS VL G  Y VYF  TNEE+EF H  +R HQ+WI+ KW IA  
Sbjct  304   REVVDAWYNDGWWVGVISGVLAGPKYAVYFSQTNEELEFDHSYLRIHQDWINGKWTIASE  363

Query  614   KSNNNLPNPKPGIMRRHSGGIASE---TTFCIGAKVEVKDDEEGNQGSWYPALILRLIGN  444
             +++  L      ++  H   +  +     F  G KVEVK DE G +GSW+ A+I+  +GN
Sbjct  364   ETSRQLLTNSNKLL--HKMAVKEKRLKAKFPKGMKVEVKSDEYGFEGSWFSAVIVDSLGN  421

Query  443   GKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQV  264
              KYLVE+  LK +    LL +EA A  +RP  P  +    ++ LE VDAW N+GW +GQ+
Sbjct  422   DKYLVEYLMLKTEDQEALLREEAYASYIRPHPPHAEHAYPYQLLENVDAWYNDGWWIGQI  481

Query  263   CEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              +V  G +Y V FRTTNE LEF H  LR HQEWING W
Sbjct  482   VKVFTGWRYTVYFRTTNEELEFEHGDLRPHQEWINGKW  519



>gb|KHG07312.1| Adenine deaminase [Gossypium arboreum]
Length=470

 Score =   340 bits (871),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 201/481 (42%), Positives = 285/481 (59%), Gaps = 27/481 (6%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDNFPIWFPAAVLRP--SVRKNQRAGQIYVEFETLCSDDDPMKRR  1881
             ++   +KGD++EV  R N   ++ A VLRP  ++RKN     ++VE+      +D  K  
Sbjct  7     SQGPLSKGDQIEV-KRPN-GAYYAATVLRPPSAMRKNM----VFVEYHA----EDGSKCV  56

Query  1880  KEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVAL-GDEDA  1704
             + YV L+ VRP+PP E    FR+G++ + ++EN GW +G V ++L++S Y+V   G+E  
Sbjct  57    RGYVDLTHVRPSPPLELNRRFRIGDAVEAYWEN-GWHQGVVRDLLKDSKYVVGFNGNEGK  115

Query  1703  VE-SVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRG  1527
             VE   ++ Q  LR+HR+W DG WVP + E          K       P  VKL+I   + 
Sbjct  116   VEEKSEIHQCNLRLHREWDDGSWVPSMAELANSSNENDDK-------PRNVKLKIVFRKK  168

Query  1526  SCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVD  1347
                 +F K   VE+  D+EGF+ SWY +V++E  GN K LV+Y   + +DG   L  E  
Sbjct  169   QADAEFQKGDEVEITSDEEGFKGSWYNAVIVEYRGNDKYLVEYSTSRKEDGVP-LRAEAK  227

Query  1346  ASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEA  1167
             A  IRPCPPE+  ++ F L + VDAW  +GWW G +S+VL  +KY V F   +E L F+ 
Sbjct  228   AQHIRPCPPELLPVASFCLREVVDAWYNDGWWIGVISRVLDGSKYAVYFSLPDEELEFDH  287

Query  1166  SDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEAT  987
             S LR HQ+WKN  W+ A++     +S  +++NS  +  K   D K    KF KGM VE  
Sbjct  288   SKLRIHQDWKNGKWIIASE----ENSRHLVMNSNRLLHKMDVDEKRFWVKFPKGMRVEVK  343

Query  986   SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFD  807
             S E GY GSWY+A+I DS+G +K+L+EY TL+T+D    L+E+A A  IRP P       
Sbjct  344   SDEPGYEGSWYSAIIVDSLGNDKYLVEYLTLKTEDLGAYLREEAYASYIRPRPQHARCTR  403

Query  806   RFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWD  627
              +K+FE VDAWYN+GWW G + KVL    Y VYF TTNE +EF H+ +R HQEWI+ KW 
Sbjct  404   HYKLFENVDAWYNDGWWIGQVIKVLATWKYAVYFQTTNEVMEFEHNDLRLHQEWINGKWI  463

Query  626   I  624
             +
Sbjct  464   V  464


 Score =   304 bits (779),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 186/457 (41%), Positives = 270/457 (59%), Gaps = 19/457 (4%)
 Frame = -3

Query  1484  KGDKEGFER---SWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPP-E  1317
             KGD+   +R   ++YA+ V+      +  + + +   +DG+  +   VD + +RP PP E
Sbjct  13    KGDQIEVKRPNGAYYAATVLRPPSAMRKNMVFVEYHAEDGSKCVRGYVDLTHVRPSPPLE  72

Query  1316  IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCF----GSMNELLTFEASDLRPH  1149
             ++R   F++ D V+A+  NGW +G V  +L D+KY+V F    G + E       +LR H
Sbjct  73    LNR--RFRIGDAVEAYWENGWHQGVVRDLLKDSKYVVGFNGNEGKVEEKSEIHQCNLRLH  130

Query  1148  QEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGY  969
             +EW + +WV +   +L  SS++     + VK+K    +K    +F KG  VE TS EEG+
Sbjct  131   REWDDGSWVPSMA-ELANSSNENDDKPRNVKLKIVFRKKQADAEFQKGDEVEITSDEEGF  189

Query  968   HGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFE  789
              GSWY AVI +  G +K+L+EY T R +D   PL+ +A A +IRPCPP +     F + E
Sbjct  190   KGSWYNAVIVEYRGNDKYLVEYSTSRKED-GVPLRAEAKAQHIRPCPPELLPVASFCLRE  248

Query  788   EVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKS  609
              VDAWYN+GWW G+IS+VLDG  Y VYF   +EE+EF H  +R HQ+W + KW IA  ++
Sbjct  249   VVDAWYNDGWWIGVISRVLDGSKYAVYFSLPDEELEFDHSKLRIHQDWKNGKWIIASEEN  308

Query  608   NNNLPNPKPGIMRRHSGGIASETTFCI----GAKVEVKDDEEGNQGSWYPALILRLIGNG  441
             + +L      ++ +       E  F +    G +VEVK DE G +GSWY A+I+  +GN 
Sbjct  309   SRHLVMNSNRLLHKMD---VDEKRFWVKFPKGMRVEVKSDEPGYEGSWYSAIIVDSLGND  365

Query  440   KYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVC  261
             KYLVE+ TLK +     L +EA A  +RP     +    ++  E VDAW N+GW +GQV 
Sbjct  366   KYLVEYLTLKTEDLGAYLREEAYASYIRPRPQHARCTRHYKLFENVDAWYNDGWWIGQVI  425

Query  260   EVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +VL   KY V F+TTNE++EF H+ LRLHQEWING W
Sbjct  426   KVLATWKYAVYFQTTNEVMEFEHNDLRLHQEWINGKW  462


 Score =   181 bits (458),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 117/319 (37%), Positives = 169/319 (53%), Gaps = 25/319 (8%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDD-PMKR  1884
             A+A+F KGD VE+    + F   W+ A ++    R N +     VE+ T   +D  P++ 
Sbjct  170   ADAEFQKGDEVEITSDEEGFKGSWYNAVIV--EYRGNDK---YLVEYSTSRKEDGVPLRA  224

Query  1883  RKEYVHLSAVRPAPPGE-PCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDED  1707
               +  H   +RP PP   P   F + E  D +Y N GW  G +  +L+ S Y V     D
Sbjct  225   EAKAQH---IRPCPPELLPVASFCLREVVDAWY-NDGWWIGVISRVLDGSKYAVYFSLPD  280

Query  1706  AVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRG  1527
               E ++ +  +LR+H+DWK+G W+   EE+          S   +M  + +  ++     
Sbjct  281   --EELEFDHSKLRIHQDWKNGKWIIASEEN----------SRHLVMNSNRLLHKMDVDEK  328

Query  1526  SCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVD  1347
                 KF K M VEVK D+ G+E SWY++++++ LGN K LV+Y  LKT+D   YL EE  
Sbjct  329   RFWVKFPKGMRVEVKSDEPGYEGSWYSAIIVDSLGNDKYLVEYLTLKTEDLGAYLREEAY  388

Query  1346  ASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEA  1167
             AS IRP P        +KL + VDAW  +GWW G V KVL   KY V F + NE++ FE 
Sbjct  389   ASYIRPRPQHARCTRHYKLFENVDAWYNDGWWIGQVIKVLATWKYAVYFQTTNEVMEFEH  448

Query  1166  SDLRPHQEWKNNNWVAATK  1110
             +DLR HQEW N  W+  +K
Sbjct  449   NDLRLHQEWINGKWIVPSK  467



>gb|KCW61332.1| hypothetical protein EUGRSUZ_H04076 [Eucalyptus grandis]
Length=400

 Score =   330 bits (847),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 188/409 (46%), Positives = 257/409 (63%), Gaps = 17/409 (4%)
 Frame = -3

Query  1820  FRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWK-DG  1644
             FRVGE  D F E+ GW  G + EI E+S Y+VA+G     E V+  Q +LR HR+W  DG
Sbjct  5     FRVGEEVDAFRED-GWHFGEIREIREDSRYLVAVGG--GSEEVEFGQRELRRHREWSGDG  61

Query  1643  CWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVR--KFSKEMPVEVKGDKE  1470
              W PPL   ++     Q+KS    + P  +K +I   +G+ +   +F K   VEV  D++
Sbjct  62    VWTPPLAGGEL-----QEKSSTMELKPFKIKFKIGLDKGTSLPPPEFGKGKTVEVSSDEK  116

Query  1469  GFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKL  1290
             G+E SW+++ V++ +GN K LV+Y  LKTDD T+ L EE  +  IRP PP +     FK 
Sbjct  117   GYEGSWFSATVIDYIGNDKYLVEYLTLKTDDETEPLREEAYSRYIRPYPPYLP-ARRFKQ  175

Query  1289  LDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             LDKVDAW  +GWW G +SKVL  ++Y+V F + NE L F  S+LR HQ+W +  WV A++
Sbjct  176   LDKVDAWYNDGWWVGVISKVLKGSQYIVYFSTSNEELIFNESNLRLHQDWSDGKWVIASR  235

Query  1109  IDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSI  930
                  +S++V L    ++ K++     +  KFSKGM VE    E+GY   W+ AVI D+I
Sbjct  236   ----DNSTEVALRIASLRGKTEFGDANIKVKFSKGMKVEVRINEDGYMDCWFPAVIIDTI  291

Query  929   GPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEG  750
             G +KFL+EYQTL+TDDE+E LKE A++ +IRP PP I     F   E VDAWYN+GWW G
Sbjct  292   G-DKFLVEYQTLQTDDETELLKEVAESSHIRPFPPDIKCAHTFAQDEMVDAWYNDGWWVG  350

Query  749   LISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNN  603
              IS++L GL Y VYF T++EE+EF HH +RPHQEWI  +W I  R S +
Sbjct  351   HISQILGGLKYKVYFMTSSEELEFEHHNLRPHQEWIGGRWIITSRGSRS  399


 Score =   294 bits (752),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 164/388 (42%), Positives = 241/388 (62%), Gaps = 7/388 (2%)
 Frame = -3

Query  1298  FKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNN-WV  1122
             F++ ++VDA+  +GW  G + ++  D++Y+V  G  +E + F   +LR H+EW  +  W 
Sbjct  5     FRVGEEVDAFREDGWHFGEIREIREDSRYLVAVGGGSEEVEFGQRELRRHREWSGDGVWT  64

Query  1121  AA-TKIDLPRSSSDVMLNskvvkvkskSDRKAL--GPKFSKGMLVEATSFEEGYHGSWYT  951
                   +L   SS + L    +K K   D+      P+F KG  VE +S E+GY GSW++
Sbjct  65    PPLAGGELQEKSSTMELKPFKIKFKIGLDKGTSLPPPEFGKGKTVEVSSDEKGYEGSWFS  124

Query  950   AVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWY  771
             A + D IG +K+L+EY TL+TDDE+EPL+E+A +  IRP PP +    RFK  ++VDAWY
Sbjct  125   ATVIDYIGNDKYLVEYLTLKTDDETEPLREEAYSRYIRPYPPYLPA-RRFKQLDKVDAWY  183

Query  770   NEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPN  591
             N+GWW G+ISKVL G  Y+VYF T+NEE+ F    +R HQ+W D KW IA R ++  +  
Sbjct  184   NDGWWVGVISKVLKGSQYIVYFSTSNEELIFNESNLRLHQDWSDGKWVIASRDNSTEVAL  243

Query  590   PKPGIMRRHSGGIAS-ETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTL  414
                 +  +   G A+ +  F  G KVEV+ +E+G    W+PA+I+  IG+ K+LVE++TL
Sbjct  244   RIASLRGKTEFGDANIKVKFSKGMKVEVRINEDGYMDCWFPAVIIDTIGD-KFLVEYQTL  302

Query  413   KCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYR  234
             + D  T+LL + A++  +RP  P ++    F   E VDAW N+GW VG + ++L G KY+
Sbjct  303   QTDDETELLKEVAESSHIRPFPPDIKCAHTFAQDEMVDAWYNDGWWVGHISQILGGLKYK  362

Query  233   VNFRTTNEILEFRHHGLRLHQEWINGAW  150
             V F T++E LEF HH LR HQEWI G W
Sbjct  363   VYFMTSSEELEFEHHNLRPHQEWIGGRW  390


 Score =   172 bits (436),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 111/321 (35%), Positives = 167/321 (52%), Gaps = 36/321 (11%)
 Frame = -3

Query  2045  QFNKGDRVEVLMRDNF--PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEY  1872
             +F KG  VEV   +      WF A V+      N +     VE+ TL +DD+    R+E 
Sbjct  102   EFGKGKTVEVSSDEKGYEGSWFSATVI--DYIGNDK---YLVEYLTLKTDDETEPLREE-  155

Query  1871  VHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESV  1692
              +   +RP PP  P   F+  +  D +Y N GW  G + ++L+ S Y+V     +  E +
Sbjct  156   AYSRYIRPYPPYLPARRFKQLDKVDAWY-NDGWWVGVISKVLKGSQYIVYFSTSN--EEL  212

Query  1691  KVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRG-----  1527
                +  LR+H+DW DG WV    ++  +                 V LRI   RG     
Sbjct  213   IFNESNLRLHQDWSDGKWVIASRDNSTE-----------------VALRIASLRGKTEFG  255

Query  1526  --SCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEE  1353
               +   KFSK M VEV+ +++G+   W+ +V+++ +G+ K LV+YQ L+TDD T+ L E 
Sbjct  256   DANIKVKFSKGMKVEVRINEDGYMDCWFPAVIIDTIGD-KFLVEYQTLQTDDETELLKEV  314

Query  1352  VDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTF  1173
              ++S IRP PP+I     F   + VDAW  +GWW GH+S++LG  KY V F + +E L F
Sbjct  315   AESSHIRPFPPDIKCAHTFAQDEMVDAWYNDGWWVGHISQILGGLKYKVYFMTSSEELEF  374

Query  1172  EASDLRPHQEWKNNNWVAATK  1110
             E  +LRPHQEW    W+  ++
Sbjct  375   EHHNLRPHQEWIGGRWIITSR  395


 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/229 (39%), Positives = 129/229 (56%), Gaps = 10/229 (4%)
 Frame = -3

Query  809  DRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI-DKK  633
            +RF++ EEVDA+  +GW  G I ++ +   Y+V     +EE+EF    +R H+EW  D  
Sbjct  3    ERFRVGEEVDAFREDGWHFGEIREIREDSRYLVAVGGGSEEVEFGQRELRRHREWSGDGV  62

Query  632  W-------DIAFRKSNNNL-PNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSW  477
            W       ++  + S   L P      +    G       F  G  VEV  DE+G +GSW
Sbjct  63   WTPPLAGGELQEKSSTMELKPFKIKFKIGLDKGTSLPPPEFGKGKTVEVSSDEKGYEGSW  122

Query  476  YPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDA  297
            + A ++  IGN KYLVE+ TLK D  T+ L +EA +  +RP  P L    RF+ L++VDA
Sbjct  123  FSATVIDYIGNDKYLVEYLTLKTDDETEPLREEAYSRYIRPYPPYLP-ARRFKQLDKVDA  181

Query  296  WSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
            W N+GW VG + +VL+G++Y V F T+NE L F    LRLHQ+W +G W
Sbjct  182  WYNDGWWVGVISKVLKGSQYIVYFSTSNEELIFNESNLRLHQDWSDGKW  230


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 82/169 (49%), Gaps = 21/169 (12%)
 Frame = -3

Query  2132  LSLRVSTFLGKLEH*VIDVPETHAMSAEAQFNKGDRVEVLMRDN--FPIWFPAAVLRPSV  1959
             ++LR+++  GK E            + + +F+KG +VEV + ++     WFPA ++    
Sbjct  241   VALRIASLRGKTEF--------GDANIKVKFSKGMKVEVRINEDGYMDCWFPAVII----  288

Query  1958  RKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCY-FRVGESADVFYEN  1782
               +    +  VE++TL +DD+  +  KE    S +RP PP   C + F   E  D +Y N
Sbjct  289   --DTIGDKFLVEYQTLQTDDE-TELLKEVAESSHIRPFPPDIKCAHTFAQDEMVDAWY-N  344

Query  1781  RGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWV  1635
              GW  G + +IL    Y V      + E ++ E   LR H++W  G W+
Sbjct  345   DGWWVGHISQILGGLKYKVYF--MTSSEELEFEHHNLRPHQEWIGGRWI  391



>ref|XP_010524742.1| PREDICTED: uncharacterized protein LOC104802712 [Tarenaya hassleriana]
Length=491

 Score =   330 bits (846),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 189/487 (39%), Positives = 276/487 (57%), Gaps = 24/487 (5%)
 Frame = -3

Query  2048  AQFNKGDRVEV-LMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEY  1872
              +F  GDRVE+         +FPA V+R  +   Q    I +EFE +C  D    R  EY
Sbjct  3     TRFANGDRVELERAVAGLAAYFPATVVRGQLGNKQ---AILIEFEFVCVGDSVHMR--EY  57

Query  1871  VHLSAVRPAPPGEPCCYFRVGESADVFYENRG-WRRGTVDEILENSMYMVALGDEDA-VE  1698
             V  + +RPAPP E   +F+ GE  D F +  G W +G V+EI E S Y+V  G  D    
Sbjct  58    VEPTRLRPAPPRELNRWFKAGEEVDAFKDGEGCWIKGNVEEIREGSRYLVGFGGSDGDRR  117

Query  1697  SVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCV  1518
              ++++ + +R+HR+W D  WVPP         +Q + +    + P  +KL IK + G   
Sbjct  118   EIEIDHFNMRLHREWDDSAWVPPF--------FQLENAVRAEVKPKRIKLIIKFSGGEDA  169

Query  1517  RK-FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEV-DA  1344
             ++ + K   VEV+ D++G++ SWY++++   LG+ K +V+Y  L+ DD     + E+ + 
Sbjct  170   QECYKKGAIVEVRSDEDGYKDSWYSALIFNCLGSEKYIVEYLTLRRDDDQSVPLREIMEG  229

Query  1343  SCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEAS  1164
               IRP PP +  I  FK  DKVDAW   GWW G VS+VL  +KY+V F   NE      S
Sbjct  230   QFIRPRPPPVSPIVRFKTGDKVDAWYNEGWWVGTVSRVLSGSKYIVYFSPTNEEQVCLHS  289

Query  1163  DLRPHQEWKNNNWVAATKI----DLPRSSSDVMLNskvvkvkskSDRKALGP--KFSKGM  1002
             +LR HQ+W N  WV  +K+    ++       +        K +S   A  P  KFSKGM
Sbjct  290   NLRLHQDWINGEWVIPSKVHKDSNIELKCCKRIQKKPGSGEKPRSGEHADKPDTKFSKGM  349

Query  1001  LVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPL  822
              VE  S E+GY GSW++A I   +  +++ +EY TL+T+D++E L+E+A   +IRP PP 
Sbjct  350   KVEVRSDEQGYEGSWFSATILTYLDKDRYTVEYHTLKTEDQTEFLREEAKTSDIRPLPPA  409

Query  821   IHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
             I R  +++  E VDAW+NEGWW G I K   G+ Y+VYF T+NEE+EF H  +RPHQEWI
Sbjct  410   IQRVYQYEPLEFVDAWFNEGWWTGQILKACSGMKYIVYFTTSNEELEFGHVDLRPHQEWI  469

Query  641   DKKWDIA  621
             +++W  A
Sbjct  470   NEEWVAA  476


 Score =   281 bits (719),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 180/474 (38%), Positives = 268/474 (57%), Gaps = 23/474 (5%)
 Frame = -3

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK-LLVQYQDLKTDDGTDYLIEEVDASC  1338
             +F+    VE++    G    + A+VV   LGN + +L++++ +   D   ++ E V+ + 
Sbjct  4     RFANGDRVELERAVAGLAAYFPATVVRGQLGNKQAILIEFEFVCVGDSV-HMREYVEPTR  62

Query  1337  IRPCPP-EIHRISPFKLLDKVDAWV-GNGWW-EGHVSKVLGDAKYMVCFGSMN---ELLT  1176
             +RP PP E++R   FK  ++VDA+  G G W +G+V ++   ++Y+V FG  +     + 
Sbjct  63    LRPAPPRELNRW--FKAGEEVDAFKDGEGCWIKGNVEEIREGSRYLVGFGGSDGDRREIE  120

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
              +  ++R H+EW ++ WV      L  +    +   ++  +   S  +     + KG +V
Sbjct  121   IDHFNMRLHREWDDSAWVPPF-FQLENAVRAEVKPKRIKLIIKFSGGEDAQECYKKGAIV  179

Query  995   EATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDD-ESEPLKEKADAFNIRPCPPLI  819
             E  S E+GY  SWY+A+IF+ +G  K+++EY TLR DD +S PL+E  +   IRP PP +
Sbjct  180   EVRSDEDGYKDSWYSALIFNCLGSEKYIVEYLTLRRDDDQSVPLREIMEGQFIRPRPPPV  239

Query  818   HRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWID  639
                 RFK  ++VDAWYNEGWW G +S+VL G  Y+VYF  TNEE    H  +R HQ+WI+
Sbjct  240   SPIVRFKTGDKVDAWYNEGWWVGTVSRVLSGSKYIVYFSPTNEEQVCLHSNLRLHQDWIN  299

Query  638   KKWDI---AFRKSNNNLP-----NPKPGIMRRHSGGIASE---TTFCIGAKVEVKDDEEG  492
              +W I     + SN  L        KPG   +   G  ++   T F  G KVEV+ DE+G
Sbjct  300   GEWVIPSKVHKDSNIELKCCKRIQKKPGSGEKPRSGEHADKPDTKFSKGMKVEVRSDEQG  359

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPL  312
              +GSW+ A IL  +   +Y VE+ TLK +  T+ L +EA    +RP  P +QRV ++ PL
Sbjct  360   YEGSWFSATILTYLDKDRYTVEYHTLKTEDQTEFLREEAKTSDIRPLPPAIQRVYQYEPL  419

Query  311   EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             E VDAW N GW  GQ+ +   G KY V F T+NE LEF H  LR HQEWIN  W
Sbjct  420   EFVDAWFNEGWWTGQILKACSGMKYIVYFTTSNEELEFGHVDLRPHQEWINEEW  473


 Score =   179 bits (453),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 148/275 (54%), Gaps = 6/275 (2%)
 Frame = -3

Query  1928  VEFETLCSDDDPMKRRKEYVHLSAVRPAPPG-EPCCYFRVGESADVFYENRGWRRGTVDE  1752
             VE+ TL  DDD     +E +    +RP PP   P   F+ G+  D +Y N GW  GTV  
Sbjct  208   VEYLTLRRDDDQSVPLREIMEGQFIRPRPPPVSPIVRFKTGDKVDAWY-NEGWWVGTVSR  266

Query  1751  ILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFL  1572
             +L  S Y+V     +  E V +    LR+H+DW +G WV P  +   D   + K  +   
Sbjct  267   VLSGSKYIVYFSPTNE-EQVCLHS-NLRLHQDWINGEWVIP-SKVHKDSNIELKCCKRIQ  323

Query  1571  MTP-SGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQ  1395
               P SG K R          KFSK M VEV+ D++G+E SW+++ ++  L   +  V+Y 
Sbjct  324   KKPGSGEKPRSGEHADKPDTKFSKGMKVEVRSDEQGYEGSWFSATILTYLDKDRYTVEYH  383

Query  1394  DLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAK  1215
              LKT+D T++L EE   S IRP PP I R+  ++ L+ VDAW   GWW G + K     K
Sbjct  384   TLKTEDQTEFLREEAKTSDIRPLPPAIQRVYQYEPLEFVDAWFNEGWWTGQILKACSGMK  443

Query  1214  YMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             Y+V F + NE L F   DLRPHQEW N  WVAA++
Sbjct  444   YIVYFTTSNEELEFGHVDLRPHQEWINEEWVAASE  478



>ref|XP_002519274.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF43138.1| RNA binding protein, putative [Ricinus communis]
Length=524

 Score =   325 bits (832),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 205/530 (39%), Positives = 289/530 (55%), Gaps = 69/530 (13%)
 Frame = -3

Query  2048  AQFNKGDRVEVLMRDNFP---IWFPAAVLRPSVRKNQRAGQIYVEFETLC-SDDDPMKRR  1881
               F KGD+VEVL ++N P    ++ A VLR   +      QI ++++TL  ++ D  K  
Sbjct  7     THFKKGDQVEVLKQENGPNTLTYYAATVLRSPAKLKT---QILIKYQTLMNAESDARKPI  63

Query  1880  KEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAV  1701
              E V L+ VRP PP E    F+ G+S DVF +N GW++GTV +ILENS ++V  G +   
Sbjct  64    TELVDLARVRPMPPRELIECFKNGDSVDVFCDN-GWQKGTVKDILENSKFVV--GFDGKS  120

Query  1700  ESVKVEQWQLRVHRDWK--DGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRG  1527
             E +  EQ  LR+HRDW   +  WVPPL E++V      + S+        V+L+IKC+  
Sbjct  121   EGIVAEQRNLRLHRDWDHDESSWVPPLLENKVLPATDTESSK--------VRLKIKCSSR  172

Query  1526  SCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVD  1347
                  F     VEVK D+EG+  +W+ + ++  +GN KLLVQY +L TDD T  L E + 
Sbjct  173   KSEPMFRTGTRVEVKSDEEGYVGAWFDANIIGTIGNDKLLVQYLNLVTDDETAPLREVIS  232

Query  1346  ASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEA  1167
             A   RPCPP I   + FK  +KVD W   GWWEG VS+VL  +KYMV F S NE L F+ 
Sbjct  233   AEHARPCPPPIPSDAGFKEFEKVDVWFNEGWWEGQVSEVLPGSKYMVYFRSTNEELEFDH  292

Query  1166  SDLRPHQEWKNNNW----------------VAATKIDL------PRS--SSDVMLNskvv  1059
             S LR HQ+W +  W                V + +ID       P++  S + M+  K  
Sbjct  293   SSLRHHQKWIDGKWVQRNPKAQFSKESMVAVKSDEIDFQYCKRNPKAQFSKESMVAVKSD  352

Query  1058  kvkskSDRKALGPKF------------------------SKGMLVEATSFEEGYHGSWYT  951
              V  + D++    +F                        SKG +VE  S   G+ G+W+ 
Sbjct  353   DVGFQCDKRTPKAQFSKGTAVKSDEVGFQGDERIPKAEFSKGTMVEVRSNAVGFQGAWFA  412

Query  950   AVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWY  771
             A I + +  +KF ++YQ L TDDE++ L+E+A A +IRP PP I     +++FE VDAWY
Sbjct  413   ATILNVMENDKFEVKYQRLLTDDETDFLREQASASDIRPSPPHIEHDYPYRLFEMVDAWY  472

Query  770   NEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
             N+ WW G I+KV     Y V+F TT EE+EF H+ +RPHQEW++  W  A
Sbjct  473   NDAWWVGRIAKVHTNSKYTVHFKTT-EELEFGHYELRPHQEWVNGYWVTA  521


 Score =   279 bits (714),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 189/517 (37%), Positives = 270/517 (52%), Gaps = 70/517 (14%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFER-SWYASVVMEVLGNGK--LLVQYQDLKT--DDGTDYLIEEVD  1347
             F K   VEV   + G    ++YA+ V+      K  +L++YQ L     D    + E VD
Sbjct  9     FKKGDQVEVLKQENGPNTLTYYAATVLRSPAKLKTQILIKYQTLMNAESDARKPITELVD  68

Query  1346  ASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEA  1167
              + +RP PP    I  FK  D VD +  NGW +G V  +L ++K++V F   +E +  E 
Sbjct  69    LARVRPMPPR-ELIECFKNGDSVDVFCDNGWQKGTVKDILENSKFVVGFDGKSEGIVAEQ  127

Query  1166  SDLRPHQEWKNN--NWVAA---TKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGM  1002
              +LR H++W ++  +WV      K+ LP + ++   +SKV      S RK+  P F  G 
Sbjct  128   RNLRLHRDWDHDESSWVPPLLENKV-LPATDTE---SSKVRLKIKCSSRKS-EPMFRTGT  182

Query  1001  LVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPL  822
              VE  S EEGY G+W+ A I  +IG +K L++Y  L TDDE+ PL+E   A + RPCPP 
Sbjct  183   RVEVKSDEEGYVGAWFDANIIGTIGNDKLLVQYLNLVTDDETAPLREVISAEHARPCPPP  242

Query  821   IHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
             I     FK FE+VD W+NEGWWEG +S+VL G  Y+VYF +TNEE+EF H  +R HQ+WI
Sbjct  243   IPSDAGFKEFEKVDVWFNEGWWEGQVSEVLPGSKYMVYFRSTNEELEFDHSSLRHHQKWI  302

Query  641   DKKW----------------------DIAFRKSNNNLPNPKPGIMR--------------  570
             D KW                      D  + K N      K  ++               
Sbjct  303   DGKWVQRNPKAQFSKESMVAVKSDEIDFQYCKRNPKAQFSKESMVAVKSDDVGFQCDKRT  362

Query  569   ---RHSGGIASET--------------TFCIGAKVEVKDDEEGNQGSWYPALILRLIGNG  441
                + S G A ++               F  G  VEV+ +  G QG+W+ A IL ++ N 
Sbjct  363   PKAQFSKGTAVKSDEVGFQGDERIPKAEFSKGTMVEVRSNAVGFQGAWFAATILNVMEND  422

Query  440   KYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVC  261
             K+ V+++ L  D  TD L ++A A  +RPS P ++    +R  E VDAW N+ W VG++ 
Sbjct  423   KFEVKYQRLLTDDETDFLREQASASDIRPSPPHIEHDYPYRLFEMVDAWYNDAWWVGRIA  482

Query  260   EVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +V   +KY V+F+TT E LEF H+ LR HQEW+NG W
Sbjct  483   KVHTNSKYTVHFKTTEE-LEFGHYELRPHQEWVNGYW  518


 Score =   163 bits (413),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 114/361 (32%), Positives = 172/361 (48%), Gaps = 55/361 (15%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDNFPI--WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRR  1881
             +E  F  G RVEV   +   +  WF A ++           ++ V++  L +DD+    R
Sbjct  174   SEPMFRTGTRVEVKSDEEGYVGAWFDANII-----GTIGNDKLLVQYLNLVTDDETAPLR  228

Query  1880  KEYVHLSAVRPAPPGEPC-CYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDA  1704
              E +     RP PP  P    F+  E  DV++ N GW  G V E+L  S YMV     + 
Sbjct  229   -EVISAEHARPCPPPIPSDAGFKEFEKVDVWF-NEGWWEGQVSEVLPGSKYMVYFRSTN-  285

Query  1703  VESVKVEQWQLRVHRDWKDGCWVP-------------PLEESQVDQQYQQK---------  1590
              E ++ +   LR H+ W DG WV               ++  ++D QY ++         
Sbjct  286   -EELEFDHSSLRHHQKWIDGKWVQRNPKAQFSKESMVAVKSDEIDFQYCKRNPKAQFSKE  344

Query  1589  -----KSEDFLMTPSGVKLRIKCTRGSCVR---------------KFSKEMPVEVKGDKE  1470
                  KS+D          + + ++G+ V+               +FSK   VEV+ +  
Sbjct  345   SMVAVKSDDVGFQCDKRTPKAQFSKGTAVKSDEVGFQGDERIPKAEFSKGTMVEVRSNAV  404

Query  1469  GFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKL  1290
             GF+ +W+A+ ++ V+ N K  V+YQ L TDD TD+L E+  AS IRP PP I    P++L
Sbjct  405   GFQGAWFAATILNVMENDKFEVKYQRLLTDDETDFLREQASASDIRPSPPHIEHDYPYRL  464

Query  1289  LDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
              + VDAW  + WW G ++KV  ++KY V F +  E L F   +LRPHQEW N  WV A  
Sbjct  465   FEMVDAWYNDAWWVGRIAKVHTNSKYTVHFKTTEE-LEFGHYELRPHQEWVNGYWVTAPM  523

Query  1109  I  1107
             +
Sbjct  524   V  524


 Score =   160 bits (404),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 150/303 (50%), Gaps = 11/303 (4%)
 Frame = -3

Query  1028  LGPKFSKGMLVEATSFEEGYHG-SWYTAVIFDSIGP--NKFLLEYQTLRT--DDESEPLK  864
             L   F KG  VE    E G +  ++Y A +  S      + L++YQTL     D  +P+ 
Sbjct  5     LHTHFKKGDQVEVLKQENGPNTLTYYAATVLRSPAKLKTQILIKYQTLMNAESDARKPIT  64

Query  863   EKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEI  684
             E  D   +RP PP     + FK  + VD + + GW +G +  +L+   +VV F   +E I
Sbjct  65    ELVDLARVRPMPPR-ELIECFKNGDSVDVFCDNGWQKGTVKDILENSKFVVGFDGKSEGI  123

Query  683   EFAHHGIRPHQEW-IDKKWDIAFRKSNNNLPNPKPGI----MRRHSGGIASETTFCIGAK  519
                   +R H++W  D+   +     N  LP          ++       SE  F  G +
Sbjct  124   VAEQRNLRLHRDWDHDESSWVPPLLENKVLPATDTESSKVRLKIKCSSRKSEPMFRTGTR  183

Query  518   VEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPIL  339
             VEVK DEEG  G+W+ A I+  IGN K LV++  L  D  T  L +   A   RP  P +
Sbjct  184   VEVKSDEEGYVGAWFDANIIGTIGNDKLLVQYLNLVTDDETAPLREVISAEHARPCPPPI  243

Query  338   QRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWIN  159
                  F+  E+VD W N GW  GQV EVL G+KY V FR+TNE LEF H  LR HQ+WI+
Sbjct  244   PSDAGFKEFEKVDVWFNEGWWEGQVSEVLPGSKYMVYFRSTNEELEFDHSSLRHHQKWID  303

Query  158   GAW  150
             G W
Sbjct  304   GKW  306



>ref|XP_004229100.1| PREDICTED: uncharacterized protein LOC101259666 isoform X1 [Solanum 
lycopersicum]
Length=350

 Score =   315 bits (806),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 230/354 (65%), Gaps = 13/354 (4%)
 Frame = -3

Query  2057  SAEAQFNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRK  1878
             +A+  FNKGD VEVL  + F IW P+ V+R +  K  R GQIYVEF+TL S ++P   R+
Sbjct  5     TAQQCFNKGDDVEVLKTNPFTIWLPSTVIRSTPCKKTRNGQIYVEFQTL-SAEEPSGSRR  63

Query  1877  EYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVE  1698
             EYV+   VRPAPP E   YF+VG++ +V YE +GWR+G V +IL+NSMY V+L   D VE
Sbjct  64    EYVNAGDVRPAPPPELHRYFKVGDNVEVLYEQKGWRKGKVTDILKNSMYFVSL---DGVE  120

Query  1697  S--VKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGS  1524
                VK EQW LRV+R W DG W+PPL+     QQ  QK   +  +   GVKLRI C+R S
Sbjct  121   EEIVKAEQWDLRVYRVWDDGSWLPPLD----FQQMPQKNRPEVELKSRGVKLRIMCSR-S  175

Query  1523  CVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDA  1344
                 FS+ M VEVK D EG   SW+ + ++E +G  K LV+Y+ LKT +GT +L EEVDA
Sbjct  176   WKDVFSEGMSVEVKRDIEGCYGSWHTAAIVESVGYDKFLVEYEKLKTVNGTQFLKEEVDA  235

Query  1343  SCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEAS  1164
             S IRPCPPEI     ++  D+VDAW+ +GWWEGH+++VLG  KY VC  +  +   FE S
Sbjct  236   SYIRPCPPEIRSFHQYEHHDRVDAWLNDGWWEGHITEVLGGLKYTVCLMNTEDEFVFEHS  295

Query  1163  DLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGM  1002
              LRP QEW    W+ A + D  RSSSD+ L SK +K++ K   +   PKFSKGM
Sbjct  296   MLRPRQEWVREKWLTAREFD--RSSSDMTLKSKELKIRIKCSGRTSKPKFSKGM  347


 Score =   179 bits (453),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 108/308 (35%), Positives = 171/308 (56%), Gaps = 9/308 (3%)
 Frame = -3

Query  1421  NGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPP-EIHRISPFKLLDKVDA-WVGNGWWE  1248
             NG++ V++Q L  ++ +    E V+A  +RP PP E+HR   FK+ D V+  +   GW +
Sbjct  43    NGQIYVEFQTLSAEEPSGSRREYVNAGDVRPAPPPELHRY--FKVGDNVEVLYEQKGWRK  100

Query  1247  GHVSKVLGDAKYMVCF-GSMNELLTFEASDLRPHQEWKNNNWVAATKID-LPRSSSDVML  1074
             G V+ +L ++ Y V   G   E++  E  DLR ++ W + +W+       +P+ +   + 
Sbjct  101   GKVTDILKNSMYFVSLDGVEEEIVKAEQWDLRVYRVWDDGSWLPPLDFQQMPQKNRPEVE  160

Query  1073  NskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTL  894
                          ++    FS+GM VE     EG +GSW+TA I +S+G +KFL+EY+ L
Sbjct  161   LKSRGVKLRIMCSRSWKDVFSEGMSVEVKRDIEGCYGSWHTAAIVESVGYDKFLVEYEKL  220

Query  893   RTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYV  714
             +T + ++ LKE+ DA  IRPCPP I  F +++  + VDAW N+GWWEG I++VL GL Y 
Sbjct  221   KTVNGTQFLKEEVDASYIRPCPPEIRSFHQYEHHDRVDAWLNDGWWEGHITEVLGGLKYT  280

Query  713   VYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA--FRKSNNNLP-NPKPGIMRRHSGGIASE  543
             V    T +E  F H  +RP QEW+ +KW  A  F +S++++    K   +R    G  S+
Sbjct  281   VCLMNTEDEFVFEHSMLRPRQEWVREKWLTAREFDRSSSDMTLKSKELKIRIKCSGRTSK  340

Query  542   TTFCIGAK  519
               F  G +
Sbjct  341   PKFSKGMR  348


 Score =   134 bits (337),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 90/266 (34%), Positives = 134/266 (50%), Gaps = 11/266 (4%)
 Frame = -3

Query  920  KFLLEYQTLRTDDESEPLKEKADAFNIRPCPPL-IHRFDRFKMFEEVDAWYNE-GWWEGL  747
            +  +E+QTL  ++ S   +E  +A ++RP PP  +HR+  FK+ + V+  Y + GW +G 
Sbjct  45   QIYVEFQTLSAEEPSGSRREYVNAGDVRPAPPPELHRY--FKVGDNVEVLYEQKGWRKGK  102

Query  746  ISKVLDGLNYVVYFWTTNEEIEFAHH-GIRPHQEWIDKKW--DIAFRK-SNNNLPN---P  588
            ++ +L    Y V      EEI  A    +R ++ W D  W   + F++    N P     
Sbjct  103  VTDILKNSMYFVSLDGVEEEIVKAEQWDLRVYRVWDDGSWLPPLDFQQMPQKNRPEVELK  162

Query  587  KPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKC  408
              G+  R     + +  F  G  VEVK D EG  GSW+ A I+  +G  K+LVE+  LK 
Sbjct  163  SRGVKLRIMCSRSWKDVFSEGMSVEVKRDIEGCYGSWHTAAIVESVGYDKFLVEYEKLKT  222

Query  407  DFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVN  228
              GT  L +E DA  +RP  P ++   ++   + VDAW N+GW  G + EVL G KY V 
Sbjct  223  VNGTQFLKEEVDASYIRPCPPEIRSFHQYEHHDRVDAWLNDGWWEGHITEVLGGLKYTVC  282

Query  227  FRTTNEILEFRHHGLRLHQEWINGAW  150
               T +   F H  LR  QEW+   W
Sbjct  283  LMNTEDEFVFEHSMLRPRQEWVREKW  308



>ref|XP_010024818.1| PREDICTED: uncharacterized protein LOC104415255 isoform X2 [Eucalyptus 
grandis]
Length=455

 Score =   313 bits (801),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 201/495 (41%), Positives = 271/495 (55%), Gaps = 59/495 (12%)
 Frame = -3

Query  2048  AQFNKGDRVEVLMRDNFP----IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRR  1881
             + F K D VE+L   + P      +PA VLR   R  +    I+VE+ TL  D       
Sbjct  6     SSFAKDDAVEILRPGSAPGLRGALYPATVLRSPARAKK---LIFVEYLTLSGDGGGGGPE  62

Query  1880  ------KEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVAL  1719
                   +EYV L+  RP PP      FRVGE  D F E+ GW  G + EI E+S Y+VA+
Sbjct  63    GERPRLREYVDLARARPVPPRVMHERFRVGEEVDAFRED-GWHFGEIREIREDSRYLVAV  121

Query  1718  GDEDAVESVKVEQWQLRVHRDWK-DGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRI  1542
             G     E V+  Q +LR HR+W  DG W PPL   ++     Q+KS    + P  +K +I
Sbjct  122   GG--GSEEVEFGQRELRRHREWSGDGVWTPPLAGGEL-----QEKSSTMELKPFKIKFKI  174

Query  1541  KCTRGSCVR--KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTD  1368
                +G+ +   +F K   VEV  D++                             DD T+
Sbjct  175   GLDKGTSLPPPEFGKGKTVEVSSDEK-----------------------------DDETE  205

Query  1367  YLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMN  1188
              L EE  +  IRP PP +     FK LDKVDAW  +GWW G +SKVL  ++Y+V F + N
Sbjct  206   PLREEAYSRYIRPYPPYLP-ARRFKQLDKVDAWYNDGWWVGVISKVLKGSQYIVYFSTSN  264

Query  1187  ELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSK  1008
             E L F  S+LR HQ+W +  WV A++     +S++V L    ++ K++     +  KFSK
Sbjct  265   EELIFNESNLRLHQDWSDGKWVIASR----DNSTEVALRIASLRGKTEFGDANIKVKFSK  320

Query  1007  GMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCP  828
             GM VE    E+GY   W+ AVI D+IG +KFL+EYQTL+TDDE+E LKE A++ +IRP P
Sbjct  321   GMKVEVRINEDGYMDCWFPAVIIDTIG-DKFLVEYQTLQTDDETELLKEVAESSHIRPFP  379

Query  827   PLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQE  648
             P I     F   E VDAWYN+GWW G IS++L GL Y VYF T++EE+EF HH +RPHQE
Sbjct  380   PDIKCAHTFAQDEMVDAWYNDGWWVGHISQILGGLKYKVYFMTSSEELEFEHHNLRPHQE  439

Query  647   WIDKKWDIAFRKSNN  603
             WI  +W I  R S +
Sbjct  440   WIGGRWIITSRGSRS  454


 Score =   256 bits (653),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 170/470 (36%), Positives = 250/470 (53%), Gaps = 48/470 (10%)
 Frame = -3

Query  1511  FSKEMPVEV--KGDKEGFERSWYASVVMEVLGNGK--LLVQYQDLKTDDGTDY-------  1365
             F+K+  VE+   G   G   + Y + V+      K  + V+Y  L  D G          
Sbjct  8     FAKDDAVEILRPGSAPGLRGALYPATVLRSPARAKKLIFVEYLTLSGDGGGGGPEGERPR  67

Query  1364  LIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNE  1185
             L E VD +  RP PP +     F++ ++VDA+  +GW  G + ++  D++Y+V  G  +E
Sbjct  68    LREYVDLARARPVPPRVMH-ERFRVGEEVDAFREDGWHFGEIREIREDSRYLVAVGGGSE  126

Query  1184  LLTFEASDLRPHQEWKNNN-WVAA-TKIDLPRSSSDVMLNskvvkvkskSDRKAL--GPK  1017
              + F   +LR H+EW  +  W       +L   SS + L    +K K   D+      P+
Sbjct  127   EVEFGQRELRRHREWSGDGVWTPPLAGGELQEKSSTMELKPFKIKFKIGLDKGTSLPPPE  186

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             F KG  VE +S E+                             DDE+EPL+E+A +  IR
Sbjct  187   FGKGKTVEVSSDEK-----------------------------DDETEPLREEAYSRYIR  217

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             P PP +    RFK  ++VDAWYN+GWW G+ISKVL G  Y+VYF T+NEE+ F    +R 
Sbjct  218   PYPPYLPA-RRFKQLDKVDAWYNDGWWVGVISKVLKGSQYIVYFSTSNEELIFNESNLRL  276

Query  656   HQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIAS-ETTFCIGAKVEVKDDEEGNQGS  480
             HQ+W D KW IA R ++  +      +  +   G A+ +  F  G KVEV+ +E+G    
Sbjct  277   HQDWSDGKWVIASRDNSTEVALRIASLRGKTEFGDANIKVKFSKGMKVEVRINEDGYMDC  336

Query  479   WYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVD  300
             W+PA+I+  IG+ K+LVE++TL+ D  T+LL + A++  +RP  P ++    F   E VD
Sbjct  337   WFPAVIIDTIGD-KFLVEYQTLQTDDETELLKEVAESSHIRPFPPDIKCAHTFAQDEMVD  395

Query  299   AWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             AW N+GW VG + ++L G KY+V F T++E LEF HH LR HQEWI G W
Sbjct  396   AWYNDGWWVGHISQILGGLKYKVYFMTSSEELEFEHHNLRPHQEWIGGRW  445



>ref|XP_010319219.1| PREDICTED: uncharacterized protein LOC101259666 isoform X2 [Solanum 
lycopersicum]
Length=339

 Score =   300 bits (769),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 169/354 (48%), Positives = 220/354 (62%), Gaps = 24/354 (7%)
 Frame = -3

Query  2057  SAEAQFNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRK  1878
             +A+  FNKGD VEVL  + F IW P+ V+R +  K  R GQIYVEF+TL S ++P   R+
Sbjct  5     TAQQCFNKGDDVEVLKTNPFTIWLPSTVIRSTPCKKTRNGQIYVEFQTL-SAEEPSGSRR  63

Query  1877  EYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVE  1698
             EYV+   VRPAPP E   YF+VG++ +V YE +GWR+G V +IL+NSMY V+L   D VE
Sbjct  64    EYVNAGDVRPAPPPELHRYFKVGDNVEVLYEQKGWRKGKVTDILKNSMYFVSL---DGVE  120

Query  1697  S--VKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGS  1524
                VK EQW LRV+R W DG W+PPL+     QQ  QK   +  +   GVKLRI C+R S
Sbjct  121   EEIVKAEQWDLRVYRVWDDGSWLPPLD----FQQMPQKNRPEVELKSRGVKLRIMCSR-S  175

Query  1523  CVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDA  1344
                 FS+ M VEVK D EG   SW+ + ++E +G  K LV+Y+ LKT +GT +L EEVDA
Sbjct  176   WKDVFSEGMSVEVKRDIEGCYGSWHTAAIVESVGYDKFLVEYEKLKTVNGTQFLKEEVDA  235

Query  1343  SCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEAS  1164
             S IRPCPPEI     ++  D+VDAW+ +GWWEGH+++VLG  KY VC  +  +   FE S
Sbjct  236   SYIRPCPPEIRSFHQYEHHDRVDAWLNDGWWEGHITEVLGGLKYTVCLMNTEDEFVFEHS  295

Query  1163  DLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGM  1002
              LRP QEW    W+ A      R S ++ +  K          +   PKFSKGM
Sbjct  296   MLRPRQEWVREKWLTA------RESKELKIRIKCSG-------RTSKPKFSKGM  336


 Score =   176 bits (447),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/271 (37%), Positives = 155/271 (57%), Gaps = 6/271 (2%)
 Frame = -3

Query  1421  NGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPP-EIHRISPFKLLDKVDA-WVGNGWWE  1248
             NG++ V++Q L  ++ +    E V+A  +RP PP E+HR   FK+ D V+  +   GW +
Sbjct  43    NGQIYVEFQTLSAEEPSGSRREYVNAGDVRPAPPPELHRY--FKVGDNVEVLYEQKGWRK  100

Query  1247  GHVSKVLGDAKYMVCF-GSMNELLTFEASDLRPHQEWKNNNWVAATKID-LPRSSSDVML  1074
             G V+ +L ++ Y V   G   E++  E  DLR ++ W + +W+       +P+ +   + 
Sbjct  101   GKVTDILKNSMYFVSLDGVEEEIVKAEQWDLRVYRVWDDGSWLPPLDFQQMPQKNRPEVE  160

Query  1073  NskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTL  894
                          ++    FS+GM VE     EG +GSW+TA I +S+G +KFL+EY+ L
Sbjct  161   LKSRGVKLRIMCSRSWKDVFSEGMSVEVKRDIEGCYGSWHTAAIVESVGYDKFLVEYEKL  220

Query  893   RTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYV  714
             +T + ++ LKE+ DA  IRPCPP I  F +++  + VDAW N+GWWEG I++VL GL Y 
Sbjct  221   KTVNGTQFLKEEVDASYIRPCPPEIRSFHQYEHHDRVDAWLNDGWWEGHITEVLGGLKYT  280

Query  713   VYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
             V    T +E  F H  +RP QEW+ +KW  A
Sbjct  281   VCLMNTEDEFVFEHSMLRPRQEWVREKWLTA  311


 Score =   134 bits (337),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 90/266 (34%), Positives = 134/266 (50%), Gaps = 11/266 (4%)
 Frame = -3

Query  920  KFLLEYQTLRTDDESEPLKEKADAFNIRPCPPL-IHRFDRFKMFEEVDAWYNE-GWWEGL  747
            +  +E+QTL  ++ S   +E  +A ++RP PP  +HR+  FK+ + V+  Y + GW +G 
Sbjct  45   QIYVEFQTLSAEEPSGSRREYVNAGDVRPAPPPELHRY--FKVGDNVEVLYEQKGWRKGK  102

Query  746  ISKVLDGLNYVVYFWTTNEEIEFAHH-GIRPHQEWIDKKW--DIAFRK-SNNNLPN---P  588
            ++ +L    Y V      EEI  A    +R ++ W D  W   + F++    N P     
Sbjct  103  VTDILKNSMYFVSLDGVEEEIVKAEQWDLRVYRVWDDGSWLPPLDFQQMPQKNRPEVELK  162

Query  587  KPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKC  408
              G+  R     + +  F  G  VEVK D EG  GSW+ A I+  +G  K+LVE+  LK 
Sbjct  163  SRGVKLRIMCSRSWKDVFSEGMSVEVKRDIEGCYGSWHTAAIVESVGYDKFLVEYEKLKT  222

Query  407  DFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVN  228
              GT  L +E DA  +RP  P ++   ++   + VDAW N+GW  G + EVL G KY V 
Sbjct  223  VNGTQFLKEEVDASYIRPCPPEIRSFHQYEHHDRVDAWLNDGWWEGHITEVLGGLKYTVC  282

Query  227  FRTTNEILEFRHHGLRLHQEWINGAW  150
               T +   F H  LR  QEW+   W
Sbjct  283  LMNTEDEFVFEHSMLRPRQEWVREKW  308



>ref|XP_010319222.1| PREDICTED: uncharacterized protein LOC101259364 [Solanum lycopersicum]
Length=230

 Score =   289 bits (740),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 165/216 (76%), Gaps = 1/216 (0%)
 Frame = -3

Query  797  MFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAF  618
            M EEVDAWYNEGWW GLI K+LDGL Y+VYFWTTNEE+ F H  +RPHQEWID KW IAF
Sbjct  1    MVEEVDAWYNEGWWVGLICKILDGLKYMVYFWTTNEELVFDHFTLRPHQEWIDGKWVIAF  60

Query  617  RKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGK  438
             K +     PK  + RR  GG+AS T FC+GAKVEV+ DEEG QGSWYPA I+R +GN K
Sbjct  61   MKKSKLQLKPKLNLKRR-KGGVASHTNFCVGAKVEVRSDEEGYQGSWYPATIVRPLGNRK  119

Query  437  YLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCE  258
            YL++++TL+ D  TDLL +E DAL +RPS P++Q+ D+FRPL+EVDAW N GW  GQVC+
Sbjct  120  YLLQYQTLETDDETDLLTEEVDALFIRPSPPVIQQADQFRPLDEVDAWHNGGWWAGQVCK  179

Query  257  VLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
            VL G+ Y V FRTTNEILEF+H  LR  Q W++G W
Sbjct  180  VLIGSNYMVYFRTTNEILEFQHSDLRPRQNWLDGEW  215


 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/236 (45%), Positives = 136/236 (58%), Gaps = 26/236 (11%)
 Frame = -3

Query  1292  LLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAA-  1116
             ++++VDAW   GWW G + K+L   KYMV F + NE L F+   LRPHQEW +  WV A 
Sbjct  1     MVEEVDAWYNEGWWVGLICKILDGLKYMVYFWTTNEELVFDHFTLRPHQEWIDGKWVIAF  60

Query  1115  ---------TKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHG  963
                       K++L R    V                A    F  G  VE  S EEGY G
Sbjct  61    MKKSKLQLKPKLNLKRRKGGV----------------ASHTNFCVGAKVEVRSDEEGYQG  104

Query  962   SWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEV  783
             SWY A I   +G  K+LL+YQTL TDDE++ L E+ DA  IRP PP+I + D+F+  +EV
Sbjct  105   SWYPATIVRPLGNRKYLLQYQTLETDDETDLLTEEVDALFIRPSPPVIQQADQFRPLDEV  164

Query  782   DAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFR  615
             DAW+N GWW G + KVL G NY+VYF TTNE +EF H  +RP Q W+D +W  A R
Sbjct  165   DAWHNGGWWAGQVCKVLIGSNYMVYFRTTNEILEFQHSDLRPRQNWLDGEWIAAKR  220


 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/235 (42%), Positives = 131/235 (56%), Gaps = 19/235 (8%)
 Frame = -3

Query  1808  ESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPP  1629
             E  D +Y N GW  G + +IL+   YMV     +  E +  + + LR H++W DG WV  
Sbjct  3     EEVDAWY-NEGWWVGLICKILDGLKYMVYFWTTN--EELVFDHFTLRPHQEWIDGKWVIA  59

Query  1628  LEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVR--KFSKEMPVEVKGDKEGFERS  1455
                         KKS+   + P   KL +K  +G       F     VEV+ D+EG++ S
Sbjct  60    F----------MKKSK-LQLKP---KLNLKRRKGGVASHTNFCVGAKVEVRSDEEGYQGS  105

Query  1454  WYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVD  1275
             WY + ++  LGN K L+QYQ L+TDD TD L EEVDA  IRP PP I +   F+ LD+VD
Sbjct  106   WYPATIVRPLGNRKYLLQYQTLETDDETDLLTEEVDALFIRPSPPVIQQADQFRPLDEVD  165

Query  1274  AWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             AW   GWW G V KVL  + YMV F + NE+L F+ SDLRP Q W +  W+AA +
Sbjct  166   AWHNGGWWAGQVCKVLIGSNYMVYFRTTNEILEFQHSDLRPRQNWLDGEWIAAKR  220



>ref|XP_010671798.1| PREDICTED: uncharacterized protein LOC104888492 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=499

 Score =   282 bits (721),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 166/431 (39%), Positives = 235/431 (55%), Gaps = 35/431 (8%)
 Frame = -3

Query  1874  YVHLSAVRPAPPGEPCC---YFRVGESADVFYENRGWRRGTVDEIL-ENSMYMVALGDED  1707
             +V    +RP PP         F + E  DV  +   W +GT+  IL E   Y+V +   D
Sbjct  82    FVDSGDIRPVPPENDVTDGRKFEIHEKVDVLRDG-CWMKGTILGILYEGLKYLVEIDGGD  140

Query  1706  AVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSG----------  1557
              V  ++V +  LRVHRDW DG W PP +  Q   +   K  ++ +  P            
Sbjct  141   DV-PIEVGRSCLRVHRDWCDGFWNPPFDYVQ---RNSVKMEQNAICKPETITEVRTHANS  196

Query  1556  --VKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKT  1383
               VKLR K        KFS +  VEVK D++G++ SWY ++V+   G GK LV+YQ LKT
Sbjct  197   RKVKLRFKGAERLLKAKFSPKTAVEVKSDQDGYQGSWYTAIVVGSAGVGKFLVEYQTLKT  256

Query  1382  DDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVC  1203
             DD  + L E  +   IRPCPPEI R   +   ++VDAW  +GWWEG + +VL D KY+V 
Sbjct  257   DDEMELLKEVANEQDIRPCPPEIPRHHRYTAHEEVDAWYNDGWWEGVIYEVLDDWKYIVF  316

Query  1202  FGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALG  1023
             F S +E L ++  +LRPHQ W +  WV A    LP S +++            +  +AL 
Sbjct  317   FASTSEKLVYQHPNLRPHQNWVDGKWVLA----LPNSINEMNF----------ASEEALR  362

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFN  843
               F +GML+E  + + G   SWYTA I   +   KFL+EY +L+T+DE   L+ +  A +
Sbjct  363   ENFREGMLIEVRNDDAGDTCSWYTATIIGFVEKKKFLVEYDSLKTNDEKHTLRREVSAID  422

Query  842   IRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGI  663
             +RP PP    F R+K  EEVDAW + GWW G +S+VL+   Y+V F +  ++ E+ H  +
Sbjct  423   VRPLPPCNLHFGRYKCSEEVDAWRDGGWWVGAVSEVLNRNKYIVQFSSAGDKWEYDHMSL  482

Query  662   RPHQEWIDKKW  630
             RPHQ+WID KW
Sbjct  483   RPHQDWIDGKW  493


 Score =   273 bits (699),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 168/440 (38%), Positives = 242/440 (55%), Gaps = 33/440 (8%)
 Frame = -3

Query  1412  LLVQYQDLKTDDGTDYLIEEVDASCIRPCPPE--IHRISPFKLLDKVDAWVGNGWWEGHV  1239
              +VQYQ    D     ++  VD+  IRP PPE  +     F++ +KVD      W +G +
Sbjct  68    FMVQYQTHLND-----IVYFVDSGDIRPVPPENDVTDGRKFEIHEKVDVLRDGCWMKGTI  122

Query  1238  SKVLGDA-KYMVCFGSMNEL-LTFEASDLRPHQEWKNNNW-------------VAATKID  1104
               +L +  KY+V     +++ +    S LR H++W +  W             +    I 
Sbjct  123   LGILYEGLKYLVEIDGGDDVPIEVGRSCLRVHRDWCDGFWNPPFDYVQRNSVKMEQNAIC  182

Query  1103  LPRSSSDVML--NskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSI  930
              P + ++V    NS+ VK++ K   + L  KFS    VE  S ++GY GSWYTA++  S 
Sbjct  183   KPETITEVRTHANSRKVKLRFKGAERLLKAKFSPKTAVEVKSDQDGYQGSWYTAIVVGSA  242

Query  929   GPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEG  750
             G  KFL+EYQTL+TDDE E LKE A+  +IRPCPP I R  R+   EEVDAWYN+GWWEG
Sbjct  243   GVGKFLVEYQTLKTDDEMELLKEVANEQDIRPCPPEIPRHHRYTAHEEVDAWYNDGWWEG  302

Query  749   LISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMR  570
             +I +VLD   Y+V+F +T+E++ + H  +RPHQ W+D KW +A   S N +       +R
Sbjct  303   VIYEVLDDWKYIVFFASTSEKLVYQHPNLRPHQNWVDGKWVLALPNSINEMNFASEEALR  362

Query  569   RHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDL  390
              +         F  G  +EV++D+ G+  SWY A I+  +   K+LVE+ +LK +     
Sbjct  363   EN---------FREGMLIEVRNDDAGDTCSWYTATIIGFVEKKKFLVEYDSLKTNDEKHT  413

Query  389   LVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNE  210
             L +E  A+ VRP  P      R++  EEVDAW + GW VG V EVL   KY V F +  +
Sbjct  414   LRREVSAIDVRPLPPCNLHFGRYKCSEEVDAWRDGGWWVGAVSEVLNRNKYIVQFSSAGD  473

Query  209   ILEFRHHGLRLHQEWINGAW  150
               E+ H  LR HQ+WI+G W
Sbjct  474   KWEYDHMSLRPHQDWIDGKW  493


 Score =   137 bits (345),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 93/296 (31%), Positives = 142/296 (48%), Gaps = 30/296 (10%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCY-FR  1815
             W+ A V+  +       G+  VE++TL +DD+ M+  KE  +   +RP PP  P  + + 
Sbjct  233   WYTAIVVGSA-----GVGKFLVEYQTLKTDDE-MELLKEVANEQDIRPCPPEIPRHHRYT  286

Query  1814  VGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWV  1635
               E  D +Y N GW  G + E+L++  Y+V        E +  +   LR H++W DG WV
Sbjct  287   AHEEVDAWY-NDGWWEGVIYEVLDDWKYIVFFAS--TSEKLVYQHPNLRPHQNWVDGKWV  343

Query  1634  PPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERS  1455
               L  S  +  +  +++           LR           F + M +EV+ D  G   S
Sbjct  344   LALPNSINEMNFASEEA-----------LR---------ENFREGMLIEVRNDDAGDTCS  383

Query  1454  WYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVD  1275
             WY + ++  +   K LV+Y  LKT+D    L  EV A  +RP PP       +K  ++VD
Sbjct  384   WYTATIIGFVEKKKFLVEYDSLKTNDEKHTLRREVSAIDVRPLPPCNLHFGRYKCSEEVD  443

Query  1274  AWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKI  1107
             AW   GWW G VS+VL   KY+V F S  +   ++   LRPHQ+W +  W+    I
Sbjct  444   AWRDGGWWVGAVSEVLNRNKYIVQFSSAGDKWEYDHMSLRPHQDWIDGKWITHEVI  499



>ref|XP_004486526.1| PREDICTED: uncharacterized protein LOC101492247 isoform X2 [Cicer 
arietinum]
Length=438

 Score =   276 bits (707),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 163/388 (42%), Positives = 220/388 (57%), Gaps = 35/388 (9%)
 Frame = -3

Query  1700  ESVKVEQWQLRVHRD-WKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRG-  1527
             +SV V+    R+H D   D  WVPPL      QQ Q+K  E     P  +K+RIK   G 
Sbjct  55    DSVTVDPCGFRLHHDSINDVDWVPPLR-----QQLQEKPLE-IEQKPKKLKIRIKKYTGK  108

Query  1526  -SCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEV  1350
              +   KF K   VEV  D+EG++ +W+ + +++ L   K LV+Y+DL  DDGT  L EE+
Sbjct  109   PNIESKFKKGEKVEVSSDEEGYKGAWFVASIVDTLEKDKFLVEYRDLMNDDGTQLLKEEI  168

Query  1349  DASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFE  1170
             DA  IRPCPP++     +K L +VDAW  +GWW+G V  +L   +  V F   NE+L FE
Sbjct  169   DAMFIRPCPPQLQNFGCYKRLQEVDAWYNDGWWKGMVVGLLNGKECFVRF-MYNEVLKFE  227

Query  1169  ASDLRPHQEWKNNNWVAATK--IDLPRSSSDV-----------------------MLNsk  1065
              S LRPHQ+     WV ++    +L +   DV                           K
Sbjct  228   YSKLRPHQDLFEGKWVISSNKSSELVKKFGDVKPKVKNLAGTKLISKCQIPNEQYAKQHK  287

Query  1064  vvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTD  885
              V  ++ ++R      F KG  VE  S EEGY GSW+TA + D +   K+L+EY +L+TD
Sbjct  288   DVTTRTINNRSKFVLHFYKGAKVEVRSDEEGYEGSWFTATVVDFLQNGKYLVEYLSLKTD  347

Query  884   DESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYF  705
             D +E L+E+AD  ++RP PP I+RF RF   E VDAWYN+GWW G +S VLDG  Y VYF
Sbjct  348   DLTEQLREEADGEDLRPYPPDINRFRRFVAGERVDAWYNDGWWVGQVSCVLDGFKYRVYF  407

Query  704   WTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
             WT+NEE+EF H  +RPHQEWI  +W +A
Sbjct  408   WTSNEELEFEHCHMRPHQEWIGGRWMLA  435


 Score =   250 bits (638),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 140/320 (44%), Positives = 190/320 (59%), Gaps = 31/320 (10%)
 Frame = -3

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNI  840
             KF KG  VE +S EEGY G+W+ A I D++  +KFL+EY+ L  DD ++ LKE+ DA  I
Sbjct  114   KFKKGEKVEVSSDEEGYKGAWFVASIVDTLEKDKFLVEYRDLMNDDGTQLLKEEIDAMFI  173

Query  839   RPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIR  660
             RPCPP +  F  +K  +EVDAWYN+GWW+G++  +L+G    V F   NE ++F +  +R
Sbjct  174   RPCPPQLQNFGCYKRLQEVDAWYNDGWWKGMVVGLLNGKECFVRF-MYNEVLKFEYSKLR  232

Query  659   PHQEWIDKKWDIAFRKSN-------------NNLPN---------PKPGIMRRH----SG  558
             PHQ+  + KW I+  KS+              NL           P     ++H    + 
Sbjct  233   PHQDLFEGKWVISSNKSSELVKKFGDVKPKVKNLAGTKLISKCQIPNEQYAKQHKDVTTR  292

Query  557   GIASETTFCI----GAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDL  390
              I + + F +    GAKVEV+ DEEG +GSW+ A ++  + NGKYLVE+ +LK D  T+ 
Sbjct  293   TINNRSKFVLHFYKGAKVEVRSDEEGYEGSWFTATVVDFLQNGKYLVEYLSLKTDDLTEQ  352

Query  389   LVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNE  210
             L +EAD   +RP  P + R  RF   E VDAW N+GW VGQV  VL+G KYRV F T+NE
Sbjct  353   LREEADGEDLRPYPPDINRFRRFVAGERVDAWYNDGWWVGQVSCVLDGFKYRVYFWTSNE  412

Query  209   ILEFRHHGLRLHQEWINGAW  150
              LEF H  +R HQEWI G W
Sbjct  413   ELEFEHCHMRPHQEWIGGRW  432


 Score =   160 bits (405),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 123/365 (34%), Positives = 180/365 (49%), Gaps = 51/365 (14%)
 Frame = -3

Query  2132  LSLRVSTFLGKLEH*VIDVPETHAMSAEAQFNKGDRVEVLMRDNF--PIWFPAAVLRPSV  1959
             L +R+  + GK              + E++F KG++VEV   +      WF A+++  ++
Sbjct  98    LKIRIKKYTGK-------------PNIESKFKKGEKVEVSSDEEGYKGAWFVASIV-DTL  143

Query  1958  RKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPG--EPCCYFRVGESADVFYE  1785
              K++      VE+  L +DD   +  KE +    +RP PP      CY R+ E  D +Y 
Sbjct  144   EKDK----FLVEYRDLMNDDG-TQLLKEEIDAMFIRPCPPQLQNFGCYKRLQE-VDAWY-  196

Query  1784  NRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWV-PPLEESQVD  1608
             N GW +G V  +L      V        E +K E  +LR H+D  +G WV    + S++ 
Sbjct  197   NDGWWKGMVVGLLNGKECFVRFMYN---EVLKFEYSKLRPHQDLFEGKWVISSNKSSELV  253

Query  1607  QQYQQKKSEDFLMTPSGVKLRIKC--------------------TRGSCVRKFSKEMPVE  1488
             +++   K +  +   +G KL  KC                     R   V  F K   VE
Sbjct  254   KKFGDVKPK--VKNLAGTKLISKCQIPNEQYAKQHKDVTTRTINNRSKFVLHFYKGAKVE  311

Query  1487  VKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHR  1308
             V+ D+EG+E SW+ + V++ L NGK LV+Y  LKTDD T+ L EE D   +RP PP+I+R
Sbjct  312   VRSDEEGYEGSWFTATVVDFLQNGKYLVEYLSLKTDDLTEQLREEADGEDLRPYPPDINR  371

Query  1307  ISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNN  1128
                F   ++VDAW  +GWW G VS VL   KY V F + NE L FE   +RPHQEW    
Sbjct  372   FRRFVAGERVDAWYNDGWWVGQVSCVLDGFKYRVYFWTSNEELEFEHCHMRPHQEWIGGR  431

Query  1127  WVAAT  1113
             W+ A+
Sbjct  432   WMLAS  436


 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 101/190 (53%), Gaps = 9/190 (5%)
 Frame = -3

Query  695  NEEIEFAHHGIRPHQEWI-DKKWDIAFRKSNNNLP-----NPKPGIMR--RHSGGIASET  540
            N+ +     G R H + I D  W    R+     P      PK   +R  +++G    E+
Sbjct  54   NDSVTVDPCGFRLHHDSINDVDWVPPLRQQLQEKPLEIEQKPKKLKIRIKKYTGKPNIES  113

Query  539  TFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSV  360
             F  G KVEV  DEEG +G+W+ A I+  +   K+LVE+R L  D GT LL +E DA+ +
Sbjct  114  KFKKGEKVEVSSDEEGYKGAWFVASIVDTLEKDKFLVEYRDLMNDDGTQLLKEEIDAMFI  173

Query  359  RPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLR  180
            RP  P LQ    ++ L+EVDAW N+GW  G V  +L G +  V F   NE+L+F +  LR
Sbjct  174  RPCPPQLQNFGCYKRLQEVDAWYNDGWWKGMVVGLLNGKECFVRF-MYNEVLKFEYSKLR  232

Query  179  LHQEWINGAW  150
             HQ+   G W
Sbjct  233  PHQDLFEGKW  242



>ref|XP_004486525.1| PREDICTED: uncharacterized protein LOC101492247 isoform X1 [Cicer 
arietinum]
Length=439

 Score =   276 bits (705),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 163/389 (42%), Positives = 220/389 (57%), Gaps = 36/389 (9%)
 Frame = -3

Query  1700  ESVKVEQWQLRVHRD-WKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRG-  1527
             +SV V+    R+H D   D  WVPPL      QQ Q+K  E     P  +K+RIK   G 
Sbjct  55    DSVTVDPCGFRLHHDSINDVDWVPPLR-----QQLQEKPLE-IEQKPKKLKIRIKKYTGK  108

Query  1526  -SCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEV  1350
              +   KF K   VEV  D+EG++ +W+ + +++ L   K LV+Y+DL  DDGT  L EE+
Sbjct  109   PNIESKFKKGEKVEVSSDEEGYKGAWFVASIVDTLEKDKFLVEYRDLMNDDGTQLLKEEI  168

Query  1349  DASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFE  1170
             DA  IRPCPP++     +K L +VDAW  +GWW+G V  +L   +  V F   NE+L FE
Sbjct  169   DAMFIRPCPPQLQNFGCYKRLQEVDAWYNDGWWKGMVVGLLNGKECFVRF-MYNEVLKFE  227

Query  1169  ASDLRPHQEWKNNNWVAATK---IDLPRSSSDV-----------------------MLNs  1068
              S LRPHQ+     WV ++     +L +   DV                           
Sbjct  228   YSKLRPHQDLFEGKWVISSNKESSELVKKFGDVKPKVKNLAGTKLISKCQIPNEQYAKQH  287

Query  1067  kvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRT  888
             K V  ++ ++R      F KG  VE  S EEGY GSW+TA + D +   K+L+EY +L+T
Sbjct  288   KDVTTRTINNRSKFVLHFYKGAKVEVRSDEEGYEGSWFTATVVDFLQNGKYLVEYLSLKT  347

Query  887   DDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVY  708
             DD +E L+E+AD  ++RP PP I+RF RF   E VDAWYN+GWW G +S VLDG  Y VY
Sbjct  348   DDLTEQLREEADGEDLRPYPPDINRFRRFVAGERVDAWYNDGWWVGQVSCVLDGFKYRVY  407

Query  707   FWTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
             FWT+NEE+EF H  +RPHQEWI  +W +A
Sbjct  408   FWTSNEELEFEHCHMRPHQEWIGGRWMLA  436


 Score =   249 bits (637),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 138/321 (43%), Positives = 189/321 (59%), Gaps = 32/321 (10%)
 Frame = -3

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNI  840
             KF KG  VE +S EEGY G+W+ A I D++  +KFL+EY+ L  DD ++ LKE+ DA  I
Sbjct  114   KFKKGEKVEVSSDEEGYKGAWFVASIVDTLEKDKFLVEYRDLMNDDGTQLLKEEIDAMFI  173

Query  839   RPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIR  660
             RPCPP +  F  +K  +EVDAWYN+GWW+G++  +L+G    V F   NE ++F +  +R
Sbjct  174   RPCPPQLQNFGCYKRLQEVDAWYNDGWWKGMVVGLLNGKECFVRF-MYNEVLKFEYSKLR  232

Query  659   PHQEWIDKKWDIAFRKSNNNLPN-----------------------PKPGIMRRH----S  561
             PHQ+  + KW I+  K ++ L                         P     ++H    +
Sbjct  233   PHQDLFEGKWVISSNKESSELVKKFGDVKPKVKNLAGTKLISKCQIPNEQYAKQHKDVTT  292

Query  560   GGIASETTFCI----GAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTD  393
               I + + F +    GAKVEV+ DEEG +GSW+ A ++  + NGKYLVE+ +LK D  T+
Sbjct  293   RTINNRSKFVLHFYKGAKVEVRSDEEGYEGSWFTATVVDFLQNGKYLVEYLSLKTDDLTE  352

Query  392   LLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTN  213
              L +EAD   +RP  P + R  RF   E VDAW N+GW VGQV  VL+G KYRV F T+N
Sbjct  353   QLREEADGEDLRPYPPDINRFRRFVAGERVDAWYNDGWWVGQVSCVLDGFKYRVYFWTSN  412

Query  212   EILEFRHHGLRLHQEWINGAW  150
             E LEF H  +R HQEWI G W
Sbjct  413   EELEFEHCHMRPHQEWIGGRW  433


 Score =   161 bits (407),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 124/366 (34%), Positives = 180/366 (49%), Gaps = 52/366 (14%)
 Frame = -3

Query  2132  LSLRVSTFLGKLEH*VIDVPETHAMSAEAQFNKGDRVEVLMRDNF--PIWFPAAVLRPSV  1959
             L +R+  + GK              + E++F KG++VEV   +      WF A+++  ++
Sbjct  98    LKIRIKKYTGK-------------PNIESKFKKGEKVEVSSDEEGYKGAWFVASIV-DTL  143

Query  1958  RKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPG--EPCCYFRVGESADVFYE  1785
              K++      VE+  L +DD   +  KE +    +RP PP      CY R+ E  D +Y 
Sbjct  144   EKDK----FLVEYRDLMNDDG-TQLLKEEIDAMFIRPCPPQLQNFGCYKRLQE-VDAWY-  196

Query  1784  NRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWV--PPLEESQV  1611
             N GW +G V  +L      V        E +K E  +LR H+D  +G WV     E S++
Sbjct  197   NDGWWKGMVVGLLNGKECFVRFMYN---EVLKFEYSKLRPHQDLFEGKWVISSNKESSEL  253

Query  1610  DQQYQQKKSEDFLMTPSGVKLRIKC--------------------TRGSCVRKFSKEMPV  1491
              +++   K +  +   +G KL  KC                     R   V  F K   V
Sbjct  254   VKKFGDVKPK--VKNLAGTKLISKCQIPNEQYAKQHKDVTTRTINNRSKFVLHFYKGAKV  311

Query  1490  EVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIH  1311
             EV+ D+EG+E SW+ + V++ L NGK LV+Y  LKTDD T+ L EE D   +RP PP+I+
Sbjct  312   EVRSDEEGYEGSWFTATVVDFLQNGKYLVEYLSLKTDDLTEQLREEADGEDLRPYPPDIN  371

Query  1310  RISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNN  1131
             R   F   ++VDAW  +GWW G VS VL   KY V F + NE L FE   +RPHQEW   
Sbjct  372   RFRRFVAGERVDAWYNDGWWVGQVSCVLDGFKYRVYFWTSNEELEFEHCHMRPHQEWIGG  431

Query  1130  NWVAAT  1113
              W+ A+
Sbjct  432   RWMLAS  437


 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 101/190 (53%), Gaps = 9/190 (5%)
 Frame = -3

Query  695  NEEIEFAHHGIRPHQEWI-DKKWDIAFRKSNNNLP-----NPKPGIMR--RHSGGIASET  540
            N+ +     G R H + I D  W    R+     P      PK   +R  +++G    E+
Sbjct  54   NDSVTVDPCGFRLHHDSINDVDWVPPLRQQLQEKPLEIEQKPKKLKIRIKKYTGKPNIES  113

Query  539  TFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSV  360
             F  G KVEV  DEEG +G+W+ A I+  +   K+LVE+R L  D GT LL +E DA+ +
Sbjct  114  KFKKGEKVEVSSDEEGYKGAWFVASIVDTLEKDKFLVEYRDLMNDDGTQLLKEEIDAMFI  173

Query  359  RPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLR  180
            RP  P LQ    ++ L+EVDAW N+GW  G V  +L G +  V F   NE+L+F +  LR
Sbjct  174  RPCPPQLQNFGCYKRLQEVDAWYNDGWWKGMVVGLLNGKECFVRF-MYNEVLKFEYSKLR  232

Query  179  LHQEWINGAW  150
             HQ+   G W
Sbjct  233  PHQDLFEGKW  242



>gb|KFK38113.1| hypothetical protein AALP_AA3G071200 [Arabis alpina]
Length=454

 Score =   275 bits (704),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 185/487 (38%), Positives = 270/487 (55%), Gaps = 40/487 (8%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEV-LMRDNFPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             M+ +  +  GDRVEV  +     ++FPA V+  PSVRKN     ++VE E+L        
Sbjct  1     MANDGFWRGGDRVEVERVVSGAVVYFPAIVVNEPSVRKNV----VWVEHESLVVGGSV--  54

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRG-WRRGTVDEILENSMYMVALGDE  1710
             R KEYV  + +RP+ P EP   F+ G+  DVF ++ G W RG V E+  +S Y+V   DE
Sbjct  55    RMKEYVIPTHLRPSSPCEPNRRFKSGDEVDVFRDSEGCWVRGNVTEVRGDSRYIVEFNDE  114

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTR  1530
             +  E+ +V    LR+HRDW+DG W    + S ++Q        D     +  KL+IK  R
Sbjct  115   NRPET-EVGHSNLRLHRDWEDGAW----KASSLEQ------GNDLEPIHNSTKLKIKLRR  163

Query  1529  GSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTD-DGTDYLIEE  1353
                  ++ KE  VEV+ +KE +E SWY + V+ +LG+ K +V +  +  D D +  L + 
Sbjct  164   RE---QYEKEALVEVRSEKEAYEGSWYCARVVSILGDDKYIVVHLRITRDGDESSPLKDL  220

Query  1352  VDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVL-GDAKYMVCFGSMNELLT  1176
             V+A  +R  PP+  ++S  +  D VDAW    WW G+VSKVL G +KY+V   S  E   
Sbjct  221   VEAKNMRLVPPQ--QLSSVEPGDDVDAWFNKRWWIGNVSKVLGGGSKYLVYLISTAEEEI  278

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
                 +LRP ++W N  WV+ +K +        + + +                F KGM+V
Sbjct  279   VPHFNLRPRKDWINGQWVSPSKEECCNPPMKKLKSCETAMKG-----------FHKGMMV  327

Query  995   EATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPP-LI  819
             E  S E GY G+WY+A I   +G N++++EYQTL+TDDE E LKE A   +IRP PP LI
Sbjct  328   EVESDEPGYEGAWYSAKIVRYLGENRYIVEYQTLKTDDEKELLKEVARGSDIRPIPPTLI  387

Query  818   HRFDRFKMFEEVDAWYNEGWWEGLI-SKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
              R  R+++ E+VDAW+N+GWW G +  K  +   Y VYF TTNE +EF ++ +RP Q W 
Sbjct  388   QRVSRYEVNEDVDAWFNDGWWSGRVYQKSNNYTRYGVYFKTTNEALEFEYNDLRPCQVWR  447

Query  641   DKKWDIA  621
               +W  A
Sbjct  448   KGEWTRA  454


 Score =   212 bits (540),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 146/417 (35%), Positives = 227/417 (54%), Gaps = 25/417 (6%)
 Frame = -3

Query  1376  GTDYLIEEVDASCIRPCPP-EIHRISPFKLLDKVDAWVGNG--WWEGHVSKVLGDAKYMV  1206
             G+  + E V  + +RP  P E +R   FK  D+VD +  +   W  G+V++V GD++Y+V
Sbjct  52    GSVRMKEYVIPTHLRPSSPCEPNR--RFKSGDEVDVFRDSEGCWVRGNVTEVRGDSRYIV  109

Query  1205  CFGSMNELLT-FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKA  1029
              F   N   T    S+LR H++W++  W A++   L + +    +++          R+ 
Sbjct  110   EFNDENRPETEVGHSNLRLHRDWEDGAWKASS---LEQGNDLEPIHNSTKLKIKLRRRE-  165

Query  1028  LGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEY-QTLRTDDESEPLKEKAD  852
                ++ K  LVE  S +E Y GSWY A +   +G +K+++ + +  R  DES PLK+  +
Sbjct  166   ---QYEKEALVEVRSEKEAYEGSWYCARVVSILGDDKYIVVHLRITRDGDESSPLKDLVE  222

Query  851   AFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDG-LNYVVYFWTTNEEIEFA  675
             A N+R  PP   +    +  ++VDAW+N+ WW G +SKVL G   Y+VY  +T EE    
Sbjct  223   AKNMRLVPP--QQLSSVEPGDDVDAWFNKRWWIGNVSKVLGGGSKYLVYLISTAEEEIVP  280

Query  674   HHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEE  495
             H  +RP ++WI+ +W    ++   N P      M++      +   F  G  VEV+ DE 
Sbjct  281   HFNLRPRKDWINGQWVSPSKEECCNPP------MKKLKSCETAMKGFHKGMMVEVESDEP  334

Query  494   GNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPIL-QRVDRFR  318
             G +G+WY A I+R +G  +Y+VE++TLK D   +LL + A    +RP  P L QRV R+ 
Sbjct  335   GYEGAWYSAKIVRYLGENRYIVEYQTLKTDDEKELLKEVARGSDIRPIPPTLIQRVSRYE  394

Query  317   PLEEVDAWSNNGWRVGQVCEVLEG-AKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
               E+VDAW N+GW  G+V +      +Y V F+TTNE LEF ++ LR  Q W  G W
Sbjct  395   VNEDVDAWFNDGWWSGRVYQKSNNYTRYGVYFKTTNEALEFEYNDLRPCQVWRKGEW  451



>emb|CDP16821.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   273 bits (697),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 184/449 (41%), Positives = 237/449 (53%), Gaps = 66/449 (15%)
 Frame = -3

Query  2042  FNKGDRVEVLMR------DNFPIWFPAAVLRPSVRK--NQRAGQIYVEFETLCS------  1905
             F+KGDRVEVL R      D   +WFPA VL+PS  +  N+    IYVEF+TL +      
Sbjct  11    FHKGDRVEVLKRDYSYNKDGVFVWFPAIVLQPSSTRSTNRPKNHIYVEFKTLRTIAIAVQ  70

Query  1904  ----------DDDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVD  1755
                       +  P+ R  E+V L  VRPAPP E      +  S ++  EN  WR     
Sbjct  71    DEDKDDDDDHNRTPLPR--EFVDLGDVRPAPPKE------LHRSLEL--EN-SWRPFVGT  119

Query  1754  EIL----ENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKK  1587
             EI     ++  + +      +    +VEQW LRV RDW DG WVP LE         QK 
Sbjct  120   EIARARGKSRFWTLWRPLRKSAIVEEVEQWGLRVVRDWDDGFWVPSLE--------LQKP  171

Query  1586  SEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLL  1407
             S D       VKLR+K  + S   KF K M VEVK D+E                 G   
Sbjct  172   SPDSDTPSQSVKLRMKYHQKSSYPKFHKGMSVEVKSDEEA--------------PGGIPN  217

Query  1406  VQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVL  1227
                  + T+D T +  EE   SCIRPCPPEIH++  F+L  +VD W  +GWW GH+SKV 
Sbjct  218   THDSRVTTEDETQFFKEEAGISCIRPCPPEIHQVEHFELFTQVDVWYNDGWWVGHISKVK  277

Query  1226  GDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvks  1047
                KY V F + NE + FE   LRPHQ+W  + WVAA     P   + + +  + +K+K 
Sbjct  278   DGFKYKVFFENTNEEIDFEHVQLRPHQDWIKDKWVAA-----PNELAKMGIKPRDLKLKI  332

Query  1046  kSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPL  867
             K  R     KF+KGM+VE  S E+GYHGSWYT  I   I  ++FL+EYQTLRTDDESEPL
Sbjct  333   KCSRNIEEEKFNKGMMVEVKSDEQGYHGSWYTTAIACPIADDRFLVEYQTLRTDDESEPL  392

Query  866   KEKADAFNIRPCPPLIHRFDRFKMFEEVD  780
              + A +  IRPCPP I + D +K+ E+VD
Sbjct  393   LDVAKSSYIRPCPPHIQKLDSYKLLEKVD  421


 Score =   188 bits (478),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 126/357 (35%), Positives = 189/357 (53%), Gaps = 27/357 (8%)
 Frame = -3

Query  1358  EEVDASCIRPCPP-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
             E VD   +RP PP E+HR    +L +    +VG       +++  G +++   +  + + 
Sbjct  88    EFVDLGDVRPAPPKELHR--SLELENSWRPFVGT-----EIARARGKSRFWTLWRPLRKS  140

Query  1181  LTFEASD---LRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFS  1011
                E  +   LR  ++W +  WV + ++  P   SD    S+ VK++ K  +K+  PKF 
Sbjct  141   AIVEEVEQWGLRVVRDWDDGFWVPSLELQKPSPDSDT--PSQSVKLRMKYHQKSSYPKFH  198

Query  1010  KGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPC  831
             KGM VE  S EE   G            PN        + T+DE++  KE+A    IRPC
Sbjct  199   KGMSVEVKSDEEAPGGI-----------PN---THDSRVTTEDETQFFKEEAGISCIRPC  244

Query  830   PPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQ  651
             PP IH+ + F++F +VD WYN+GWW G ISKV DG  Y V+F  TNEEI+F H  +RPHQ
Sbjct  245   PPEIHQVEHFELFTQVDVWYNDGWWVGHISKVKDGFKYKVFFENTNEEIDFEHVQLRPHQ  304

Query  650   EWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYP  471
             +WI  KW  A  +       P+   ++        E  F  G  VEVK DE+G  GSWY 
Sbjct  305   DWIKDKWVAAPNELAKMGIKPRDLKLKIKCSRNIEEEKFNKGMMVEVKSDEQGYHGSWYT  364

Query  470   ALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVD  300
               I   I + ++LVE++TL+ D  ++ L+  A +  +RP  P +Q++D ++ LE+VD
Sbjct  365   TAIACPIADDRFLVEYQTLRTDDESEPLLDVAKSSYIRPCPPHIQKLDSYKLLEKVD  421


 Score =   125 bits (315),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/266 (32%), Positives = 133/266 (50%), Gaps = 35/266 (13%)
 Frame = -3

Query  2066  HAMSAEAQFNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             H  S+  +F+KG  VEV   +  P                  G I    ++  + +D  +
Sbjct  189   HQKSSYPKFHKGMSVEVKSDEEAP------------------GGIPNTHDSRVTTEDETQ  230

Query  1886  RRKEYVHLSAVRPAPPG-EPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDE  1710
               KE   +S +RP PP      +F +    DV+Y N GW  G + ++ +   Y V    E
Sbjct  231   FFKEEAGISCIRPCPPEIHQVEHFELFTQVDVWY-NDGWWVGHISKVKDGFKYKVFF--E  287

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVP-PLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCT  1533
             +  E +  E  QLR H+DW    WV  P E +++             + P  +KL+IKC+
Sbjct  288   NTNEEIDFEHVQLRPHQDWIKDKWVAAPNELAKMG------------IKPRDLKLKIKCS  335

Query  1532  RGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEE  1353
             R     KF+K M VEVK D++G+  SWY + +   + + + LV+YQ L+TDD ++ L++ 
Sbjct  336   RNIEEEKFNKGMMVEVKSDEQGYHGSWYTTAIACPIADDRFLVEYQTLRTDDESEPLLDV  395

Query  1352  VDASCIRPCPPEIHRISPFKLLDKVD  1275
               +S IRPCPP I ++  +KLL+KVD
Sbjct  396   AKSSYIRPCPPHIQKLDSYKLLEKVD  421


 Score = 88.2 bits (217),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 88/328 (27%), Positives = 129/328 (39%), Gaps = 66/328 (20%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGS----WYTAVIFDSIGP-------NKFLLEYQTLRT------  888
             F KG  VE    +  Y+      W+ A++             N   +E++TLRT      
Sbjct  11    FHKGDRVEVLKRDYSYNKDGVFVWFPAIVLQPSSTRSTNRPKNHIYVEFKTLRTIAIAVQ  70

Query  887   --------DDESEPL-KEKADAFNIRPCPPL-IHRFDRFKMFEEVDAWYNEGWWEGLISK  738
                     D    PL +E  D  ++RP PP  +HR               E  W   +  
Sbjct  71    DEDKDDDDDHNRTPLPREFVDLGDVRPAPPKELHRSLEL-----------ENSWRPFVGT  119

Query  737   VLDGLNYVVYFWT---------TNEEIEFAHHGIRPHQEWIDKKW--DIAFRKSNNNLPN  591
              +        FWT           EE+E    G+R  ++W D  W   +  +K + +   
Sbjct  120   EIARARGKSRFWTLWRPLRKSAIVEEVE--QWGLRVVRDWDDGFWVPSLELQKPSPDSDT  177

Query  590   PKPGI-MRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTL  414
             P   + +R      +S   F  G  VEVK DEE   G          I N         +
Sbjct  178   PSQSVKLRMKYHQKSSYPKFHKGMSVEVKSDEEAPGG----------IPN----THDSRV  223

Query  413   KCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYR  234
               +  T    +EA    +RP  P + +V+ F    +VD W N+GW VG + +V +G KY+
Sbjct  224   TTEDETQFFKEEAGISCIRPCPPEIHQVEHFELFTQVDVWYNDGWWVGHISKVKDGFKYK  283

Query  233   VNFRTTNEILEFRHHGLRLHQEWINGAW  150
             V F  TNE ++F H  LR HQ+WI   W
Sbjct  284   VFFENTNEEIDFEHVQLRPHQDWIKDKW  311



>ref|XP_008223470.1| PREDICTED: uncharacterized protein LOC103323261 [Prunus mume]
Length=492

 Score =   275 bits (702),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 186/497 (37%), Positives = 265/497 (53%), Gaps = 49/497 (10%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDNFPI--WFPAAVLRPSVRKNQRAGQIYVEFETLCSDD-DPMKR  1884
             ++  FNKGD+VEV    +     ++PA VLRP  +       + V+ +TL + + D  K 
Sbjct  2     SQIPFNKGDQVEVTRPGHGSTGPYYPATVLRPVFKDK---AHMLVQHQTLTNPNADGSKT  58

Query  1883  RKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDA  1704
               E V L   RP PP E   +F+VG+  D  Y ++GW RGTV EILENS Y+VA   ++ 
Sbjct  59    LTEIVELRNARPMPPKELYEFFKVGDDVDA-YRDKGWSRGTVREILENSKYLVAFQGQE-  116

Query  1703  VESVKVEQWQLRVHRD---WKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCT  1533
                 + +Q+ LR+HR      D         S+V+   Q + S    + PS   L     
Sbjct  117   ---FQCQQFNLRLHRLKMLLDDAL-------SKVECPLQHR-SHHLPLPPSSRYLHFIIL  165

Query  1532  RGSCVR---------KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK--LLVQYQDLK  1386
                  R          F+K   VEV     G    +Y + V+  +   K  +LVQ+Q L 
Sbjct  166   FSLPPRVSNFPMSQIPFNKGDQVEVTRPGHGSTGPYYPATVLRPVFKDKAHMLVQHQTLT  225

Query  1385  TD--DGTDYLIEEVDASCIRPCPP-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAK  1215
                 DG+  L E V+    RP PP E++    FK+ D VDA+   GW  G V ++L ++K
Sbjct  226   NPNADGSKTLTEIVELRNARPMPPKELYEF--FKVGDDVDAYRDKGWSRGTVREILENSK  283

Query  1214  YMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKID--LPRSSSDVMLNskvvkvkskS  1041
             Y+V F    +    +  +LR H+EW++++WV   + +   P  S  ++L  K        
Sbjct  284   YLVAF--QGQEFQCQQFNLRLHREWEDDSWVPVFQEEKTSPVKSRKLVLKIKC-------  334

Query  1040  DRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKE  861
               +  G  F  G +VE +S EEGY G+WYTA I D IG +KFL+EY+ L TDD +E L+E
Sbjct  335   SNRTSGASFENGTVVEVSSDEEGYKGAWYTAKIIDHIGSDKFLVEYEHLVTDDGTELLRE  394

Query  860   KADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIE  681
             +  A  IRPCPP +    +FK+ ++VD  YN+GWWEG ISKVL G  YVVYF TTNEE+E
Sbjct  395   ETCASYIRPCPPRLPPVAQFKVLQKVDTLYNDGWWEGTISKVLSGSKYVVYFSTTNEELE  454

Query  680   FAHHGIRPHQEWIDKKW  630
             F H  +RPHQ+WI+ +W
Sbjct  455   FKHSNLRPHQDWINGRW  471


 Score =   233 bits (593),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 126/320 (39%), Positives = 187/320 (58%), Gaps = 22/320 (7%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDNFPI--WFPAAVLRPSVRKNQRAGQIYVEFETLCSDD-DPMKR  1884
             ++  FNKGD+VEV    +     ++PA VLRP  +       + V+ +TL + + D  K 
Sbjct  178   SQIPFNKGDQVEVTRPGHGSTGPYYPATVLRPVFKDK---AHMLVQHQTLTNPNADGSKT  234

Query  1883  RKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDA  1704
               E V L   RP PP E   +F+VG+  D  Y ++GW RGTV EILENS Y+VA   ++ 
Sbjct  235   LTEIVELRNARPMPPKELYEFFKVGDDVDA-YRDKGWSRGTVREILENSKYLVAFQGQE-  292

Query  1703  VESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGS  1524
                 + +Q+ LR+HR+W+D  WVP  +E +      +K           + L+IKC+  +
Sbjct  293   ---FQCQQFNLRLHREWEDDSWVPVFQEEKTSPVKSRK-----------LVLKIKCSNRT  338

Query  1523  CVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDA  1344
                 F     VEV  D+EG++ +WY + +++ +G+ K LV+Y+ L TDDGT+ L EE  A
Sbjct  339   SGASFENGTVVEVSSDEEGYKGAWYTAKIIDHIGSDKFLVEYEHLVTDDGTELLREETCA  398

Query  1343  SCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEAS  1164
             S IRPCPP +  ++ FK+L KVD    +GWWEG +SKVL  +KY+V F + NE L F+ S
Sbjct  399   SYIRPCPPRLPPVAQFKVLQKVDTLYNDGWWEGTISKVLSGSKYVVYFSTTNEELEFKHS  458

Query  1163  DLRPHQEWKNNNWVAATKID  1104
             +LRPHQ+W N  W+    ++
Sbjct  459   NLRPHQDWINGRWIHGYMVN  478


 Score =   221 bits (563),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 160/474 (34%), Positives = 241/474 (51%), Gaps = 28/474 (6%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK--LLVQYQDLKTD--DGTDYLIEEVDA  1344
             F+K   VEV     G    +Y + V+  +   K  +LVQ+Q L     DG+  L E V+ 
Sbjct  6     FNKGDQVEVTRPGHGSTGPYYPATVLRPVFKDKAHMLVQHQTLTNPNADGSKTLTEIVEL  65

Query  1343  SCIRPCPP-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEA  1167
                RP PP E++    FK+ D VDA+   GW  G V ++L ++KY+V F    +    + 
Sbjct  66    RNARPMPPKELYEF--FKVGDDVDAYRDKGWSRGTVREILENSKYLVAF--QGQEFQCQQ  121

Query  1166  SDLRPHQEWKNNNWVAATKID-----------LPRSSSDVMLNskvvkvkskSDRKALGP  1020
              +LR H+  K     A +K++           LP SS  +            S+      
Sbjct  122   FNLRLHR-LKMLLDDALSKVECPLQHRSHHLPLPPSSRYLHFIILFSLPPRVSNFPMSQI  180

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK--FLLEYQTLRTD--DESEPLKEKAD  852
              F+KG  VE T    G  G +Y A +   +  +K   L+++QTL     D S+ L E  +
Sbjct  181   PFNKGDQVEVTRPGHGSTGPYYPATVLRPVFKDKAHMLVQHQTLTNPNADGSKTLTEIVE  240

Query  851   AFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
               N RP PP    ++ FK+ ++VDA+ ++GW  G + ++L+   Y+V F    +E +   
Sbjct  241   LRNARPMPPK-ELYEFFKVGDDVDAYRDKGWSRGTVREILENSKYLVAF--QGQEFQCQQ  297

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
               +R H+EW D  W   F++   +    +  +++       S  +F  G  VEV  DEEG
Sbjct  298   FNLRLHREWEDDSWVPVFQEEKTSPVKSRKLVLKIKCSNRTSGASFENGTVVEVSSDEEG  357

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPL  312
              +G+WY A I+  IG+ K+LVE+  L  D GT+LL +E  A  +RP  P L  V +F+ L
Sbjct  358   YKGAWYTAKIIDHIGSDKFLVEYEHLVTDDGTELLREETCASYIRPCPPRLPPVAQFKVL  417

Query  311   EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             ++VD   N+GW  G + +VL G+KY V F TTNE LEF+H  LR HQ+WING W
Sbjct  418   QKVDTLYNDGWWEGTISKVLSGSKYVVYFSTTNEELEFKHSNLRPHQDWINGRW  471


 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 68/130 (52%), Gaps = 7/130 (5%)
 Frame = -3

Query  548  SETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGK--YLVEFRTLKCDF--GTDLLVQ  381
            S+  F  G +VEV     G+ G +YPA +LR +   K   LV+ +TL      G+  L +
Sbjct  2    SQIPFNKGDQVEVTRPGHGSTGPYYPATVLRPVFKDKAHMLVQHQTLTNPNADGSKTLTE  61

Query  380  EADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILE  201
              +  + RP  P  +  + F+  ++VDA+ + GW  G V E+LE +KY V F+   +  +
Sbjct  62   IVELRNARPMPP-KELYEFFKVGDDVDAYRDKGWSRGTVREILENSKYLVAFQ--GQEFQ  118

Query  200  FRHHGLRLHQ  171
             +   LRLH+
Sbjct  119  CQQFNLRLHR  128



>ref|NP_187304.1| agenet domain-containing protein [Arabidopsis thaliana]
 gb|AAG51333.1|AC020580_13 hypothetical protein; 66083-64412 [Arabidopsis thaliana]
 gb|AEE74406.1| agenet domain-containing protein [Arabidopsis thaliana]
Length=466

 Score =   274 bits (700),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 185/489 (38%), Positives = 274/489 (56%), Gaps = 38/489 (8%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEV-LMRDNFPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             M+++  +  GDRVEV  +      +FPA+V+  PSVRK      ++VE E+L        
Sbjct  1     MTSDRFWRGGDRVEVERLVSGATAYFPASVVSAPSVRKKL----VWVEHESLTVGGSVSV  56

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRG-WRRGTVDEILENSMYMVALGDE  1710
             R KEYV  + +RP+PP E    F+  +  DVF ++ G W RG V  +LE+S Y+V    E
Sbjct  57    RMKEYVTPTRLRPSPPRELNRRFKADDEVDVFRDSEGCWVRGNVTTVLEDSRYIVEFKGE  116

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPPL-EESQVDQQYQQKKSEDFLMTPSGVKLRIKCT  1533
             +  E ++V+Q+ LR+HR+W DG WVP L ++S   +   Q+           +KL+IK  
Sbjct  117   NRPE-IEVDQFNLRLHREWLDGGWVPSLLQQSNFSESTAQR-----------IKLKIKIK  164

Query  1532  RGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDY-LIE  1356
             R     ++ K   VEV+ +++ ++ SWY + ++ +LG+ K +V++     DDG    L +
Sbjct  165   RRD---QYEKGALVEVRSEEKAYKGSWYCARILCLLGDDKYIVEHLKFSRDDGESIPLRD  221

Query  1355  EVDASCIRPCPP-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDA--KYMVCFGSMNE  1185
              V+A  IRP PP E+  +  ++    VDAW    WW   VSKVLG    KY V   S  E
Sbjct  222   VVEAKDIRPVPPSELSPVVCYEPGVIVDAWFNKRWWTSRVSKVLGGGSNKYSVFIISTGE  281

Query  1184  LLTFEASDLRPHQEWKNNNWVAATKI--DLPRSSSDVMLNskvvkvkskSDRKALGPKFS  1011
               T    +LRPH++W N  WV  +K+  D+P       L       +++         F+
Sbjct  282   ETTILNFNLRPHKDWINGQWVIPSKVLTDVPEECYKPPLKKLKSCERAEK-------VFN  334

Query  1010  KGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR-P  834
              GM VE  S E GY  SW++A I   +G N++ +EYQTL+TDDE E LKE+A   +IR P
Sbjct  335   NGMEVEVRSDEPGYEASWFSAKIVSYLGENRYTVEYQTLKTDDERELLKEEARGSDIRPP  394

Query  833   CPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDG-LNYVVYFWTTNEEIEFAHHGIRP  657
              PPLI +  R++++E VDAWYNEGWW G + K+ +    Y VYF TT+E +EFA++ +RP
Sbjct  395   PPPLIPKGYRYELYELVDAWYNEGWWSGRVYKINNNKTRYGVYFQTTDESLEFAYNDLRP  454

Query  656   HQEWIDKKW  630
              Q W + KW
Sbjct  455   CQVWRNGKW  463


 Score =   202 bits (514),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 163/464 (35%), Positives = 250/464 (54%), Gaps = 29/464 (6%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLL-VQYQDLKTDDGTDYLIEE-VDASCIRPCPP  1320
             VEV+    G    + ASVV       KL+ V+++ L         ++E V  + +RP PP
Sbjct  13    VEVERLVSGATAYFPASVVSAPSVRKKLVWVEHESLTVGGSVSVRMKEYVTPTRLRPSPP  72

Query  1319  -EIHRISPFKLLDKVDAWVGN--GWWEGHVSKVLGDAKYMVCFGSMNEL-LTFEASDLRP  1152
              E++R   FK  D+VD +  +   W  G+V+ VL D++Y+V F   N   +  +  +LR 
Sbjct  73    RELNR--RFKADDEVDVFRDSEGCWVRGNVTTVLEDSRYIVEFKGENRPEIEVDQFNLRL  130

Query  1151  HQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEG  972
             H+EW +  WV +    L + S+     ++ +K+K K  R+    ++ KG LVE  S E+ 
Sbjct  131   HREWLDGGWVPS----LLQQSNFSESTAQRIKLKIKIKRRD---QYEKGALVEVRSEEKA  183

Query  971   YHGSWYTAVIFDSIGPNKFLLEYQTLRTDD-ESEPLKEKADAFNIRPCPPLIHRFDRFKM  795
             Y GSWY A I   +G +K+++E+     DD ES PL++  +A +IRP PP          
Sbjct  184   YKGSWYCARILCLLGDDKYIVEHLKFSRDDGESIPLRDVVEAKDIRPVPP--SELSPVVC  241

Query  794   FEE---VDAWYNEGWWEGLISKVLDGLN--YVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             +E    VDAW+N+ WW   +SKVL G +  Y V+  +T EE    +  +RPH++WI+ +W
Sbjct  242   YEPGVIVDAWFNKRWWTSRVSKVLGGGSNKYSVFIISTGEETTILNFNLRPHKDWINGQW  301

Query  629   DIAFRKSNNNLPNP--KPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILR  456
              I   K   ++P    KP + +  S   A E  F  G +VEV+ DE G + SW+ A I+ 
Sbjct  302   VIP-SKVLTDVPEECYKPPLKKLKSCERA-EKVFNNGMEVEVRSDEPGYEASWFSAKIVS  359

Query  455   LIGNGKYLVEFRTLKCDFGTDLLVQEADALSVR-PSAPILQRVDRFRPLEEVDAWSNNGW  279
              +G  +Y VE++TLK D   +LL +EA    +R P  P++ +  R+   E VDAW N GW
Sbjct  360   YLGENRYTVEYQTLKTDDERELLKEEARGSDIRPPPPPLIPKGYRYELYELVDAWYNEGW  419

Query  278   RVGQVCEVLEG-AKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
               G+V ++     +Y V F+TT+E LEF ++ LR  Q W NG W
Sbjct  420   WSGRVYKINNNKTRYGVYFQTTDESLEFAYNDLRPCQVWRNGKW  463



>ref|XP_010544152.1| PREDICTED: uncharacterized protein LOC104816857 [Tarenaya hassleriana]
Length=480

 Score =   269 bits (687),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 167/473 (35%), Positives = 262/473 (55%), Gaps = 13/473 (3%)
 Frame = -3

Query  1541  KCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGN---GKLLVQYQDLKTD-DG  1374
             +  R S +++ S    VE+  D+ GF  SWY + V+    +    K  V+Y  L +D +G
Sbjct  7     RTGRSSHLKRGS---AVEISSDEHGFRGSWYPATVVRQFSDKNPAKYQVEYTTLFSDKEG  63

Query  1373  TDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGS  1194
                L E V+   IRP PP   +   F + ++VDA   +GWWEGHV++VLGD ++ V F S
Sbjct  64    KKRLREIVELGQIRPPPPR-EKERDFAVEEEVDAHYNDGWWEGHVTEVLGDGEFNVFFRS  122

Query  1193  MNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSD----RKAL  1026
               E + F   D+R H+EW +  W+   + D      D   + +     SK D    +  +
Sbjct  123   SREQIRFRKDDIRLHREWVDGAWMPPLEEDEEVEEEDDDEDEQEENNLSKIDPDIVKAIV  182

Query  1025  GPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAF  846
               + S+  LVE +S EEG+ GSW+ A + + IG +K+L+EY  LR ++  + LKE+AD  
Sbjct  183   KQELSRDTLVEVSSEEEGFEGSWFVARVVEPIGEDKYLVEYLDLREENGVQLLKEEADIL  242

Query  845   NIRPCPPLIHRFDR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHH  669
             +IRP PP     D+ F++ ++VDA+YN+GWWEG+I+++L    + V+F    E I F   
Sbjct  243   HIRPPPPPSSDGDKDFELGDKVDAFYNDGWWEGIITEILKDGRFGVFFKHPREMIRFGRQ  302

Query  668   GIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGN  489
             G+R H++WI+  W +  +              +  +G       F + + +EV  +EEG 
Sbjct  303   GLRFHKDWINGNWLLPPKGGEKKKAEKVSRNGKVSAGKATGLQEFRVRSVIEVSIEEEGF  362

Query  488   QGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLE  309
             + SW+ A I+   G GKYLVE+  +K +   + L +E D L +R   P    V+ F+  E
Sbjct  363   EDSWFLAKIIEARGKGKYLVEYEKIKAEDCKEPLREEVDVLHMRHQPPETLMVEGFKKFE  422

Query  308   EVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +V+A+ N+GW VG++ +VL  +KY V+F+ T   L+F H  LRLHQEW+NG W
Sbjct  423   KVEAFYNDGWWVGEISKVLTESKYLVHFKNTQASLKFDHSQLRLHQEWVNGRW  475


 Score =   261 bits (668),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 166/456 (36%), Positives = 251/456 (55%), Gaps = 15/456 (3%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCYFRV  1812
             W+PA V+R    KN    +  VE+ TL SD +  KR +E V L  +RP PP E    F V
Sbjct  33    WYPATVVRQFSDKN--PAKYQVEYTTLFSDKEGKKRLREIVELGQIRPPPPREKERDFAV  90

Query  1811  GESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVP  1632
              E  D  Y N GW  G V E+L +  + V      + E ++  +  +R+HR+W DG W+P
Sbjct  91    EEEVDAHY-NDGWWEGHVTEVLGDGEFNVFF--RSSREQIRFRKDDIRLHREWVDGAWMP  147

Query  1631  PLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSW  1452
             PLEE +  ++    + E      S  K+     +    ++ S++  VEV  ++EGFE SW
Sbjct  148   PLEEDEEVEEEDDDEDEQEENNLS--KIDPDIVKAIVKQELSRDTLVEVSSEEEGFEGSW  205

Query  1451  YASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISP-FKLLDKVD  1275
             + + V+E +G  K LV+Y DL+ ++G   L EE D   IRP PP        F+L DKVD
Sbjct  206   FVARVVEPIGEDKYLVEYLDLREENGVQLLKEEADILHIRPPPPPSSDGDKDFELGDKVD  265

Query  1274  AWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPR  1095
             A+  +GWWEG ++++L D ++ V F    E++ F    LR H++W N NW+   K    +
Sbjct  266   AFYNDGWWEGIITEILKDGRFGVFFKHPREMIRFGRQGLRFHKDWINGNWLLPPKGGEKK  325

Query  1094  SSSDVMLNskvvkvkskSDRKALG-PKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK  918
              +  V  N KV         KA G  +F    ++E +  EEG+  SW+ A I ++ G  K
Sbjct  326   KAEKVSRNGKVSAG------KATGLQEFRVRSVIEVSIEEEGFEDSWFLAKIIEARGKGK  379

Query  917   FLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISK  738
             +L+EY+ ++ +D  EPL+E+ D  ++R  PP     + FK FE+V+A+YN+GWW G ISK
Sbjct  380   YLVEYEKIKAEDCKEPLREEVDVLHMRHQPPETLMVEGFKKFEKVEAFYNDGWWVGEISK  439

Query  737   VLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             VL    Y+V+F  T   ++F H  +R HQEW++ +W
Sbjct  440   VLTESKYLVHFKNTQASLKFDHSQLRLHQEWVNGRW  475


 Score =   140 bits (354),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/238 (33%), Positives = 128/238 (54%), Gaps = 16/238 (7%)
 Frame = -3

Query  1820  FRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGC  1641
             F +G+  D FY N GW  G + EIL++  + V    +   E ++  +  LR H+DW +G 
Sbjct  258   FELGDKVDAFY-NDGWWEGIITEILKDGRFGVFF--KHPREMIRFGRQGLRFHKDWINGN  314

Query  1640  WV-PPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGF  1464
             W+ PP    +   +   +              ++   + + +++F     +EV  ++EGF
Sbjct  315   WLLPPKGGEKKKAEKVSRNG------------KVSAGKATGLQEFRVRSVIEVSIEEEGF  362

Query  1463  ERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLD  1284
             E SW+ + ++E  G GK LV+Y+ +K +D  + L EEVD   +R  PPE   +  FK  +
Sbjct  363   EDSWFLAKIIEARGKGKYLVEYEKIKAEDCKEPLREEVDVLHMRHQPPETLMVEGFKKFE  422

Query  1283  KVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             KV+A+  +GWW G +SKVL ++KY+V F +    L F+ S LR HQEW N  W+  ++
Sbjct  423   KVEAFYNDGWWVGEISKVLTESKYLVHFKNTQASLKFDHSQLRLHQEWVNGRWIRPSR  480



>ref|XP_006407936.1| hypothetical protein EUTSA_v10020690mg [Eutrema salsugineum]
 gb|ESQ49389.1| hypothetical protein EUTSA_v10020690mg [Eutrema salsugineum]
Length=460

 Score =   268 bits (685),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 179/488 (37%), Positives = 266/488 (55%), Gaps = 36/488 (7%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEV-LMRDNFPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             M ++  +  GDRVEV  +      +FPA+V+  PS+RK      ++VE E L        
Sbjct  1     MMSDGLWRGGDRVEVERVVSGAAAYFPASVVSAPSLRKKL----VWVEHEALLVGSSV--  54

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRG-WRRGTVDEILENSMYMVALGDE  1710
             R KEYV  + +RP+PP E    F+ G+  D+F ++ G W RG V  IL +S Y+V     
Sbjct  55    RMKEYVIPTRLRPSPPRELNRSFKAGDEVDIFRDSEGCWVRGNVTTILGDSRYIVEFKGG  114

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTR  1530
             +  E+ +V+   LR+HR+W+DG WVP L + Q +      KS         +K++ +  R
Sbjct  115   NRPEA-QVDHLNLRLHREWEDGTWVPSLFQHQGNVLESTTKS-------MKLKIKFRERR  166

Query  1529  GSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTD-DGTDYLIEE  1353
             G    ++ K   VEV+ ++E +  SWY + ++ +LG+ K +V++     D D +  L + 
Sbjct  167   G----QYEKGAIVEVRSEEEAYTGSWYCARILNLLGDDKYIVEHLRFSRDGDESIPLRDL  222

Query  1352  VDASCIRPCPP-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLG-DAKYMVCFGSMNELL  1179
             V+A  IRP PP E+  +  ++  D+VDAW    WW G VSKVL  D+ Y+V F S  E +
Sbjct  223   VEAENIRPVPPSELSPVLRYEPGDEVDAWFNKRWWIGRVSKVLARDSTYLVYFISTGEEV  282

Query  1178  TFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGML  999
             T    +LRP ++W N  W+ + K +         L             K     F+ GM+
Sbjct  283   TVLHFNLRPRKDWINGRWINSYKGEECFKPPWKKLKFC----------KRAEKVFNIGMM  332

Query  998   VEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPP-L  822
             VE  S E GY GSWY+A I   +G N++ +EYQTLRT+D  E LKE+A   +IRP PP L
Sbjct  333   VEVRSDERGYEGSWYSAKIISYLGENRYTVEYQTLRTEDGRELLKEEARGLDIRPNPPQL  392

Query  821   IHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLN-YVVYFWTTNEEIEFAHHGIRPHQEW  645
             I R  R++  ++V+AW+N+GWW G + K+      Y VYF TT+E +EFA+  +RP Q W
Sbjct  393   IQRACRYESLKDVEAWFNDGWWSGRVYKINSNYTRYGVYFKTTDERLEFAYTDLRPCQVW  452

Query  644   IDKKWDIA  621
                KW  A
Sbjct  453   RKGKWSRA  460


 Score =   239 bits (609),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 164/459 (36%), Positives = 256/459 (56%), Gaps = 25/459 (5%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLL-VQYQDLKTDDGTDYLIEEVDASCIRPCPP-  1320
             VEV+    G    + ASVV       KL+ V+++ L        + E V  + +RP PP 
Sbjct  13    VEVERVVSGAAAYFPASVVSAPSLRKKLVWVEHEALLVGSSVR-MKEYVIPTRLRPSPPR  71

Query  1319  EIHRISPFKLLDKVDAWVGN--GWWEGHVSKVLGDAKYMVCF-GSMNELLTFEASDLRPH  1149
             E++R   FK  D+VD +  +   W  G+V+ +LGD++Y+V F G        +  +LR H
Sbjct  72    ELNR--SFKAGDEVDIFRDSEGCWVRGNVTTILGDSRYIVEFKGGNRPEAQVDHLNLRLH  129

Query  1148  QEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGY  969
             +EW++  WV +    L +   +V+ ++          R+  G ++ KG +VE  S EE Y
Sbjct  130   REWEDGTWVPS----LFQHQGNVLESTTKSMKLKIKFRERRG-QYEKGAIVEVRSEEEAY  184

Query  968   HGSWYTAVIFDSIGPNKFLLEYQTLRTD-DESEPLKEKADAFNIRPCPPL-IHRFDRFKM  795
              GSWY A I + +G +K+++E+     D DES PL++  +A NIRP PP  +    R++ 
Sbjct  185   TGSWYCARILNLLGDDKYIVEHLRFSRDGDESIPLRDLVEAENIRPVPPSELSPVLRYEP  244

Query  794   FEEVDAWYNEGWWEGLISKVLD-GLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAF  618
              +EVDAW+N+ WW G +SKVL     Y+VYF +T EE+   H  +RP ++WI+ +W  ++
Sbjct  245   GDEVDAWFNKRWWIGRVSKVLARDSTYLVYFISTGEEVTVLHFNLRPRKDWINGRWINSY  304

Query  617   RKSNNNLPN-PKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNG  441
             +      P   K    +R      +E  F IG  VEV+ DE G +GSWY A I+  +G  
Sbjct  305   KGEECFKPPWKKLKFCKR------AEKVFNIGMMVEVRSDERGYEGSWYSAKIISYLGEN  358

Query  440   KYLVEFRTLKCDFGTDLLVQEADALSVRPSAP-ILQRVDRFRPLEEVDAWSNNGWRVGQV  264
             +Y VE++TL+ + G +LL +EA  L +RP+ P ++QR  R+  L++V+AW N+GW  G+V
Sbjct  359   RYTVEYQTLRTEDGRELLKEEARGLDIRPNPPQLIQRACRYESLKDVEAWFNDGWWSGRV  418

Query  263   CEVLEG-AKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              ++     +Y V F+TT+E LEF +  LR  Q W  G W
Sbjct  419   YKINSNYTRYGVYFKTTDERLEFAYTDLRPCQVWRKGKW  457



>ref|XP_010553710.1| PREDICTED: uncharacterized protein LOC104823716 isoform X1 [Tarenaya 
hassleriana]
Length=483

 Score =   265 bits (678),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 167/456 (37%), Positives = 250/456 (55%), Gaps = 12/456 (3%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGN---GKLLVQYQDLKTDD-GTDYLIEEVDASCIRPC  1326
             VE+  D+ GF  SWY   V+    +    K  V+Y  L  D+ G   L E V+   +RP 
Sbjct  20    VEISSDEHGFRGSWYPGTVVRRSSDKSPAKYQVEYATLFLDNEGKKQLREIVELRQLRPP  79

Query  1325  PPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQ  1146
             P    +   F + ++VDA+  +GWWEG V++ LGD ++ V F S  + + F  +DLR H+
Sbjct  80    P-PPEKGRDFAVGEEVDAYYNDGWWEGVVTEALGDEEFNVFFRSSKDQIRFRKNDLRLHR  138

Query  1145  EWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPK-FSKGMLVEATSFEEGY  969
             EW +  W    + +      +      ++        KA+  + FS   +VE  S EEG+
Sbjct  139   EWVDGAWRPPVEAEEEDEEEEDEEEENILCKVDPEIVKAIAKQEFSNDTVVEVCSGEEGF  198

Query  968   HGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFE  789
              GSW+ A I + IG +K+L+EY+ LR +D  E L+EK D  +IRP PP       F++ +
Sbjct  199   EGSWFVARIVEPIGEDKYLVEYRDLRAEDGVELLREKTDFLHIRPPPPSKEEDKDFELGD  258

Query  788   EVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKS  609
             +VDA+YN+GWWEG+++++L    + V+F  + E I F   G+R H+ WI+  W ++   +
Sbjct  259   KVDAYYNDGWWEGVVTEILPDGRFGVFFKYSRERIRFGRQGLRLHRHWINGNWQLS---T  315

Query  608   NNNLPNPKPGIMRRHSGGIASET---TFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGK  438
                       + R    G   ET    F IG+ VEV  +EEG + SW+ A ++   G  K
Sbjct  316   KAGEKKKAKKVSRNGKVGTKKETGKQEFSIGSVVEVSSEEEGFEDSWFVAKVIEARGKRK  375

Query  437   YLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCE  258
             YLVE+  LK + G + L +E D L +RP  P    V+ F   E+VDA  N+GW VG++ +
Sbjct  376   YLVEYEKLKGEDGKESLREEVDVLHMRPRPPETFMVEGFVKHEKVDALYNDGWWVGEISK  435

Query  257   VLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             VL  +KY V+F+ T E L+F H  LRLHQEWING W
Sbjct  436   VLANSKYVVHFKNTQEFLKFDHSQLRLHQEWINGKW  471


 Score =   263 bits (672),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 172/455 (38%), Positives = 256/455 (56%), Gaps = 17/455 (4%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCYFRV  1812
             W+P  V+R S  K+    Q  VE+ TL  D++  K+ +E V L  +RP PP E    F V
Sbjct  33    WYPGTVVRRSSDKSPAKYQ--VEYATLFLDNEGKKQLREIVELRQLRPPPPPEKGRDFAV  90

Query  1811  GESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVP  1632
             GE  D +Y N GW  G V E L +  + V      + + ++  +  LR+HR+W DG W P
Sbjct  91    GEEVDAYY-NDGWWEGVVTEALGDEEFNVFF--RSSKDQIRFRKNDLRLHREWVDGAWRP  147

Query  1631  PLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSW  1452
             P+E  + D++ + ++ E+ L      K+  +  +    ++FS +  VEV   +EGFE SW
Sbjct  148   PVEAEEEDEEEEDEEEENIL-----CKVDPEIVKAIAKQEFSNDTVVEVCSGEEGFEGSW  202

Query  1451  YASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDA  1272
             + + ++E +G  K LV+Y+DL+ +DG + L E+ D   IRP PP       F+L DKVDA
Sbjct  203   FVARIVEPIGEDKYLVEYRDLRAEDGVELLREKTDFLHIRPPPPSKEEDKDFELGDKVDA  262

Query  1271  WVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRS  1092
             +  +GWWEG V+++L D ++ V F    E + F    LR H+ W N NW  +TK    + 
Sbjct  263   YYNDGWWEGVVTEILPDGRFGVFFKYSRERIRFGRQGLRLHRHWINGNWQLSTKAGEKKK  322

Query  1091  SSDVMLNskvvkvkskSDRKALGPK-FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKF  915
             +  V  N KV        +K  G + FS G +VE +S EEG+  SW+ A + ++ G  K+
Sbjct  323   AKKVSRNGKVGT------KKETGKQEFSIGSVVEVSSEEEGFEDSWFVAKVIEARGKRKY  376

Query  914   LLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKV  735
             L+EY+ L+ +D  E L+E+ D  ++RP PP     + F   E+VDA YN+GWW G ISKV
Sbjct  377   LVEYEKLKGEDGKESLREEVDVLHMRPRPPETFMVEGFVKHEKVDALYNDGWWVGEISKV  436

Query  734   LDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             L    YVV+F  T E ++F H  +R HQEWI+ KW
Sbjct  437   LANSKYVVHFKNTQEFLKFDHSQLRLHQEWINGKW  471


 Score =   145 bits (367),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 108/329 (33%), Positives = 166/329 (50%), Gaps = 27/329 (8%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             PE     A+ +F+    VEV    + F   WF A ++ P         +  VE+  L ++
Sbjct  172   PEIVKAIAKQEFSNDTVVEVCSGEEGFEGSWFVARIVEPIGED-----KYLVEYRDLRAE  226

Query  1901  D--DPMKRRKEYVHLSAVRPAPPG-EPCCYFRVGESADVFYENRGWRRGTVDEILENSMY  1731
             D  + ++ + +++H   +RP PP  E    F +G+  D +Y N GW  G V EIL +  +
Sbjct  227   DGVELLREKTDFLH---IRPPPPSKEEDKDFELGDKVDAYY-NDGWWEGVVTEILPDGRF  282

Query  1730  MVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVK  1551
              V    + + E ++  +  LR+HR W +G W           Q   K  E          
Sbjct  283   GVFF--KYSRERIRFGRQGLRLHRHWINGNW-----------QLSTKAGEKKKAKKVSRN  329

Query  1550  LRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGT  1371
              ++   + +  ++FS    VEV  ++EGFE SW+ + V+E  G  K LV+Y+ LK +DG 
Sbjct  330   GKVGTKKETGKQEFSIGSVVEVSSEEEGFEDSWFVAKVIEARGKRKYLVEYEKLKGEDGK  389

Query  1370  DYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSM  1191
             + L EEVD   +RP PPE   +  F   +KVDA   +GWW G +SKVL ++KY+V F + 
Sbjct  390   ESLREEVDVLHMRPRPPETFMVEGFVKHEKVDALYNDGWWVGEISKVLANSKYVVHFKNT  449

Query  1190  NELLTFEASDLRPHQEWKNNNWVAATKID  1104
              E L F+ S LR HQEW N  W+  +K +
Sbjct  450   QEFLKFDHSQLRLHQEWINGKWLTPSKAE  478


 Score = 84.7 bits (208),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 72/129 (56%), Gaps = 3/129 (2%)
 Frame = -3

Query  527  GAKVEVKDDEEGNQGSWYPALILRLIGN---GKYLVEFRTLKCDFGTDLLVQEADALSVR  357
            G+ VE+  DE G +GSWYP  ++R   +    KY VE+ TL  D      ++E   L   
Sbjct  17   GSAVEISSDEHGFRGSWYPGTVVRRSSDKSPAKYQVEYATLFLDNEGKKQLREIVELRQL  76

Query  356  PSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRL  177
               P  ++   F   EEVDA+ N+GW  G V E L   ++ V FR++ + + FR + LRL
Sbjct  77   RPPPPPEKGRDFAVGEEVDAYYNDGWWEGVVTEALGDEEFNVFFRSSKDQIRFRKNDLRL  136

Query  176  HQEWINGAW  150
            H+EW++GAW
Sbjct  137  HREWVDGAW  145



>ref|XP_010553711.1| PREDICTED: uncharacterized protein LOC104823716 isoform X2 [Tarenaya 
hassleriana]
Length=476

 Score =   265 bits (677),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 167/456 (37%), Positives = 250/456 (55%), Gaps = 12/456 (3%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGN---GKLLVQYQDLKTDD-GTDYLIEEVDASCIRPC  1326
             VE+  D+ GF  SWY   V+    +    K  V+Y  L  D+ G   L E V+   +RP 
Sbjct  20    VEISSDEHGFRGSWYPGTVVRRSSDKSPAKYQVEYATLFLDNEGKKQLREIVELRQLRPP  79

Query  1325  PPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQ  1146
             P    +   F + ++VDA+  +GWWEG V++ LGD ++ V F S  + + F  +DLR H+
Sbjct  80    P-PPEKGRDFAVGEEVDAYYNDGWWEGVVTEALGDEEFNVFFRSSKDQIRFRKNDLRLHR  138

Query  1145  EWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPK-FSKGMLVEATSFEEGY  969
             EW +  W    + +      +      ++        KA+  + FS   +VE  S EEG+
Sbjct  139   EWVDGAWRPPVEAEEEDEEEEDEEEENILCKVDPEIVKAIAKQEFSNDTVVEVCSGEEGF  198

Query  968   HGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFE  789
              GSW+ A I + IG +K+L+EY+ LR +D  E L+EK D  +IRP PP       F++ +
Sbjct  199   EGSWFVARIVEPIGEDKYLVEYRDLRAEDGVELLREKTDFLHIRPPPPSKEEDKDFELGD  258

Query  788   EVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKS  609
             +VDA+YN+GWWEG+++++L    + V+F  + E I F   G+R H+ WI+  W ++   +
Sbjct  259   KVDAYYNDGWWEGVVTEILPDGRFGVFFKYSRERIRFGRQGLRLHRHWINGNWQLS---T  315

Query  608   NNNLPNPKPGIMRRHSGGIASET---TFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGK  438
                       + R    G   ET    F IG+ VEV  +EEG + SW+ A ++   G  K
Sbjct  316   KAGEKKKAKKVSRNGKVGTKKETGKQEFSIGSVVEVSSEEEGFEDSWFVAKVIEARGKRK  375

Query  437   YLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCE  258
             YLVE+  LK + G + L +E D L +RP  P    V+ F   E+VDA  N+GW VG++ +
Sbjct  376   YLVEYEKLKGEDGKESLREEVDVLHMRPRPPETFMVEGFVKHEKVDALYNDGWWVGEISK  435

Query  257   VLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             VL  +KY V+F+ T E L+F H  LRLHQEWING W
Sbjct  436   VLANSKYVVHFKNTQEFLKFDHSQLRLHQEWINGKW  471


 Score =   263 bits (672),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 172/455 (38%), Positives = 256/455 (56%), Gaps = 17/455 (4%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCYFRV  1812
             W+P  V+R S  K+    Q  VE+ TL  D++  K+ +E V L  +RP PP E    F V
Sbjct  33    WYPGTVVRRSSDKSPAKYQ--VEYATLFLDNEGKKQLREIVELRQLRPPPPPEKGRDFAV  90

Query  1811  GESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVP  1632
             GE  D +Y N GW  G V E L +  + V      + + ++  +  LR+HR+W DG W P
Sbjct  91    GEEVDAYY-NDGWWEGVVTEALGDEEFNVFF--RSSKDQIRFRKNDLRLHREWVDGAWRP  147

Query  1631  PLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSW  1452
             P+E  + D++ + ++ E+ L      K+  +  +    ++FS +  VEV   +EGFE SW
Sbjct  148   PVEAEEEDEEEEDEEEENIL-----CKVDPEIVKAIAKQEFSNDTVVEVCSGEEGFEGSW  202

Query  1451  YASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDA  1272
             + + ++E +G  K LV+Y+DL+ +DG + L E+ D   IRP PP       F+L DKVDA
Sbjct  203   FVARIVEPIGEDKYLVEYRDLRAEDGVELLREKTDFLHIRPPPPSKEEDKDFELGDKVDA  262

Query  1271  WVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRS  1092
             +  +GWWEG V+++L D ++ V F    E + F    LR H+ W N NW  +TK    + 
Sbjct  263   YYNDGWWEGVVTEILPDGRFGVFFKYSRERIRFGRQGLRLHRHWINGNWQLSTKAGEKKK  322

Query  1091  SSDVMLNskvvkvkskSDRKALGPK-FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKF  915
             +  V  N KV        +K  G + FS G +VE +S EEG+  SW+ A + ++ G  K+
Sbjct  323   AKKVSRNGKVGT------KKETGKQEFSIGSVVEVSSEEEGFEDSWFVAKVIEARGKRKY  376

Query  914   LLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKV  735
             L+EY+ L+ +D  E L+E+ D  ++RP PP     + F   E+VDA YN+GWW G ISKV
Sbjct  377   LVEYEKLKGEDGKESLREEVDVLHMRPRPPETFMVEGFVKHEKVDALYNDGWWVGEISKV  436

Query  734   LDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             L    YVV+F  T E ++F H  +R HQEWI+ KW
Sbjct  437   LANSKYVVHFKNTQEFLKFDHSQLRLHQEWINGKW  471


 Score =   145 bits (367),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 108/327 (33%), Positives = 165/327 (50%), Gaps = 27/327 (8%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             PE     A+ +F+    VEV    + F   WF A ++ P         +  VE+  L ++
Sbjct  172   PEIVKAIAKQEFSNDTVVEVCSGEEGFEGSWFVARIVEPIGED-----KYLVEYRDLRAE  226

Query  1901  D--DPMKRRKEYVHLSAVRPAPPG-EPCCYFRVGESADVFYENRGWRRGTVDEILENSMY  1731
             D  + ++ + +++H   +RP PP  E    F +G+  D +Y N GW  G V EIL +  +
Sbjct  227   DGVELLREKTDFLH---IRPPPPSKEEDKDFELGDKVDAYY-NDGWWEGVVTEILPDGRF  282

Query  1730  MVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVK  1551
              V    + + E ++  +  LR+HR W +G W           Q   K  E          
Sbjct  283   GVFF--KYSRERIRFGRQGLRLHRHWINGNW-----------QLSTKAGEKKKAKKVSRN  329

Query  1550  LRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGT  1371
              ++   + +  ++FS    VEV  ++EGFE SW+ + V+E  G  K LV+Y+ LK +DG 
Sbjct  330   GKVGTKKETGKQEFSIGSVVEVSSEEEGFEDSWFVAKVIEARGKRKYLVEYEKLKGEDGK  389

Query  1370  DYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSM  1191
             + L EEVD   +RP PPE   +  F   +KVDA   +GWW G +SKVL ++KY+V F + 
Sbjct  390   ESLREEVDVLHMRPRPPETFMVEGFVKHEKVDALYNDGWWVGEISKVLANSKYVVHFKNT  449

Query  1190  NELLTFEASDLRPHQEWKNNNWVAATK  1110
              E L F+ S LR HQEW N  W+  +K
Sbjct  450   QEFLKFDHSQLRLHQEWINGKWLTPSK  476


 Score = 84.3 bits (207),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 72/129 (56%), Gaps = 3/129 (2%)
 Frame = -3

Query  527  GAKVEVKDDEEGNQGSWYPALILRLIGN---GKYLVEFRTLKCDFGTDLLVQEADALSVR  357
            G+ VE+  DE G +GSWYP  ++R   +    KY VE+ TL  D      ++E   L   
Sbjct  17   GSAVEISSDEHGFRGSWYPGTVVRRSSDKSPAKYQVEYATLFLDNEGKKQLREIVELRQL  76

Query  356  PSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRL  177
               P  ++   F   EEVDA+ N+GW  G V E L   ++ V FR++ + + FR + LRL
Sbjct  77   RPPPPPEKGRDFAVGEEVDAYYNDGWWEGVVTEALGDEEFNVFFRSSKDQIRFRKNDLRL  136

Query  176  HQEWINGAW  150
            H+EW++GAW
Sbjct  137  HREWVDGAW  145



>ref|XP_010475763.1| PREDICTED: uncharacterized protein LOC104755123, partial [Camelina 
sativa]
Length=508

 Score =   265 bits (678),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 167/475 (35%), Positives = 246/475 (52%), Gaps = 41/475 (9%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGK--LLVQYQDLKTD-DGTDYLIEEVDASCIRPCP  1323
             VE+  D+ GF  SWY   V+    + K    V+Y  L  D +GT  L E VD S +RP  
Sbjct  45    VEISSDEIGFRGSWYLGKVITTPSSDKEKCQVEYTRLFFDKEGTKPLKEVVDLSQLRPPA  104

Query  1322  P---EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRP  1152
             P   E  +     + D+VDA+  +GWWEG V++VLGD ++ V F    E + F+   LR 
Sbjct  105   PPMSEREKKREIAIGDEVDAFYNDGWWEGDVTEVLGDGRFSVFFRCSKEQIQFKKDKLRF  164

Query  1151  HQEWKNNNW-----------VAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKG  1005
             H+EW    W               K+D      + +L     +V  ++ R      FS G
Sbjct  165   HREWVGGAWKPPLEDTEEEESEEDKVDNTEDEEEDIL----ARVDLETTRATAKEMFSSG  220

Query  1004  MLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPP  825
              +VE +S EEG+ G W+ A + + IG +KFL+EY+ LR +D  EPLKE  D  +IRP PP
Sbjct  221   TIVEVSSDEEGFKGCWFAAKVVEPIGDDKFLVEYRDLREEDGVEPLKEVIDFLHIRPPPP  280

Query  824   LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEW  645
                  D F + ++++A+YN+GWW G + + + G    ++F  + E++ F   G+R H++W
Sbjct  281   RDEDKD-FTVGDKINAFYNDGWWIGFVIEGMKGGTVGIHFRQSGEKMRFGRQGLRLHKDW  339

Query  644   IDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETT----------FCIGAKVEVKDDEE  495
             ++  W          LP  K G ++R      S             F IG  VEV  +E+
Sbjct  340   VNGTW---------QLPPLKGGQIKREKTVSCSRNVRPKKAIEKQEFSIGTPVEVSSEEQ  390

Query  494   GNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRP  315
             G +GSW+PA ++   GN K +VE+  LK + G + L +E +   +RP       V  F  
Sbjct  391   GFEGSWFPAKLVEYRGNDKCVVEYDNLKAEDGKEPLREEVNVSEIRPQPVEQVMVCPFEK  450

Query  314   LEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              ++VDA  N+GW VG + +VL  + Y V F  T E+L+F H  LRLHQEWING W
Sbjct  451   NDKVDALYNDGWWVGVIRKVLAKSSYLVYFENTQEMLKFHHSQLRLHQEWINGKW  505


 Score =   233 bits (595),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 154/444 (35%), Positives = 236/444 (53%), Gaps = 25/444 (6%)
 Frame = -3

Query  1928  VEFETLCSDDDPMKRRKEYVHLSAVRP-APP---GEPCCYFRVGESADVFYENRGWRRGT  1761
             VE+  L  D +  K  KE V LS +RP APP    E      +G+  D FY N GW  G 
Sbjct  76    VEYTRLFFDKEGTKPLKEVVDLSQLRPPAPPMSEREKKREIAIGDEVDAFY-NDGWWEGD  134

Query  1760  VDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQK---  1590
             V E+L +  + V      + E ++ ++ +LR HR+W  G W PPLE+++ ++  + K   
Sbjct  135   VTEVLGDGRFSVFF--RCSKEQIQFKKDKLRFHREWVGGAWKPPLEDTEEEESEEDKVDN  192

Query  1589  ---KSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGN  1419
                + ED L      ++ ++ TR +    FS    VEV  D+EGF+  W+A+ V+E +G+
Sbjct  193   TEDEEEDIL-----ARVDLETTRATAKEMFSSGTIVEVSSDEEGFKGCWFAAKVVEPIGD  247

Query  1418  GKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHV  1239
              K LV+Y+DL+ +DG + L E +D   IRP PP       F + DK++A+  +GWW G V
Sbjct  248   DKFLVEYRDLREEDGVEPLKEVIDFLHIRPPPPR-DEDKDFTVGDKINAFYNDGWWIGFV  306

Query  1238  SKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvv  1059
              + +      + F    E + F    LR H++W N  W        P     +     V 
Sbjct  307   IEGMKGGTVGIHFRQSGEKMRFGRQGLRLHKDWVNGTWQLP-----PLKGGQIKREKTVS  361

Query  1058  kvkskSDRKALGPK-FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDD  882
               ++   +KA+  + FS G  VE +S E+G+ GSW+ A + +  G +K ++EY  L+ +D
Sbjct  362   CSRNVRPKKAIEKQEFSIGTPVEVSSEEQGFEGSWFPAKLVEYRGNDKCVVEYDNLKAED  421

Query  881   ESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFW  702
               EPL+E+ +   IRP P        F+  ++VDA YN+GWW G+I KVL   +Y+VYF 
Sbjct  422   GKEPLREEVNVSEIRPQPVEQVMVCPFEKNDKVDALYNDGWWVGVIRKVLAKSSYLVYFE  481

Query  701   TTNEEIEFAHHGIRPHQEWIDKKW  630
              T E ++F H  +R HQEWI+ KW
Sbjct  482   NTQEMLKFHHSQLRLHQEWINGKW  505


 Score =   163 bits (413),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 110/323 (34%), Positives = 170/323 (53%), Gaps = 27/323 (8%)
 Frame = -3

Query  2072  ETHAMSAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDD  1899
             ET   +A+  F+ G  VEV    + F   WF A V+ P         +  VE+  L  +D
Sbjct  207   ETTRATAKEMFSSGTIVEVSSDEEGFKGCWFAAKVVEPI-----GDDKFLVEYRDLREED  261

Query  1898  --DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMV  1725
               +P+K   +++H   +RP PP +    F VG+  + FY N GW  G V E ++     V
Sbjct  262   GVEPLKEVIDFLH---IRPPPPRDEDKDFTVGDKINAFY-NDGWWIGFVIEGMKGGT--V  315

Query  1724  ALGDEDAVESVKVEQWQLRVHRDWKDGCW-VPPLEESQVDQQYQQKKSEDFLMTPSGVKL  1548
              +    + E ++  +  LR+H+DW +G W +PPL+  Q+ ++     S +          
Sbjct  316   GIHFRQSGEKMRFGRQGLRLHKDWVNGTWQLPPLKGGQIKREKTVSCSRN----------  365

Query  1547  RIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTD  1368
              ++  +    ++FS   PVEV  +++GFE SW+ + ++E  GN K +V+Y +LK +DG +
Sbjct  366   -VRPKKAIEKQEFSIGTPVEVSSEEQGFEGSWFPAKLVEYRGNDKCVVEYDNLKAEDGKE  424

Query  1367  YLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMN  1188
              L EEV+ S IRP P E   + PF+  DKVDA   +GWW G + KVL  + Y+V F +  
Sbjct  425   PLREEVNVSEIRPQPVEQVMVCPFEKNDKVDALYNDGWWVGVIRKVLAKSSYLVYFENTQ  484

Query  1187  ELLTFEASDLRPHQEWKNNNWVA  1119
             E+L F  S LR HQEW N  W+ 
Sbjct  485   EMLKFHHSQLRLHQEWINGKWIT  507


 Score = 83.2 bits (204),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 71/132 (54%), Gaps = 6/132 (5%)
 Frame = -3

Query  527  GAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDF---GTDLLVQEADALSVR  357
            GA VE+  DE G +GSWY   ++    + K   +    +  F   GT  L +  D   +R
Sbjct  42   GAAVEISSDEIGFRGSWYLGKVITTPSSDKEKCQVEYTRLFFDKEGTKPLKEVVDLSQLR  101

Query  356  PSAPILQRVDRFRPL---EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHG  186
            P AP +   ++ R +   +EVDA+ N+GW  G V EVL   ++ V FR + E ++F+   
Sbjct  102  PPAPPMSEREKKREIAIGDEVDAFYNDGWWEGDVTEVLGDGRFSVFFRCSKEQIQFKKDK  161

Query  185  LRLHQEWINGAW  150
            LR H+EW+ GAW
Sbjct  162  LRFHREWVGGAW  173



>ref|XP_010475764.1| PREDICTED: uncharacterized protein LOC104755124 isoform X1 [Camelina 
sativa]
Length=514

 Score =   265 bits (677),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 167/475 (35%), Positives = 246/475 (52%), Gaps = 41/475 (9%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGK--LLVQYQDLKTD-DGTDYLIEEVDASCIRPCP  1323
             VE+  D+ GF  SWY   V+    + K    V+Y  L  D +GT  L E VD S +RP  
Sbjct  45    VEISSDEIGFRGSWYLGKVITTPSSDKEKCQVEYTRLFFDKEGTKPLKEVVDLSQLRPPA  104

Query  1322  P---EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRP  1152
             P   E  +     + D+VDA+  +GWWEG V++VLGD ++ V F    E + F+   LR 
Sbjct  105   PPMSEREKKREIAIGDEVDAFYNDGWWEGDVTEVLGDGRFSVFFRCSKEQIQFKKDKLRF  164

Query  1151  HQEWKNNNW-----------VAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKG  1005
             H+EW    W               K+D      + +L     +V  ++ R      FS G
Sbjct  165   HREWVGGAWKPPLEDTEEEESEEDKVDNTEDEEEDIL----ARVDLETTRATAKEMFSSG  220

Query  1004  MLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPP  825
              +VE +S EEG+ G W+ A + + IG +KFL+EY+ LR +D  EPLKE  D  +IRP PP
Sbjct  221   TIVEVSSDEEGFKGCWFAAKVVEPIGDDKFLVEYRDLREEDGVEPLKEVIDFLHIRPPPP  280

Query  824   LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEW  645
                  D F + ++++A+YN+GWW G + + + G    ++F  + E++ F   G+R H++W
Sbjct  281   RDEDKD-FTVGDKINAFYNDGWWIGFVIEGMKGGTVGIHFRQSGEKMRFGRQGLRLHKDW  339

Query  644   IDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETT----------FCIGAKVEVKDDEE  495
             ++  W          LP  K G ++R      S             F IG  VEV  +E+
Sbjct  340   VNGTW---------QLPPLKGGQIKREKVVSCSRNVRPKKAIEKQEFSIGTPVEVSSEEQ  390

Query  494   GNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRP  315
             G +GSW+PA ++   GN K +VE+  LK + G + L +E +   +RP       V  F  
Sbjct  391   GFEGSWFPAKLVEYRGNDKCVVEYDNLKAEDGKEPLREEVNVSEIRPQPVEQVMVCPFEK  450

Query  314   LEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              ++VDA  N+GW VG + +VL  + Y V F  T E+L+F H  LRLHQEWING W
Sbjct  451   NDKVDALYNDGWWVGVIRKVLAKSSYLVYFENTQEMLKFHHSQLRLHQEWINGKW  505


 Score =   235 bits (600),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 155/449 (35%), Positives = 238/449 (53%), Gaps = 25/449 (6%)
 Frame = -3

Query  1928  VEFETLCSDDDPMKRRKEYVHLSAVRP-APP---GEPCCYFRVGESADVFYENRGWRRGT  1761
             VE+  L  D +  K  KE V LS +RP APP    E      +G+  D FY N GW  G 
Sbjct  76    VEYTRLFFDKEGTKPLKEVVDLSQLRPPAPPMSEREKKREIAIGDEVDAFY-NDGWWEGD  134

Query  1760  VDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQK---  1590
             V E+L +  + V      + E ++ ++ +LR HR+W  G W PPLE+++ ++  + K   
Sbjct  135   VTEVLGDGRFSVFF--RCSKEQIQFKKDKLRFHREWVGGAWKPPLEDTEEEESEEDKVDN  192

Query  1589  ---KSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGN  1419
                + ED L      ++ ++ TR +    FS    VEV  D+EGF+  W+A+ V+E +G+
Sbjct  193   TEDEEEDIL-----ARVDLETTRATAKEMFSSGTIVEVSSDEEGFKGCWFAAKVVEPIGD  247

Query  1418  GKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHV  1239
              K LV+Y+DL+ +DG + L E +D   IRP PP       F + DK++A+  +GWW G V
Sbjct  248   DKFLVEYRDLREEDGVEPLKEVIDFLHIRPPPPR-DEDKDFTVGDKINAFYNDGWWIGFV  306

Query  1238  SKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvv  1059
              + +      + F    E + F    LR H++W N  W        P     +     V 
Sbjct  307   IEGMKGGTVGIHFRQSGEKMRFGRQGLRLHKDWVNGTWQLP-----PLKGGQIKREKVVS  361

Query  1058  kvkskSDRKALGPK-FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDD  882
               ++   +KA+  + FS G  VE +S E+G+ GSW+ A + +  G +K ++EY  L+ +D
Sbjct  362   CSRNVRPKKAIEKQEFSIGTPVEVSSEEQGFEGSWFPAKLVEYRGNDKCVVEYDNLKAED  421

Query  881   ESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFW  702
               EPL+E+ +   IRP P        F+  ++VDA YN+GWW G+I KVL   +Y+VYF 
Sbjct  422   GKEPLREEVNVSEIRPQPVEQVMVCPFEKNDKVDALYNDGWWVGVIRKVLAKSSYLVYFE  481

Query  701   TTNEEIEFAHHGIRPHQEWIDKKWDIAFR  615
              T E ++F H  +R HQEWI+ KW   F+
Sbjct  482   NTQEMLKFHHSQLRLHQEWINGKWITNFK  510


 Score =   164 bits (416),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 113/326 (35%), Positives = 171/326 (52%), Gaps = 27/326 (8%)
 Frame = -3

Query  2072  ETHAMSAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDD  1899
             ET   +A+  F+ G  VEV    + F   WF A V+ P         +  VE+  L  +D
Sbjct  207   ETTRATAKEMFSSGTIVEVSSDEEGFKGCWFAAKVVEPI-----GDDKFLVEYRDLREED  261

Query  1898  --DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMV  1725
               +P+K   +++H   +RP PP +    F VG+  + FY N GW  G V E ++     V
Sbjct  262   GVEPLKEVIDFLH---IRPPPPRDEDKDFTVGDKINAFY-NDGWWIGFVIEGMKGGT--V  315

Query  1724  ALGDEDAVESVKVEQWQLRVHRDWKDGCW-VPPLEESQVDQQYQQKKSEDFLMTPSGVKL  1548
              +    + E ++  +  LR+H+DW +G W +PPL+  Q+       K E  +     V+ 
Sbjct  316   GIHFRQSGEKMRFGRQGLRLHKDWVNGTWQLPPLKGGQI-------KREKVVSCSRNVRP  368

Query  1547  RIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTD  1368
             +    +    ++FS   PVEV  +++GFE SW+ + ++E  GN K +V+Y +LK +DG +
Sbjct  369   KKAIEK----QEFSIGTPVEVSSEEQGFEGSWFPAKLVEYRGNDKCVVEYDNLKAEDGKE  424

Query  1367  YLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMN  1188
              L EEV+ S IRP P E   + PF+  DKVDA   +GWW G + KVL  + Y+V F +  
Sbjct  425   PLREEVNVSEIRPQPVEQVMVCPFEKNDKVDALYNDGWWVGVIRKVLAKSSYLVYFENTQ  484

Query  1187  ELLTFEASDLRPHQEWKNNNWVAATK  1110
             E+L F  S LR HQEW N  W+   K
Sbjct  485   EMLKFHHSQLRLHQEWINGKWITNFK  510


 Score = 83.2 bits (204),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 71/132 (54%), Gaps = 6/132 (5%)
 Frame = -3

Query  527  GAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDF---GTDLLVQEADALSVR  357
            GA VE+  DE G +GSWY   ++    + K   +    +  F   GT  L +  D   +R
Sbjct  42   GAAVEISSDEIGFRGSWYLGKVITTPSSDKEKCQVEYTRLFFDKEGTKPLKEVVDLSQLR  101

Query  356  PSAPILQRVDRFRPL---EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHG  186
            P AP +   ++ R +   +EVDA+ N+GW  G V EVL   ++ V FR + E ++F+   
Sbjct  102  PPAPPMSEREKKREIAIGDEVDAFYNDGWWEGDVTEVLGDGRFSVFFRCSKEQIQFKKDK  161

Query  185  LRLHQEWINGAW  150
            LR H+EW+ GAW
Sbjct  162  LRFHREWVGGAW  173



>ref|XP_010475765.1| PREDICTED: uncharacterized protein LOC104755124 isoform X2 [Camelina 
sativa]
Length=512

 Score =   265 bits (677),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 167/475 (35%), Positives = 246/475 (52%), Gaps = 41/475 (9%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGK--LLVQYQDLKTD-DGTDYLIEEVDASCIRPCP  1323
             VE+  D+ GF  SWY   V+    + K    V+Y  L  D +GT  L E VD S +RP  
Sbjct  45    VEISSDEIGFRGSWYLGKVITTPSSDKEKCQVEYTRLFFDKEGTKPLKEVVDLSQLRPPA  104

Query  1322  P---EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRP  1152
             P   E  +     + D+VDA+  +GWWEG V++VLGD ++ V F    E + F+   LR 
Sbjct  105   PPMSEREKKREIAIGDEVDAFYNDGWWEGDVTEVLGDGRFSVFFRCSKEQIQFKKDKLRF  164

Query  1151  HQEWKNNNW-----------VAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKG  1005
             H+EW    W               K+D      + +L     +V  ++ R      FS G
Sbjct  165   HREWVGGAWKPPLEDTEEEESEEDKVDNTEDEEEDIL----ARVDLETTRATAKEMFSSG  220

Query  1004  MLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPP  825
              +VE +S EEG+ G W+ A + + IG +KFL+EY+ LR +D  EPLKE  D  +IRP PP
Sbjct  221   TIVEVSSDEEGFKGCWFAAKVVEPIGDDKFLVEYRDLREEDGVEPLKEVIDFLHIRPPPP  280

Query  824   LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEW  645
                  D F + ++++A+YN+GWW G + + + G    ++F  + E++ F   G+R H++W
Sbjct  281   RDEDKD-FTVGDKINAFYNDGWWIGFVIEGMKGGTVGIHFRQSGEKMRFGRQGLRLHKDW  339

Query  644   IDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETT----------FCIGAKVEVKDDEE  495
             ++  W          LP  K G ++R      S             F IG  VEV  +E+
Sbjct  340   VNGTW---------QLPPLKGGQIKREKVVSCSRNVRPKKAIEKQEFSIGTPVEVSSEEQ  390

Query  494   GNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRP  315
             G +GSW+PA ++   GN K +VE+  LK + G + L +E +   +RP       V  F  
Sbjct  391   GFEGSWFPAKLVEYRGNDKCVVEYDNLKAEDGKEPLREEVNVSEIRPQPVEQVMVCPFEK  450

Query  314   LEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              ++VDA  N+GW VG + +VL  + Y V F  T E+L+F H  LRLHQEWING W
Sbjct  451   NDKVDALYNDGWWVGVIRKVLAKSSYLVYFENTQEMLKFHHSQLRLHQEWINGKW  505


 Score =   237 bits (605),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 156/451 (35%), Positives = 240/451 (53%), Gaps = 25/451 (6%)
 Frame = -3

Query  1928  VEFETLCSDDDPMKRRKEYVHLSAVRP-APP---GEPCCYFRVGESADVFYENRGWRRGT  1761
             VE+  L  D +  K  KE V LS +RP APP    E      +G+  D FY N GW  G 
Sbjct  76    VEYTRLFFDKEGTKPLKEVVDLSQLRPPAPPMSEREKKREIAIGDEVDAFY-NDGWWEGD  134

Query  1760  VDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQK---  1590
             V E+L +  + V      + E ++ ++ +LR HR+W  G W PPLE+++ ++  + K   
Sbjct  135   VTEVLGDGRFSVFF--RCSKEQIQFKKDKLRFHREWVGGAWKPPLEDTEEEESEEDKVDN  192

Query  1589  ---KSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGN  1419
                + ED L      ++ ++ TR +    FS    VEV  D+EGF+  W+A+ V+E +G+
Sbjct  193   TEDEEEDIL-----ARVDLETTRATAKEMFSSGTIVEVSSDEEGFKGCWFAAKVVEPIGD  247

Query  1418  GKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHV  1239
              K LV+Y+DL+ +DG + L E +D   IRP PP       F + DK++A+  +GWW G V
Sbjct  248   DKFLVEYRDLREEDGVEPLKEVIDFLHIRPPPPR-DEDKDFTVGDKINAFYNDGWWIGFV  306

Query  1238  SKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvv  1059
              + +      + F    E + F    LR H++W N  W        P     +     V 
Sbjct  307   IEGMKGGTVGIHFRQSGEKMRFGRQGLRLHKDWVNGTWQLP-----PLKGGQIKREKVVS  361

Query  1058  kvkskSDRKALGPK-FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDD  882
               ++   +KA+  + FS G  VE +S E+G+ GSW+ A + +  G +K ++EY  L+ +D
Sbjct  362   CSRNVRPKKAIEKQEFSIGTPVEVSSEEQGFEGSWFPAKLVEYRGNDKCVVEYDNLKAED  421

Query  881   ESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFW  702
               EPL+E+ +   IRP P        F+  ++VDA YN+GWW G+I KVL   +Y+VYF 
Sbjct  422   GKEPLREEVNVSEIRPQPVEQVMVCPFEKNDKVDALYNDGWWVGVIRKVLAKSSYLVYFE  481

Query  701   TTNEEIEFAHHGIRPHQEWIDKKWDIAFRKS  609
              T E ++F H  +R HQEWI+ KW   F+K+
Sbjct  482   NTQEMLKFHHSQLRLHQEWINGKWITNFKKA  512


 Score =   164 bits (415),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 113/326 (35%), Positives = 171/326 (52%), Gaps = 27/326 (8%)
 Frame = -3

Query  2072  ETHAMSAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDD  1899
             ET   +A+  F+ G  VEV    + F   WF A V+ P         +  VE+  L  +D
Sbjct  207   ETTRATAKEMFSSGTIVEVSSDEEGFKGCWFAAKVVEPI-----GDDKFLVEYRDLREED  261

Query  1898  --DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMV  1725
               +P+K   +++H   +RP PP +    F VG+  + FY N GW  G V E ++     V
Sbjct  262   GVEPLKEVIDFLH---IRPPPPRDEDKDFTVGDKINAFY-NDGWWIGFVIEGMKGGT--V  315

Query  1724  ALGDEDAVESVKVEQWQLRVHRDWKDGCW-VPPLEESQVDQQYQQKKSEDFLMTPSGVKL  1548
              +    + E ++  +  LR+H+DW +G W +PPL+  Q+       K E  +     V+ 
Sbjct  316   GIHFRQSGEKMRFGRQGLRLHKDWVNGTWQLPPLKGGQI-------KREKVVSCSRNVRP  368

Query  1547  RIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTD  1368
             +    +    ++FS   PVEV  +++GFE SW+ + ++E  GN K +V+Y +LK +DG +
Sbjct  369   KKAIEK----QEFSIGTPVEVSSEEQGFEGSWFPAKLVEYRGNDKCVVEYDNLKAEDGKE  424

Query  1367  YLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMN  1188
              L EEV+ S IRP P E   + PF+  DKVDA   +GWW G + KVL  + Y+V F +  
Sbjct  425   PLREEVNVSEIRPQPVEQVMVCPFEKNDKVDALYNDGWWVGVIRKVLAKSSYLVYFENTQ  484

Query  1187  ELLTFEASDLRPHQEWKNNNWVAATK  1110
             E+L F  S LR HQEW N  W+   K
Sbjct  485   EMLKFHHSQLRLHQEWINGKWITNFK  510


 Score = 83.2 bits (204),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 71/132 (54%), Gaps = 6/132 (5%)
 Frame = -3

Query  527  GAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDF---GTDLLVQEADALSVR  357
            GA VE+  DE G +GSWY   ++    + K   +    +  F   GT  L +  D   +R
Sbjct  42   GAAVEISSDEIGFRGSWYLGKVITTPSSDKEKCQVEYTRLFFDKEGTKPLKEVVDLSQLR  101

Query  356  PSAPILQRVDRFRPL---EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHG  186
            P AP +   ++ R +   +EVDA+ N+GW  G V EVL   ++ V FR + E ++F+   
Sbjct  102  PPAPPMSEREKKREIAIGDEVDAFYNDGWWEGDVTEVLGDGRFSVFFRCSKEQIQFKKDK  161

Query  185  LRLHQEWINGAW  150
            LR H+EW+ GAW
Sbjct  162  LRFHREWVGGAW  173



>ref|XP_010441337.1| PREDICTED: uncharacterized protein LOC104724507 isoform X1 [Camelina 
sativa]
Length=461

 Score =   260 bits (664),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 184/489 (38%), Positives = 268/489 (55%), Gaps = 38/489 (8%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEV-LMRDNFPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             M+++  +  GDRVEV  +      +FPA V+  PSVRKN     + VE E+L        
Sbjct  2     MTSDGFWRGGDRVEVERLVSGAKTYFPATVVSTPSVRKNH----VLVEHESLMVGGSV--  55

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRG-WRRGTVDEILENSMYMVALGDE  1710
             R KEYV  + +RP+PP +    F+  +  DVF +  G W RG V  +L +S Y+V     
Sbjct  56    RMKEYVIPTRLRPSPPRDLNRRFKAKDEVDVFRDTEGCWVRGNVTTVLGDSRYIVEFKGG  115

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKC-T  1533
             +  E ++V+Q  LR+HR+W+ G WVP L        +QQ  S     TP  +KL+IK  T
Sbjct  116   NRPE-IEVDQVDLRLHREWQHGSWVPSL--------FQQ--SNVLEPTPQRIKLKIKIKT  164

Query  1532  RGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDY-LIE  1356
             R +   ++ K   VEV+ ++E ++ SWY + ++  LG+GK +V++     DDG    L +
Sbjct  165   RDN---QYEKGALVEVRSEEEVYKGSWYCARILCSLGDGKYIVEHLKFSRDDGESLPLRD  221

Query  1355  EVDASCIRPC-PPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGD-AKYMVCFGSMNEL  1182
              V+A  +RP  PP++  +  ++  ++VD W    WW G VS VLG  +KY V   S  E 
Sbjct  222   VVEAQNMRPVHPPQVSHVVCYEPGNEVDVWFNKRWWIGRVSNVLGGGSKYSVFITSRGEE  281

Query  1181  LTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGM  1002
              T    +LRPH++W N  W   +K       S    N    K     +R  +   F  GM
Sbjct  282   PTVLNFNLRPHKDWINGAWSNTSK-------SKGECNRPPFKKLKSCERADM--MFKDGM  332

Query  1001  LVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFN-IRPCPP  825
             +VE  S E GY GSW++A I   +G N++ +EYQTL+TDDE E LKE+A   +     PP
Sbjct  333   MVEVRSDERGYEGSWFSAKIISYLGENRYTVEYQTLKTDDERELLKEEARGSDLRPIPPP  392

Query  824   LIHRFDRFKMFEEVDAWYNEGWWEGLI-SKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQE  648
             LI +  R++++EEVDAWYNEGWW G + ++  +   Y VYF T NE +EFA+  +RP Q 
Sbjct  393   LIPKAYRYELYEEVDAWYNEGWWSGRVYTRNHNYTRYGVYFKTNNERLEFAYSDLRPCQV  452

Query  647   WIDKKWDIA  621
             W + KW  A
Sbjct  453   WRNGKWSRA  461


 Score =   205 bits (521),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 151/431 (35%), Positives = 229/431 (53%), Gaps = 24/431 (6%)
 Frame = -3

Query  1412  LLVQYQDLKTDDGTDYLIEEVDASCIRPCPP-EIHRISPFKLLDKVDAW--VGNGWWEGH  1242
             +LV+++ L    G+  + E V  + +RP PP +++R   FK  D+VD +      W  G+
Sbjct  42    VLVEHESLMVG-GSVRMKEYVIPTRLRPSPPRDLNR--RFKAKDEVDVFRDTEGCWVRGN  98

Query  1241  VSKVLGDAKYMVCF-GSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNsk  1065
             V+ VLGD++Y+V F G     +  +  DLR H+EW++ +WV +    L + S+  +L   
Sbjct  99    VTTVLGDSRYIVEFKGGNRPEIEVDQVDLRLHREWQHGSWVPS----LFQQSN--VLEPT  152

Query  1064  vvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTD  885
               ++K K   K    ++ KG LVE  S EE Y GSWY A I  S+G  K+++E+     D
Sbjct  153   PQRIKLKIKIKTRDNQYEKGALVEVRSEEEVYKGSWYCARILCSLGDGKYIVEHLKFSRD  212

Query  884   D-ESEPLKEKADAFNIRPC-PPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDG-LNYV  714
             D ES PL++  +A N+RP  PP +     ++   EVD W+N+ WW G +S VL G   Y 
Sbjct  213   DGESLPLRDVVEAQNMRPVHPPQVSHVVCYEPGNEVDVWFNKRWWIGRVSNVLGGGSKYS  272

Query  713   VYFWTTNEEIEFAHHGIRPHQEWIDKKW-DIAFRKSNNNLPNPKPGIMRRHSGGIASETT  537
             V+  +  EE    +  +RPH++WI+  W + +  K   N P       ++      ++  
Sbjct  273   VFITSRGEEPTVLNFNLRPHKDWINGAWSNTSKSKGECNRPP-----FKKLKSCERADMM  327

Query  536   FCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADAL-SV  360
             F  G  VEV+ DE G +GSW+ A I+  +G  +Y VE++TLK D   +LL +EA      
Sbjct  328   FKDGMMVEVRSDERGYEGSWFSAKIISYLGENRYTVEYQTLKTDDERELLKEEARGSDLR  387

Query  359   RPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEG-AKYRVNFRTTNEILEFRHHGL  183
                 P++ +  R+   EEVDAW N GW  G+V        +Y V F+T NE LEF +  L
Sbjct  388   PIPPPLIPKAYRYELYEEVDAWYNEGWWSGRVYTRNHNYTRYGVYFKTNNERLEFAYSDL  447

Query  182   RLHQEWINGAW  150
             R  Q W NG W
Sbjct  448   RPCQVWRNGKW  458



>ref|XP_003594681.1| RNA binding protein [Medicago truncatula]
 gb|AES64932.1| plant tudor-like protein [Medicago truncatula]
Length=471

 Score =   259 bits (661),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 151/370 (41%), Positives = 214/370 (58%), Gaps = 36/370 (10%)
 Frame = -3

Query  1646  GCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCT-RGSCVRKFSKEMPVEVKGDKE  1470
              CWVPPL + Q D+  Q+ K E        VK++ K T +     KF K   VEV  D+E
Sbjct  28    ACWVPPLLQPQ-DKPPQEIKKE------PKVKIKFKFTGKPKNEPKFRKGEIVEVSSDEE  80

Query  1469  GFERSWYASVVMEVLGNGKLLVQYQDLKTDDG-TDYLIEEVDASCIRPCPPEIHRISPFK  1293
             G++ +W+ + +++ LGN K LV+++DL  +DG  + L EE++   IRPCPP +     FK
Sbjct  81    GYQGAWFVATIIDTLGNEKFLVEHRDLLMNDGGIEVLKEEIETKFIRPCPPHVPMFGSFK  140

Query  1292  LLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAAT  1113
              L +VDAW  +GWWEG V +++   +  V F + NE+L FE+S LRPHQ+W +  W+ ++
Sbjct  141   RLQEVDAWYNDGWWEGMVVELVNSEECYVRFRN-NEVLKFESSKLRPHQDWIDGKWIMSS  199

Query  1112  KIDLPR--------------SSSDVMLNskvvkvkskSDRKAL-----GPKFS----KGM  1002
             K    R                + ++L   +    +K +R  +     G KF     KG 
Sbjct  200   KESSERVKKFGDVIHETENLGGTKLILKGPIPSESAKHNRDMISTVHNGSKFDLHFYKGT  259

Query  1001  LVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPL  822
              VE  S E+GY GSWY A + D     K+L+EY TL+TDD ++ LKE  D  +IRP PP 
Sbjct  260   NVEVKSDEQGYEGSWYPATVVDLYQNGKYLVEYSTLKTDDLTQQLKEVVDVSDIRPRPPD  319

Query  821   IHRFDRFKMFEEVDAWYNEGWWEGLISKV---LDGLNYVVYFWTTNEEIEFAHHGIRPHQ  651
             I  F R+   E VDAWYN+GWWEG++S V   L+G  Y VYFWT+NE +EF H+ +RPHQ
Sbjct  320   IDHFCRYVRQEWVDAWYNDGWWEGVVSNVGHGLNGFKYQVYFWTSNEVLEFEHNHLRPHQ  379

Query  650   EWIDKKWDIA  621
              WID +W +A
Sbjct  380   YWIDGRWVLA  389


 Score =   238 bits (607),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 135/323 (42%), Positives = 184/323 (57%), Gaps = 33/323 (10%)
 Frame = -3

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDES-EPLKEKADAF  846
             PKF KG +VE +S EEGY G+W+ A I D++G  KFL+E++ L  +D   E LKE+ +  
Sbjct  65    PKFRKGEIVEVSSDEEGYQGAWFVATIIDTLGNEKFLVEHRDLLMNDGGIEVLKEEIETK  124

Query  845   NIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHG  666
              IRPCPP +  F  FK  +EVDAWYN+GWWEG++ ++++     V F   NE ++F    
Sbjct  125   FIRPCPPHVPMFGSFKRLQEVDAWYNDGWWEGMVVELVNSEECYVRF-RNNEVLKFESSK  183

Query  665   IRPHQEWIDKKWDIAFRKSNNN--------------------LPNPKPGIMRRHSGGIAS  546
             +RPHQ+WID KW ++ ++S+                      L  P P    +H+  + S
Sbjct  184   LRPHQDWIDGKWIMSSKESSERVKKFGDVIHETENLGGTKLILKGPIPSESAKHNRDMIS  243

Query  545   --------ETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDL  390
                     +  F  G  VEVK DE+G +GSWYPA ++ L  NGKYLVE+ TLK D  T  
Sbjct  244   TVHNGSKFDLHFYKGTNVEVKSDEQGYEGSWYPATVVDLYQNGKYLVEYSTLKTDDLTQQ  303

Query  389   LVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEV---LEGAKYRVNFRT  219
             L +  D   +RP  P +    R+   E VDAW N+GW  G V  V   L G KY+V F T
Sbjct  304   LKEVVDVSDIRPRPPDIDHFCRYVRQEWVDAWYNDGWWEGVVSNVGHGLNGFKYQVYFWT  363

Query  218   TNEILEFRHHGLRLHQEWINGAW  150
             +NE+LEF H+ LR HQ WI+G W
Sbjct  364   SNEVLEFEHNHLRPHQYWIDGRW  386


 Score =   156 bits (395),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 120/343 (35%), Positives = 169/343 (49%), Gaps = 40/343 (12%)
 Frame = -3

Query  2051  EAQFNKGDRVEVLMRDNF--PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRK  1878
             E +F KG+ VEV   +      WF A ++      N++     VE   L  +D  ++  K
Sbjct  64    EPKFRKGEIVEVSSDEEGYQGAWFVATII--DTLGNEK---FLVEHRDLLMNDGGIEVLK  118

Query  1877  EYVHLSAVRPAPPGEPCC-YFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAV  1701
             E +    +RP PP  P    F+  +  D +Y N GW  G V E++ +    V   +    
Sbjct  119   EEIETKFIRPCPPHVPMFGSFKRLQEVDAWY-NDGWWEGMVVELVNSEECYVRFRNN---  174

Query  1700  ESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTP---SGVKLRIKCTR  1530
             E +K E  +LR H+DW DG W+   +ES      + KK  D +       G KL +K   
Sbjct  175   EVLKFESSKLRPHQDWIDGKWIMSSKESS----ERVKKFGDVIHETENLGGTKLILKGPI  230

Query  1529  GSCVRKFSKEM------------------PVEVKGDKEGFERSWYASVVMEVLGNGKLLV  1404
              S   K +++M                   VEVK D++G+E SWY + V+++  NGK LV
Sbjct  231   PSESAKHNRDMISTVHNGSKFDLHFYKGTNVEVKSDEQGYEGSWYPATVVDLYQNGKYLV  290

Query  1403  QYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKV--  1230
             +Y  LKTDD T  L E VD S IRP PP+I     +   + VDAW  +GWWEG VS V  
Sbjct  291   EYSTLKTDDLTQQLKEVVDVSDIRPRPPDIDHFCRYVRQEWVDAWYNDGWWEGVVSNVGH  350

Query  1229  -LGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKID  1104
              L   KY V F + NE+L FE + LRPHQ W +  WV A+ ++
Sbjct  351   GLNGFKYQVYFWTSNEVLEFEHNHLRPHQYWIDGRWVLASLVE  393


 Score =   110 bits (276),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 86/148 (58%), Gaps = 2/148 (1%)
 Frame = -3

Query  590  PKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLK  411
            PK  I  + +G   +E  F  G  VEV  DEEG QG+W+ A I+  +GN K+LVE R L 
Sbjct  49   PKVKIKFKFTGKPKNEPKFRKGEIVEVSSDEEGYQGAWFVATIIDTLGNEKFLVEHRDLL  108

Query  410  C-DFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYR  234
              D G ++L +E +   +RP  P +     F+ L+EVDAW N+GW  G V E++   +  
Sbjct  109  MNDGGIEVLKEEIETKFIRPCPPHVPMFGSFKRLQEVDAWYNDGWWEGMVVELVNSEECY  168

Query  233  VNFRTTNEILEFRHHGLRLHQEWINGAW  150
            V FR  NE+L+F    LR HQ+WI+G W
Sbjct  169  VRFR-NNEVLKFESSKLRPHQDWIDGKW  195



>ref|XP_002882477.1| agenet domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58736.1| agenet domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=459

 Score =   258 bits (660),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 179/489 (37%), Positives = 268/489 (55%), Gaps = 39/489 (8%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEV-LMRDNFPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             M+++  +  GDRVEV  +      +FPA V+  PSVRK      ++VE E+L        
Sbjct  1     MTSDRFWRGGDRVEVERLVSGATAYFPATVVSAPSVRKKL----VWVEHESLTVGGSVSV  56

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRG-WRRGTVDEILENSMYMVALGDE  1710
             R KEYV  + +RP+PP E    F+  +  DVF ++ G W RG V  + E S Y+V     
Sbjct  57    RMKEYVIPTRLRPSPPRELNRRFKADDEVDVFRDSEGCWVRGNVTTVFEESRYIVEFKGG  116

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPS-GVKLRIKCT  1533
             +  E ++V+Q+ LR+HR+W+DG WVP L +             +FL + +  +KL+IK  
Sbjct  117   NRPE-IEVDQFDLRLHREWQDGAWVPSLLQQS-----------NFLESKAQSIKLKIKIK  164

Query  1532  RGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDY-LIE  1356
             R     ++ K   VEV+ +++ ++ SWY + ++ +LG+ K +V++     DDG    L +
Sbjct  165   RRD---QYEKGALVEVRSEEKAYKDSWYCARILCLLGDDKYIVEHLKFSRDDGESIPLRD  221

Query  1355  EVDASCIRPCPP-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGD-AKYMVCFGSMNEL  1182
              V+A+ +RP PP E+  I  ++    VDAW    WW G VSKVLG  +KY V   S  E 
Sbjct  222   VVEANNMRPVPPSELPPIVCYEPGVIVDAWFNKRWWIGRVSKVLGGGSKYSVLIISTGEE  281

Query  1181  LTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGM  1002
              T    +LRPH++W N  WV  +K +  +     + + +  +             F  GM
Sbjct  282   PTILNFNLRPHKDWINGQWVNPSKEECYKPPLKKLKSCERAEKV-----------FKNGM  330

Query  1001  LVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFN-IRPCPP  825
             +VE  S E GY GSW++A I   +G N++ +EYQTL TDDE E LKE+A   +     PP
Sbjct  331   MVEVRSDERGYEGSWFSAKIVSYLGGNRYTVEYQTLTTDDEGELLKEEARGSDIRPIPPP  390

Query  824   LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLN-YVVYFWTTNEEIEFAHHGIRPHQE  648
             LI +  R++  E+VDAWYNEGWW G +  + +    Y VYF TT+E +EFA++ +RP Q 
Sbjct  391   LIPKAYRYESCEDVDAWYNEGWWSGRVYTINNNYTRYGVYFKTTDERLEFAYNDLRPCQV  450

Query  647   WIDKKWDIA  621
             W + KW  A
Sbjct  451   WRNGKWSRA  459


 Score =   192 bits (487),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 155/461 (34%), Positives = 240/461 (52%), Gaps = 30/461 (7%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLL-VQYQDLKTDDGTDYLIEE-VDASCIRPCPP  1320
             VEV+    G    + A+VV       KL+ V+++ L         ++E V  + +RP PP
Sbjct  13    VEVERLVSGATAYFPATVVSAPSVRKKLVWVEHESLTVGGSVSVRMKEYVIPTRLRPSPP  72

Query  1319  -EIHRISPFKLLDKVDAWVGN--GWWEGHVSKVLGDAKYMVCF-GSMNELLTFEASDLRP  1152
              E++R   FK  D+VD +  +   W  G+V+ V  +++Y+V F G     +  +  DLR 
Sbjct  73    RELNR--RFKADDEVDVFRDSEGCWVRGNVTTVFEESRYIVEFKGGNRPEIEVDQFDLRL  130

Query  1151  HQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEG  972
             H+EW++  WV +    L + S+ +   ++ +K+K K  R+    ++ KG LVE  S E+ 
Sbjct  131   HREWQDGAWVPS----LLQQSNFLESKAQSIKLKIKIKRR---DQYEKGALVEVRSEEKA  183

Query  971   YHGSWYTAVIFDSIGPNKFLLEYQTLRTDD-ESEPLKEKADAFNIRPCPPLIHRFDRFKM  795
             Y  SWY A I   +G +K+++E+     DD ES PL++  +A N+RP PP          
Sbjct  184   YKDSWYCARILCLLGDDKYIVEHLKFSRDDGESIPLRDVVEANNMRPVPP--SELPPIVC  241

Query  794   FEE---VDAWYNEGWWEGLISKVLDG-LNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWD  627
             +E    VDAW+N+ WW G +SKVL G   Y V   +T EE    +  +RPH++WI+ +W 
Sbjct  242   YEPGVIVDAWFNKRWWIGRVSKVLGGGSKYSVLIISTGEEPTILNFNLRPHKDWINGQWV  301

Query  626   IAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIG  447
                ++     P  K     R      +E  F  G  VEV+ DE G +GSW+ A I+  +G
Sbjct  302   NPSKEECYKPPLKKLKSCER------AEKVFKNGMMVEVRSDERGYEGSWFSAKIVSYLG  355

Query  446   NGKYLVEFRTLKCDFGTDLLVQEADAL-SVRPSAPILQRVDRFRPLEEVDAWSNNGWRVG  270
               +Y VE++TL  D   +LL +EA          P++ +  R+   E+VDAW N GW  G
Sbjct  356   GNRYTVEYQTLTTDDEGELLKEEARGSDIRPIPPPLIPKAYRYESCEDVDAWYNEGWWSG  415

Query  269   QVCEVLEG-AKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +V  +     +Y V F+TT+E LEF ++ LR  Q W NG W
Sbjct  416   RVYTINNNYTRYGVYFKTTDERLEFAYNDLRPCQVWRNGKW  456



>ref|XP_006417584.1| hypothetical protein EUTSA_v10009728mg [Eutrema salsugineum]
 gb|ESQ35937.1| hypothetical protein EUTSA_v10009728mg [Eutrema salsugineum]
Length=533

 Score =   259 bits (663),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 168/506 (33%), Positives = 252/506 (50%), Gaps = 40/506 (8%)
 Frame = -3

Query  1598  QQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGN  1419
             Q+KK+    +TP       +  R            VE+  D+  F  SWYA  V+    +
Sbjct  36    QKKKAPKKSITP-------RAKRNRLPSYLKPGSAVEISSDEVEFRGSWYAGSVVTTSSS  88

Query  1418  ----GKLLVQYQDLKTD-DGTDYLIEEVDASCIRPCPP---EIHRISPFKLLDKVDAWVG  1263
                 GK+ V+Y  L  D +G   L E VD + +RP  P   E  +   F + + VDA+  
Sbjct  89    DKNSGKVQVEYTTLFFDKEGQKRLREVVDMAQLRPPAPPMSEREKKKDFAVGEVVDAFHN  148

Query  1262  NGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSD  1083
             +GWWEG V++VLGD ++ V F    E + +    LR H+EW N  W           S +
Sbjct  149   DGWWEGDVTEVLGDGQFSVFFRGTREQIRYSKDQLRLHREWVNGAWKPPLDEPEEEESEE  208

Query  1082  VMLNskvvkvks------kSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPN  921
                +    +         ++ R      FS G LVE +S EEG+ G W+ A + + IG +
Sbjct  209   DKGDDTEDEESLLSLVDPETARAVAKEMFSTGTLVEVSSDEEGFKGCWFVAKVIEPIGED  268

Query  920   KFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLIS  741
             K+L+EY+ LR +D  EPLKE+ D  +IRP PP     D F +  +VDA+YN+GWW G + 
Sbjct  269   KYLVEYRDLREEDGIEPLKEEIDFLHIRPPPPSEEDID-FAVGNKVDAFYNDGWWAGHVI  327

Query  740   KVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDI---------AFRKSNNNLPNP  588
             + +      ++F  + E+I     G+R H+ W++  W +         A + S +    P
Sbjct  328   ESMHDGRIGIFFKESGEKIRIGRQGLRLHKVWVNGTWQLPLKGGEIKRAKKVSCDRNVRP  387

Query  587   KPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKC  408
             K G  +++           IG  VEV   EEG + SW+ A ++   G  K LVE+  LK 
Sbjct  388   KNGFDKQY---------ISIGTPVEVSSIEEGFEDSWFLAKLIEYRGTDKCLVEYDKLKA  438

Query  407   DFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVN  228
             + G + L +E D   +RP  P +  V+ F  L++VDA  N+GW VG V ++L  + Y V 
Sbjct  439   EDGKEPLREEVDVFQIRPQPPEMVVVNPFEKLDKVDALYNDGWWVGSVKKILAKSSYLVY  498

Query  227   FRTTNEILEFRHHGLRLHQEWINGAW  150
             F   +E+L+F H  LRLHQEWI+G W
Sbjct  499   FSKNDEVLKFHHSQLRLHQEWIDGNW  524


 Score =   257 bits (657),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 160/463 (35%), Positives = 249/463 (54%), Gaps = 24/463 (5%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRP-APP---GEPCC  1824
             W+  +V+  S   ++ +G++ VE+ TL  D +  KR +E V ++ +RP APP    E   
Sbjct  77    WYAGSVVTTS-SSDKNSGKVQVEYTTLFFDKEGQKRLREVVDMAQLRPPAPPMSEREKKK  135

Query  1823  YFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDG  1644
              F VGE  D F+ N GW  G V E+L +  + V        E ++  + QLR+HR+W +G
Sbjct  136   DFAVGEVVDAFH-NDGWWEGDVTEVLGDGQFSVFF--RGTREQIRYSKDQLRLHREWVNG  192

Query  1643  CWVPPLEESQVDQQYQQ----KKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGD  1476
              W PPL+E + ++  +      + E+ L++     +  +  R      FS    VEV  D
Sbjct  193   AWKPPLDEPEEEESEEDKGDDTEDEESLLS----LVDPETARAVAKEMFSTGTLVEVSSD  248

Query  1475  KEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPF  1296
             +EGF+  W+ + V+E +G  K LV+Y+DL+ +DG + L EE+D   IRP PP    I  F
Sbjct  249   EEGFKGCWFVAKVIEPIGEDKYLVEYRDLREEDGIEPLKEEIDFLHIRPPPPSEEDID-F  307

Query  1295  KLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAA  1116
              + +KVDA+  +GWW GHV + + D +  + F    E +      LR H+ W N  W   
Sbjct  308   AVGNKVDAFYNDGWWAGHVIESMHDGRIGIFFKESGEKIRIGRQGLRLHKVWVNGTW---  364

Query  1115  TKIDLPRSSSDVMLNskvvkvkskSDRKALGPKF-SKGMLVEATSFEEGYHGSWYTAVIF  939
                 LP    ++    KV   ++   +     ++ S G  VE +S EEG+  SW+ A + 
Sbjct  365   ---QLPLKGGEIKRAKKVSCDRNVRPKNGFDKQYISIGTPVEVSSIEEGFEDSWFLAKLI  421

Query  938   DSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGW  759
             +  G +K L+EY  L+ +D  EPL+E+ D F IRP PP +   + F+  ++VDA YN+GW
Sbjct  422   EYRGTDKCLVEYDKLKAEDGKEPLREEVDVFQIRPQPPEMVVVNPFEKLDKVDALYNDGW  481

Query  758   WEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             W G + K+L   +Y+VYF   +E ++F H  +R HQEWID  W
Sbjct  482   WVGSVKKILAKSSYLVYFSKNDEVLKFHHSQLRLHQEWIDGNW  524


 Score =   176 bits (446),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 116/326 (36%), Positives = 171/326 (52%), Gaps = 26/326 (8%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             PET    A+  F+ G  VEV    + F   WF A V+ P         +  VE+  L  +
Sbjct  226   PETARAVAKEMFSTGTLVEVSSDEEGFKGCWFVAKVIEPIGED-----KYLVEYRDLREE  280

Query  1901  D--DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYM  1728
             D  +P+K   +++H   +RP PP E    F VG   D FY N GW  G V E + +    
Sbjct  281   DGIEPLKEEIDFLH---IRPPPPSEEDIDFAVGNKVDAFY-NDGWWAGHVIESMHDGRIG  336

Query  1727  VALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKL  1548
             +    +++ E +++ +  LR+H+ W +G W  PL+  ++ +   +K S D  + P     
Sbjct  337   IFF--KESGEKIRIGRQGLRLHKVWVNGTWQLPLKGGEIKRA--KKVSCDRNVRPKN---  389

Query  1547  RIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTD  1368
                   G   +  S   PVEV   +EGFE SW+ + ++E  G  K LV+Y  LK +DG +
Sbjct  390   ------GFDKQYISIGTPVEVSSIEEGFEDSWFLAKLIEYRGTDKCLVEYDKLKAEDGKE  443

Query  1367  YLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMN  1188
              L EEVD   IRP PPE+  ++PF+ LDKVDA   +GWW G V K+L  + Y+V F   +
Sbjct  444   PLREEVDVFQIRPQPPEMVVVNPFEKLDKVDALYNDGWWVGSVKKILAKSSYLVYFSKND  503

Query  1187  ELLTFEASDLRPHQEWKNNNWVAATK  1110
             E+L F  S LR HQEW + NW+ ++K
Sbjct  504   EVLKFHHSQLRLHQEWIDGNWITSSK  529



>emb|CDY64778.1| BnaC08g50050D [Brassica napus]
Length=500

 Score =   259 bits (661),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 171/515 (33%), Positives = 265/515 (51%), Gaps = 48/515 (9%)
 Frame = -3

Query  1619  SQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASV  1440
             S+  Q  Q+KK+ +  +TP  ++L      G+ V         E+  D+ GF  SWY   
Sbjct  3     SRRRQSTQRKKAPESSVTP--IRLPPFLKPGAAV---------EISSDEAGFRGSWYLGE  51

Query  1439  VMEVLGN---GKLLVQYQDLKTD-DGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDA  1272
             V+ V  +    K  V+Y  L  D +G   L E VDA+ +RP  P +       + + VDA
Sbjct  52    VVAVPSSDSTTKCEVEYTTLFLDKEGRKRLKEVVDAAQLRPPVPAMSE-RDVAVGEDVDA  110

Query  1271  WVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRS  1092
             +  +GWWEG V++VLGD ++ V F +  E + F   +LR H+EW N  W    +      
Sbjct  111   FYSDGWWEGTVTEVLGDGRFSVYFRASKEQIRFRRDELRFHREWVNGAWKPPIEEREEEE  170

Query  1091  SSDVMLNskvvkvkskSD----------RKALGPKFSKGMLVEATSFEEGYHGSWYTAVI  942
               +  +        +  D          R      FS G +VE +S EEG+ GSW++A +
Sbjct  171   EEEESIVFTAKFESTLIDLLSRVDPETARGIAKQMFSIGTIVEVSSDEEGFKGSWFSAKV  230

Query  941   FDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEG  762
              + +  +K+L+EY+ LR ++  EPLKE+AD  +IRP PP     D F + +++DA+YN+ 
Sbjct  231   IEHVDEDKYLVEYRDLREENGIEPLKEEADFLHIRPPPPTDEDVD-FAVGDKIDAFYNDA  289

Query  761   WWEG-LISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAF-----RKSNNN  600
             WW G +I  + DG+  V + + T E++ F  HG+R H++WI+  W +       +++   
Sbjct  290   WWVGDVIESMKDGIVGVCFRY-TGEKMRFGRHGLRLHRDWINGTWQLPLKRGEMKRATKK  348

Query  599   LP-----NPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKY  435
             +P      PK  I + H         F +G  VEV   EEG + SW+ A ++   G  K+
Sbjct  349   VPCDRNVRPKKAIDKEH---------FSVGDPVEVSSVEEGFEDSWFLAKVIEYRGTDKW  399

Query  434   LVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEV  255
             LVE+  LK + G + L +E +   +RP       V+ F  L+EVDA  N+GW  G V +V
Sbjct  400   LVEYEKLKAEDGKEPLREEVNVFQIRPRPQETVMVNPFEKLDEVDALYNDGWWFGVVKKV  459

Query  254   LEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             L  + Y V+F  T+E+L+F    LR HQEWI+G W
Sbjct  460   LAKSNYLVHFPKTDEVLKFHVSRLRPHQEWIDGKW  494


 Score =   251 bits (641),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 161/460 (35%), Positives = 252/460 (55%), Gaps = 18/460 (4%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCYFRV  1812
             W+   V+  +V  +    +  VE+ TL  D +  KR KE V  + +RP  P        V
Sbjct  47    WYLGEVV--AVPSSDSTTKCEVEYTTLFLDKEGRKRLKEVVDAAQLRPPVPAMSERDVAV  104

Query  1811  GESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVP  1632
             GE  D FY + GW  GTV E+L +  + V      + E ++  + +LR HR+W +G W P
Sbjct  105   GEDVDAFYSD-GWWEGTVTEVLGDGRFSVYF--RASKEQIRFRRDELRFHREWVNGAWKP  161

Query  1631  PLEESQVDQQYQQKK--SEDFLMTPSGVKLRI--KCTRGSCVRKFSKEMPVEVKGDKEGF  1464
             P+EE + +++ ++    +  F  T   +  R+  +  RG   + FS    VEV  D+EGF
Sbjct  162   PIEEREEEEEEEESIVFTAKFESTLIDLLSRVDPETARGIAKQMFSIGTIVEVSSDEEGF  221

Query  1463  ERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLD  1284
             + SW+++ V+E +   K LV+Y+DL+ ++G + L EE D   IRP PP    +  F + D
Sbjct  222   KGSWFSAKVIEHVDEDKYLVEYRDLREENGIEPLKEEADFLHIRPPPPTDEDVD-FAVGD  280

Query  1283  KVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNW-VAATKI  1107
             K+DA+  + WW G V + + D    VCF    E + F    LR H++W N  W +   + 
Sbjct  281   KIDAFYNDAWWVGDVIESMKDGIVGVCFRYTGEKMRFGRHGLRLHRDWINGTWQLPLKRG  340

Query  1106  DLPRSSSDVMLNskvvkvkskSDRKALGPK-FSKGMLVEATSFEEGYHGSWYTAVIFDSI  930
             ++ R++  V  +  V        +KA+  + FS G  VE +S EEG+  SW+ A + +  
Sbjct  341   EMKRATKKVPCDRNVRP------KKAIDKEHFSVGDPVEVSSVEEGFEDSWFLAKVIEYR  394

Query  929   GPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEG  750
             G +K+L+EY+ L+ +D  EPL+E+ + F IRP P      + F+  +EVDA YN+GWW G
Sbjct  395   GTDKWLVEYEKLKAEDGKEPLREEVNVFQIRPRPQETVMVNPFEKLDEVDALYNDGWWFG  454

Query  749   LISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             ++ KVL   NY+V+F  T+E ++F    +RPHQEWID KW
Sbjct  455   VVKKVLAKSNYLVHFPKTDEVLKFHVSRLRPHQEWIDGKW  494


 Score =   170 bits (431),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 119/344 (35%), Positives = 178/344 (52%), Gaps = 30/344 (9%)
 Frame = -3

Query  2114  TFLGKLEH*VIDV-----PETHAMSAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVR  1956
              F  K E  +ID+     PET    A+  F+ G  VEV    + F   WF A V+     
Sbjct  177   VFTAKFESTLIDLLSRVDPETARGIAKQMFSIGTIVEVSSDEEGFKGSWFSAKVI-----  231

Query  1955  KNQRAGQIYVEFETLCSDD--DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYEN  1782
             ++    +  VE+  L  ++  +P+K   +++H   +RP PP +    F VG+  D FY N
Sbjct  232   EHVDEDKYLVEYRDLREENGIEPLKEEADFLH---IRPPPPTDEDVDFAVGDKIDAFY-N  287

Query  1781  RGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQ  1602
               W  G V E +++ +  V        E ++  +  LR+HRDW +G W  PL+  ++ + 
Sbjct  288   DAWWVGDVIESMKDGIVGVCF--RYTGEKMRFGRHGLRLHRDWINGTWQLPLKRGEMKRA  345

Query  1601  YQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLG  1422
              ++         P    +R K  +      FS   PVEV   +EGFE SW+ + V+E  G
Sbjct  346   TKK--------VPCDRNVRPK--KAIDKEHFSVGDPVEVSSVEEGFEDSWFLAKVIEYRG  395

Query  1421  NGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGH  1242
               K LV+Y+ LK +DG + L EEV+   IRP P E   ++PF+ LD+VDA   +GWW G 
Sbjct  396   TDKWLVEYEKLKAEDGKEPLREEVNVFQIRPRPQETVMVNPFEKLDEVDALYNDGWWFGV  455

Query  1241  VSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             V KVL  + Y+V F   +E+L F  S LRPHQEW +  W+A++K
Sbjct  456   VKKVLAKSNYLVHFPKTDEVLKFHVSRLRPHQEWIDGKWIASSK  499



>gb|KFK43230.1| hypothetical protein AALP_AA1G097000 [Arabis alpina]
Length=546

 Score =   259 bits (663),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 165/494 (33%), Positives = 252/494 (51%), Gaps = 50/494 (10%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNG-----KLLVQYQDLKTD-DGTDYLIEEVDASCIR  1332
             VE+   + GF  SWY   V+ +  +      K  V+Y  L  D DG   L E VD   +R
Sbjct  48    VEISSIEPGFRGSWYPGKVITIPSSSDKDSVKCQVEYTTLFFDKDGKKRLKEAVDIIQLR  107

Query  1331  PCPPEIHRISPFKLL---DKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
             P  P +      K++   ++VDA+  +GWWEG V++VL D ++ V F S  E + F   +
Sbjct  108   PPAPSMSESEKKKVIAVGEEVDAFYNDGWWEGTVTEVLDDGRFSVFFKSSKEQIRFRKDE  167

Query  1160  LRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPK---------FSK  1008
              R H+EW N  W    K D+     +      + + + +     + P+         F  
Sbjct  168   FRFHREWLNGAWKPPLK-DIEEEELEEEKVDDIEEEEEEHFLARVDPETARAIAKQMFVS  226

Query  1007  GMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCP  828
             G +VE +S EEG+ GSW+ A + + IG +K+L+EY+ LR +DE +PLKE+ D  +IRP P
Sbjct  227   GTIVEVSSEEEGFKGSWFVAKVIEPIGEDKYLVEYRDLREEDEIQPLKEECDFLHIRPPP  286

Query  827   PLIHRFDRFKMFEEVDAWYNEGWWEG-LISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQ  651
             P     D F + ++VDA+YN+GWW G +I    DG+   ++F  + E++ F   G+R H+
Sbjct  287   PSEDGID-FAVGDKVDAFYNDGWWVGDVIESKQDGI-VGIFFRQSGEKMRFGRQGLRLHK  344

Query  650   EWIDKKWDIAFRKSN---NNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGS  480
             EWI+  W++  ++       +PN       R    I  +  F IG  +EV  +EEG + S
Sbjct  345   EWINGTWELPLKRGQIKRAKVPNVSCDRNVRPKKAIGKQE-FSIGTSIEVSSEEEGFEDS  403

Query  479   WYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVD  300
             W+PA ++   GN K L+E+  +K + G +LL +E D   +RP       V+ F  L+ VD
Sbjct  404   WFPAKLIEYRGNDKCLIEYDHMKAEDGIELLREEVDVSQIRPQPLETVMVNAFEKLDRVD  463

Query  299   AWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHG----------------------  186
             A  N+GW VG + +VL  A Y V+F  T E+L+F H                        
Sbjct  464   ALYNDGWWVGVIMKVLAKASYLVHFEKTEEVLKFHHSXXXXXXSYLVHFEKTEEVLKFHH  523

Query  185   --LRLHQEWINGAW  150
               LR+HQEWI+G W
Sbjct  524   SQLRIHQEWIDGKW  537


 Score =   231 bits (588),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 158/485 (33%), Positives = 239/485 (49%), Gaps = 39/485 (8%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPG----EPCC  1824
             W+P  V+      ++ + +  VE+ TL  D D  KR KE V +  +RP  P     E   
Sbjct  61    WYPGKVITIPSSSDKDSVKCQVEYTTLFFDKDGKKRLKEAVDIIQLRPPAPSMSESEKKK  120

Query  1823  YFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDG  1644
                VGE  D FY N GW  GTV E+L++  + V    + + E ++  + + R HR+W +G
Sbjct  121   VIAVGEEVDAFY-NDGWWEGTVTEVLDDGRFSVFF--KSSKEQIRFRKDEFRFHREWLNG  177

Query  1643  CWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRI--KCTRGSCVRKFSKEMPVEVKGDKE  1470
              W PPL++ + ++  ++K  +           R+  +  R    + F     VEV  ++E
Sbjct  178   AWKPPLKDIEEEELEEEKVDDIEEEEEEHFLARVDPETARAIAKQMFVSGTIVEVSSEEE  237

Query  1469  GFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKL  1290
             GF+ SW+ + V+E +G  K LV+Y+DL+ +D    L EE D   IRP PP    I  F +
Sbjct  238   GFKGSWFVAKVIEPIGEDKYLVEYRDLREEDEIQPLKEECDFLHIRPPPPSEDGID-FAV  296

Query  1289  LDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
              DKVDA+  +GWW G V +   D    + F    E + F    LR H+EW N  W    +
Sbjct  297   GDKVDAFYNDGWWVGDVIESKQDGIVGIFFRQSGEKMRFGRQGLRLHKEWINGTW----E  352

Query  1109  IDLPRSSSDVMLNskvvkvkskSDRKALGPK-FSKGMLVEATSFEEGYHGSWYTAVIFDS  933
             + L R          V   ++   +KA+G + FS G  +E +S EEG+  SW+ A + + 
Sbjct  353   LPLKRGQIKRAKVPNVSCDRNVRPKKAIGKQEFSIGTSIEVSSEEEGFEDSWFPAKLIEY  412

Query  932   IGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWE  753
              G +K L+EY  ++ +D  E L+E+ D   IRP P      + F+  + VDA YN+GWW 
Sbjct  413   RGNDKCLIEYDHMKAEDGIELLREEVDVSQIRPQPLETVMVNAFEKLDRVDALYNDGWWV  472

Query  752   GLISKVL------------------------DGLNYVVYFWTTNEEIEFAHHGIRPHQEW  645
             G+I KVL                           +Y+V+F  T E ++F H  +R HQEW
Sbjct  473   GVIMKVLAKASYLVHFEKTEEVLKFHHSXXXXXXSYLVHFEKTEEVLKFHHSQLRIHQEW  532

Query  644   IDKKW  630
             ID KW
Sbjct  533   IDGKW  537


 Score =   155 bits (393),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 111/350 (32%), Positives = 167/350 (48%), Gaps = 48/350 (14%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVLMRDNF--PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             PET    A+  F  G  VEV   +      WF A V+ P         +  VE+  L  +
Sbjct  213   PETARAIAKQMFVSGTIVEVSSEEEGFKGSWFVAKVIEPI-----GEDKYLVEYRDLREE  267

Query  1901  DD--PMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYM  1728
             D+  P+K   +++H   +RP PP E    F VG+  D FY N GW  G V E  ++ +  
Sbjct  268   DEIQPLKEECDFLH---IRPPPPSEDGIDFAVGDKVDAFY-NDGWWVGDVIESKQDGI--  321

Query  1727  VALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKL  1548
             V +    + E ++  +  LR+H++W +G W  PL+  Q+ +      S D  + P     
Sbjct  322   VGIFFRQSGEKMRFGRQGLRLHKEWINGTWELPLKRGQIKRAKVPNVSCDRNVRPK----  377

Query  1547  RIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTD  1368
                  +    ++FS    +EV  ++EGFE SW+ + ++E  GN K L++Y  +K +DG +
Sbjct  378   -----KAIGKQEFSIGTSIEVSSEEEGFEDSWFPAKLIEYRGNDKCLIEYDHMKAEDGIE  432

Query  1367  YLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDA----------  1218
              L EEVD S IRP P E   ++ F+ LD+VDA   +GWW G + KVL  A          
Sbjct  433   LLREEVDVSQIRPQPLETVMVNAFEKLDRVDALYNDGWWVGVIMKVLAKASYLVHFEKTE  492

Query  1217  --------------KYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
                            Y+V F    E+L F  S LR HQEW +  W+ ++K
Sbjct  493   EVLKFHHSXXXXXXSYLVHFEKTEEVLKFHHSQLRIHQEWIDGKWITSSK  542


 Score = 89.4 bits (220),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 9/135 (7%)
 Frame = -3

Query  527  GAKVEVKDDEEGNQGSWYPALILRLIGNG-----KYLVEFRTLKCDF-GTDLLVQEADAL  366
            GA VE+   E G +GSWYP  ++ +  +      K  VE+ TL  D  G   L +  D +
Sbjct  45   GAAVEISSIEPGFRGSWYPGKVITIPSSSDKDSVKCQVEYTTLFFDKDGKKRLKEAVDII  104

Query  365  SVRPSAPILQRVDRFRPL---EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFR  195
             +RP AP +   ++ + +   EEVDA+ N+GW  G V EVL+  ++ V F+++ E + FR
Sbjct  105  QLRPPAPSMSESEKKKVIAVGEEVDAFYNDGWWEGTVTEVLDDGRFSVFFKSSKEQIRFR  164

Query  194  HHGLRLHQEWINGAW  150
                R H+EW+NGAW
Sbjct  165  KDEFRFHREWLNGAW  179



>ref|XP_002892499.1| agenet domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68758.1| agenet domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=518

 Score =   259 bits (661),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 168/505 (33%), Positives = 249/505 (49%), Gaps = 38/505 (8%)
 Frame = -3

Query  1574  LMTPSGVKLRIKC-TRGSCVRKFSKEMP--------VEVKGDKEGFERSWYASVVMEVLG  1422
             L   S  K R K  T     R   K +P        VE+  D+ GF  SWY   V+    
Sbjct  13    LGISSPAKQRKKAPTNSMATRANRKRLPSYLKPGATVEISSDEIGFRGSWYLGKVITTPS  72

Query  1421  NGK----LLVQYQDLKTD-DGTDYLIEEVDASCIRPCPP---EIHRISPFKLLDKVDAWV  1266
             + K      V+Y  L  D +GT  L E VD S +RP  P   E  +     + ++VDA+ 
Sbjct  73    SHKDSLKCQVEYTTLFFDKEGTKPLKEVVDMSQLRPPAPPMSEREKKKDIAVGEEVDAFY  132

Query  1265  GNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNW-----------VA  1119
              +GWWEG V++VL D K+ V F S  E + F   +LR H+EW +  W             
Sbjct  133   NDGWWEGDVTEVLDDGKFSVFFRSSKEQIRFRKDELRFHREWLDGAWKPPLEETEEEESE  192

Query  1118  ATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIF  939
               K+D      D++    +        R      FS G +VE +S EEG+ G W+ A + 
Sbjct  193   EDKLDDSEDEEDILARVDLETT-----RAIAKQMFSSGTIVEVSSDEEGFQGCWFAAKVV  247

Query  938   DSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGW  759
             + +G +KFL+EY+ LR  D  EPLKE+ D  +IRP PP     D F + ++++A+YN+GW
Sbjct  248   EPVGEDKFLVEYRDLREKDGIEPLKEETDFLHIRPPPPRDEDID-FAVGDKINAFYNDGW  306

Query  758   WEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPG  579
             W G++   +      +YF  + E++ F   G+R H++W+D  W +  +     +   K  
Sbjct  307   WVGVVIDGMKDGTVGIYFRQSQEKMRFGRQGLRLHKDWVDGTWQLPLK--GGKIKREKTV  364

Query  578   IMRRH--SGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCD  405
             +  R+        +  F IG  VEV  +EEG + SW+ A ++   G  K LVE+  LK +
Sbjct  365   LCNRNVRPKKATEKQAFSIGTPVEVSPEEEGFEDSWFLAKLIEYRGKDKCLVEYDKLKAE  424

Query  404   FGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNF  225
              G + L +E +   +RP       V  F   ++V+A  N+GW VG + +VL  + Y V F
Sbjct  425   DGKEPLREEVNVSQIRPQPLESVMVSPFERHDKVNALYNDGWWVGVIRKVLAKSSYLVLF  484

Query  224   RTTNEILEFRHHGLRLHQEWINGAW  150
               T E+L F H  LRLHQEWI+G W
Sbjct  485   EKTQEMLRFHHSQLRLHQEWIDGKW  509


 Score =   247 bits (630),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 167/469 (36%), Positives = 242/469 (52%), Gaps = 26/469 (6%)
 Frame = -3

Query  1991  WFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRP-APP---GEPC  1827
             W+   V+  PS  K+    Q  VE+ TL  D +  K  KE V +S +RP APP    E  
Sbjct  62    WYLGKVITTPSSHKDSLKCQ--VEYTTLFFDKEGTKPLKEVVDMSQLRPPAPPMSEREKK  119

Query  1826  CYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKD  1647
                 VGE  D FY N GW  G V E+L++  + V      + E ++  + +LR HR+W D
Sbjct  120   KDIAVGEEVDAFY-NDGWWEGDVTEVLDDGKFSVFF--RSSKEQIRFRKDELRFHREWLD  176

Query  1646  GCWVPPLEESQV-----DQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVK  1482
             G W PPLEE++      D+    +  ED L      ++ ++ TR    + FS    VEV 
Sbjct  177   GAWKPPLEETEEEESEEDKLDDSEDEEDIL-----ARVDLETTRAIAKQMFSSGTIVEVS  231

Query  1481  GDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRIS  1302
              D+EGF+  W+A+ V+E +G  K LV+Y+DL+  DG + L EE D   IRP PP    I 
Sbjct  232   SDEEGFQGCWFAAKVVEPVGEDKFLVEYRDLREKDGIEPLKEETDFLHIRPPPPRDEDID  291

Query  1301  PFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWV  1122
              F + DK++A+  +GWW G V   + D    + F    E + F    LR H++W +  W 
Sbjct  292   -FAVGDKINAFYNDGWWVGVVIDGMKDGTVGIYFRQSQEKMRFGRQGLRLHKDWVDGTWQ  350

Query  1121  AATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVI  942
                K    +    V+ N  V   K+   +      FS G  VE +  EEG+  SW+ A +
Sbjct  351   LPLKGGKIKREKTVLCNRNVRPKKATEKQA-----FSIGTPVEVSPEEEGFEDSWFLAKL  405

Query  941   FDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEG  762
              +  G +K L+EY  L+ +D  EPL+E+ +   IRP P        F+  ++V+A YN+G
Sbjct  406   IEYRGKDKCLVEYDKLKAEDGKEPLREEVNVSQIRPQPLESVMVSPFERHDKVNALYNDG  465

Query  761   WWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFR  615
             WW G+I KVL   +Y+V F  T E + F H  +R HQEWID KW  +F+
Sbjct  466   WWVGVIRKVLAKSSYLVLFEKTQEMLRFHHSQLRLHQEWIDGKWITSFK  514


 Score =   165 bits (418),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 112/329 (34%), Positives = 172/329 (52%), Gaps = 27/329 (8%)
 Frame = -3

Query  2084  IDVPETHAMSAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETL  1911
             +D+  T A+ A+  F+ G  VEV    + F   WF A V+ P         +  VE+  L
Sbjct  209   VDLETTRAI-AKQMFSSGTIVEVSSDEEGFQGCWFAAKVVEPV-----GEDKFLVEYRDL  262

Query  1910  CSDD--DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENS  1737
                D  +P+K   +++H   +RP PP +    F VG+  + FY N GW  G V + +++ 
Sbjct  263   REKDGIEPLKEETDFLH---IRPPPPRDEDIDFAVGDKINAFY-NDGWWVGVVIDGMKDG  318

Query  1736  MYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSG  1557
                V +    + E ++  +  LR+H+DW DG W  PL+  ++       K E  ++    
Sbjct  319   T--VGIYFRQSQEKMRFGRQGLRLHKDWVDGTWQLPLKGGKI-------KREKTVLCNRN  369

Query  1556  VKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD  1377
             V+ +    + +  + FS   PVEV  ++EGFE SW+ + ++E  G  K LV+Y  LK +D
Sbjct  370   VRPK----KATEKQAFSIGTPVEVSPEEEGFEDSWFLAKLIEYRGKDKCLVEYDKLKAED  425

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
             G + L EEV+ S IRP P E   +SPF+  DKV+A   +GWW G + KVL  + Y+V F 
Sbjct  426   GKEPLREEVNVSQIRPQPLESVMVSPFERHDKVNALYNDGWWVGVIRKVLAKSSYLVLFE  485

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATK  1110
                E+L F  S LR HQEW +  W+ + K
Sbjct  486   KTQEMLRFHHSQLRLHQEWIDGKWITSFK  514



>ref|XP_006307268.1| hypothetical protein CARUB_v10008882mg [Capsella rubella]
 gb|EOA40166.1| hypothetical protein CARUB_v10008882mg [Capsella rubella]
Length=512

 Score =   258 bits (660),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 161/473 (34%), Positives = 244/473 (52%), Gaps = 39/473 (8%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGN-GKLLVQYQDLKTD-DGTDYLIEEVDASCIRPCPP  1320
             VE+  D+ GF  SWY   V+ +  +  K  V+Y  L  D +GT  L E VD S +RP  P
Sbjct  45    VEISSDETGFRGSWYLGKVITIPSSEDKCQVEYTTLFFDKEGTKPLKEVVDMSQLRPPAP  104

Query  1319  EIHRISPFKLL---DKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPH  1149
              +      +++   ++VDA+  +GWWEG V++VLGD K+ V F S  E + F+   LR H
Sbjct  105   PMSEREKKRVIAIGEEVDAFYNDGWWEGDVTEVLGDGKFSVFFRSSKEQIQFKKDQLRFH  164

Query  1148  QEWKNNNW-----------VAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGM  1002
             +EW +  W               K+D  +   + +L    ++      ++     FS G 
Sbjct  165   REWVDGAWKPPLEEAEGEESEEDKVDDTQDEEEDILPRVDLETTRVIAKQI----FSTGT  220

Query  1001  LVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPL  822
             +VE +S EEG+   W+ A + + IG +KFL+EYQ LR  D  EPLKE  D  +IRP PP 
Sbjct  221   IVEVSSDEEGFKECWFAAKVVEPIGDDKFLVEYQDLREKDGIEPLKEVTDFLHIRPPPPR  280

Query  821   IHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
                 D F + ++++A+YN+GWW G + + +      +YF  + E++ F   G+R H++W+
Sbjct  281   DENMD-FSVGDKINAFYNDGWWVGFVIEGMKDGTVGIYFRQSREKMRFGRQGLRLHKDWV  339

Query  641   DKKWDIAFRK---------SNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGN  489
             +  W +  +          S N    PK  I +           F IG  VEV  +EEG 
Sbjct  340   NGTWKLPLKGGEIKREKTVSCNRNVRPKKAIEKHK---------FSIGTSVEVSSEEEGF  390

Query  488   QGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLE  309
             + SW+ A ++   G  K LVE+  LK + G + L +E +   +RP       V  F   +
Sbjct  391   EDSWFSAKLVEYRGKEKCLVEYDKLKAEDGKEPLREEVNVSQIRPLPLEQVMVCPFEKND  450

Query  308   EVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +V+A  N+GW VG + +VL  + Y V+F  T EIL F H  LRLHQ+WI+G W
Sbjct  451   KVNALYNDGWWVGVIRKVLAKSSYLVHFEKTQEILRFHHSQLRLHQDWIDGKW  503


 Score =   247 bits (630),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 164/451 (36%), Positives = 238/451 (53%), Gaps = 30/451 (7%)
 Frame = -3

Query  1928  VEFETLCSDDDPMKRRKEYVHLSAVRP-APP---GEPCCYFRVGESADVFYENRGWRRGT  1761
             VE+ TL  D +  K  KE V +S +RP APP    E      +GE  D FY N GW  G 
Sbjct  75    VEYTTLFFDKEGTKPLKEVVDMSQLRPPAPPMSEREKKRVIAIGEEVDAFY-NDGWWEGD  133

Query  1760  VDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEE--------SQVDQ  1605
             V E+L +  + V      + E ++ ++ QLR HR+W DG W PPLEE         +VD 
Sbjct  134   VTEVLGDGKFSVFF--RSSKEQIQFKKDQLRFHREWVDGAWKPPLEEAEGEESEEDKVDD  191

Query  1604  QYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVL  1425
                Q + ED L      ++ ++ TR    + FS    VEV  D+EGF+  W+A+ V+E +
Sbjct  192   T--QDEEEDILP-----RVDLETTRVIAKQIFSTGTIVEVSSDEEGFKECWFAAKVVEPI  244

Query  1424  GNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEG  1245
             G+ K LV+YQDL+  DG + L E  D   IRP PP    +  F + DK++A+  +GWW G
Sbjct  245   GDDKFLVEYQDLREKDGIEPLKEVTDFLHIRPPPPRDENMD-FSVGDKINAFYNDGWWVG  303

Query  1244  HVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNsk  1065
              V + + D    + F    E + F    LR H++W N  W       LP    ++     
Sbjct  304   FVIEGMKDGTVGIYFRQSREKMRFGRQGLRLHKDWVNGTW------KLPLKGGEIKREKT  357

Query  1064  vvkvkskSDRKALGP-KFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRT  888
             V   ++   +KA+   KFS G  VE +S EEG+  SW++A + +  G  K L+EY  L+ 
Sbjct  358   VSCNRNVRPKKAIEKHKFSIGTSVEVSSEEEGFEDSWFSAKLVEYRGKEKCLVEYDKLKA  417

Query  887   DDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVY  708
             +D  EPL+E+ +   IRP P        F+  ++V+A YN+GWW G+I KVL   +Y+V+
Sbjct  418   EDGKEPLREEVNVSQIRPLPLEQVMVCPFEKNDKVNALYNDGWWVGVIRKVLAKSSYLVH  477

Query  707   FWTTNEEIEFAHHGIRPHQEWIDKKWDIAFR  615
             F  T E + F H  +R HQ+WID KW   F+
Sbjct  478   FEKTQEILRFHHSQLRLHQDWIDGKWITNFK  508


 Score =   155 bits (392),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 109/325 (34%), Positives = 166/325 (51%), Gaps = 26/325 (8%)
 Frame = -3

Query  2072  ETHAMSAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDD  1899
             ET  + A+  F+ G  VEV    + F   WF A V+ P         +  VE++ L   D
Sbjct  206   ETTRVIAKQIFSTGTIVEVSSDEEGFKECWFAAKVVEPI-----GDDKFLVEYQDLREKD  260

Query  1898  --DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMV  1725
               +P+K   +++H   +RP PP +    F VG+  + FY N GW  G V E +++    V
Sbjct  261   GIEPLKEVTDFLH---IRPPPPRDENMDFSVGDKINAFY-NDGWWVGFVIEGMKDGT--V  314

Query  1724  ALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLR  1545
              +    + E ++  +  LR+H+DW +G W  PL+  ++       K E  +     V+ +
Sbjct  315   GIYFRQSREKMRFGRQGLRLHKDWVNGTWKLPLKGGEI-------KREKTVSCNRNVRPK  367

Query  1544  IKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDY  1365
                 +     KFS    VEV  ++EGFE SW+++ ++E  G  K LV+Y  LK +DG + 
Sbjct  368   KAIEK----HKFSIGTSVEVSSEEEGFEDSWFSAKLVEYRGKEKCLVEYDKLKAEDGKEP  423

Query  1364  LIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNE  1185
             L EEV+ S IRP P E   + PF+  DKV+A   +GWW G + KVL  + Y+V F    E
Sbjct  424   LREEVNVSQIRPLPLEQVMVCPFEKNDKVNALYNDGWWVGVIRKVLAKSSYLVHFEKTQE  483

Query  1184  LLTFEASDLRPHQEWKNNNWVAATK  1110
             +L F  S LR HQ+W +  W+   K
Sbjct  484   ILRFHHSQLRLHQDWIDGKWITNFK  508


 Score = 91.3 bits (225),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 77/131 (59%), Gaps = 5/131 (4%)
 Frame = -3

Query  527  GAKVEVKDDEEGNQGSWYPALILRLIGN-GKYLVEFRTLKCDF-GTDLLVQEADALSVRP  354
            GA VE+  DE G +GSWY   ++ +  +  K  VE+ TL  D  GT  L +  D   +RP
Sbjct  42   GAAVEISSDETGFRGSWYLGKVITIPSSEDKCQVEYTTLFFDKEGTKPLKEVVDMSQLRP  101

Query  353  SAPILQRVDRFRPL---EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGL  183
             AP +   ++ R +   EEVDA+ N+GW  G V EVL   K+ V FR++ E ++F+   L
Sbjct  102  PAPPMSEREKKRVIAIGEEVDAFYNDGWWEGDVTEVLGDGKFSVFFRSSKEQIQFKKDQL  161

Query  182  RLHQEWINGAW  150
            R H+EW++GAW
Sbjct  162  RFHREWVDGAW  172


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 56/107 (52%), Gaps = 5/107 (5%)
 Frame = -3

Query  1928  VEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEP-CCYFRVGESADVFYENRGWRRGTVDE  1752
             VE++ L ++D     R+E V++S +RP P  +   C F   +  +  Y N GW  G + +
Sbjct  410   VEYDKLKAEDGKEPLREE-VNVSQIRPLPLEQVMVCPFEKNDKVNALY-NDGWWVGVIRK  467

Query  1751  ILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQV  1611
             +L  S Y+V    E   E ++    QLR+H+DW DG W+   +  +V
Sbjct  468   VLAKSSYLVHF--EKTQEILRFHHSQLRLHQDWIDGKWITNFKSQKV  512



>gb|KFK41896.1| hypothetical protein AALP_AA2G186200 [Arabis alpina]
Length=439

 Score =   254 bits (649),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 179/486 (37%), Positives = 255/486 (52%), Gaps = 68/486 (14%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEV-LMRDNFPIWFPAAVL-RPSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             M+ +  +  GDRVEV  +     ++FPA V+  PSVRKN     ++VE E+L        
Sbjct  1     MANDGFWRGGDRVEVERVVSGAVVYFPAIVVNEPSVRKNV----VWVEHESLVVGGS--V  54

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVF-YENRGWRRGTVDE-ILENSMYMVALGD  1713
             R KEYV  + +RP+PP EP   F+ G+  DVF Y    W RG V + +L +S Y+V    
Sbjct  55    RMKEYVIPTHLRPSPPCEPNRRFKSGDEVDVFRYIEGCWVRGKVKKTVLGDSRYIVEFSG  114

Query  1712  EDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCT  1533
             E+  E+V V  + LR+HRDW+DG W P    S + Q        D     +  KL+IK  
Sbjct  115   ENRPETV-VGHFNLRLHRDWEDGTWKP----SSLPQ------GNDLEPIHNSTKLKIKLR  163

Query  1532  RGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEE  1353
             R     ++ KE  VEV+ +KE ++                            G+  L + 
Sbjct  164   RRE---QYEKEAIVEVRSEKEAYK----------------------------GSCPLRDL  192

Query  1352  VDASCIRPCPP-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVL-GDAKYMVCFGSMNELL  1179
             V+A  +RP PP ++  +  F+L D+VDAW    WW G VSKVL G +KY+V   S  E  
Sbjct  193   VEAKNMRPVPPQQLSSVGRFELGDEVDAWFNKRWWIGSVSKVLGGGSKYLVYLISTGEEQ  252

Query  1178  TFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGML  999
                  +LR  ++W N  WV+ +K +        + + +                FSKGM+
Sbjct  253   IVPHFNLRTRKDWINGQWVSPSKEECCNPPMKKLKSCETAMKG-----------FSKGMM  301

Query  998   VEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPP-L  822
             VE  S E GY G+WY+A I   +G N++++EYQTL+TDDE E LKE A   +IRP PP L
Sbjct  302   VEVESDEPGYEGAWYSAKIVRYLGENRYIVEYQTLKTDDEKELLKEVARGSDIRPVPPTL  361

Query  821   IHRFDRFKMFEEVDAWYNEGWWEGLISKVL--DGLNYVVYFWTTNEEIEFAHHGIRPHQE  648
             I R  R+++ E+VDAW+N+GWW G + ++   D   YVVYF TTNE +EF +  +RP Q 
Sbjct  362   IQRVSRYELDEDVDAWFNDGWWSGRVYEISNDDYTRYVVYFKTTNEALEFEYSDLRPSQV  421

Query  647   WIDKKW  630
             W   +W
Sbjct  422   WRKGEW  427


 Score =   194 bits (493),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 141/419 (34%), Positives = 213/419 (51%), Gaps = 53/419 (13%)
 Frame = -3

Query  1376  GTDYLIEEVDASCIRPCPP-EIHRISPFKLLDKVDA--WVGNGWWEGHVSK-VLGDAKYM  1209
             G+  + E V  + +RP PP E +R   FK  D+VD   ++   W  G V K VLGD++Y+
Sbjct  52    GSVRMKEYVIPTHLRPSPPCEPNR--RFKSGDEVDVFRYIEGCWVRGKVKKTVLGDSRYI  109

Query  1208  VCFGSMNELLTFEAS-DLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRK  1032
             V F   N   T     +LR H++W++  W  ++   LP+ +    +++          R+
Sbjct  110   VEFSGENRPETVVGHFNLRLHRDWEDGTWKPSS---LPQGNDLEPIHNSTKLKIKLRRRE  166

Query  1031  ALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKAD  852
                 ++ K  +VE  S +E Y GS                             PL++  +
Sbjct  167   ----QYEKEAIVEVRSEKEAYKGSC----------------------------PLRDLVE  194

Query  851   AFNIRPCPP-LIHRFDRFKMFEEVDAWYNEGWWEGLISKVL-DGLNYVVYFWTTNEEIEF  678
             A N+RP PP  +    RF++ +EVDAW+N+ WW G +SKVL  G  Y+VY  +T EE   
Sbjct  195   AKNMRPVPPQQLSSVGRFELGDEVDAWFNKRWWIGSVSKVLGGGSKYLVYLISTGEEQIV  254

Query  677   AHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDE  498
              H  +R  ++WI+ +W    ++   N P      M++      +   F  G  VEV+ DE
Sbjct  255   PHFNLRTRKDWINGQWVSPSKEECCNPP------MKKLKSCETAMKGFSKGMMVEVESDE  308

Query  497   EGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPIL-QRVDRF  321
              G +G+WY A I+R +G  +Y+VE++TLK D   +LL + A    +RP  P L QRV R+
Sbjct  309   PGYEGAWYSAKIVRYLGENRYIVEYQTLKTDDEKELLKEVARGSDIRPVPPTLIQRVSRY  368

Query  320   RPLEEVDAWSNNGWRVGQVCEVL--EGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
                E+VDAW N+GW  G+V E+   +  +Y V F+TTNE LEF +  LR  Q W  G W
Sbjct  369   ELDEDVDAWFNDGWWSGRVYEISNDDYTRYVVYFKTTNEALEFEYSDLRPSQVWRKGEW  427


 Score =   147 bits (372),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/266 (34%), Positives = 139/266 (52%), Gaps = 32/266 (12%)
 Frame = -3

Query  1880  KEYVHLSAVRPAPPGEPCCY--FRVGESADVFYENRGWRRGTVDEILENS----MYMVAL  1719
             ++ V    +RP PP +      F +G+  D ++ N+ W  G+V ++L       +Y+++ 
Sbjct  190   RDLVEAKNMRPVPPQQLSSVGRFELGDEVDAWF-NKRWWIGSVSKVLGGGSKYLVYLIST  248

Query  1718  GDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIK  1539
             G+E  V       + LR  +DW +G WV P +E   +   ++ KS +  M          
Sbjct  249   GEEQIVP-----HFNLRTRKDWINGQWVSPSKEECCNPPMKKLKSCETAM----------  293

Query  1538  CTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLI  1359
                    + FSK M VEV+ D+ G+E +WY++ ++  LG  + +V+YQ LKTDD  + L 
Sbjct  294   -------KGFSKGMMVEVESDEPGYEGAWYSAKIVRYLGENRYIVEYQTLKTDDEKELLK  346

Query  1358  EEVDASCIRPCPPE-IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGD--AKYMVCFGSMN  1188
             E    S IRP PP  I R+S ++L + VDAW  +GWW G V ++  D   +Y+V F + N
Sbjct  347   EVARGSDIRPVPPTLIQRVSRYELDEDVDAWFNDGWWSGRVYEISNDDYTRYVVYFKTTN  406

Query  1187  ELLTFEASDLRPHQEWKNNNWVAATK  1110
             E L FE SDLRP Q W+   W    K
Sbjct  407   EALEFEYSDLRPSQVWRKGEWTRGEK  432



>ref|NP_172403.3| agenet domain-containing protein [Arabidopsis thaliana]
 gb|AAY34173.1| At1g09320 [Arabidopsis thaliana]
 gb|AEE28429.1| agenet domain-containing protein [Arabidopsis thaliana]
Length=517

 Score =   256 bits (655),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 160/473 (34%), Positives = 242/473 (51%), Gaps = 34/473 (7%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNG-----KLLVQYQDLKTD-DGTDYLIEEVDASCIR  1332
             VE+  D+ GF  SWY   V+ +  +      K  V+Y  L  D +GT  L E VD S +R
Sbjct  45    VEISSDEIGFRGSWYMGKVITIPSSSDKDSVKCQVEYTTLFFDKEGTKPLKEVVDMSQLR  104

Query  1331  PCPPEIHRISPFKLL---DKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
             P  P +  I   K +   ++VDA+  +GWWEG V++VL D K+ V F S  E + F   +
Sbjct  105   PPAPPMSEIEKKKKIVVGEEVDAFYNDGWWEGDVTEVLDDGKFSVFFRSSKEQIRFRKDE  164

Query  1160  LRPHQEWKNNNW-------------VAATKIDLPRSSSDVMLNskvvkvkskSDRKALGP  1020
             LR H+EW +  W                 K+D      D++    +        R     
Sbjct  165   LRFHREWVDGAWKPPLEETEEEEDESEEDKLDDSEDEEDILARVDLETT-----RAIAKQ  219

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNI  840
              FS G +VE +S EEG+ G W+ A + + +G +KFL+EY+ LR  D  EPLKE+ D  +I
Sbjct  220   MFSSGTVVEVSSDEEGFQGCWFAAKVVEPVGEDKFLVEYRDLREKDGIEPLKEETDFLHI  279

Query  839   RPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYV---VYFWTTNEEIEFAHH  669
             RP PP     D F + ++++A+YN+GWW G+   V+DG+ +    +YF  + E++ F   
Sbjct  280   RPPPPRDEDID-FAVGDKINAFYNDGWWVGV---VIDGMKHGTVGIYFRQSQEKMRFGRQ  335

Query  668   GIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGN  489
             G+R H++W+D  W +  +                       +  F IG  +EV  +EEG 
Sbjct  336   GLRLHKDWVDGTWQLPLKGGKIKREKTVSCNRNVRPKKATEKQAFSIGTPIEVSPEEEGF  395

Query  488   QGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLE  309
             + SW+ A ++   G  K LVE+  LK + G + L +E +   +RP       V  F   +
Sbjct  396   EDSWFLAKLIEYRGKDKCLVEYDNLKAEDGKEPLREEVNVSRIRPLPLESVMVSPFERHD  455

Query  308   EVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +V+A  N+GW VG + +VL  + Y V F+ T E+L+F H  LRLHQEWI+G W
Sbjct  456   KVNALYNDGWWVGVIRKVLAKSSYLVLFKNTQELLKFHHSQLRLHQEWIDGKW  508


 Score =   243 bits (620),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 160/471 (34%), Positives = 242/471 (51%), Gaps = 27/471 (6%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRP-APPG---EPCC  1824
             W+   V+      ++ + +  VE+ TL  D +  K  KE V +S +RP APP    E   
Sbjct  58    WYMGKVITIPSSSDKDSVKCQVEYTTLFFDKEGTKPLKEVVDMSQLRPPAPPMSEIEKKK  117

Query  1823  YFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDG  1644
                VGE  D FY N GW  G V E+L++  + V      + E ++  + +LR HR+W DG
Sbjct  118   KIVVGEEVDAFY-NDGWWEGDVTEVLDDGKFSVFF--RSSKEQIRFRKDELRFHREWVDG  174

Query  1643  CWVPPLEESQVDQQYQ-------QKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEV  1485
              W PPLEE++ ++           +  ED L      ++ ++ TR    + FS    VEV
Sbjct  175   AWKPPLEETEEEEDESEEDKLDDSEDEEDIL-----ARVDLETTRAIAKQMFSSGTVVEV  229

Query  1484  KGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRI  1305
               D+EGF+  W+A+ V+E +G  K LV+Y+DL+  DG + L EE D   IRP PP    I
Sbjct  230   SSDEEGFQGCWFAAKVVEPVGEDKFLVEYRDLREKDGIEPLKEETDFLHIRPPPPRDEDI  289

Query  1304  SPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNW  1125
               F + DK++A+  +GWW G V   +      + F    E + F    LR H++W +  W
Sbjct  290   D-FAVGDKINAFYNDGWWVGVVIDGMKHGTVGIYFRQSQEKMRFGRQGLRLHKDWVDGTW  348

Query  1124  VAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPK-FSKGMLVEATSFEEGYHGSWYTA  948
                    LP     +     V   ++   +KA   + FS G  +E +  EEG+  SW+ A
Sbjct  349   ------QLPLKGGKIKREKTVSCNRNVRPKKATEKQAFSIGTPIEVSPEEEGFEDSWFLA  402

Query  947   VIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYN  768
              + +  G +K L+EY  L+ +D  EPL+E+ +   IRP P        F+  ++V+A YN
Sbjct  403   KLIEYRGKDKCLVEYDNLKAEDGKEPLREEVNVSRIRPLPLESVMVSPFERHDKVNALYN  462

Query  767   EGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFR  615
             +GWW G+I KVL   +Y+V F  T E ++F H  +R HQEWID KW  +F+
Sbjct  463   DGWWVGVIRKVLAKSSYLVLFKNTQELLKFHHSQLRLHQEWIDGKWITSFK  513


 Score =   167 bits (422),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 109/329 (33%), Positives = 171/329 (52%), Gaps = 27/329 (8%)
 Frame = -3

Query  2084  IDVPETHAMSAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETL  1911
             +D+  T A+ A+  F+ G  VEV    + F   WF A V+ P         +  VE+  L
Sbjct  208   VDLETTRAI-AKQMFSSGTVVEVSSDEEGFQGCWFAAKVVEPV-----GEDKFLVEYRDL  261

Query  1910  CSDD--DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENS  1737
                D  +P+K   +++H   +RP PP +    F VG+  + FY N GW  G V + +++ 
Sbjct  262   REKDGIEPLKEETDFLH---IRPPPPRDEDIDFAVGDKINAFY-NDGWWVGVVIDGMKHG  317

Query  1736  MYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSG  1557
                V +    + E ++  +  LR+H+DW DG W  PL+  ++ ++               
Sbjct  318   T--VGIYFRQSQEKMRFGRQGLRLHKDWVDGTWQLPLKGGKIKRE-----------KTVS  364

Query  1556  VKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD  1377
                 ++  + +  + FS   P+EV  ++EGFE SW+ + ++E  G  K LV+Y +LK +D
Sbjct  365   CNRNVRPKKATEKQAFSIGTPIEVSPEEEGFEDSWFLAKLIEYRGKDKCLVEYDNLKAED  424

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
             G + L EEV+ S IRP P E   +SPF+  DKV+A   +GWW G + KVL  + Y+V F 
Sbjct  425   GKEPLREEVNVSRIRPLPLESVMVSPFERHDKVNALYNDGWWVGVIRKVLAKSSYLVLFK  484

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             +  ELL F  S LR HQEW +  W+ + K
Sbjct  485   NTQELLKFHHSQLRLHQEWIDGKWITSFK  513


 Score = 90.9 bits (224),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 78/135 (58%), Gaps = 9/135 (7%)
 Frame = -3

Query  527  GAKVEVKDDEEGNQGSWYPALILRLIGNG-----KYLVEFRTLKCDF-GTDLLVQEADAL  366
            G+ VE+  DE G +GSWY   ++ +  +      K  VE+ TL  D  GT  L +  D  
Sbjct  42   GSAVEISSDEIGFRGSWYMGKVITIPSSSDKDSVKCQVEYTTLFFDKEGTKPLKEVVDMS  101

Query  365  SVRPSAPILQRVDRFRPL---EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFR  195
             +RP AP +  +++ + +   EEVDA+ N+GW  G V EVL+  K+ V FR++ E + FR
Sbjct  102  QLRPPAPPMSEIEKKKKIVVGEEVDAFYNDGWWEGDVTEVLDDGKFSVFFRSSKEQIRFR  161

Query  194  HHGLRLHQEWINGAW  150
               LR H+EW++GAW
Sbjct  162  KDELRFHREWVDGAW  176



>dbj|BAD44256.1| unknown protein [Arabidopsis thaliana]
Length=517

 Score =   256 bits (655),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 161/473 (34%), Positives = 243/473 (51%), Gaps = 34/473 (7%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNG-----KLLVQYQDLKTD-DGTDYLIEEVDASCIR  1332
             VE+  D+ GF  SWY   V+ +  +      K  V+Y  L  D +GT  L E VD S +R
Sbjct  45    VEISSDEIGFRGSWYMGKVITIPSSSDKDSVKCQVEYTTLFFDKEGTKPLKEVVDMSQLR  104

Query  1331  -PCPP--EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
              P PP  EI +     + ++VDA+  +GWWEG V++VL D K+ V F S  E + F   +
Sbjct  105   SPAPPMSEIEKKKKIVVGEEVDAFYNDGWWEGDVTEVLDDGKFSVFFRSSKEQIRFRKDE  164

Query  1160  LRPHQEWKNNNW-------------VAATKIDLPRSSSDVMLNskvvkvkskSDRKALGP  1020
             LR H+EW +  W                 K+D      D++    +        R     
Sbjct  165   LRFHREWVDGAWKPPLEETEEEEDESEEDKLDDSEDEEDILARVDLETT-----RAIAKQ  219

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNI  840
              FS G +VE +S EEG+ G W+ A + + +G +KFL+EY+ LR  D  EPLKE+ D  +I
Sbjct  220   MFSSGTVVEVSSDEEGFQGCWFAAKVVEPVGEDKFLVEYRDLREKDGIEPLKEETDFLHI  279

Query  839   RPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYV---VYFWTTNEEIEFAHH  669
             RP PP     D F + ++++A+YN+GWW G+   V+DG+ +    +YF  + E++ F   
Sbjct  280   RPPPPRDEDID-FAVGDKINAFYNDGWWVGV---VIDGMKHGTVGIYFRQSQEKMRFGRQ  335

Query  668   GIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGN  489
             G+R H++W+D  W +  +                       +  F IG  +EV  +EEG 
Sbjct  336   GLRLHKDWVDGTWQLPLKGGKIKREKTVSCNRNVRPKKATEKQAFSIGTPIEVSPEEEGF  395

Query  488   QGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLE  309
             + SW+ A ++   G  K LVE+  LK + G + L +E +   +RP       V  F   +
Sbjct  396   EDSWFLAKLIEYRGKDKCLVEYDNLKAEDGKEPLREEVNVSRIRPLPLESVMVSPFERHD  455

Query  308   EVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +V+A  N+GW VG + +VL  + Y V F+ T E+L+F H  LRLHQEWI+G W
Sbjct  456   KVNALYNDGWWVGVIRKVLAKSSYLVLFKNTQELLKFHHSQLRLHQEWIDGKW  508


 Score =   243 bits (620),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 160/471 (34%), Positives = 242/471 (51%), Gaps = 27/471 (6%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVR-PAPPG---EPCC  1824
             W+   V+      ++ + +  VE+ TL  D +  K  KE V +S +R PAPP    E   
Sbjct  58    WYMGKVITIPSSSDKDSVKCQVEYTTLFFDKEGTKPLKEVVDMSQLRSPAPPMSEIEKKK  117

Query  1823  YFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDG  1644
                VGE  D FY N GW  G V E+L++  + V      + E ++  + +LR HR+W DG
Sbjct  118   KIVVGEEVDAFY-NDGWWEGDVTEVLDDGKFSVFF--RSSKEQIRFRKDELRFHREWVDG  174

Query  1643  CWVPPLEESQVDQQYQ-------QKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEV  1485
              W PPLEE++ ++           +  ED L      ++ ++ TR    + FS    VEV
Sbjct  175   AWKPPLEETEEEEDESEEDKLDDSEDEEDIL-----ARVDLETTRAIAKQMFSSGTVVEV  229

Query  1484  KGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRI  1305
               D+EGF+  W+A+ V+E +G  K LV+Y+DL+  DG + L EE D   IRP PP    I
Sbjct  230   SSDEEGFQGCWFAAKVVEPVGEDKFLVEYRDLREKDGIEPLKEETDFLHIRPPPPRDEDI  289

Query  1304  SPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNW  1125
               F + DK++A+  +GWW G V   +      + F    E + F    LR H++W +  W
Sbjct  290   D-FAVGDKINAFYNDGWWVGVVIDGMKHGTVGIYFRQSQEKMRFGRQGLRLHKDWVDGTW  348

Query  1124  VAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPK-FSKGMLVEATSFEEGYHGSWYTA  948
                    LP     +     V   ++   +KA   + FS G  +E +  EEG+  SW+ A
Sbjct  349   ------QLPLKGGKIKREKTVSCNRNVRPKKATEKQAFSIGTPIEVSPEEEGFEDSWFLA  402

Query  947   VIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYN  768
              + +  G +K L+EY  L+ +D  EPL+E+ +   IRP P        F+  ++V+A YN
Sbjct  403   KLIEYRGKDKCLVEYDNLKAEDGKEPLREEVNVSRIRPLPLESVMVSPFERHDKVNALYN  462

Query  767   EGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFR  615
             +GWW G+I KVL   +Y+V F  T E ++F H  +R HQEWID KW  +F+
Sbjct  463   DGWWVGVIRKVLAKSSYLVLFKNTQELLKFHHSQLRLHQEWIDGKWITSFK  513


 Score =   167 bits (422),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 109/329 (33%), Positives = 171/329 (52%), Gaps = 27/329 (8%)
 Frame = -3

Query  2084  IDVPETHAMSAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETL  1911
             +D+  T A+ A+  F+ G  VEV    + F   WF A V+ P         +  VE+  L
Sbjct  208   VDLETTRAI-AKQMFSSGTVVEVSSDEEGFQGCWFAAKVVEPV-----GEDKFLVEYRDL  261

Query  1910  CSDD--DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENS  1737
                D  +P+K   +++H   +RP PP +    F VG+  + FY N GW  G V + +++ 
Sbjct  262   REKDGIEPLKEETDFLH---IRPPPPRDEDIDFAVGDKINAFY-NDGWWVGVVIDGMKHG  317

Query  1736  MYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSG  1557
                V +    + E ++  +  LR+H+DW DG W  PL+  ++ ++               
Sbjct  318   T--VGIYFRQSQEKMRFGRQGLRLHKDWVDGTWQLPLKGGKIKRE-----------KTVS  364

Query  1556  VKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD  1377
                 ++  + +  + FS   P+EV  ++EGFE SW+ + ++E  G  K LV+Y +LK +D
Sbjct  365   CNRNVRPKKATEKQAFSIGTPIEVSPEEEGFEDSWFLAKLIEYRGKDKCLVEYDNLKAED  424

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
             G + L EEV+ S IRP P E   +SPF+  DKV+A   +GWW G + KVL  + Y+V F 
Sbjct  425   GKEPLREEVNVSRIRPLPLESVMVSPFERHDKVNALYNDGWWVGVIRKVLAKSSYLVLFK  484

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             +  ELL F  S LR HQEW +  W+ + K
Sbjct  485   NTQELLKFHHSQLRLHQEWIDGKWITSFK  513


 Score = 87.8 bits (216),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 77/135 (57%), Gaps = 9/135 (7%)
 Frame = -3

Query  527  GAKVEVKDDEEGNQGSWYPALILRLIGNG-----KYLVEFRTLKCDF-GTDLLVQEADAL  366
            G+ VE+  DE G +GSWY   ++ +  +      K  VE+ TL  D  GT  L +  D  
Sbjct  42   GSAVEISSDEIGFRGSWYMGKVITIPSSSDKDSVKCQVEYTTLFFDKEGTKPLKEVVDMS  101

Query  365  SVRPSAPILQRVDRFRPL---EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFR  195
             +R  AP +  +++ + +   EEVDA+ N+GW  G V EVL+  K+ V FR++ E + FR
Sbjct  102  QLRSPAPPMSEIEKKKKIVVGEEVDAFYNDGWWEGDVTEVLDDGKFSVFFRSSKEQIRFR  161

Query  194  HHGLRLHQEWINGAW  150
               LR H+EW++GAW
Sbjct  162  KDELRFHREWVDGAW  176



>gb|KFK43229.1| hypothetical protein AALP_AA1G097000 [Arabis alpina]
Length=544

 Score =   257 bits (656),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 164/492 (33%), Positives = 250/492 (51%), Gaps = 48/492 (10%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNG-----KLLVQYQDLKTD-DGTDYLIEEVDASCIR  1332
             VE+   + GF  SWY   V+ +  +      K  V+Y  L  D DG   L E VD   +R
Sbjct  48    VEISSIEPGFRGSWYPGKVITIPSSSDKDSVKCQVEYTTLFFDKDGKKRLKEAVDIIQLR  107

Query  1331  PCPPEIHRISPFKLL---DKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
             P  P +      K++   ++VDA+  +GWWEG V++VL D ++ V F S  E + F   +
Sbjct  108   PPAPSMSESEKKKVIAVGEEVDAFYNDGWWEGTVTEVLDDGRFSVFFKSSKEQIRFRKDE  167

Query  1160  LRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPK---------FSK  1008
              R H+EW N  W    K D+     +      + + + +     + P+         F  
Sbjct  168   FRFHREWLNGAWKPPLK-DIEEEELEEEKVDDIEEEEEEHFLARVDPETARAIAKQMFVS  226

Query  1007  GMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCP  828
             G +VE +S EEG+ GSW+ A + + IG +K+L+EY+ LR +DE +PLKE+ D  +IRP P
Sbjct  227   GTIVEVSSEEEGFKGSWFVAKVIEPIGEDKYLVEYRDLREEDEIQPLKEECDFLHIRPPP  286

Query  827   PLIHRFDRFKMFEEVDAWYNEGWWEG-LISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQ  651
             P     D F + ++VDA+YN+GWW G +I    DG+   ++F  + E++ F   G+R H+
Sbjct  287   PSEDGID-FAVGDKVDAFYNDGWWVGDVIESKQDGI-VGIFFRQSGEKMRFGRQGLRLHK  344

Query  650   EWIDKKWDIAFRKSN-NNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWY  474
             EWI+  W++  ++       N       R    I  +  F IG  +EV  +EEG + SW+
Sbjct  345   EWINGTWELPLKRGQIKRAKNVSCDRNVRPKKAIGKQE-FSIGTSIEVSSEEEGFEDSWF  403

Query  473   PALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAW  294
             PA ++   GN K L+E+  +K + G +LL +E D   +RP       V+ F  L+ VDA 
Sbjct  404   PAKLIEYRGNDKCLIEYDHMKAEDGIELLREEVDVSQIRPQPLETVMVNAFEKLDRVDAL  463

Query  293   SNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHG------------------------  186
              N+GW VG + +VL  A Y V+F  T E+L+F H                          
Sbjct  464   YNDGWWVGVIMKVLAKASYLVHFEKTEEVLKFHHSXXXXXXSYLVHFEKTEEVLKFHHSQ  523

Query  185   LRLHQEWINGAW  150
             LR+HQEWI+G W
Sbjct  524   LRIHQEWIDGKW  535


 Score =   234 bits (598),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 158/485 (33%), Positives = 239/485 (49%), Gaps = 41/485 (8%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPG----EPCC  1824
             W+P  V+      ++ + +  VE+ TL  D D  KR KE V +  +RP  P     E   
Sbjct  61    WYPGKVITIPSSSDKDSVKCQVEYTTLFFDKDGKKRLKEAVDIIQLRPPAPSMSESEKKK  120

Query  1823  YFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDG  1644
                VGE  D FY N GW  GTV E+L++  + V    + + E ++  + + R HR+W +G
Sbjct  121   VIAVGEEVDAFY-NDGWWEGTVTEVLDDGRFSVFF--KSSKEQIRFRKDEFRFHREWLNG  177

Query  1643  CWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRI--KCTRGSCVRKFSKEMPVEVKGDKE  1470
              W PPL++ + ++  ++K  +           R+  +  R    + F     VEV  ++E
Sbjct  178   AWKPPLKDIEEEELEEEKVDDIEEEEEEHFLARVDPETARAIAKQMFVSGTIVEVSSEEE  237

Query  1469  GFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKL  1290
             GF+ SW+ + V+E +G  K LV+Y+DL+ +D    L EE D   IRP PP    I  F +
Sbjct  238   GFKGSWFVAKVIEPIGEDKYLVEYRDLREEDEIQPLKEECDFLHIRPPPPSEDGID-FAV  296

Query  1289  LDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
              DKVDA+  +GWW G V +   D    + F    E + F    LR H+EW N  W     
Sbjct  297   GDKVDAFYNDGWWVGDVIESKQDGIVGIFFRQSGEKMRFGRQGLRLHKEWINGTW-----  351

Query  1109  IDLPRSSSDVMLNskvvkvkskSDRKALGPK-FSKGMLVEATSFEEGYHGSWYTAVIFDS  933
              +LP     +     V   ++   +KA+G + FS G  +E +S EEG+  SW+ A + + 
Sbjct  352   -ELPLKRGQIKRAKNVSCDRNVRPKKAIGKQEFSIGTSIEVSSEEEGFEDSWFPAKLIEY  410

Query  932   IGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWE  753
              G +K L+EY  ++ +D  E L+E+ D   IRP P      + F+  + VDA YN+GWW 
Sbjct  411   RGNDKCLIEYDHMKAEDGIELLREEVDVSQIRPQPLETVMVNAFEKLDRVDALYNDGWWV  470

Query  752   GLISKVL------------------------DGLNYVVYFWTTNEEIEFAHHGIRPHQEW  645
             G+I KVL                           +Y+V+F  T E ++F H  +R HQEW
Sbjct  471   GVIMKVLAKASYLVHFEKTEEVLKFHHSXXXXXXSYLVHFEKTEEVLKFHHSQLRIHQEW  530

Query  644   IDKKW  630
             ID KW
Sbjct  531   IDGKW  535


 Score =   154 bits (390),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 109/350 (31%), Positives = 169/350 (48%), Gaps = 50/350 (14%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVLMRDNF--PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             PET    A+  F  G  VEV   +      WF A V+ P         +  VE+  L  +
Sbjct  213   PETARAIAKQMFVSGTIVEVSSEEEGFKGSWFVAKVIEPI-----GEDKYLVEYRDLREE  267

Query  1901  DD--PMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYM  1728
             D+  P+K   +++H   +RP PP E    F VG+  D FY N GW  G V E  ++ +  
Sbjct  268   DEIQPLKEECDFLH---IRPPPPSEDGIDFAVGDKVDAFY-NDGWWVGDVIESKQDGI--  321

Query  1727  VALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKL  1548
             V +    + E ++  +  LR+H++W +G W  PL+  Q+      K++++          
Sbjct  322   VGIFFRQSGEKMRFGRQGLRLHKEWINGTWELPLKRGQI------KRAKNV-----SCDR  370

Query  1547  RIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTD  1368
              ++  +    ++FS    +EV  ++EGFE SW+ + ++E  GN K L++Y  +K +DG +
Sbjct  371   NVRPKKAIGKQEFSIGTSIEVSSEEEGFEDSWFPAKLIEYRGNDKCLIEYDHMKAEDGIE  430

Query  1367  YLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDA----------  1218
              L EEVD S IRP P E   ++ F+ LD+VDA   +GWW G + KVL  A          
Sbjct  431   LLREEVDVSQIRPQPLETVMVNAFEKLDRVDALYNDGWWVGVIMKVLAKASYLVHFEKTE  490

Query  1217  --------------KYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
                            Y+V F    E+L F  S LR HQEW +  W+ ++K
Sbjct  491   EVLKFHHSXXXXXXSYLVHFEKTEEVLKFHHSQLRIHQEWIDGKWITSSK  540


 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 9/135 (7%)
 Frame = -3

Query  527  GAKVEVKDDEEGNQGSWYPALILRLIGNG-----KYLVEFRTLKCDF-GTDLLVQEADAL  366
            GA VE+   E G +GSWYP  ++ +  +      K  VE+ TL  D  G   L +  D +
Sbjct  45   GAAVEISSIEPGFRGSWYPGKVITIPSSSDKDSVKCQVEYTTLFFDKDGKKRLKEAVDII  104

Query  365  SVRPSAPILQRVDRFRPL---EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFR  195
             +RP AP +   ++ + +   EEVDA+ N+GW  G V EVL+  ++ V F+++ E + FR
Sbjct  105  QLRPPAPSMSESEKKKVIAVGEEVDAFYNDGWWEGTVTEVLDDGRFSVFFKSSKEQIRFR  164

Query  194  HHGLRLHQEWINGAW  150
                R H+EW+NGAW
Sbjct  165  KDEFRFHREWLNGAW  179



>ref|XP_008340577.1| PREDICTED: uncharacterized protein LOC103403512 [Malus domestica]
Length=303

 Score =   247 bits (631),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 139/318 (44%), Positives = 189/318 (59%), Gaps = 21/318 (7%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLM---RDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKR  1884
             ++  F+KGD VEV+    R +   ++PA V RP V+       I V+++TL + +    R
Sbjct  2     SQTHFSKGDEVEVVTKPSRSSTGPYYPATVRRPVVKDK---AHILVQYQTLTTPNAVSPR  58

Query  1883  R-KEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDED  1707
               +E V L  VRPAPP E   +F+VG+  D + EN GW RGTV +ILENS Y+VAL  E+
Sbjct  59    LLQEIVELGNVRPAPPRELYQFFKVGDDVDAYREN-GWSRGTVTDILENSKYLVALRGEE  117

Query  1706  AVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRG  1527
                  + EQ  +R+HRDW DG WVPP++E        +  S   ++    + L+ KC + 
Sbjct  118   ----FECEQCDMRIHRDWDDGSWVPPIQE--------ENSSSGMVVKSRKLILKFKCGKK  165

Query  1526  SCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGT-DYLIEEV  1350
                  F     VEV  D+EG++ +WY + +++ +GN K LV+Y  L TDDGT D L EE 
Sbjct  166   PLGASFENGTVVEVSSDEEGYKDAWYTAKIIDHVGNNKYLVEYLYLVTDDGTKDPLREET  225

Query  1349  DASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFE  1170
              AS IRPCPP +  ++ FK+L KVDAW   GWWEG VSKVLG   Y+V F S NE L FE
Sbjct  226   CASYIRPCPPALPSVAHFKVLQKVDAWYNEGWWEGTVSKVLGGLMYVVYFSSTNEELMFE  285

Query  1169  ASDLRPHQEWKNNNWVAA  1116
              S+LRP Q+W N  W+ A
Sbjct  286   HSNLRPRQDWINGQWIPA  303


 Score =   214 bits (545),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 129/301 (43%), Positives = 182/301 (60%), Gaps = 13/301 (4%)
 Frame = -3

Query  1511  FSK--EMPVEVKGDKEGFERSWYASVVMEVLGN-GKLLVQYQDLKTDDGTD--YLIEEVD  1347
             FSK  E+ V  K  +      + A+V   V+ +   +LVQYQ L T +      L E V+
Sbjct  6     FSKGDEVEVVTKPSRSSTGPYYPATVRRPVVKDKAHILVQYQTLTTPNAVSPRLLQEIVE  65

Query  1346  ASCIRPCPP-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFE  1170
                +RP PP E+++   FK+ D VDA+  NGW  G V+ +L ++KY+V      E    E
Sbjct  66    LGNVRPAPPRELYQF--FKVGDDVDAYRENGWSRGTVTDILENSKYLVAL--RGEEFECE  121

Query  1169  ASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEA  990
               D+R H++W + +WV    I    SSS +++ S+ + +K K  +K LG  F  G +VE 
Sbjct  122   QCDMRIHRDWDDGSWVPP--IQEENSSSGMVVKSRKLILKFKCGKKPLGASFENGTVVEV  179

Query  989   TSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDES-EPLKEKADAFNIRPCPPLIHR  813
             +S EEGY  +WYTA I D +G NK+L+EY  L TDD + +PL+E+  A  IRPCPP +  
Sbjct  180   SSDEEGYKDAWYTAKIIDHVGNNKYLVEYLYLVTDDGTKDPLREETCASYIRPCPPALPS  239

Query  812   FDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKK  633
                FK+ ++VDAWYNEGWWEG +SKVL GL YVVYF +TNEE+ F H  +RP Q+WI+ +
Sbjct  240   VAHFKVLQKVDAWYNEGWWEGTVSKVLGGLMYVVYFSSTNEELMFEHSNLRPRQDWINGQ  299

Query  632   W  630
             W
Sbjct  300   W  300


 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 112/299 (37%), Positives = 159/299 (53%), Gaps = 14/299 (5%)
 Frame = -3

Query  1016  FSKGMLVEA-TSFEEGYHGSWYTAVIFDSIGPNK--FLLEYQTLRTDDESEP--LKEKAD  852
             FSKG  VE  T       G +Y A +   +  +K   L++YQTL T +   P  L+E  +
Sbjct  6     FSKGDEVEVVTKPSRSSTGPYYPATVRRPVVKDKAHILVQYQTLTTPNAVSPRLLQEIVE  65

Query  851   AFNIRPCPPL-IHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFA  675
               N+RP PP  +++F  FK+ ++VDA+   GW  G ++ +L+   Y+V      EE E  
Sbjct  66    LGNVRPAPPRELYQF--FKVGDDVDAYRENGWSRGTVTDILENSKYLVAL--RGEEFECE  121

Query  674   HHGIRPHQEWIDKKWDIAFRKSNNN---LPNPKPGIMRRHSGGIASETTFCIGAKVEVKD  504
                +R H++W D  W    ++ N++   +   +  I++   G      +F  G  VEV  
Sbjct  122   QCDMRIHRDWDDGSWVPPIQEENSSSGMVVKSRKLILKFKCGKKPLGASFENGTVVEVSS  181

Query  503   DEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGT-DLLVQEADALSVRPSAPILQRVD  327
             DEEG + +WY A I+  +GN KYLVE+  L  D GT D L +E  A  +RP  P L  V 
Sbjct  182   DEEGYKDAWYTAKIIDHVGNNKYLVEYLYLVTDDGTKDPLREETCASYIRPCPPALPSVA  241

Query  326   RFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              F+ L++VDAW N GW  G V +VL G  Y V F +TNE L F H  LR  Q+WING W
Sbjct  242   HFKVLQKVDAWYNEGWWEGTVSKVLGGLMYVVYFSSTNEELMFEHSNLRPRQDWINGQW  300



>emb|CDX94986.1| BnaC05g06850D [Brassica napus]
Length=517

 Score =   253 bits (647),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 155/466 (33%), Positives = 241/466 (52%), Gaps = 19/466 (4%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGK----LLVQYQDLKTDDGTDYLIEEVDASCIRPC  1326
             VE+  ++EGF  +W+   V+ V    K      V+Y  +   DG+  L E VD   +RP 
Sbjct  41    VEISTNEEGFRGAWFMGKVVAVPSPDKDPLNCQVEYATISEADGSKPLKEFVDLDHLRPA  100

Query  1325  --PP--EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDL  1158
               PP  E+ +       + VDA+  + WWEG V++V GD K+ V F    EL+ F   +L
Sbjct  101   LLPPMSEMEKKRDILAGEDVDAFYKDVWWEGTVTEVRGDGKFSVYFRGSGELIQFRRDEL  160

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskS---------DRKALGPK-FSK  1008
             R H+EW N+ W             +        + K              KA+  + FS 
Sbjct  161   RFHREWINDTWKPPLDEAEEEEEEEEDEVDDYTEDKEVQYLVPQVNLETTKAIAKEMFSS  220

Query  1007  GMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCP  828
             G +VE +S EEG+ G W+ A + + IG +++ +EY+ LR ++  EPLKE AD  +IRP P
Sbjct  221   GTVVEVSSDEEGFVGCWFAAKVVERIGDDEYRIEYKDLREENGVEPLKEVADFLHIRPPP  280

Query  827   PLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQE  648
             P     D F + +++DA+YN+GWW G +   L   +  ++F  + E++ F   G+R H++
Sbjct  281   PSDEDID-FSVGDKIDAFYNDGWWVGEVIDNLKDGSVGIFFRESAEKMRFGRQGLRLHKD  339

Query  647   WIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPA  468
             W++  W++  ++         P            +  F IGA VEV   EEG + SW+ A
Sbjct  340   WVNGTWELPLKRGELKRAKKVPCERNVRPKRAIDKQYFSIGAPVEVSSIEEGFEDSWFLA  399

Query  467   LILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSN  288
              ++   G  K LVE+  LK + G + L +E +   +RP  P +  V+ F  L++V+A  N
Sbjct  400   KLIEYRGTDKCLVEYDKLKAEDGKEPLREEVNEFQIRPQPPEMVMVNPFEKLDKVNALYN  459

Query  287   NGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +GW +G V +VL  + Y V+F  T+EIL+F H  LRLHQEW +G W
Sbjct  460   DGWWIGVVKKVLAKSSYLVHFSRTDEILKFHHSQLRLHQEWSDGKW  505


 Score =   226 bits (576),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 157/469 (33%), Positives = 250/469 (53%), Gaps = 32/469 (7%)
 Frame = -3

Query  1991  WFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPA--PPGEPCCY  1821
             WF   V+  PS  K+    Q  VE+ T+ S+ D  K  KE+V L  +RPA  PP      
Sbjct  54    WFMGKVVAVPSPDKDPLNCQ--VEYATI-SEADGSKPLKEFVDLDHLRPALLPPMSEMEK  110

Query  1820  FR---VGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWK  1650
              R    GE  D FY++  W  GTV E+  +  + V      + E ++  + +LR HR+W 
Sbjct  111   KRDILAGEDVDAFYKDVWWE-GTVTEVRGDGKFSVYF--RGSGELIQFRRDELRFHREWI  167

Query  1649  DGCWVPPLEESQVDQQYQQK--------KSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMP  1494
             +  W PPL+E++ +++ ++         K   +L+     ++ ++ T+      FS    
Sbjct  168   NDTWKPPLDEAEEEEEEEEDEVDDYTEDKEVQYLVP----QVNLETTKAIAKEMFSSGTV  223

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEI  1314
             VEV  D+EGF   W+A+ V+E +G+ +  ++Y+DL+ ++G + L E  D   IRP PP  
Sbjct  224   VEVSSDEEGFVGCWFAAKVVERIGDDEYRIEYKDLREENGVEPLKEVADFLHIRPPPPSD  283

Query  1313  HRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKN  1134
               I  F + DK+DA+  +GWW G V   L D    + F    E + F    LR H++W N
Sbjct  284   EDID-FSVGDKIDAFYNDGWWVGEVIDNLKDGSVGIFFRESAEKMRFGRQGLRLHKDWVN  342

Query  1133  NNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPK-FSKGMLVEATSFEEGYHGSW  957
               W      +LP    ++    KV   ++   ++A+  + FS G  VE +S EEG+  SW
Sbjct  343   GTW------ELPLKRGELKRAKKVPCERNVRPKRAIDKQYFSIGAPVEVSSIEEGFEDSW  396

Query  956   YTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDA  777
             + A + +  G +K L+EY  L+ +D  EPL+E+ + F IRP PP +   + F+  ++V+A
Sbjct  397   FLAKLIEYRGTDKCLVEYDKLKAEDGKEPLREEVNEFQIRPQPPEMVMVNPFEKLDKVNA  456

Query  776   WYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
              YN+GWW G++ KVL   +Y+V+F  T+E ++F H  +R HQEW D KW
Sbjct  457   LYNDGWWIGVVKKVLAKSSYLVHFSRTDEILKFHHSQLRLHQEWSDGKW  505


 Score =   171 bits (434),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 113/330 (34%), Positives = 176/330 (53%), Gaps = 30/330 (9%)
 Frame = -3

Query  2072  ETHAMSAEAQFNKGDRVEVLMRDNFPI--WFPAAVLRPSVRKNQRAG--QIYVEFETLCS  1905
             ET    A+  F+ G  VEV   +   +  WF A V+       +R G  +  +E++ L  
Sbjct  208   ETTKAIAKEMFSSGTVVEVSSDEEGFVGCWFAAKVV-------ERIGDDEYRIEYKDLRE  260

Query  1904  DD--DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMY  1731
             ++  +P+K   +++H   +RP PP +    F VG+  D FY N GW  G V + L++   
Sbjct  261   ENGVEPLKEVADFLH---IRPPPPSDEDIDFSVGDKIDAFY-NDGWWVGEVIDNLKDGS-  315

Query  1730  MVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVK  1551
              V +   ++ E ++  +  LR+H+DW +G W  PL+  ++ +  +          P    
Sbjct  316   -VGIFFRESAEKMRFGRQGLRLHKDWVNGTWELPLKRGELKRAKK---------VPCERN  365

Query  1550  LRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGT  1371
             +R K  R    + FS   PVEV   +EGFE SW+ + ++E  G  K LV+Y  LK +DG 
Sbjct  366   VRPK--RAIDKQYFSIGAPVEVSSIEEGFEDSWFLAKLIEYRGTDKCLVEYDKLKAEDGK  423

Query  1370  DYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSM  1191
             + L EEV+   IRP PPE+  ++PF+ LDKV+A   +GWW G V KVL  + Y+V F   
Sbjct  424   EPLREEVNEFQIRPQPPEMVMVNPFEKLDKVNALYNDGWWIGVVKKVLAKSSYLVHFSRT  483

Query  1190  NELLTFEASDLRPHQEWKNNNWVAATKIDL  1101
             +E+L F  S LR HQEW +  W+ ++K+ L
Sbjct  484   DEILKFHHSQLRLHQEWSDGKWITSSKVSL  513


 Score =   162 bits (410),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 103/316 (33%), Positives = 163/316 (52%), Gaps = 27/316 (9%)
 Frame = -3

Query  1022  PKFSK-GMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLL----EYQTLRTDDESEPLKEK  858
             P F K G  VE ++ EEG+ G+W+   +     P+K  L    EY T+   D S+PLKE 
Sbjct  32    PSFLKPGAAVEISTNEEGFRGAWFMGKVVAVPSPDKDPLNCQVEYATISEADGSKPLKEF  91

Query  857   ADAFNIRPC--PPLIHRFDRFKMF--EEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNE  690
              D  ++RP   PP+     +  +   E+VDA+Y + WWEG +++V     + VYF  + E
Sbjct  92    VDLDHLRPALLPPMSEMEKKRDILAGEDVDAFYKDVWWEGTVTEVRGDGKFSVYFRGSGE  151

Query  689   EIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPK----------------PGIMRRHSG  558
              I+F    +R H+EWI+  W     ++       +                P +    + 
Sbjct  152   LIQFRRDELRFHREWINDTWKPPLDEAEEEEEEEEDEVDDYTEDKEVQYLVPQVNLETTK  211

Query  557   GIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQE  378
              IA E  F  G  VEV  DEEG  G W+ A ++  IG+ +Y +E++ L+ + G + L + 
Sbjct  212   AIAKE-MFSSGTVVEVSSDEEGFVGCWFAAKVVERIGDDEYRIEYKDLREENGVEPLKEV  270

Query  377   ADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEF  198
             AD L +RP  P  + +D F   +++DA+ N+GW VG+V + L+     + FR + E + F
Sbjct  271   ADFLHIRPPPPSDEDID-FSVGDKIDAFYNDGWWVGEVIDNLKDGSVGIFFRESAEKMRF  329

Query  197   RHHGLRLHQEWINGAW  150
                GLRLH++W+NG W
Sbjct  330   GRQGLRLHKDWVNGTW  345



>ref|XP_009118323.1| PREDICTED: uncharacterized protein LOC103843357 [Brassica rapa]
Length=495

 Score =   250 bits (638),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 160/467 (34%), Positives = 249/467 (53%), Gaps = 30/467 (6%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGN---GKLLVQYQDLKTD-DGTDYLIEEVDASCIRP-  1329
             VE+  D+ GF  SWY   V+ V  +    K  V+Y  L  D +G   L E VDA+ +RP 
Sbjct  34    VEISSDEAGFRGSWYVGEVVAVPSSDSTTKCEVEYTTLFFDKEGRKRLKEVVDAAQLRPP  93

Query  1328  --CPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLR  1155
                 PE  +     + + VDA+  +GWWEG V++VLGD ++ V F +  E + F   +LR
Sbjct  94    VPAMPEREKERDVAVGEDVDAFYSDGWWEGTVTEVLGDGRFSVYFRASKEQIRFRRDELR  153

Query  1154  PHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEE  975
              H+EW N  W    +        +      + +V  ++ R+     FS G +VE +S EE
Sbjct  154   FHREWVNGAWKPPIEEREEEEEEEEEEEDLLSRVDPETAREIAKQMFSIGTIVEVSSDEE  213

Query  974   GYHGSWYTAVIFDSIGP-NKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFK  798
             G+ GSW++A + + +   +K+L+EY+ LR ++  EPLKE+AD  +IRP PP     D F 
Sbjct  214   GFKGSWFSAKVIEHVDEEDKYLVEYRDLREENGIEPLKEEADFLHIRPPPPADEDID-FA  272

Query  797   MFEEVDAWYNEGWWEG-LISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
             + +++DA+YN+ WW G +I  + +G+  V + +T  E++ F   G+R H++WI+  W + 
Sbjct  273   VRDKIDAFYNDAWWVGDVIESMKEGIVGVCFRYT-GEKMRFGRQGLRLHRDWINGTWQLP  331

Query  620   FRK-----SNNNLP-----NPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYP  471
              ++     +   +P      PK  I + H         F  G  VEV   EEG + SW+ 
Sbjct  332   LKRGEMKRATKKVPCDRNVRPKKAIDKEH---------FSGGDPVEVSSVEEGFEDSWFL  382

Query  470   ALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWS  291
             A ++   G  K+LVE+  LK + G + L +E +   +RP       V+    L+EVDA  
Sbjct  383   AKVIEYRGTDKWLVEYEKLKAEDGKEPLREEVNVFQIRPRPQETVMVNPLEKLDEVDALY  442

Query  290   NNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             N+GW  G V +VL  + Y V+F  T+E+L+F    LR HQEWI+G W
Sbjct  443   NDGWWFGVVKKVLAKSNYLVHFPKTDEVLKFHVSRLRPHQEWIDGKW  489


 Score =   241 bits (614),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 161/461 (35%), Positives = 251/461 (54%), Gaps = 25/461 (5%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCY---  1821
             W+   V+  +V  +    +  VE+ TL  D +  KR KE V  + +RP  P  P      
Sbjct  47    WYVGEVV--AVPSSDSTTKCEVEYTTLFFDKEGRKRLKEVVDAAQLRPPVPAMPEREKER  104

Query  1820  -FRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDG  1644
                VGE  D FY + GW  GTV E+L +  + V      + E ++  + +LR HR+W +G
Sbjct  105   DVAVGEDVDAFYSD-GWWEGTVTEVLGDGRFSVYF--RASKEQIRFRRDELRFHREWVNG  161

Query  1643  CWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGF  1464
              W PP+EE +  ++ ++++ ED L      ++  +  R    + FS    VEV  D+EGF
Sbjct  162   AWKPPIEEREE-EEEEEEEEEDLLS-----RVDPETAREIAKQMFSIGTIVEVSSDEEGF  215

Query  1463  ERSWYASVVME-VLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLL  1287
             + SW+++ V+E V    K LV+Y+DL+ ++G + L EE D   IRP PP    I  F + 
Sbjct  216   KGSWFSAKVIEHVDEEDKYLVEYRDLREENGIEPLKEEADFLHIRPPPPADEDID-FAVR  274

Query  1286  DKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNW-VAATK  1110
             DK+DA+  + WW G V + + +    VCF    E + F    LR H++W N  W +   +
Sbjct  275   DKIDAFYNDAWWVGDVIESMKEGIVGVCFRYTGEKMRFGRQGLRLHRDWINGTWQLPLKR  334

Query  1109  IDLPRSSSDVMLNskvvkvkskSDRKALGPK-FSKGMLVEATSFEEGYHGSWYTAVIFDS  933
              ++ R++  V  +  V        +KA+  + FS G  VE +S EEG+  SW+ A + + 
Sbjct  335   GEMKRATKKVPCDRNVRP------KKAIDKEHFSGGDPVEVSSVEEGFEDSWFLAKVIEY  388

Query  932   IGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWE  753
              G +K+L+EY+ L+ +D  EPL+E+ + F IRP P      +  +  +EVDA YN+GWW 
Sbjct  389   RGTDKWLVEYEKLKAEDGKEPLREEVNVFQIRPRPQETVMVNPLEKLDEVDALYNDGWWF  448

Query  752   GLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             G++ KVL   NY+V+F  T+E ++F    +RPHQEWID KW
Sbjct  449   GVVKKVLAKSNYLVHFPKTDEVLKFHVSRLRPHQEWIDGKW  489


 Score =   162 bits (409),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 112/326 (34%), Positives = 166/326 (51%), Gaps = 24/326 (7%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             PET    A+  F+ G  VEV    + F   WF A V    +       +  VE+  L  +
Sbjct  189   PETAREIAKQMFSIGTIVEVSSDEEGFKGSWFSAKV----IEHVDEEDKYLVEYRDLREE  244

Query  1901  D--DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYM  1728
             +  +P+K   +++H   +RP PP +    F V +  D FY N  W  G V E ++  +  
Sbjct  245   NGIEPLKEEADFLH---IRPPPPADEDIDFAVRDKIDAFY-NDAWWVGDVIESMKEGIVG  300

Query  1727  VALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKL  1548
             V        E ++  +  LR+HRDW +G W  PL+  ++ +  ++         P    +
Sbjct  301   VCF--RYTGEKMRFGRQGLRLHRDWINGTWQLPLKRGEMKRATKK--------VPCDRNV  350

Query  1547  RIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTD  1368
             R K  +      FS   PVEV   +EGFE SW+ + V+E  G  K LV+Y+ LK +DG +
Sbjct  351   RPK--KAIDKEHFSGGDPVEVSSVEEGFEDSWFLAKVIEYRGTDKWLVEYEKLKAEDGKE  408

Query  1367  YLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMN  1188
              L EEV+   IRP P E   ++P + LD+VDA   +GWW G V KVL  + Y+V F   +
Sbjct  409   PLREEVNVFQIRPRPQETVMVNPLEKLDEVDALYNDGWWFGVVKKVLAKSNYLVHFPKTD  468

Query  1187  ELLTFEASDLRPHQEWKNNNWVAATK  1110
             E+L F  S LRPHQEW +  W+A++K
Sbjct  469   EVLKFHVSRLRPHQEWIDGKWIASSK  494


 Score = 85.5 bits (210),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 74/133 (56%), Gaps = 7/133 (5%)
 Frame = -3

Query  527  GAKVEVKDDEEGNQGSWYPALILRLIGN---GKYLVEFRTLKCDF-GTDLLVQEADALSV  360
            GA VE+  DE G +GSWY   ++ +  +    K  VE+ TL  D  G   L +  DA  +
Sbjct  31   GAAVEISSDEAGFRGSWYVGEVVAVPSSDSTTKCEVEYTTLFFDKEGRKRLKEVVDAAQL  90

Query  359  RPSAPILQRVDRFRPL---EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHH  189
            RP  P +   ++ R +   E+VDA+ ++GW  G V EVL   ++ V FR + E + FR  
Sbjct  91   RPPVPAMPEREKERDVAVGEDVDAFYSDGWWEGTVTEVLGDGRFSVYFRASKEQIRFRRD  150

Query  188  GLRLHQEWINGAW  150
             LR H+EW+NGAW
Sbjct  151  ELRFHREWVNGAW  163



>gb|AAD18097.1| T31J12.4 [Arabidopsis thaliana]
Length=514

 Score =   249 bits (635),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 158/491 (32%), Positives = 245/491 (50%), Gaps = 47/491 (10%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNG-----KLLVQYQDLKTD-DGTDYLIEEVDASCIR  1332
             VE+  D+ GF  SWY   V+ +  +      K  V+Y  L  D +GT  L E VD S +R
Sbjct  20    VEISSDEIGFRGSWYMGKVITIPSSSDKDSVKCQVEYTTLFFDKEGTKPLKEVVDMSQLR  79

Query  1331  PCPPEIHRISPFKLL---DKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
             P  P +  I   K +   ++VDA+  +GWWEG V++VL D K+ V F S  E + F   +
Sbjct  80    PPAPPMSEIEKKKKIVVGEEVDAFYNDGWWEGDVTEVLDDGKFSVFFRSSKEQIRFRKDE  139

Query  1160  LRPHQEWKNNNW-------------------------------VAATKIDLPRSSSDVML  1074
             LR H+EW +  W                               +    + +  +     +
Sbjct  140   LRFHREWVDGAWKPPLEETEEEEDESEEDKLDDSEDEETFALVLLEQFMRMHFNHDSNKM  199

Query  1073  NskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTL  894
                + +V  ++ R      FS G +VE +S EEG+ G W+ A + + +G +KFL+EY+ L
Sbjct  200   QDILARVDLETTRAIAKQMFSSGTVVEVSSDEEGFQGCWFAAKVVEPVGEDKFLVEYRDL  259

Query  893   RTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYV  714
             R  D  EPLKE+ D  +IRP PP     D F + ++++A+YN+GWW G+   V+DG+ + 
Sbjct  260   REKDGIEPLKEETDFLHIRPPPPRDEDID-FAVGDKINAFYNDGWWVGV---VIDGMKHG  315

Query  713   ---VYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASE  543
                +YF  + E++ F   G+R H++W+D  W +  +                       +
Sbjct  316   TVGIYFRQSQEKMRFGRQGLRLHKDWVDGTWQLPLKGGKIKREKTVSCNRNVRPKKATEK  375

Query  542   TTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALS  363
               F IG  +EV  +EEG + SW+ A ++   G  K LVE+  LK + G + L +E +   
Sbjct  376   QAFSIGTPIEVSPEEEGFEDSWFLAKLIEYRGKDKCLVEYDNLKAEDGKEPLREEVNVSR  435

Query  362   VRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGL  183
             +RP       V  F   ++V+A  N+GW VG + +VL  + Y V F+ T E+L+F H  L
Sbjct  436   IRPLPLESVMVSPFERHDKVNALYNDGWWVGVIRKVLAKSSYLVLFKNTQELLKFHHSQL  495

Query  182   RLHQEWINGAW  150
             RLHQEWI+G W
Sbjct  496   RLHQEWIDGKW  506


 Score =   238 bits (608),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 161/489 (33%), Positives = 243/489 (50%), Gaps = 40/489 (8%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRP-APPG---EPCC  1824
             W+   V+      ++ + +  VE+ TL  D +  K  KE V +S +RP APP    E   
Sbjct  33    WYMGKVITIPSSSDKDSVKCQVEYTTLFFDKEGTKPLKEVVDMSQLRPPAPPMSEIEKKK  92

Query  1823  YFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDG  1644
                VGE  D FY N GW  G V E+L++  + V      + E ++  + +LR HR+W DG
Sbjct  93    KIVVGEEVDAFY-NDGWWEGDVTEVLDDGKFSVFF--RSSKEQIRFRKDELRFHREWVDG  149

Query  1643  CWVPPLEE---------------SQVDQQYQQKKSEDFL----------MTPSGVKLRIK  1539
              W PPLEE               S+ ++ +     E F+          M     ++ ++
Sbjct  150   AWKPPLEETEEEEDESEEDKLDDSEDEETFALVLLEQFMRMHFNHDSNKMQDILARVDLE  209

Query  1538  CTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLI  1359
              TR    + FS    VEV  D+EGF+  W+A+ V+E +G  K LV+Y+DL+  DG + L 
Sbjct  210   TTRAIAKQMFSSGTVVEVSSDEEGFQGCWFAAKVVEPVGEDKFLVEYRDLREKDGIEPLK  269

Query  1358  EEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELL  1179
             EE D   IRP PP    I  F + DK++A+  +GWW G V   +      + F    E +
Sbjct  270   EETDFLHIRPPPPRDEDID-FAVGDKINAFYNDGWWVGVVIDGMKHGTVGIYFRQSQEKM  328

Query  1178  TFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPK-FSKGM  1002
              F    LR H++W +  W       LP     +     V   ++   +KA   + FS G 
Sbjct  329   RFGRQGLRLHKDWVDGTW------QLPLKGGKIKREKTVSCNRNVRPKKATEKQAFSIGT  382

Query  1001  LVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPL  822
              +E +  EEG+  SW+ A + +  G +K L+EY  L+ +D  EPL+E+ +   IRP P  
Sbjct  383   PIEVSPEEEGFEDSWFLAKLIEYRGKDKCLVEYDNLKAEDGKEPLREEVNVSRIRPLPLE  442

Query  821   IHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
                   F+  ++V+A YN+GWW G+I KVL   +Y+V F  T E ++F H  +R HQEWI
Sbjct  443   SVMVSPFERHDKVNALYNDGWWVGVIRKVLAKSSYLVLFKNTQELLKFHHSQLRLHQEWI  502

Query  641   DKKWDIAFR  615
             D KW  +F+
Sbjct  503   DGKWITSFK  511


 Score =   168 bits (426),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/330 (33%), Positives = 172/330 (52%), Gaps = 27/330 (8%)
 Frame = -3

Query  2084  IDVPETHAMSAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETL  1911
             +D+  T A+ A+  F+ G  VEV    + F   WF A V+ P         +  VE+  L
Sbjct  206   VDLETTRAI-AKQMFSSGTVVEVSSDEEGFQGCWFAAKVVEPV-----GEDKFLVEYRDL  259

Query  1910  CSDD--DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENS  1737
                D  +P+K   +++H   +RP PP +    F VG+  + FY N GW  G V + +++ 
Sbjct  260   REKDGIEPLKEETDFLH---IRPPPPRDEDIDFAVGDKINAFY-NDGWWVGVVIDGMKHG  315

Query  1736  MYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSG  1557
                V +    + E ++  +  LR+H+DW DG W  PL+  ++ ++               
Sbjct  316   T--VGIYFRQSQEKMRFGRQGLRLHKDWVDGTWQLPLKGGKIKRE-----------KTVS  362

Query  1556  VKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD  1377
                 ++  + +  + FS   P+EV  ++EGFE SW+ + ++E  G  K LV+Y +LK +D
Sbjct  363   CNRNVRPKKATEKQAFSIGTPIEVSPEEEGFEDSWFLAKLIEYRGKDKCLVEYDNLKAED  422

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
             G + L EEV+ S IRP P E   +SPF+  DKV+A   +GWW G + KVL  + Y+V F 
Sbjct  423   GKEPLREEVNVSRIRPLPLESVMVSPFERHDKVNALYNDGWWVGVIRKVLAKSSYLVLFK  482

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATKI  1107
             +  ELL F  S LR HQEW +  W+ + K+
Sbjct  483   NTQELLKFHHSQLRLHQEWIDGKWITSFKV  512


 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 78/135 (58%), Gaps = 9/135 (7%)
 Frame = -3

Query  527  GAKVEVKDDEEGNQGSWYPALILRLIGNG-----KYLVEFRTLKCDF-GTDLLVQEADAL  366
            G+ VE+  DE G +GSWY   ++ +  +      K  VE+ TL  D  GT  L +  D  
Sbjct  17   GSAVEISSDEIGFRGSWYMGKVITIPSSSDKDSVKCQVEYTTLFFDKEGTKPLKEVVDMS  76

Query  365  SVRPSAPILQRVDRFRPL---EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFR  195
             +RP AP +  +++ + +   EEVDA+ N+GW  G V EVL+  K+ V FR++ E + FR
Sbjct  77   QLRPPAPPMSEIEKKKKIVVGEEVDAFYNDGWWEGDVTEVLDDGKFSVFFRSSKEQIRFR  136

Query  194  HHGLRLHQEWINGAW  150
               LR H+EW++GAW
Sbjct  137  KDELRFHREWVDGAW  151



>ref|XP_010489699.1| PREDICTED: uncharacterized protein LOC104767362 [Camelina sativa]
Length=482

 Score =   247 bits (630),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 186/499 (37%), Positives = 266/499 (53%), Gaps = 38/499 (8%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEV-LMRDNFPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             M+++  +  GDRVEV  +      +FPA V+  PSVRKN     + VE E L        
Sbjct  2     MTSDGFWRGGDRVEVERLVSGATAYFPATVVSAPSVRKNH----VLVEHEALMVGGSV--  55

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRG-WRRGTVDEILENSMYMVALGDE  1710
             R KEYV  + +RP+PP E    F+  +  DVF +  G W RG V  +L +S Y+V     
Sbjct  56    RMKEYVIPTRLRPSPPRELNRRFKAEDEVDVFRDTEGCWVRGNVTTVLGDSRYIVEFKGG  115

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKC-T  1533
             +  E ++V Q  LR+HR+W+DG WVP L         QQ K      TP  +KL+IK  T
Sbjct  116   NRPE-IEVGQLDLRLHREWQDGSWVPSLS--------QQVKIX--XXTPQRIKLKIKIKT  164

Query  1532  RGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDY-LIE  1356
             R +    + K   VEV+ ++E ++ SWY + ++  LG+ K +V++     DDG    L +
Sbjct  165   RDNL---YEKGALVEVRSEEEVYKGSWYCARILCSLGDDKYIVEHLKFSRDDGESLPLRD  221

Query  1355  EVDASCIRPCPPEIHRISP-FKLLDKVDAWVGNGWWEGHVSKVLGD-AKYMVCFGSMNEL  1182
              V+A  +RP PP        ++  D+VD W    WW G VS VLG  +KY V   S  E 
Sbjct  222   VVEAQNMRPVPPPDVSPVLCYEPGDEVDVWFNKRWWIGRVSNVLGGGSKYSVFINSRGEE  281

Query  1181  LTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGM  1002
              T    +LRPH++W N  W   +K       +    N    K     +R  +   F  GM
Sbjct  282   PTVLNFNLRPHKDWINGAWSNPSK-------AKGECNRPPFKKLKTCERAEM--VFKIGM  332

Query  1001  LVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFN-IRPCPP  825
             +VE  S E+GY GSW++A +   +G N++ +EYQTL+TDDE E LKE+A   +     PP
Sbjct  333   MVEVRSDEQGYEGSWFSAKVISYLGNNRYTVEYQTLKTDDEGELLKEEARGSDLRPIPPP  392

Query  824   LIHRFDRFKMFEEVDAWYNEGWWEGLISKV-LDGLNYVVYFWTTNEEIEFAHHGIRPHQE  648
             LI +  R+++ EEVDAWYNEGWW G +  +  +   Y VYF T NE +EFA++ +RP Q 
Sbjct  393   LIPKAYRYELHEEVDAWYNEGWWSGRVYTINYNHTRYGVYFKTNNERLEFAYNDLRPCQV  452

Query  647   WIDKKWDIAFRKSNNNLPN  591
             W + KW +    S ++L N
Sbjct  453   WRNGKWSLTLLDSKDSLFN  471


 Score =   200 bits (509),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 153/433 (35%), Positives = 226/433 (52%), Gaps = 28/433 (6%)
 Frame = -3

Query  1412  LLVQYQDLKTDDGTDYLIEEVDASCIRPCPP-EIHRISPFKLLDKVDAW--VGNGWWEGH  1242
             +LV+++ L    G+  + E V  + +RP PP E++R   FK  D+VD +      W  G+
Sbjct  42    VLVEHEALMVG-GSVRMKEYVIPTRLRPSPPRELNR--RFKAEDEVDVFRDTEGCWVRGN  98

Query  1241  VSKVLGDAKYMVCF-GSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNsk  1065
             V+ VLGD++Y+V F G     +     DLR H+EW++ +WV       P  S  V +   
Sbjct  99    VTTVLGDSRYIVEFKGGNRPEIEVGQLDLRLHREWQDGSWV-------PSLSQQVKIXXX  151

Query  1064  vvkvkskSDR-KALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRT  888
               +      + K     + KG LVE  S EE Y GSWY A I  S+G +K+++E+     
Sbjct  152   TPQRIKLKIKIKTRDNLYEKGALVEVRSEEEVYKGSWYCARILCSLGDDKYIVEHLKFSR  211

Query  887   DD-ESEPLKEKADAFNIRPCPPLIHRFDR-FKMFEEVDAWYNEGWWEGLISKVLDG-LNY  717
             DD ES PL++  +A N+RP PP        ++  +EVD W+N+ WW G +S VL G   Y
Sbjct  212   DDGESLPLRDVVEAQNMRPVPPPDVSPVLCYEPGDEVDVWFNKRWWIGRVSNVLGGGSKY  271

Query  716   VVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSN--NNLPNPKPGIMRRHSGGIASE  543
              V+  +  EE    +  +RPH++WI+  W    +     N  P  K     R      +E
Sbjct  272   SVFINSRGEEPTVLNFNLRPHKDWINGAWSNPSKAKGECNRPPFKKLKTCER------AE  325

Query  542   TTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALS  363
               F IG  VEV+ DE+G +GSW+ A ++  +GN +Y VE++TLK D   +LL +EA    
Sbjct  326   MVFKIGMMVEVRSDEQGYEGSWFSAKVISYLGNNRYTVEYQTLKTDDEGELLKEEARGSD  385

Query  362   -VRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEV-LEGAKYRVNFRTTNEILEFRHH  189
                   P++ +  R+   EEVDAW N GW  G+V  +     +Y V F+T NE LEF ++
Sbjct  386   LRPIPPPLIPKAYRYELHEEVDAWYNEGWWSGRVYTINYNHTRYGVYFKTNNERLEFAYN  445

Query  188   GLRLHQEWINGAW  150
              LR  Q W NG W
Sbjct  446   DLRPCQVWRNGKW  458



>emb|CDX93511.1| BnaA06g05370D [Brassica napus]
Length=512

 Score =   245 bits (626),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 150/465 (32%), Positives = 243/465 (52%), Gaps = 18/465 (4%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGK----LLVQYQDLKTDDGTDYLIEEVDASCIRPC  1326
             VE+  ++EGF  +W+   V+ V    K      V+Y  +   DG+  L E V    +RP 
Sbjct  41    VEISTNEEGFRGAWFMGKVVTVPSPDKEPLNCQVEYATISELDGSKPLKEFVHVDHLRPA  100

Query  1325  PPEIHRISPFKLL---DKVDAWVGNGWWEGHVSKVLG-DAKYMVCFGSMNELLTFEASDL  1158
              P +  +   + +   + VDA+  + WWEG V++V G D K+ V F    EL+ F   +L
Sbjct  101   LPPMSEMEKKRDILAGEDVDAFYKDVWWEGTVTEVRGGDGKFSVYFRGSQELIQFRRGEL  160

Query  1157  RPHQEWKNNNW--------VAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPK-FSKG  1005
             R H+EW N+ W            + +      D      +V   +    KA+  + FS G
Sbjct  161   RFHREWINDTWQPPLDEAVEEEEEEESEEDEVDDYTEEYLVPQVNLETTKAIAKEMFSIG  220

Query  1004  MLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPP  825
              +VE +S EEG+ G W+ A + + IG +++ +EY+ LR  +  EPLKE AD  +IRP PP
Sbjct  221   TVVEVSSDEEGFVGCWFAAKVVERIGDDEYRVEYKDLREGNGVEPLKEVADFLHIRPPPP  280

Query  824   LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEW  645
                  D F + +++DA+YN+GWW G + + +   +  ++F  + E++ F  HG+R H++W
Sbjct  281   SDEDID-FAVGDKIDAFYNDGWWVGEVIESMKDGSVGIFFRESAEKMRFGRHGLRLHKDW  339

Query  644   IDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPAL  465
             ++  W++  ++         P            +  F IG  VEV   EEG + SW+ A 
Sbjct  340   VNGNWELPLKRGEVKRAKKVPFERNVRRKKAIDKQYFNIGTPVEVSSIEEGFEDSWFLAK  399

Query  464   ILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNN  285
             ++   G  K LVE+  LK + G + L +E +   +RP  P +  V+ F  L++V+A  N+
Sbjct  400   LIEYRGTDKCLVEYDKLKAEDGKEPLSEEVNEFQIRPQPPEMVMVNPFEKLDKVNALYND  459

Query  284   GWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             GW +G V +VL  + Y V+F  T+E+L+F H  LRLHQ+W +G W
Sbjct  460   GWWIGVVKKVLAKSSYLVHFSKTDEMLKFHHSQLRLHQDWSDGKW  504


 Score =   228 bits (580),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 159/471 (34%), Positives = 253/471 (54%), Gaps = 37/471 (8%)
 Frame = -3

Query  1991  WFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPA-PPGEPCCYF  1818
             WF   V+  PS  K     Q  VE+ T+ S+ D  K  KE+VH+  +RPA PP       
Sbjct  54    WFMGKVVTVPSPDKEPLNCQ--VEYATI-SELDGSKPLKEFVHVDHLRPALPPMSEMEKK  110

Query  1817  R---VGESADVFYENRGWRRGTVDEIL----ENSMYMVALGDEDAVESVKVEQWQLRVHR  1659
             R    GE  D FY++  W  GTV E+     + S+Y        + E ++  + +LR HR
Sbjct  111   RDILAGEDVDAFYKDVWWE-GTVTEVRGGDGKFSVYFRG-----SQELIQFRRGELRFHR  164

Query  1658  DWKDGCWVPPLEESQVDQQYQQKK-------SEDFLMTPSGVKLRIKCTRGSCVRKFSKE  1500
             +W +  W PPL+E+  +++ ++ +       +E++L+     ++ ++ T+      FS  
Sbjct  165   EWINDTWQPPLDEAVEEEEEEESEEDEVDDYTEEYLVP----QVNLETTKAIAKEMFSIG  220

Query  1499  MPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPP  1320
               VEV  D+EGF   W+A+ V+E +G+ +  V+Y+DL+  +G + L E  D   IRP PP
Sbjct  221   TVVEVSSDEEGFVGCWFAAKVVERIGDDEYRVEYKDLREGNGVEPLKEVADFLHIRPPPP  280

Query  1319  EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEW  1140
                 I  F + DK+DA+  +GWW G V + + D    + F    E + F    LR H++W
Sbjct  281   SDEDID-FAVGDKIDAFYNDGWWVGEVIESMKDGSVGIFFRESAEKMRFGRHGLRLHKDW  339

Query  1139  KNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPK-FSKGMLVEATSFEEGYHG  963
              N NW      +LP    +V    KV   ++   +KA+  + F+ G  VE +S EEG+  
Sbjct  340   VNGNW------ELPLKRGEVKRAKKVPFERNVRRKKAIDKQYFNIGTPVEVSSIEEGFED  393

Query  962   SWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEV  783
             SW+ A + +  G +K L+EY  L+ +D  EPL E+ + F IRP PP +   + F+  ++V
Sbjct  394   SWFLAKLIEYRGTDKCLVEYDKLKAEDGKEPLSEEVNEFQIRPQPPEMVMVNPFEKLDKV  453

Query  782   DAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             +A YN+GWW G++ KVL   +Y+V+F  T+E ++F H  +R HQ+W D KW
Sbjct  454   NALYNDGWWIGVVKKVLAKSSYLVHFSKTDEMLKFHHSQLRLHQDWSDGKW  504


 Score =   167 bits (424),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 111/330 (34%), Positives = 172/330 (52%), Gaps = 34/330 (10%)
 Frame = -3

Query  2072  ETHAMSAEAQFNKGDRVEVLMRDNFPI--WFPAAVLRPSVRKNQRAG--QIYVEFETLCS  1905
             ET    A+  F+ G  VEV   +   +  WF A V+       +R G  +  VE++ L  
Sbjct  207   ETTKAIAKEMFSIGTVVEVSSDEEGFVGCWFAAKVV-------ERIGDDEYRVEYKDLRE  259

Query  1904  DD--DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMY  1731
              +  +P+K   +++H   +RP PP +    F VG+  D FY N GW  G V E +++   
Sbjct  260   GNGVEPLKEVADFLH---IRPPPPSDEDIDFAVGDKIDAFY-NDGWWVGEVIESMKDGS-  314

Query  1730  MVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVK  1551
              V +   ++ E ++  +  LR+H+DW +G W  PL+  +V +  +             V 
Sbjct  315   -VGIFFRESAEKMRFGRHGLRLHKDWVNGNWELPLKRGEVKRAKK-------------VP  360

Query  1550  LRIKCTRGSCVRK--FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD  1377
                   R   + K  F+   PVEV   +EGFE SW+ + ++E  G  K LV+Y  LK +D
Sbjct  361   FERNVRRKKAIDKQYFNIGTPVEVSSIEEGFEDSWFLAKLIEYRGTDKCLVEYDKLKAED  420

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
             G + L EEV+   IRP PPE+  ++PF+ LDKV+A   +GWW G V KVL  + Y+V F 
Sbjct  421   GKEPLSEEVNEFQIRPQPPEMVMVNPFEKLDKVNALYNDGWWIGVVKKVLAKSSYLVHFS  480

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATKI  1107
               +E+L F  S LR HQ+W +  W+ ++K+
Sbjct  481   KTDEMLKFHHSQLRLHQDWSDGKWITSSKV  510


 Score =   165 bits (417),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 164/315 (52%), Gaps = 26/315 (8%)
 Frame = -3

Query  1022  PKFSK-GMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLL----EYQTLRTDDESEPLKEK  858
             P F K G  VE ++ EEG+ G+W+   +     P+K  L    EY T+   D S+PLKE 
Sbjct  32    PSFLKPGAAVEISTNEEGFRGAWFMGKVVTVPSPDKEPLNCQVEYATISELDGSKPLKEF  91

Query  857   ADAFNIRPCPPLIHRFDRFKMF---EEVDAWYNEGWWEGLISKVLDG-LNYVVYFWTTNE  690
                 ++RP  P +   ++ +     E+VDA+Y + WWEG +++V  G   + VYF  + E
Sbjct  92    VHVDHLRPALPPMSEMEKKRDILAGEDVDAFYKDVWWEGTVTEVRGGDGKFSVYFRGSQE  151

Query  689   EIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPK---------------PGIMRRHSGG  555
              I+F    +R H+EWI+  W     ++       +               P +    +  
Sbjct  152   LIQFRRGELRFHREWINDTWQPPLDEAVEEEEEEESEEDEVDDYTEEYLVPQVNLETTKA  211

Query  554   IASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEA  375
             IA E  F IG  VEV  DEEG  G W+ A ++  IG+ +Y VE++ L+   G + L + A
Sbjct  212   IAKE-MFSIGTVVEVSSDEEGFVGCWFAAKVVERIGDDEYRVEYKDLREGNGVEPLKEVA  270

Query  374   DALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFR  195
             D L +RP  P  + +D F   +++DA+ N+GW VG+V E ++     + FR + E + F 
Sbjct  271   DFLHIRPPPPSDEDID-FAVGDKIDAFYNDGWWVGEVIESMKDGSVGIFFRESAEKMRFG  329

Query  194   HHGLRLHQEWINGAW  150
              HGLRLH++W+NG W
Sbjct  330   RHGLRLHKDWVNGNW  344



>ref|XP_009148183.1| PREDICTED: uncharacterized protein LOC103871658 [Brassica rapa]
Length=508

 Score =   243 bits (621),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 150/465 (32%), Positives = 243/465 (52%), Gaps = 16/465 (3%)
 Frame = -3

Query  1499  MPVEVKGDKEGFERSWYASVVMEVLGNGK----LLVQYQDLKTDDGTDYLIEEVDASCIR  1332
             + VE+  ++EGF  +W+   V+ V    K      V+Y  +   DG+  L E V    +R
Sbjct  36    VAVEISTNEEGFRGAWFMGKVVTVPSPDKDPLNCQVEYATISELDGSKPLKEFVHVDHLR  95

Query  1331  PCPPEIHRISPFKLL---DKVDAWVGNGWWEGHVSKVLG-DAKYMVCFGSMNELLTFEAS  1164
             P  P +  +   + +   + VDA+  + WWEG V++V G D K  V F    EL+ F   
Sbjct  96    PALPPMSEMEKKRDILAGEDVDAFYKDVWWEGTVTEVRGGDGKLSVYFRGSQELIQFRRD  155

Query  1163  DLRPHQEWKNNNW------VAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPK-FSKG  1005
             +LR H+EW N+ W          + +      D      +V   +    KA+  + FS G
Sbjct  156   ELRFHREWINDTWQPPLDEAVEEEEESEEDEVDDYTEEYLVPQVNLETTKAVAKEMFSIG  215

Query  1004  MLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPP  825
              +VE +S EEG+ G W+ A + + IG +++ +EY+ LR  +  EPLKE AD  +IRP PP
Sbjct  216   TVVEVSSDEEGFVGCWFAAKVVERIGDDEYRVEYKDLREVNGVEPLKEVADFLHIRPPPP  275

Query  824   LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEW  645
                  D F + +++DA+YN+GWW G + + +   +  ++F  + E++ F  HG+R H++W
Sbjct  276   SDEDID-FAVGDKIDAFYNDGWWVGEVIESMKDGSVGIFFRESAEKMRFGRHGLRLHKDW  334

Query  644   IDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPAL  465
             ++  W++  ++         P            +  F IG  VEV   EEG + SW+ A 
Sbjct  335   VNGNWELPLKRGEVKRAKKVPFERNVRRKIAIDKQYFSIGTPVEVSSIEEGFEDSWFLAK  394

Query  464   ILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNN  285
             ++   G  K LVE+  LK + G + L +E +   +RP  P +  V+ F  L++V+A  N+
Sbjct  395   LIEYRGTDKCLVEYDKLKAEDGKEPLSEEVNEFQIRPQPPEMVMVNPFEKLDKVNALYND  454

Query  284   GWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             GW +G V +VL  + Y V+F  T+E+L+F H  LRLHQ+W +G W
Sbjct  455   GWWIGVVKKVLAKSSYLVHFSKTDEMLKFHHSQLRLHQDWSDGKW  499


 Score =   227 bits (578),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 158/467 (34%), Positives = 252/467 (54%), Gaps = 31/467 (7%)
 Frame = -3

Query  1991  WFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPA-PPGEPCCYF  1818
             WF   V+  PS  K+    Q  VE+ T+ S+ D  K  KE+VH+  +RPA PP       
Sbjct  51    WFMGKVVTVPSPDKDPLNCQ--VEYATI-SELDGSKPLKEFVHVDHLRPALPPMSEMEKK  107

Query  1817  R---VGESADVFYENRGWRRGTVDEIL--ENSMYMVALGDEDAVESVKVEQWQLRVHRDW  1653
             R    GE  D FY++  W  GTV E+   +  + +   G +   E ++  + +LR HR+W
Sbjct  108   RDILAGEDVDAFYKDVWWE-GTVTEVRGGDGKLSVYFRGSQ---ELIQFRRDELRFHREW  163

Query  1652  KDGCWVPPLEESQVDQQYQQKK-----SEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVE  1488
              +  W PPL+E+  +++  ++      +E++L+     ++ ++ T+      FS    VE
Sbjct  164   INDTWQPPLDEAVEEEEESEEDEVDDYTEEYLVP----QVNLETTKAVAKEMFSIGTVVE  219

Query  1487  VKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHR  1308
             V  D+EGF   W+A+ V+E +G+ +  V+Y+DL+  +G + L E  D   IRP PP    
Sbjct  220   VSSDEEGFVGCWFAAKVVERIGDDEYRVEYKDLREVNGVEPLKEVADFLHIRPPPPSDED  279

Query  1307  ISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNN  1128
             I  F + DK+DA+  +GWW G V + + D    + F    E + F    LR H++W N N
Sbjct  280   ID-FAVGDKIDAFYNDGWWVGEVIESMKDGSVGIFFRESAEKMRFGRHGLRLHKDWVNGN  338

Query  1127  WVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPK-FSKGMLVEATSFEEGYHGSWYT  951
             W      +LP    +V    KV   ++   + A+  + FS G  VE +S EEG+  SW+ 
Sbjct  339   W------ELPLKRGEVKRAKKVPFERNVRRKIAIDKQYFSIGTPVEVSSIEEGFEDSWFL  392

Query  950   AVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWY  771
             A + +  G +K L+EY  L+ +D  EPL E+ + F IRP PP +   + F+  ++V+A Y
Sbjct  393   AKLIEYRGTDKCLVEYDKLKAEDGKEPLSEEVNEFQIRPQPPEMVMVNPFEKLDKVNALY  452

Query  770   NEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             N+GWW G++ KVL   +Y+V+F  T+E ++F H  +R HQ+W D KW
Sbjct  453   NDGWWIGVVKKVLAKSSYLVHFSKTDEMLKFHHSQLRLHQDWSDGKW  499


 Score =   167 bits (422),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 113/327 (35%), Positives = 175/327 (54%), Gaps = 30/327 (9%)
 Frame = -3

Query  2072  ETHAMSAEAQFNKGDRVEVLMRDNFPI--WFPAAVLRPSVRKNQRAG--QIYVEFETL--  1911
             ET    A+  F+ G  VEV   +   +  WF A V+       +R G  +  VE++ L  
Sbjct  202   ETTKAVAKEMFSIGTVVEVSSDEEGFVGCWFAAKVV-------ERIGDDEYRVEYKDLRE  254

Query  1910  CSDDDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMY  1731
              +  +P+K   +++H   +RP PP +    F VG+  D FY N GW  G V E +++   
Sbjct  255   VNGVEPLKEVADFLH---IRPPPPSDEDIDFAVGDKIDAFY-NDGWWVGEVIESMKDGS-  309

Query  1730  MVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVK  1551
              V +   ++ E ++  +  LR+H+DW +G W  PL+  +V    ++ K   F      V+
Sbjct  310   -VGIFFRESAEKMRFGRHGLRLHKDWVNGNWELPLKRGEV----KRAKKVPF---ERNVR  361

Query  1550  LRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGT  1371
              +I   +    + FS   PVEV   +EGFE SW+ + ++E  G  K LV+Y  LK +DG 
Sbjct  362   RKIAIDK----QYFSIGTPVEVSSIEEGFEDSWFLAKLIEYRGTDKCLVEYDKLKAEDGK  417

Query  1370  DYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSM  1191
             + L EEV+   IRP PPE+  ++PF+ LDKV+A   +GWW G V KVL  + Y+V F   
Sbjct  418   EPLSEEVNEFQIRPQPPEMVMVNPFEKLDKVNALYNDGWWIGVVKKVLAKSSYLVHFSKT  477

Query  1190  NELLTFEASDLRPHQEWKNNNWVAATK  1110
             +E+L F  S LR HQ+W +  W+ ++K
Sbjct  478   DEMLKFHHSQLRLHQDWSDGKWITSSK  504


 Score =   164 bits (415),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 104/313 (33%), Positives = 165/313 (53%), Gaps = 24/313 (8%)
 Frame = -3

Query  1022  PKFSK-GMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLL----EYQTLRTDDESEPLKEK  858
             P F K G+ VE ++ EEG+ G+W+   +     P+K  L    EY T+   D S+PLKE 
Sbjct  29    PSFLKPGVAVEISTNEEGFRGAWFMGKVVTVPSPDKDPLNCQVEYATISELDGSKPLKEF  88

Query  857   ADAFNIRPCPPLIHRFDRFKMF---EEVDAWYNEGWWEGLISKVLDGLNYV-VYFWTTNE  690
                 ++RP  P +   ++ +     E+VDA+Y + WWEG +++V  G   + VYF  + E
Sbjct  89    VHVDHLRPALPPMSEMEKKRDILAGEDVDAFYKDVWWEGTVTEVRGGDGKLSVYFRGSQE  148

Query  689   EIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPK-------------PGIMRRHSGGIA  549
              I+F    +R H+EWI+  W     ++       +             P +    +  +A
Sbjct  149   LIQFRRDELRFHREWINDTWQPPLDEAVEEEEESEEDEVDDYTEEYLVPQVNLETTKAVA  208

Query  548   SETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADA  369
              E  F IG  VEV  DEEG  G W+ A ++  IG+ +Y VE++ L+   G + L + AD 
Sbjct  209   KE-MFSIGTVVEVSSDEEGFVGCWFAAKVVERIGDDEYRVEYKDLREVNGVEPLKEVADF  267

Query  368   LSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHH  189
             L +RP  P  + +D F   +++DA+ N+GW VG+V E ++     + FR + E + F  H
Sbjct  268   LHIRPPPPSDEDID-FAVGDKIDAFYNDGWWVGEVIESMKDGSVGIFFRESAEKMRFGRH  326

Query  188   GLRLHQEWINGAW  150
             GLRLH++W+NG W
Sbjct  327   GLRLHKDWVNGNW  339



>gb|KFK38112.1| hypothetical protein AALP_AA3G071100 [Arabis alpina]
Length=417

 Score =   240 bits (612),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 174/486 (36%), Positives = 252/486 (52%), Gaps = 75/486 (15%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEV-LMRDNFPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             M+ +  +  GDRVEV  +     ++FPA V+  PSVRKN     ++VE E+L        
Sbjct  1     MANDGFWRGGDRVEVERVVSGAVVYFPAIVVNEPSVRKNV----VWVEHESLVVGGS--V  54

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRG-WRRGTVDEILENSMYMVALGDE  1710
             R KEYV  + +RP+PP EP   F+ G+  DVF ++ G W RG V E+  +S Y+V    E
Sbjct  55    RMKEYVIPTRLRPSPPCEPNRRFKSGDEVDVFRDSEGCWVRGNVTEVRGDSRYIVEFNGE  114

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTR  1530
             +  E+ +VE   LR+HRDWK       L+E    ++              G KL+IK  R
Sbjct  115   NRPET-EVEHNNLRMHRDWKPSS----LQEGNDLER--------------GYKLKIKLKR  155

Query  1529  GSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEV  1350
                  ++ K   VEV+ +KE ++                            G+  L + V
Sbjct  156   RE---QYEKGAIVEVRSEKEAYK----------------------------GSCPLRDLV  184

Query  1349  DASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVL-GDAKYMVCFGSMNELLTF  1173
             +A  +RP PP+  ++S  +  D+VDAW    WW G+VSKVL G +KY+V   S  E    
Sbjct  185   EAKNMRPVPPQ--QLSSVEPGDEVDAWFNKRWWIGNVSKVLGGGSKYLVYLISTAEEEIV  242

Query  1172  EASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVE  993
                +LRP ++W N  WV+ +K +        + + +                F KGM+VE
Sbjct  243   PHFNLRPRKDWINGQWVSPSKEECCNPPMKKLKSCETAMKG-----------FHKGMMVE  291

Query  992   ATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPP-LIH  816
               S E GY G+WY+A I   +G N++++EYQTL+TDDE E LKE A   +IRP PP LI 
Sbjct  292   VKSDEPGYEGAWYSAKIVRYLGENRYIVEYQTLKTDDERELLKEVARGSDIRPVPPTLIQ  351

Query  815   RFDRFKMFEEVDAWYNEGWWEGLI-SKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWID  639
             R  R+++ E+VDAW+N+GWW G +  K  +   Y VYF TTNE +EF ++ +RP Q W  
Sbjct  352   RVSRYEVNEDVDAWFNDGWWSGRVYQKSNNYTRYGVYFKTTNEALEFEYNDLRPCQVWRK  411

Query  638   KKWDIA  621
              +W  A
Sbjct  412   GEWTRA  417


 Score =   187 bits (476),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 141/417 (34%), Positives = 209/417 (50%), Gaps = 62/417 (15%)
 Frame = -3

Query  1376  GTDYLIEEVDASCIRPCPP-EIHRISPFKLLDKVDAWVGNG--WWEGHVSKVLGDAKYMV  1206
             G+  + E V  + +RP PP E +R   FK  D+VD +  +   W  G+V++V GD++Y+V
Sbjct  52    GSVRMKEYVIPTRLRPSPPCEPNR--RFKSGDEVDVFRDSEGCWVRGNVTEVRGDSRYIV  109

Query  1205  CFGSMNELLT-FEASDLRPHQEWKNNNWVAATKIDLPRSSS-DVMLNskvvkvkskSDRK  1032
              F   N   T  E ++LR H++WK ++       DL R     + L  +           
Sbjct  110   EFNGENRPETEVEHNNLRMHRDWKPSSLQEGN--DLERGYKLKIKLKRRE----------  157

Query  1031  ALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKAD  852
                 ++ KG +VE  S +E Y GS                             PL++  +
Sbjct  158   ----QYEKGAIVEVRSEKEAYKGSC----------------------------PLRDLVE  185

Query  851   AFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDG-LNYVVYFWTTNEEIEFA  675
             A N+RP PP   +    +  +EVDAW+N+ WW G +SKVL G   Y+VY  +T EE    
Sbjct  186   AKNMRPVPP--QQLSSVEPGDEVDAWFNKRWWIGNVSKVLGGGSKYLVYLISTAEEEIVP  243

Query  674   HHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEE  495
             H  +RP ++WI+ +W    ++   N P      M++      +   F  G  VEVK DE 
Sbjct  244   HFNLRPRKDWINGQWVSPSKEECCNPP------MKKLKSCETAMKGFHKGMMVEVKSDEP  297

Query  494   GNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPIL-QRVDRFR  318
             G +G+WY A I+R +G  +Y+VE++TLK D   +LL + A    +RP  P L QRV R+ 
Sbjct  298   GYEGAWYSAKIVRYLGENRYIVEYQTLKTDDERELLKEVARGSDIRPVPPTLIQRVSRYE  357

Query  317   PLEEVDAWSNNGWRVGQVCEVLEG-AKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
               E+VDAW N+GW  G+V +      +Y V F+TTNE LEF ++ LR  Q W  G W
Sbjct  358   VNEDVDAWFNDGWWSGRVYQKSNNYTRYGVYFKTTNEALEFEYNDLRPCQVWRKGEW  414



>ref|XP_002316056.2| hypothetical protein POPTR_0010s15910g [Populus trichocarpa]
 gb|EEF02227.2| hypothetical protein POPTR_0010s15910g [Populus trichocarpa]
Length=410

 Score =   240 bits (612),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 174/488 (36%), Positives = 241/488 (49%), Gaps = 107/488 (22%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDNFP---IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKR  1884
             + A FNKGDR+EVL R+N P    ++PA V++ +        Q+++E++TL  + +   +
Sbjct  5     SHALFNKGDRLEVLKRENGPSTSTYYPATVVKSN------KNQVFIEYQTLMVESNSKGQ  58

Query  1883  RKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDA  1704
                        P    EP   F+V E  DV+ +N G  +GTV +ILENS Y V   D + 
Sbjct  59    ---------TLPRGNNEP---FKVNEKVDVYCDN-GSHKGTVKDILENSRYAVGF-DGEC  104

Query  1703  VESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQY--QQKKSEDFLMTPSGVKLRIKCTR  1530
              E +  EQ  LR+HR+W +G W+PPL    +DQ+Y     KS   ++     K++ +  +
Sbjct  105   SEGIVSEQCNLRLHREWDEGSWIPPL----LDQKYFWDGVKSRKIML-----KIKCRLKK  155

Query  1529  GSCVRKFSKEMP--------VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDG  1374
                V K   +M         VEVK D+EG++ SW+                       D 
Sbjct  156   PDPVGKAGDKMQQIFRDGTLVEVKSDEEGYDGSWF-----------------------DE  192

Query  1373  TDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGS  1194
             T  L E V    IRP PPE+  +  FKL +KVDAW   GWWEG VS VL   KYMV F S
Sbjct  193   TAPLREIVTEQNIRPNPPEVQDVIKFKLHEKVDAWFNEGWWEGVVSSVLSGFKYMVHFNS  252

Query  1193  MNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKF  1014
              N L             W N N + +  ++                     + +   PKF
Sbjct  253   TNTL-------------W-NLNMLESIVLE--------------------GNGRTPKPKF  278

Query  1013  SKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRP  834
             SKG  VE  S E G+ GSWY+A I + +  +KFL++Y+T         L+E+A A +IRP
Sbjct  279   SKGTRVEVKSEEVGFQGSWYSATIVEVMENDKFLVQYET-------GSLREEAGASDIRP  331

Query  833   CPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPH  654
               P I R   F++ E VDAWYN+GWW G I KV + L Y V+F TT E        +RPH
Sbjct  332   SHPRIQRAYAFELSEIVDAWYNDGWWMGCIVKVHNKLKYTVHFKTTEELEFELCE-LRPH  390

Query  653   QEWIDKKW  630
             QEWID+ W
Sbjct  391   QEWIDRNW  398


 Score =   191 bits (486),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 139/393 (35%), Positives = 190/393 (48%), Gaps = 70/393 (18%)
 Frame = -3

Query  1301  PFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCF-GSMNELLTFEASDLRPHQEWKNNNW  1125
             PFK+ +KVD +  NG  +G V  +L +++Y V F G  +E +  E  +LR H+EW   +W
Sbjct  67    PFKVNEKVDVYCDNGSHKGTVKDILENSRYAVGFDGECSEGIVSEQCNLRLHREWDEGSW  126

Query  1124  VAATKIDLPR-----SSSDVMLNskvvkvkskSDRKA---LGPKFSKGMLVEATSFEEGY  969
             +    +D         S  +ML  K    K     KA   +   F  G LVE  S EEGY
Sbjct  127   IPPL-LDQKYFWDGVKSRKIMLKIKCRLKKPDPVGKAGDKMQQIFRDGTLVEVKSDEEGY  185

Query  968   HGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFE  789
              GSW+                       DE+ PL+E     NIRP PP +    +FK+ E
Sbjct  186   DGSWF-----------------------DETAPLREIVTEQNIRPNPPEVQDVIKFKLHE  222

Query  788   EVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKS  609
             +VDAW+NEGWWEG++S VL G  Y+V+F +TN               W     +    + 
Sbjct  223   KVDAWFNEGWWEGVVSSVLSGFKYMVHFNSTN-------------TLWNLNMLESIVLEG  269

Query  608   NNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLV  429
             N   P PK                F  G +VEVK +E G QGSWY A I+ ++ N K+LV
Sbjct  270   NGRTPKPK----------------FSKGTRVEVKSEEVGFQGSWYSATIVEVMENDKFLV  313

Query  428   EFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLE  249
             ++        T  L +EA A  +RPS P +QR   F   E VDAW N+GW +G + +V  
Sbjct  314   QYE-------TGSLREEAGASDIRPSHPRIQRAYAFELSEIVDAWYNDGWWMGCIVKVHN  366

Query  248   GAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
               KY V+F+TT E+       LR HQEWI+  W
Sbjct  367   KLKYTVHFKTTEELEFELCE-LRPHQEWIDRNW  398


 Score =   109 bits (273),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 86/259 (33%), Positives = 116/259 (45%), Gaps = 52/259 (20%)
 Frame = -3

Query  1880  KEYVHLSAVRPAPPG-EPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDA  1704
             +E V    +RP PP  +    F++ E  D ++ N GW  G V  +L    YMV     + 
Sbjct  197   REIVTEQNIRPNPPEVQDVIKFKLHEKVDAWF-NEGWWEGVVSSVLSGFKYMVHFNSTNT  255

Query  1703  VESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGS  1524
             +       W L +            LE   ++   +  K                     
Sbjct  256   L-------WNLNM------------LESIVLEGNGRTPKP--------------------  276

Query  1523  CVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDA  1344
                KFSK   VEVK ++ GF+ SWY++ ++EV+ N K LVQY+       T  L EE  A
Sbjct  277   ---KFSKGTRVEVKSEEVGFQGSWYSATIVEVMENDKFLVQYE-------TGSLREEAGA  326

Query  1343  SCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEAS  1164
             S IRP  P I R   F+L + VDAW  +GWW G + KV    KY V F +  EL   E  
Sbjct  327   SDIRPSHPRIQRAYAFELSEIVDAWYNDGWWMGCIVKVHNKLKYTVHFKTTEELEF-ELC  385

Query  1163  DLRPHQEWKNNNWVAATKI  1107
             +LRPHQEW + NW    KI
Sbjct  386   ELRPHQEWIDRNWFTVPKI  404


 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 84/287 (29%), Positives = 115/287 (40%), Gaps = 56/287 (20%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             F+KG  +E    E G   S Y          N+  +EYQTL    ES    +     N  
Sbjct  9     FNKGDRLEVLKRENGPSTSTYYPATVVKSNKNQVFIEYQTLMV--ESNSKGQTLPRGNNE  66

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYF-WTTNEEIEFAHHGIR  660
             P          FK+ E+VD + + G  +G +  +L+   Y V F    +E I      +R
Sbjct  67    P----------FKVNEKVDVYCDNGSHKGTVKDILENSRYAVGFDGECSEGIVSEQCNLR  116

Query  659   PHQEW---------IDKK--WDIA-----FRKSNNNLPNPKPGIMRRHSGGIASETTFCI  528
              H+EW         +D+K  WD         K    L  P P        G   +  F  
Sbjct  117   LHREWDEGSWIPPLLDQKYFWDGVKSRKIMLKIKCRLKKPDP----VGKAGDKMQQIFRD  172

Query  527   GAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSA  348
             G  VEVK DEEG  GSW+                         T  L +     ++RP+ 
Sbjct  173   GTLVEVKSDEEGYDGSWFDE-----------------------TAPLREIVTEQNIRPNP  209

Query  347   PILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEI  207
             P +Q V +F+  E+VDAW N GW  G V  VL G KY V+F +TN +
Sbjct  210   PEVQDVIKFKLHEKVDAWFNEGWWEGVVSSVLSGFKYMVHFNSTNTL  256



>ref|XP_011092174.1| PREDICTED: uncharacterized protein LOC105172443 [Sesamum indicum]
Length=317

 Score =   234 bits (597),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 133/314 (42%), Positives = 192/314 (61%), Gaps = 14/314 (4%)
 Frame = -3

Query  1538  CTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGN-----GKLLVQYQDLKTDD-  1377
              +R S  + F K   VE+  D+EGF  SWYA+ V+   GN      K+LV+Y+ L  D+ 
Sbjct  4     SSRDSISQYFKKGAEVEISSDEEGFRGSWYAATVVRPPGNVKRGSAKVLVEYKTLTEDEK  63

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
             GT  L EE+    +RP PP   R S FK  ++VDA+  +GWWEG +++V+G+ KY+V F 
Sbjct  64    GTRPLREELQLVQLRPPPPREKRRS-FKFSEEVDAYYSDGWWEGIITEVVGEDKYLVFFR  122

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVM--LNskvvkvkskSDRKALG  1023
                E + F+ SDLR H+EW +  WV   +      + DV+  +       + ++ ++   
Sbjct  123   GTREQIAFKGSDLRLHREWVHGKWVPPLE-----PAQDVIPEIEKLPPSTEVEAAKEMNE  177

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFN  843
               FS G +VE +S EEG+ G+W+TA +   +   KFL+EYQTLR DD+++ L+E+ D F+
Sbjct  178   HNFSPGEVVEVSSDEEGFEGAWFTATVVKKLKAGKFLVEYQTLRNDDDTDFLREEVDTFH  237

Query  842   IRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGI  663
             IRPCPP +   DRF + EEVDA YN+GWW G+ISKVL    Y VYF  T EE++F H  +
Sbjct  238   IRPCPPDVGLLDRFDVLEEVDALYNDGWWRGVISKVLKNDRYSVYFKNTQEELKFKHSDL  297

Query  662   RPHQEWIDKKWDIA  621
             R HQ+W++ KW IA
Sbjct  298   RVHQDWVNGKWVIA  311


 Score =   212 bits (539),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 121/304 (40%), Positives = 179/304 (59%), Gaps = 9/304 (3%)
 Frame = -3

Query  1037  RKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFD-----SIGPNKFLLEYQTLRTDDE-S  876
             R ++   F KG  VE +S EEG+ GSWY A +         G  K L+EY+TL  D++ +
Sbjct  6     RDSISQYFKKGAEVEISSDEEGFRGSWYAATVVRPPGNVKRGSAKVLVEYKTLTEDEKGT  65

Query  875   EPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTT  696
              PL+E+     +RP PP   R   FK  EEVDA+Y++GWWEG+I++V+    Y+V+F  T
Sbjct  66    RPLREELQLVQLRPPPPREKRRS-FKFSEEVDAYYSDGWWEGIITEVVGEDKYLVFFRGT  124

Query  695   NEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPK--PGIMRRHSGGIASETTFCIGA  522
              E+I F    +R H+EW+  KW      + + +P  +  P      +    +E  F  G 
Sbjct  125   REQIAFKGSDLRLHREWVHGKWVPPLEPAQDVIPEIEKLPPSTEVEAAKEMNEHNFSPGE  184

Query  521   KVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPI  342
              VEV  DEEG +G+W+ A +++ +  GK+LVE++TL+ D  TD L +E D   +RP  P 
Sbjct  185   VVEVSSDEEGFEGAWFTATVVKKLKAGKFLVEYQTLRNDDDTDFLREEVDTFHIRPCPPD  244

Query  341   LQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWI  162
             +  +DRF  LEEVDA  N+GW  G + +VL+  +Y V F+ T E L+F+H  LR+HQ+W+
Sbjct  245   VGLLDRFDVLEEVDALYNDGWWRGVISKVLKNDRYSVYFKNTQEELKFKHSDLRVHQDWV  304

Query  161   NGAW  150
             NG W
Sbjct  305   NGKW  308


 Score =   187 bits (476),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 117/318 (37%), Positives = 173/318 (54%), Gaps = 14/318 (4%)
 Frame = -3

Query  2057  SAEAQFNKGDRVEVLMRDN--FPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKR  1884
             S    F KG  VE+   +      W+ A V+RP     + + ++ VE++TL  D+   + 
Sbjct  8     SISQYFKKGAEVEISSDEEGFRGSWYAATVVRPPGNVKRGSAKVLVEYKTLTEDEKGTRP  67

Query  1883  RKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDA  1704
              +E + L  +RP PP E    F+  E  D +Y + GW  G + E++    Y+V       
Sbjct  68    LREELQLVQLRPPPPREKRRSFKFSEEVDAYYSD-GWWEGIITEVVGEDKYLVFF--RGT  124

Query  1703  VESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGS  1524
              E +  +   LR+HR+W  G WVPPLE +Q D   + +K     + PS     ++  +  
Sbjct  125   REQIAFKGSDLRLHREWVHGKWVPPLEPAQ-DVIPEIEK-----LPPS---TEVEAAKEM  175

Query  1523  CVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDA  1344
                 FS    VEV  D+EGFE +W+ + V++ L  GK LV+YQ L+ DD TD+L EEVD 
Sbjct  176   NEHNFSPGEVVEVSSDEEGFEGAWFTATVVKKLKAGKFLVEYQTLRNDDDTDFLREEVDT  235

Query  1343  SCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEAS  1164
               IRPCPP++  +  F +L++VDA   +GWW G +SKVL + +Y V F +  E L F+ S
Sbjct  236   FHIRPCPPDVGLLDRFDVLEEVDALYNDGWWRGVISKVLKNDRYSVYFKNTQEELKFKHS  295

Query  1163  DLRPHQEWKNNNWVAATK  1110
             DLR HQ+W N  WV A+K
Sbjct  296   DLRVHQDWVNGKWVIASK  313



>ref|XP_006297650.1| hypothetical protein CARUB_v10013669mg [Capsella rubella]
 gb|EOA30548.1| hypothetical protein CARUB_v10013669mg [Capsella rubella]
Length=457

 Score =   238 bits (608),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 178/488 (36%), Positives = 265/488 (54%), Gaps = 39/488 (8%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEV-LMRDNFPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             M+++  +  GDRVEV  +      +F A V+  PSVRK      ++VE E L        
Sbjct  1     MASDRFWRGGDRVEVERLVSGATAYFTATVVSAPSVRKKH----VWVEHEALTVGGSA--  54

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRG-WRRGTVDEILENSMYMVALGDE  1710
             R KEYV  S +RP+PP E    F+  +  DVF +  G W RGTV  +L +S Y+VA   E
Sbjct  55    RMKEYVIPSLLRPSPPRELNRRFKANDEVDVFRDTEGCWVRGTVTTVLGDSRYIVAFKGE  114

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTR  1530
             +  E ++ +Q  +R+HR+W+ G WVP L        +QQ  S     TP  +KL+IK  R
Sbjct  115   NRPE-IEFDQLDMRLHREWQGGSWVPSL--------FQQ--SNVLESTPKSIKLKIKIKR  163

Query  1529  GSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDY-LIEE  1353
                  ++ K   VEV+ ++  ++ SWY ++++ +LG+ K +V++ +   D G    L + 
Sbjct  164   RD---QYEKGALVEVRSEEAAYKGSWYCALILCLLGDDKYIVEHLNFSRDGGESIPLRDV  220

Query  1352  VDASCIRPCPPEIHRISP-FKLLDKVDAWVGNGWWEGHVSKVLGD-AKYMVCFGSMNELL  1179
             V++  +RP PP        ++  D+VD W    WW G VSKVLG  +KY V   S  E  
Sbjct  221   VESQNMRPVPPPQVSPVECYEPGDEVDVWFNKRWWTGRVSKVLGGGSKYSVFITSKGEEP  280

Query  1178  TFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGML  999
             T  +S+LRPH++W N  W   +K +  R     + + +  +             F+  M+
Sbjct  281   TILSSNLRPHKDWINGEWSNPSKAECYRPPLKKLKSCERAEKV-----------FNNEMM  329

Query  998   VEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFN-IRPCPPL  822
             VE  S E GY GSW++A I   +G N++ +EYQTL+TDDE E LKE+A   +     PPL
Sbjct  330   VEVRSDERGYEGSWFSAKIISYLGDNRYTVEYQTLKTDDEGELLKEEARGSDIRPIPPPL  389

Query  821   IHRFDRFKMFEEVDAWYNEGWWEGLISKV-LDGLNYVVYFWTTNEEIEFAHHGIRPHQEW  645
             I +  R+K++E+VDAWYNEGWW G +  +  +   Y VYF T +E +EFA+  +RP Q W
Sbjct  390   IPKAYRYKLYEDVDAWYNEGWWSGRVYTINYNYTRYGVYFKTNDERLEFAYSDLRPCQVW  449

Query  644   IDKKWDIA  621
              + KW  A
Sbjct  450   RNGKWSHA  457


 Score =   193 bits (490),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 147/421 (35%), Positives = 223/421 (53%), Gaps = 24/421 (6%)
 Frame = -3

Query  1385  TDDGTDYLIEEVDASCIRPCPP-EIHRISPFKLLDKVDAW--VGNGWWEGHVSKVLGDAK  1215
             T  G+  + E V  S +RP PP E++R   FK  D+VD +      W  G V+ VLGD++
Sbjct  49    TVGGSARMKEYVIPSLLRPSPPRELNR--RFKANDEVDVFRDTEGCWVRGTVTTVLGDSR  106

Query  1214  YMVCFGSMNE-LLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSD  1038
             Y+V F   N   + F+  D+R H+EW+  +WV +    L + S+ +    K +K+K K  
Sbjct  107   YIVAFKGENRPEIEFDQLDMRLHREWQGGSWVPS----LFQQSNVLESTPKSIKLKIKIK  162

Query  1037  RKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDD-ESEPLKE  861
             R+    ++ KG LVE  S E  Y GSWY A+I   +G +K+++E+     D  ES PL++
Sbjct  163   RR---DQYEKGALVEVRSEEAAYKGSWYCALILCLLGDDKYIVEHLNFSRDGGESIPLRD  219

Query  860   KADAFNIRPCPPLIHRFDR-FKMFEEVDAWYNEGWWEGLISKVLDG-LNYVVYFWTTNEE  687
               ++ N+RP PP        ++  +EVD W+N+ WW G +SKVL G   Y V+  +  EE
Sbjct  220   VVESQNMRPVPPPQVSPVECYEPGDEVDVWFNKRWWTGRVSKVLGGGSKYSVFITSKGEE  279

Query  686   IEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVK  507
                    +RPH++WI+ +W    +      P  K     R      +E  F     VEV+
Sbjct  280   PTILSSNLRPHKDWINGEWSNPSKAECYRPPLKKLKSCER------AEKVFNNEMMVEVR  333

Query  506   DDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADAL-SVRPSAPILQRV  330
              DE G +GSW+ A I+  +G+ +Y VE++TLK D   +LL +EA          P++ + 
Sbjct  334   SDERGYEGSWFSAKIISYLGDNRYTVEYQTLKTDDEGELLKEEARGSDIRPIPPPLIPKA  393

Query  329   DRFRPLEEVDAWSNNGWRVGQVCEV-LEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGA  153
              R++  E+VDAW N GW  G+V  +     +Y V F+T +E LEF +  LR  Q W NG 
Sbjct  394   YRYKLYEDVDAWYNEGWWSGRVYTINYNYTRYGVYFKTNDERLEFAYSDLRPCQVWRNGK  453

Query  152   W  150
             W
Sbjct  454   W  454



>ref|XP_010938198.1| PREDICTED: uncharacterized protein LOC105057314 [Elaeis guineensis]
Length=428

 Score =   236 bits (602),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 163/480 (34%), Positives = 236/480 (49%), Gaps = 67/480 (14%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDN--FPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRR  1881
             A A F  GD VEV   D+     WF A V R  + K  R   +Y   ET+  D D  +  
Sbjct  2     AAAGFMTGDAVEVSSEDDGFRDAWFEAKVAR-YMPKLHRYTVVY---ETIMDDADESRPL  57

Query  1880  KEYVHLSAVRPAPPGEPCC--YFRVGESADVFYENRGWRRGTVDEILENS-MYMVALGDE  1710
             +E V    VRP PP  P     F + +  D FY N GW  G V  + E    +  ++   
Sbjct  58    RETVDGRFVRPRPPSRPTAGGRFALHQPVDAFY-NDGWWVGVVSRVAEKERQWRYSVVFP  116

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTR  1530
                E ++    +LR H +W DG WV P  E    + Y+           +G ++ +   +
Sbjct  117   TTREEIEFAASELRTHLEWVDGKWVLPESEETPAKVYE-----------TGTQVEVARMK  165

Query  1529  GSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEV  1350
             G+         P+           +W ++VV++ +     LV+Y+  +  D T+ L E V
Sbjct  166   GNT--------PI-----------AWLSAVVVKAIWKSNFLVEYKHFRNLDDTELLREIV  206

Query  1349  DASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFE  1170
             DA  +RPCPP   ++  F LLD+V+A+ GNGW  G V+K+   +KY V      E   F 
Sbjct  207   DAKHMRPCPPHASKVK-FDLLDEVEAFYGNGWLPGVVAKIHTRSKYRVKIAHWGEEREFS  265

Query  1169  ASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEA  990
              ++LR   +  +  WV A++     + SD+ L                     +G +VE 
Sbjct  266   YAELRLRYDLVDGQWVKASQ-----NKSDMELR--------------------EGTMVEV  300

Query  989   TSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRF  810
              S +EG+ G+WY A I   I   KFL+EYQ L+TDDE++PL E  D  +IRP P      
Sbjct  301   CSDDEGFRGAWYAATIVRLIWKKKFLVEYQNLKTDDETKPLTEIVDFQHIRPSPE-TSVV  359

Query  809   DRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             +RFK+ EEVDA+YN+GWW G+ISKVL G  Y+VYF   +EE+EF H  +R H +WI  +W
Sbjct  360   ERFKLLEEVDAFYNDGWWVGVISKVLKGQRYMVYFKPWSEELEFGHKDLRLHHDWIGGRW  419


 Score =   226 bits (575),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 154/454 (34%), Positives = 226/454 (50%), Gaps = 52/454 (11%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGN-GKLLVQYQDLKTD-DGTDYLIEEVDASCIRPCPP  1320
             VEV  + +GF  +W+ + V   +    +  V Y+ +  D D +  L E VD   +RP PP
Sbjct  12    VEVSSEDDGFRDAWFEAKVARYMPKLHRYTVVYETIMDDADESRPLRETVDGRFVRPRPP  71

Query  1319  EIHRISP-FKLLDKVDAWVGNGWWEGHVSKVLGDAK---YMVCFGSMNELLTFEASDLRP  1152
                     F L   VDA+  +GWW G VS+V    +   Y V F +  E + F AS+LR 
Sbjct  72    SRPTAGGRFALHQPVDAFYNDGWWVGVVSRVAEKERQWRYSVVFPTTREEIEFAASELRT  131

Query  1151  HQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEG  972
             H EW +  WV      LP S                   +     +  G  VE    +  
Sbjct  132   HLEWVDGKWV------LPESE------------------ETPAKVYETGTQVEVARMKGN  167

Query  971   YHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMF  792
                +W +AV+  +I  + FL+EY+  R  D++E L+E  DA ++RPCPP   +  +F + 
Sbjct  168   TPIAWLSAVVVKAIWKSNFLVEYKHFRNLDDTELLREIVDAKHMRPCPPHASKV-KFDLL  226

Query  791   EEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRK  612
             +EV+A+Y  GW  G+++K+     Y V      EE EF++  +R   + +D +W    + 
Sbjct  227   DEVEAFYGNGWLPGVVAKIHTRSKYRVKIAHWGEEREFSYAELRLRYDLVDGQW---VKA  283

Query  611   SNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYL  432
             S N                  S+     G  VEV  D+EG +G+WY A I+RLI   K+L
Sbjct  284   SQNK-----------------SDMELREGTMVEVCSDDEGFRGAWYAATIVRLIWKKKFL  326

Query  431   VEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVL  252
             VE++ LK D  T  L +  D   +RPS P    V+RF+ LEEVDA+ N+GW VG + +VL
Sbjct  327   VEYQNLKTDDETKPLTEIVDFQHIRPS-PETSVVERFKLLEEVDAFYNDGWWVGVISKVL  385

Query  251   EGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +G +Y V F+  +E LEF H  LRLH +WI G W
Sbjct  386   KGQRYMVYFKPWSEELEFGHKDLRLHHDWIGGRW  419


 Score =   137 bits (344),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 108/325 (33%), Positives = 155/325 (48%), Gaps = 44/325 (14%)
 Frame = -3

Query  2078  VPETHAMSAEAQFNKGDRVEVL-MRDNFPI-WFPAAVLRPSVRKNQRAGQIYVEFETLCS  1905
             +PE+    A+  +  G +VEV  M+ N PI W  A V++   + N       VE++   +
Sbjct  142   LPESEETPAKV-YETGTQVEVARMKGNTPIAWLSAVVVKAIWKSN-----FLVEYKHFRN  195

Query  1904  DDDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMV  1725
              DD    R E V    +RP PP      F + +  + FY N GW  G V +I   S Y V
Sbjct  196   LDDTELLR-EIVDAKHMRPCPPHASKVKFDLLDEVEAFYGN-GWLPGVVAKIHTRSKYRV  253

Query  1724  ALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLR  1545
              +      E  +    +LR+  D  DG WV          +  Q KS+            
Sbjct  254   KIAHWG--EEREFSYAELRLRYDLVDGQWV----------KASQNKSD------------  289

Query  1544  IKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDY  1365
             ++   G+ V         EV  D EGF  +WYA+ ++ ++   K LV+YQ+LKTDD T  
Sbjct  290   MELREGTMV---------EVCSDDEGFRGAWYAATIVRLIWKKKFLVEYQNLKTDDETKP  340

Query  1364  LIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNE  1185
             L E VD   IRP P E   +  FKLL++VDA+  +GWW G +SKVL   +YMV F   +E
Sbjct  341   LTEIVDFQHIRPSP-ETSVVERFKLLEEVDAFYNDGWWVGVISKVLKGQRYMVYFKPWSE  399

Query  1184  LLTFEASDLRPHQEWKNNNWVAATK  1110
              L F   DLR H +W    W+ +++
Sbjct  400   ELEFGHKDLRLHHDWIGGRWLRSSE  424


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 67/135 (50%), Gaps = 6/135 (4%)
 Frame = -3

Query  536  FCIGAKVEVKDDEEGNQGSWYPALILRLIGN-GKYLVEFRTLKCDFGTDLLVQEA-DALS  363
            F  G  VEV  +++G + +W+ A + R +    +Y V + T+  D      ++E  D   
Sbjct  6    FMTGDAVEVSSEDDGFRDAWFEAKVARYMPKLHRYTVVYETIMDDADESRPLRETVDGRF  65

Query  362  VRPSAPILQRV-DRFRPLEEVDAWSNNGWRVGQVCEVLEGA---KYRVNFRTTNEILEFR  195
            VRP  P       RF   + VDA+ N+GW VG V  V E     +Y V F TT E +EF 
Sbjct  66   VRPRPPSRPTAGGRFALHQPVDAFYNDGWWVGVVSRVAEKERQWRYSVVFPTTREEIEFA  125

Query  194  HHGLRLHQEWINGAW  150
               LR H EW++G W
Sbjct  126  ASELRTHLEWVDGKW  140



>ref|XP_010464225.1| PREDICTED: uncharacterized protein LOC104744821 [Camelina sativa]
Length=459

 Score =   236 bits (601),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 173/487 (36%), Positives = 252/487 (52%), Gaps = 36/487 (7%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEV-LMRDNFPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             M+++  +  GDRVEV  +      +FPA V+  PSVRKN     + VE E L        
Sbjct  2     MTSDGFWRGGDRVEVERIVSGATAYFPATVVSAPSVRKNH----VLVEHEALTVGGSV--  55

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRG-WRRGTVDEILENSMYMVALGDE  1710
             R KEYV  + +RP+PP E    F+  +  DVF +  G W RG V  +L +S Y+V     
Sbjct  56    RMKEYVTPTRLRPSPPRELNRRFKAKDEVDVFRDTEGCWVRGNVTTVLGDSRYIVEFKGG  115

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTR  1530
             +  E ++V+Q  +R+HR+W+DG WVP L++S V +   Q+      +             
Sbjct  116   NRPE-IEVDQLDMRLHREWQDGSWVPSLQQSNVMESTPQRIKLKIKIKKRE---------  165

Query  1529  GSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDY-LIEE  1353
                  ++ K   VEV+ ++E ++ SWY + ++  LG+ K +V++     DDG    L + 
Sbjct  166   ----NQYEKGALVEVRSEEEVYKGSWYCARILCSLGDDKYIVEHLKFSRDDGESLPLRDV  221

Query  1352  VDASCIRPCPPEIHRISP-FKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
             V+A  +RP PP        ++  D+VD W    WW G VS VLG       F S  E  T
Sbjct  222   VEAQNMRPVPPPEVSPVVCYEPEDEVDVWFKKRWWIGRVSNVLGGGCKYTVFISRGEEPT  281

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
                 +LRPH++W N  W   +K       S    N    K     +R  +   F  GM+V
Sbjct  282   VLNFNLRPHKDWINGEWSNPSK-------SKGECNRPPFKKLKSCERAEM--VFKNGMMV  332

Query  995   EATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFN-IRPCPPLI  819
             E  S E GY GSW++A +   +G N++ +EYQTL+TDDE E LKE+A   +     PPLI
Sbjct  333   EVRSDEPGYEGSWFSAKVISYLGENRYTVEYQTLKTDDEGELLKEEARGSDLRPIPPPLI  392

Query  818   HRFDRFKMFEEVDAWYNEGWWEGLISKV-LDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
              +  R+++ E+VDAWYNEGWW G +  +  +   Y VYF T NE +EFA + +RP Q W 
Sbjct  393   PKAYRYELHEDVDAWYNEGWWSGQVYTINYNHTRYGVYFKTNNERLEFACNDLRPCQVWR  452

Query  641   DKKWDIA  621
             + KW  A
Sbjct  453   NGKWSRA  459


 Score =   194 bits (492),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 148/429 (34%), Positives = 226/429 (53%), Gaps = 22/429 (5%)
 Frame = -3

Query  1412  LLVQYQDLKTDDGTDYLIEEVDASCIRPCPP-EIHRISPFKLLDKVDAW--VGNGWWEGH  1242
             +LV+++ L T  G+  + E V  + +RP PP E++R   FK  D+VD +      W  G+
Sbjct  42    VLVEHEAL-TVGGSVRMKEYVTPTRLRPSPPRELNR--RFKAKDEVDVFRDTEGCWVRGN  98

Query  1241  VSKVLGDAKYMVCF-GSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNsk  1065
             V+ VLGD++Y+V F G     +  +  D+R H+EW++ +WV + +       S+VM ++ 
Sbjct  99    VTTVLGDSRYIVEFKGGNRPEIEVDQLDMRLHREWQDGSWVPSLQ------QSNVMESTP  152

Query  1064  vvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTD  885
                      +K    ++ KG LVE  S EE Y GSWY A I  S+G +K+++E+     D
Sbjct  153   QRIKLKIKIKKREN-QYEKGALVEVRSEEEVYKGSWYCARILCSLGDDKYIVEHLKFSRD  211

Query  884   D-ESEPLKEKADAFNIRPCPPLIHRFDR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVV  711
             D ES PL++  +A N+RP PP        ++  +EVD W+ + WW G +S VL G     
Sbjct  212   DGESLPLRDVVEAQNMRPVPPPEVSPVVCYEPEDEVDVWFKKRWWIGRVSNVLGGGCKYT  271

Query  710   YFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFC  531
              F +  EE    +  +RPH++WI+ +W     KS      P     ++      +E  F 
Sbjct  272   VFISRGEEPTVLNFNLRPHKDWINGEWSNP-SKSKGECNRPP---FKKLKSCERAEMVFK  327

Query  530   IGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALS-VRP  354
              G  VEV+ DE G +GSW+ A ++  +G  +Y VE++TLK D   +LL +EA        
Sbjct  328   NGMMVEVRSDEPGYEGSWFSAKVISYLGENRYTVEYQTLKTDDEGELLKEEARGSDLRPI  387

Query  353   SAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEV-LEGAKYRVNFRTTNEILEFRHHGLRL  177
               P++ +  R+   E+VDAW N GW  GQV  +     +Y V F+T NE LEF  + LR 
Sbjct  388   PPPLIPKAYRYELHEDVDAWYNEGWWSGQVYTINYNHTRYGVYFKTNNERLEFACNDLRP  447

Query  176   HQEWINGAW  150
              Q W NG W
Sbjct  448   CQVWRNGKW  456



>gb|KHG16120.1| hypothetical protein F383_01239 [Gossypium arboreum]
Length=352

 Score =   231 bits (588),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 127/329 (39%), Positives = 182/329 (55%), Gaps = 39/329 (12%)
 Frame = -3

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTAVIF---DSIGPNKFLLEYQTLRTDDE-SEPLKEKA  855
             P    G  VE +S + G+ GSWYT VI     S  P+KFL++Y  L  D+  + PLKE  
Sbjct  16    PHLQPGSQVEISSNDPGFRGSWYTGVIIKRPSSKKPSKFLVQYTHLFEDEAGTTPLKETI  75

Query  854   DAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFA  675
             DA +IRP  P      +FK  EEVDA+YN+GWWEG+I+K L+  N+ VYF  + E++EF 
Sbjct  76    DAVDIRPLAPR-ESTRKFKFSEEVDAYYNDGWWEGVITKELENGNFHVYFKRSKEQLEFG  134

Query  674   HHGIRPHQEWIDKKW--------------------DIAFRK--SNNNLPNPKPGIMRRHS  561
                +R H+EWI+  W                     + F K  +   L        ++  
Sbjct  135   EEQLRLHREWINGSWTPPLAGDEQVKESDRAVTEAKMKFSKVVTQEKLKRDNAASKKKSK  194

Query  560   GGIAS------------ETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRT  417
              G+A             +  FC GA VEV  DE+G +G+W+   I++++G  +YLV++ +
Sbjct  195   SGLAGSGEKLRSSKITMDKFFCKGAHVEVTSDEDGFEGAWFAGTIVKVVGKDRYLVQYES  254

Query  416   LKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKY  237
             L+ D  TD L +E D L +RP  P +   DRF+ L+EVDA+ N+GW VG + +VL  +KY
Sbjct  255   LRTDDDTDFLKEEFDDLHIRPCPPEIVMADRFQKLDEVDAFYNDGWWVGVISKVLSDSKY  314

Query  236   RVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              V F+ T E ++F H  LRLHQ+WING W
Sbjct  315   EVYFKATKEEMKFEHSELRLHQDWINGKW  343


 Score =   209 bits (531),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 123/326 (38%), Positives = 173/326 (53%), Gaps = 34/326 (10%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGN---GKLLVQYQDLKTDD-GTDYLIEEVDASCIRPC  1326
             VE+  +  GF  SWY  V+++   +    K LVQY  L  D+ GT  L E +DA  IRP 
Sbjct  24    VEISSNDPGFRGSWYTGVIIKRPSSKKPSKFLVQYTHLFEDEAGTTPLKETIDAVDIRPL  83

Query  1325  PPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQ  1146
              P       FK  ++VDA+  +GWWEG ++K L +  + V F    E L F    LR H+
Sbjct  84    APR-ESTRKFKFSEEVDAYYNDGWWEGVITKELENGNFHVYFKRSKEQLEFGEEQLRLHR  142

Query  1145  EWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKAL------------------GP  1020
             EW N +W      D     SD  +    +K      ++ L                  G 
Sbjct  143   EWINGSWTPPLAGDEQVKESDRAVTEAKMKFSKVVTQEKLKRDNAASKKKSKSGLAGSGE  202

Query  1019  K-----------FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESE  873
             K           F KG  VE TS E+G+ G+W+   I   +G +++L++Y++LRTDD+++
Sbjct  203   KLRSSKITMDKFFCKGAHVEVTSDEDGFEGAWFAGTIVKVVGKDRYLVQYESLRTDDDTD  262

Query  872   PLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTN  693
              LKE+ D  +IRPCPP I   DRF+  +EVDA+YN+GWW G+ISKVL    Y VYF  T 
Sbjct  263   FLKEEFDDLHIRPCPPEIVMADRFQKLDEVDAFYNDGWWVGVISKVLSDSKYEVYFKATK  322

Query  692   EEIEFAHHGIRPHQEWIDKKWDIAFR  615
             EE++F H  +R HQ+WI+ KW  AF+
Sbjct  323   EEMKFEHSELRLHQDWINGKWVAAFQ  348


 Score =   192 bits (488),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 117/319 (37%), Positives = 170/319 (53%), Gaps = 36/319 (11%)
 Frame = -3

Query  1991  WFPAAVL-RPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCYFR  1815
             W+   ++ RPS +K     +  V++  L  D+      KE +    +RP  P E    F+
Sbjct  37    WYTGVIIKRPSSKK---PSKFLVQYTHLFEDEAGTTPLKETIDAVDIRPLAPRESTRKFK  93

Query  1814  VGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWV  1635
               E  D +Y N GW  G + + LEN  + V    + + E ++  + QLR+HR+W +G W 
Sbjct  94    FSEEVDAYY-NDGWWEGVITKELENGNFHVYF--KRSKEQLEFGEEQLRLHREWINGSWT  150

Query  1634  PPL--------------------------EESQVDQQYQQKKSEDFLMTPSGVKLRIKCT  1533
             PPL                          E+ + D    +KKS+  L   SG KLR   +
Sbjct  151   PPLAGDEQVKESDRAVTEAKMKFSKVVTQEKLKRDNAASKKKSKSGLAG-SGEKLR--SS  207

Query  1532  RGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEE  1353
             + +  + F K   VEV  D++GFE +W+A  +++V+G  + LVQY+ L+TDD TD+L EE
Sbjct  208   KITMDKFFCKGAHVEVTSDEDGFEGAWFAGTIVKVVGKDRYLVQYESLRTDDDTDFLKEE  267

Query  1352  VDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTF  1173
              D   IRPCPPEI     F+ LD+VDA+  +GWW G +SKVL D+KY V F +  E + F
Sbjct  268   FDDLHIRPCPPEIVMADRFQKLDEVDAFYNDGWWVGVISKVLSDSKYEVYFKATKEEMKF  327

Query  1172  EASDLRPHQEWKNNNWVAA  1116
             E S+LR HQ+W N  WVAA
Sbjct  328   EHSELRLHQDWINGKWVAA  346



>ref|XP_007221606.1| hypothetical protein PRUPE_ppa026926mg [Prunus persica]
 gb|EMJ22805.1| hypothetical protein PRUPE_ppa026926mg [Prunus persica]
Length=301

 Score =   225 bits (573),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/314 (39%), Positives = 184/314 (59%), Gaps = 22/314 (7%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDNFPI--WFPAAVLRPSVRKNQRAGQIYVEFETLCS-DDDPMKR  1884
             ++  FNKGD+VEV    +     ++PA VLRP  +       + V+ +TL + + D  K 
Sbjct  2     SQTLFNKGDQVEVTRPGHGSTGPYYPAMVLRPVFKDK---AHMLVQHQTLTNPNADGSKT  58

Query  1883  RKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDA  1704
               E V L   R  PP E   +F+VG+  D  Y ++GW RGTV +ILENS Y+VA   ++ 
Sbjct  59    LIEIVELRNARLVPPRELYQFFKVGDDVDA-YRDKGWSRGTVRDILENSKYLVAFQGQE-  116

Query  1703  VESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGS  1524
                 + +Q+ LR+HR+W+D  WVP  +E +      +K           + L++KC+  +
Sbjct  117   ---FQCQQFNLRLHREWEDDSWVPHFQEEKTSPVKSRK-----------LVLKLKCSNRT  162

Query  1523  CVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDA  1344
                 F     VEV  D+EG+E +WY + +++ +G+ K LV+Y+ L TDDGT+ L EE  A
Sbjct  163   SGASFENGTVVEVSSDEEGYEGAWYTAKIIDHIGSDKFLVEYEHLVTDDGTELLREETCA  222

Query  1343  SCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEAS  1164
             S IRPCPP +  ++ FK+L +VD    +GWW+G +SKVL  +KY+V F S NE L F+ S
Sbjct  223   SYIRPCPPRLPPVAQFKVLQQVDTLYNDGWWKGTISKVLSGSKYVVYFSSTNEELEFKHS  282

Query  1163  DLRPHQEWKNNNWV  1122
             +LRPHQ+W N  W+
Sbjct  283   NLRPHQDWINGRWI  296


 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 123/301 (41%), Positives = 177/301 (59%), Gaps = 18/301 (6%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK--LLVQYQDLKT--DDGTDYLIEEVDA  1344
             F+K   VEV     G    +Y ++V+  +   K  +LVQ+Q L     DG+  LIE V+ 
Sbjct  6     FNKGDQVEVTRPGHGSTGPYYPAMVLRPVFKDKAHMLVQHQTLTNPNADGSKTLIEIVEL  65

Query  1343  SCIRPCPP-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEA  1167
                R  PP E+++   FK+ D VDA+   GW  G V  +L ++KY+V F    +    + 
Sbjct  66    RNARLVPPRELYQF--FKVGDDVDAYRDKGWSRGTVRDILENSKYLVAF--QGQEFQCQQ  121

Query  1166  SDLRPHQEWKNNNWVAATKID--LPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVE  993
              +LR H+EW++++WV   + +   P  S  ++L  K          +  G  F  G +VE
Sbjct  122   FNLRLHREWEDDSWVPHFQEEKTSPVKSRKLVLKLKC-------SNRTSGASFENGTVVE  174

Query  992   ATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHR  813
              +S EEGY G+WYTA I D IG +KFL+EY+ L TDD +E L+E+  A  IRPCPP +  
Sbjct  175   VSSDEEGYEGAWYTAKIIDHIGSDKFLVEYEHLVTDDGTELLREETCASYIRPCPPRLPP  234

Query  812   FDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKK  633
               +FK+ ++VD  YN+GWW+G ISKVL G  YVVYF +TNEE+EF H  +RPHQ+WI+ +
Sbjct  235   VAQFKVLQQVDTLYNDGWWKGTISKVLSGSKYVVYFSSTNEELEFKHSNLRPHQDWINGR  294

Query  632   W  630
             W
Sbjct  295   W  295


 Score =   182 bits (461),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 109/294 (37%), Positives = 165/294 (56%), Gaps = 9/294 (3%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK--FLLEYQTLRT--DDESEPLKEKADA  849
             F+KG  VE T    G  G +Y A++   +  +K   L+++QTL     D S+ L E  + 
Sbjct  6     FNKGDQVEVTRPGHGSTGPYYPAMVLRPVFKDKAHMLVQHQTLTNPNADGSKTLIEIVEL  65

Query  848   FNIRPCPPL-IHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
              N R  PP  +++F  FK+ ++VDA+ ++GW  G +  +L+   Y+V F    +E +   
Sbjct  66    RNARLVPPRELYQF--FKVGDDVDAYRDKGWSRGTVRDILENSKYLVAF--QGQEFQCQQ  121

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
               +R H+EW D  W   F++   +    +  +++       S  +F  G  VEV  DEEG
Sbjct  122   FNLRLHREWEDDSWVPHFQEEKTSPVKSRKLVLKLKCSNRTSGASFENGTVVEVSSDEEG  181

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPL  312
              +G+WY A I+  IG+ K+LVE+  L  D GT+LL +E  A  +RP  P L  V +F+ L
Sbjct  182   YEGAWYTAKIIDHIGSDKFLVEYEHLVTDDGTELLREETCASYIRPCPPRLPPVAQFKVL  241

Query  311   EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             ++VD   N+GW  G + +VL G+KY V F +TNE LEF+H  LR HQ+WING W
Sbjct  242   QQVDTLYNDGWWKGTISKVLSGSKYVVYFSSTNEELEFKHSNLRPHQDWINGRW  295


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 74/137 (54%), Gaps = 7/137 (5%)
 Frame = -3

Query  548  SETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGK--YLVEFRTLKCDF--GTDLLVQ  381
            S+T F  G +VEV     G+ G +YPA++LR +   K   LV+ +TL      G+  L++
Sbjct  2    SQTLFNKGDQVEVTRPGHGSTGPYYPAMVLRPVFKDKAHMLVQHQTLTNPNADGSKTLIE  61

Query  380  EADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILE  201
              +  + R   P  +    F+  ++VDA+ + GW  G V ++LE +KY V F+   +  +
Sbjct  62   IVELRNAR-LVPPRELYQFFKVGDDVDAYRDKGWSRGTVRDILENSKYLVAFQ--GQEFQ  118

Query  200  FRHHGLRLHQEWINGAW  150
             +   LRLH+EW + +W
Sbjct  119  CQQFNLRLHREWEDDSW  135



>ref|XP_007035879.1| Agenet domain-containing protein, putative isoform 5, partial 
[Theobroma cacao]
 gb|EOY06805.1| Agenet domain-containing protein, putative isoform 5, partial 
[Theobroma cacao]
Length=397

 Score =   223 bits (569),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 147/354 (42%), Positives = 203/354 (57%), Gaps = 23/354 (6%)
 Frame = -3

Query  2051  EAQFNKGDRVEVLMRDNFPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMKRRKE  1875
             + Q +KGDRVEV  R N   ++ A VLR PSV    R   ++VE+E +   ++  K  KE
Sbjct  65    QGQISKGDRVEV-KRPN-GAYYAATVLRFPSV---TRKNTVFVEYEVI---NEGTKHVKE  116

Query  1874  YVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVAL-GDEDAVE  1698
             YV LS +RP PP EP   F  G+S D  +EN GWR+G V +ILENS Y+V   G+ +  E
Sbjct  117   YVDLSNLRPLPPCEPNRCFVPGDSVDAHWEN-GWRKGVVKDILENSKYVVGFDGNGEKEE  175

Query  1697  SVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCV  1518
               ++EQ  LR+HR+W DG WVPP  E     Q  ++K + F      VK++I   + +  
Sbjct  176   ESEIEQCNLRLHREWDDGSWVPPFTELT---QSSKEKDDKF----RRVKVKIVFGKRAAD  228

Query  1517  RKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASC  1338
              K  K+  VEV  ++EGF  SW+++V++E + N K LV+   L+T+DG  +  EE +A  
Sbjct  229   AKLRKDDEVEVTREEEGFRGSWFSAVIVEYIRNDKYLVECTTLRTEDGMPFR-EEANACH  287

Query  1337  IRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDL  1158
             IRPCPPE+  I+ F L + VDAW  +GWW G +S VL   KY V F   NE L F+ S L
Sbjct  288   IRPCPPELSPIASFHLREVVDAWYNDGWWVGVISGVLAGPKYAVYFSQTNEELEFDHSYL  347

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
             R HQ+W N  W  A++     +S  ++ NS  +  K     K L  KF KGM V
Sbjct  348   RIHQDWINGKWTIASE----ETSRQLLTNSNKLLHKMAVKEKRLKAKFPKGMKV  397


 Score =   189 bits (481),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 180/306 (59%), Gaps = 16/306 (5%)
 Frame = -3

Query  1484  KGDKEGFER---SWYASVVM---EVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCP  1323
             KGD+   +R   ++YA+ V+    V     + V+Y+ +  ++GT ++ E VD S +RP P
Sbjct  70    KGDRVEVKRPNGAYYAATVLRFPSVTRKNTVFVEYEVI--NEGTKHVKEYVDLSNLRPLP  127

Query  1322  P-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCF---GSMNELLTFEASDLR  1155
             P E +R   F   D VDA   NGW +G V  +L ++KY+V F   G   E    E  +LR
Sbjct  128   PCEPNRC--FVPGDSVDAHWENGWRKGVVKDILENSKYVVGFDGNGEKEEESEIEQCNLR  185

Query  1154  PHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEE  975
              H+EW + +WV     +L +SS +     + VKVK    ++A   K  K   VE T  EE
Sbjct  186   LHREWDDGSWVPPF-TELTQSSKEKDDKFRRVKVKIVFGKRAADAKLRKDDEVEVTREEE  244

Query  974   GYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKM  795
             G+ GSW++AVI + I  +K+L+E  TLRT+D   P +E+A+A +IRPCPP +     F +
Sbjct  245   GFRGSWFSAVIVEYIRNDKYLVECTTLRTED-GMPFREEANACHIRPCPPELSPIASFHL  303

Query  794   FEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFR  615
              E VDAWYN+GWW G+IS VL G  Y VYF  TNEE+EF H  +R HQ+WI+ KW IA  
Sbjct  304   REVVDAWYNDGWWVGVISGVLAGPKYAVYFSQTNEELEFDHSYLRIHQDWINGKWTIASE  363

Query  614   KSNNNL  597
             +++  L
Sbjct  364   ETSRQL  369


 Score =   150 bits (379),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 112/306 (37%), Positives = 157/306 (51%), Gaps = 18/306 (6%)
 Frame = -3

Query  1037  RKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIG-PNKFLLEYQTLRTDDESEPLKE  861
             R+ L  + SKG  VE       Y+ +  T + F S+   N   +EY+ +  ++ ++ +KE
Sbjct  61    RRQLQGQISKGDRVEVKRPNGAYYAA--TVLRFPSVTRKNTVFVEYEVI--NEGTKHVKE  116

Query  860   KADAFNIRPCPPLIHRFDR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYF---WTTN  693
               D  N+RP PP     +R F   + VDA +  GW +G++  +L+   YVV F       
Sbjct  117   YVDLSNLRPLPPC--EPNRCFVPGDSVDAHWENGWRKGVVKDILENSKYVVGFDGNGEKE  174

Query  692   EEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHS-----GGIASETTFCI  528
             EE E     +R H+EW D  W   F +   +    K    RR       G  A++     
Sbjct  175   EESEIEQCNLRLHREWDDGSWVPPFTELTQS-SKEKDDKFRRVKVKIVFGKRAADAKLRK  233

Query  527   GAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSA  348
               +VEV  +EEG +GSW+ A+I+  I N KYLVE  TL+ + G     +EA+A  +RP  
Sbjct  234   DDEVEVTREEEGFRGSWFSAVIVEYIRNDKYLVECTTLRTEDGMPFR-EEANACHIRPCP  292

Query  347   PILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQE  168
             P L  +  F   E VDAW N+GW VG +  VL G KY V F  TNE LEF H  LR+HQ+
Sbjct  293   PELSPIASFHLREVVDAWYNDGWWVGVISGVLAGPKYAVYFSQTNEELEFDHSYLRIHQD  352

Query  167   WINGAW  150
             WING W
Sbjct  353   WINGKW  358



>ref|XP_010441411.1| PREDICTED: uncharacterized protein LOC104724507 isoform X2 [Camelina 
sativa]
Length=416

 Score =   224 bits (570),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 172/487 (35%), Positives = 245/487 (50%), Gaps = 79/487 (16%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEV-LMRDNFPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             M+++  +  GDRVEV  +      +FPA V+  PSVRKN     + VE E+L        
Sbjct  2     MTSDGFWRGGDRVEVERLVSGAKTYFPATVVSTPSVRKNH----VLVEHESLMVGGSV--  55

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRG-WRRGTVDEILENSMYMVALGDE  1710
             R KEYV  + +RP+PP +    F+  +  DVF +  G W RG V  +L +S Y+V     
Sbjct  56    RMKEYVIPTRLRPSPPRDLNRRFKAKDEVDVFRDTEGCWVRGNVTTVLGDSRYIVEFKGG  115

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKC-T  1533
             +  E ++V+Q  LR+HR+W+ G WVP L        +QQ  S     TP  +KL+IK  T
Sbjct  116   NRPE-IEVDQVDLRLHREWQHGSWVPSL--------FQQ--SNVLEPTPQRIKLKIKIKT  164

Query  1532  RGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEE  1353
             R +   ++ K   VEV+ ++E ++ SWY + ++  LG+G                     
Sbjct  165   RDN---QYEKGALVEVRSEEEVYKGSWYCARILCSLGDG---------------------  200

Query  1352  VDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGD-AKYMVCFGSMNELLT  1176
                                   ++VD W    WW G VS VLG  +KY V   S  E  T
Sbjct  201   ----------------------NEVDVWFNKRWWIGRVSNVLGGGSKYSVFITSRGEEPT  238

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
                 +LRPH++W N  W   +K       S    N    K     +R  +   F  GM+V
Sbjct  239   VLNFNLRPHKDWINGAWSNTSK-------SKGECNRPPFKKLKSCERADM--MFKDGMMV  289

Query  995   EATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFN-IRPCPPLI  819
             E  S E GY GSW++A I   +G N++ +EYQTL+TDDE E LKE+A   +     PPLI
Sbjct  290   EVRSDERGYEGSWFSAKIISYLGENRYTVEYQTLKTDDERELLKEEARGSDLRPIPPPLI  349

Query  818   HRFDRFKMFEEVDAWYNEGWWEGLI-SKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
              +  R++++EEVDAWYNEGWW G + ++  +   Y VYF T NE +EFA+  +RP Q W 
Sbjct  350   PKAYRYELYEEVDAWYNEGWWSGRVYTRNHNYTRYGVYFKTNNERLEFAYSDLRPCQVWR  409

Query  641   DKKWDIA  621
             + KW  A
Sbjct  410   NGKWSRA  416


 Score =   165 bits (417),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 137/429 (32%), Positives = 204/429 (48%), Gaps = 65/429 (15%)
 Frame = -3

Query  1412  LLVQYQDLKTDDGTDYLIEEVDASCIRPCPP-EIHRISPFKLLDKVDAW--VGNGWWEGH  1242
             +LV+++ L    G+  + E V  + +RP PP +++R   FK  D+VD +      W  G+
Sbjct  42    VLVEHESLMVG-GSVRMKEYVIPTRLRPSPPRDLNR--RFKAKDEVDVFRDTEGCWVRGN  98

Query  1241  VSKVLGDAKYMVCF-GSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNsk  1065
             V+ VLGD++Y+V F G     +  +  DLR H+EW++ +WV +    L + S+  +L   
Sbjct  99    VTTVLGDSRYIVEFKGGNRPEIEVDQVDLRLHREWQHGSWVPS----LFQQSN--VLEPT  152

Query  1064  vvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTD  885
               ++K K   K    ++ KG LVE  S EE Y GSWY A I  S+G              
Sbjct  153   PQRIKLKIKIKTRDNQYEKGALVEVRSEEEVYKGSWYCARILCSLGDGN-----------  201

Query  884   DESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDG-LNYVVY  708
                                             EVD W+N+ WW G +S VL G   Y V+
Sbjct  202   --------------------------------EVDVWFNKRWWIGRVSNVLGGGSKYSVF  229

Query  707   FWTTNEEIEFAHHGIRPHQEWIDKKW-DIAFRKSNNNLPNPKPGIMRRHSGGIASETTFC  531
               +  EE    +  +RPH++WI+  W + +  K   N P       ++      ++  F 
Sbjct  230   ITSRGEEPTVLNFNLRPHKDWINGAWSNTSKSKGECNRPP-----FKKLKSCERADMMFK  284

Query  530   IGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADAL-SVRP  354
              G  VEV+ DE G +GSW+ A I+  +G  +Y VE++TLK D   +LL +EA        
Sbjct  285   DGMMVEVRSDERGYEGSWFSAKIISYLGENRYTVEYQTLKTDDERELLKEEARGSDLRPI  344

Query  353   SAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEG-AKYRVNFRTTNEILEFRHHGLRL  177
               P++ +  R+   EEVDAW N GW  G+V        +Y V F+T NE LEF +  LR 
Sbjct  345   PPPLIPKAYRYELYEEVDAWYNEGWWSGRVYTRNHNYTRYGVYFKTNNERLEFAYSDLRP  404

Query  176   HQEWINGAW  150
              Q W NG W
Sbjct  405   CQVWRNGKW  413


 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 119/273 (44%), Gaps = 52/273 (19%)
 Frame = -3

Query  953  TAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPL-IHRFDRFKMFEEVDA  777
            T V   S+  N  L+E+++L     S  +KE      +RP PP  ++R  RFK  +EVD 
Sbjct  30   TVVSTPSVRKNHVLVEHESLMVGG-SVRMKEYVIPTRLRPSPPRDLNR--RFKAKDEVDV  86

Query  776  WYN-EGWW-EGLISKVLDGLNYVVYFWTTNE-EIEFAHHGIRPHQEWIDKKWDIAFRKSN  606
            + + EG W  G ++ VL    Y+V F   N  EIE     +R H+EW    W  +  + +
Sbjct  87   FRDTEGCWVRGNVTTVLGDSRYIVEFKGGNRPEIEVDQVDLRLHREWQHGSWVPSLFQQS  146

Query  605  NNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVE  426
            N L  P P  ++        +  +  GA VEV+ +EE  +GSWY A IL  +G+G     
Sbjct  147  NVL-EPTPQRIKLKIKIKTRDNQYEKGALVEVRSEEEVYKGSWYCARILCSLGDGN----  201

Query  425  FRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVL-E  249
                                                   EVD W N  W +G+V  VL  
Sbjct  202  ---------------------------------------EVDVWFNKRWWIGRVSNVLGG  222

Query  248  GAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
            G+KY V   +  E     +  LR H++WINGAW
Sbjct  223  GSKYSVFITSRGEEPTVLNFNLRPHKDWINGAW  255



>ref|XP_010674562.1| PREDICTED: uncharacterized protein LOC104890683 [Beta vulgaris 
subsp. vulgaris]
Length=299

 Score =   218 bits (555),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 173/292 (59%), Gaps = 10/292 (3%)
 Frame = -3

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPN--KFLLEYQTLRTDDESEPLKEKADAF  846
             +F KG+ VE +  EEG+ G W+   +      N  K ++EY TL  ++ S PL+EK D  
Sbjct  5     QFKKGIKVEISIDEEGFRGVWFPGTVIKPPSKNDLKVMVEYDTLLAENGSTPLREKVDLV  64

Query  845   NIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHG  666
              IRP PP   + + +K+ +EVD ++N+GWWEG+I+ VL+G  Y VYF  T ++ +F    
Sbjct  65    QIRPIPPRESKRE-YKLDDEVDVFFNDGWWEGVITHVLEGNQYSVYFRPTRDQNDFNGFD  123

Query  665   IRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQ  486
             +R H+EW+  KW             P   ++ +       E  F  G+ VEV  DE+G +
Sbjct  124   LRLHREWVHGKW---LPPLEEEAVQPVEEMIHKEK----EEKNFSKGSLVEVSSDEDGFE  176

Query  485   GSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEE  306
             G+W+ A +L +IG  K+L+E+R LK +   + + +E DAL +RP  P   +VD+F+  EE
Sbjct  177   GAWFTATVLEVIGKDKFLIEYRDLKTEDDKEFVREEVDALHIRPHPPKAGKVDKFKQFEE  236

Query  305   VDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             VDA  N+GW VG + +VL  +KY V F++T+E LEF+   LRLH EWI+G W
Sbjct  237   VDALYNDGWWVGCISKVLGDSKYLVYFKSTDEELEFKDDELRLHHEWISGEW  288


 Score =   214 bits (545),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/300 (39%), Positives = 177/300 (59%), Gaps = 15/300 (5%)
 Frame = -3

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNG--KLLVQYQDLKTDDGTDYLIEEVDAS  1341
             +F K + VE+  D+EGF   W+   V++       K++V+Y  L  ++G+  L E+VD  
Sbjct  5     QFKKGIKVEISIDEEGFRGVWFPGTVIKPPSKNDLKVMVEYDTLLAENGSTPLREKVDLV  64

Query  1340  CIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
              IRP PP   +   +KL D+VD +  +GWWEG ++ VL   +Y V F    +   F   D
Sbjct  65    QIRPIPPRESK-REYKLDDEVDVFFNDGWWEGVITHVLEGNQYSVYFRPTRDQNDFNGFD  123

Query  1160  LRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSF  981
             LR H+EW +  W+   + +  +   +++             ++     FSKG LVE +S 
Sbjct  124   LRLHREWVHGKWLPPLEEEAVQPVEEMI------------HKEKEEKNFSKGSLVEVSSD  171

Query  980   EEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRF  801
             E+G+ G+W+TA + + IG +KFL+EY+ L+T+D+ E ++E+ DA +IRP PP   + D+F
Sbjct  172   EDGFEGAWFTATVLEVIGKDKFLIEYRDLKTEDDKEFVREEVDALHIRPHPPKAGKVDKF  231

Query  800   KMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
             K FEEVDA YN+GWW G ISKVL    Y+VYF +T+EE+EF    +R H EWI  +W +A
Sbjct  232   KQFEEVDALYNDGWWVGCISKVLGDSKYLVYFKSTDEELEFKDDELRLHHEWISGEWVMA  291


 Score =   202 bits (513),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 115/317 (36%), Positives = 178/317 (56%), Gaps = 33/317 (10%)
 Frame = -3

Query  2045  QFNKGDRVEVLMRDN--FPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEY  1872
             QF KG +VE+ + +     +WFP  V++P  + + +   + VE++TL +++     R E 
Sbjct  5     QFKKGIKVEISIDEEGFRGVWFPGTVIKPPSKNDLK---VMVEYDTLLAENGSTPLR-EK  60

Query  1871  VHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESV  1692
             V L  +RP PP E    +++ +  DVF+ N GW  G +  +LE + Y V        +  
Sbjct  61    VDLVQIRPIPPRESKREYKLDDEVDVFF-NDGWWEGVITHVLEGNQYSVYF--RPTRDQN  117

Query  1691  KVEQWQLRVHRDWKDGCWVPPLEESQV---DQQYQQKKSEDFLMTPSGVKLRIKCTRGSC  1521
                 + LR+HR+W  G W+PPLEE  V   ++   ++K E                    
Sbjct  118   DFNGFDLRLHREWVHGKWLPPLEEEAVQPVEEMIHKEKEE--------------------  157

Query  1520  VRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDAS  1341
              + FSK   VEV  D++GFE +W+ + V+EV+G  K L++Y+DLKT+D  +++ EEVDA 
Sbjct  158   -KNFSKGSLVEVSSDEDGFEGAWFTATVLEVIGKDKFLIEYRDLKTEDDKEFVREEVDAL  216

Query  1340  CIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
              IRP PP+  ++  FK  ++VDA   +GWW G +SKVLGD+KY+V F S +E L F+  +
Sbjct  217   HIRPHPPKAGKVDKFKQFEEVDALYNDGWWVGCISKVLGDSKYLVYFKSTDEELEFKDDE  276

Query  1160  LRPHQEWKNNNWVAATK  1110
             LR H EW +  WV A+K
Sbjct  277   LRLHHEWISGEWVMASK  293


 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 77/135 (57%), Gaps = 3/135 (2%)
 Frame = -3

Query  548  SETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNG--KYLVEFRTLKCDFGTDLLVQEA  375
            S   F  G KVE+  DEEG +G W+P  +++       K +VE+ TL  + G+  L ++ 
Sbjct  2    SNFQFKKGIKVEISIDEEGFRGVWFPGTVIKPPSKNDLKVMVEYDTLLAENGSTPLREKV  61

Query  374  DALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFR  195
            D + +RP  P   + + ++  +EVD + N+GW  G +  VLEG +Y V FR T +  +F 
Sbjct  62   DLVQIRPIPPRESKRE-YKLDDEVDVFFNDGWWEGVITHVLEGNQYSVYFRPTRDQNDFN  120

Query  194  HHGLRLHQEWINGAW  150
               LRLH+EW++G W
Sbjct  121  GFDLRLHREWVHGKW  135



>ref|XP_008793358.1| PREDICTED: uncharacterized protein LOC103709675 [Phoenix dactylifera]
Length=429

 Score =   221 bits (563),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 161/482 (33%), Positives = 232/482 (48%), Gaps = 70/482 (15%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLM-RDNF-PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRR  1881
             A   F  GD VEV    D F   WF A V R  + K  R   +Y   + +  D D  +  
Sbjct  2     APGVFTTGDAVEVSSDEDGFRDAWFEAKVAR-YMPKLHRCTVVY---DAIMDDADDSRSL  57

Query  1880  KEYV--HLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEIL---ENSMYMVALG  1716
             +E V   L   RP         F + +  D FY N GW  G V  +        Y VA  
Sbjct  58    RETVDGRLVRPRPPFRPPAGGRFALHQPVDAFY-NDGWWVGVVSRVAGKGRQRRYSVAF-  115

Query  1715  DEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKC  1536
                  E ++    +LR H +W DG WV P  +   ++ Y+           +G ++ I  
Sbjct  116   -PSTREEMEFAASELRTHLEWVDGEWVLPEWKGTPEKVYE-----------TGTQVEIAR  163

Query  1535  TRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIE  1356
              +G+         P+           +W ++VV++ +     LV+Y+  +  D T+ L E
Sbjct  164   VKGNT--------PI-----------AWLSAVVVQAIWKSSFLVEYKHFRNLDDTELLRE  204

Query  1355  EVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
              VD   IRPCPP   + + F LLD+V+A+ GNGW  G V+K+   +KY V      E   
Sbjct  205   IVDVKHIRPCPPHASK-AKFDLLDEVEAFYGNGWLPGVVAKIHTSSKYRVKIAHWGEERE  263

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
             F  ++LR   +  N  WV A++     + SD+ +                     +G +V
Sbjct  264   FSHAELRLRYDLVNGQWVKASQ-----NKSDMEMR--------------------EGTMV  298

Query  995   EATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIH  816
             E +S +EG+ G+WYTA I   I   KFL+EYQ LRTDDE++PL E  D  +IRP PP   
Sbjct  299   EVSSDDEGFRGAWYTATIVKLIRKKKFLVEYQNLRTDDETKPLTEIVDFQHIRPSPPETP  358

Query  815   RFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDK  636
               ++FK+ EEVDA+YN+GWW G+ISKVL    Y+VYF   +EE+EF H  +R H +WI  
Sbjct  359   VVEQFKLLEEVDAFYNDGWWVGVISKVLKSQRYMVYFKPWSEEMEFGHKELRLHHDWIGG  418

Query  635   KW  630
             +W
Sbjct  419   RW  420


 Score =   219 bits (558),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 151/460 (33%), Positives = 221/460 (48%), Gaps = 51/460 (11%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDY--LIEEVDASC  1338
             F+    VEV  D++GF  +W+ + V   +          D   DD  D   L E VD   
Sbjct  6     FTTGDAVEVSSDEDGFRDAWFEAKVARYMPKLHRCTVVYDAIMDDADDSRSLRETVDGRL  65

Query  1337  IRPCPPEIHRISP-FKLLDKVDAWVGNGWWEGHVSKVLGDAK---YMVCFGSMNELLTFE  1170
             +RP PP        F L   VDA+  +GWW G VS+V G  +   Y V F S  E + F 
Sbjct  66    VRPRPPFRPPAGGRFALHQPVDAFYNDGWWVGVVSRVAGKGRQRRYSVAFPSTREEMEFA  125

Query  1169  ASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEA  990
             AS+LR H EW +  WV       P                           +  G  VE 
Sbjct  126   ASELRTHLEWVDGEWVLPEWKGTPEKV------------------------YETGTQVEI  161

Query  989   TSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRF  810
                +     +W +AV+  +I  + FL+EY+  R  D++E L+E  D  +IRPCPP   + 
Sbjct  162   ARVKGNTPIAWLSAVVVQAIWKSSFLVEYKHFRNLDDTELLREIVDVKHIRPCPPHASK-  220

Query  809   DRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
              +F + +EV+A+Y  GW  G+++K+     Y V      EE EF+H  +R   + ++ +W
Sbjct  221   AKFDLLDEVEAFYGNGWLPGVVAKIHTSSKYRVKIAHWGEEREFSHAELRLRYDLVNGQW  280

Query  629   DIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLI  450
                 + S N                  S+     G  VEV  D+EG +G+WY A I++LI
Sbjct  281   ---VKASQNK-----------------SDMEMREGTMVEVSSDDEGFRGAWYTATIVKLI  320

Query  449   GNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVG  270
                K+LVE++ L+ D  T  L +  D   +RPS P    V++F+ LEEVDA+ N+GW VG
Sbjct  321   RKKKFLVEYQNLRTDDETKPLTEIVDFQHIRPSPPETPVVEQFKLLEEVDAFYNDGWWVG  380

Query  269   QVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              + +VL+  +Y V F+  +E +EF H  LRLH +WI G W
Sbjct  381   VISKVLKSQRYMVYFKPWSEEMEFGHKELRLHHDWIGGRW  420


 Score =   139 bits (350),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 99/317 (31%), Positives = 156/317 (49%), Gaps = 40/317 (13%)
 Frame = -3

Query  2057  SAEAQFNKGDRVEVL-MRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRR  1881
             + E  +  G +VE+  ++ N PI + +AV+  ++ K+       VE++   + DD    R
Sbjct  148   TPEKVYETGTQVEIARVKGNTPIAWLSAVVVQAIWKSS----FLVEYKHFRNLDDTELLR  203

Query  1880  KEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAV  1701
              E V +  +RP PP      F + +  + FY N GW  G V +I  +S Y V +      
Sbjct  204   -EIVDVKHIRPCPPHASKAKFDLLDEVEAFYGN-GWLPGVVAKIHTSSKYRVKIAHWG--  259

Query  1700  ESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSC  1521
             E  +    +LR+  D  +G WV          +  Q KS+            ++   G+ 
Sbjct  260   EEREFSHAELRLRYDLVNGQWV----------KASQNKSD------------MEMREGTM  297

Query  1520  VRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDAS  1341
             V         EV  D EGF  +WY + +++++   K LV+YQ+L+TDD T  L E VD  
Sbjct  298   V---------EVSSDDEGFRGAWYTATIVKLIRKKKFLVEYQNLRTDDETKPLTEIVDFQ  348

Query  1340  CIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
              IRP PPE   +  FKLL++VDA+  +GWW G +SKVL   +YMV F   +E + F   +
Sbjct  349   HIRPSPPETPVVEQFKLLEEVDAFYNDGWWVGVISKVLKSQRYMVYFKPWSEEMEFGHKE  408

Query  1160  LRPHQEWKNNNWVAATK  1110
             LR H +W    W+ +++
Sbjct  409   LRLHHDWIGGRWLRSSE  425



>emb|CDY06353.1| BnaA09g48500D [Brassica napus]
Length=486

 Score =   222 bits (565),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 154/462 (33%), Positives = 241/462 (52%), Gaps = 38/462 (8%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPG----EPCC  1824
             W+   V+  +V  +    +  VE+ TL  D +  KR KE V  + +RPA P     E   
Sbjct  47    WYLGEVV--AVPSSDSTTKCEVEYTTLFFDKEGRKRLKEVVDAAQLRPAVPAMSEREKER  104

Query  1823  YFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDG  1644
                VGE  D FY + GW  GTV E+L +  + V      + E ++  + +LR HR+W +G
Sbjct  105   DVAVGEDVDAFYSD-GWWEGTVTEVLGDGRFSVYF--RASKEQIRFRRDELRFHREWVNG  161

Query  1643  CWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRI--KCTRGSCVRKFSKEMPVEVKGDKE  1470
              W PP+EE + +++ ++++    L     +  R+  +  R    + FS    VEV  D+E
Sbjct  162   AWKPPIEEREEEEEEEEEEERQILAVFVDLLSRVDPETAREIAKQMFSIGTIVEVSSDEE  221

Query  1469  GFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKL  1290
             GF+ SW+++ V+E          + D KT        +E D   IRP PP    I  F +
Sbjct  222   GFKGSWFSAKVIE----------HVDEKT--------KEADFLHIRPPPPADEDID-FAV  262

Query  1289  LDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNW-VAAT  1113
              DK+DA+  + WW G V + + +    VCF    E + F    LR H++W N  W +   
Sbjct  263   RDKIDAFYNDAWWVGDVIESMKEGIVGVCFRYTGEKMRFGRQGLRLHRDWINGTWQLPLK  322

Query  1112  KIDLPRSSSDVMLNskvvkvkskSDRKALGPK-FSKGMLVEATSFEEGYHGSWYTAVIFD  936
             + ++ R++  V  +  V        +KA+  + FS G  VE +S EEG+  SW+ A + +
Sbjct  323   RGEMKRATKKVPCDRNVRP------KKAIDKEHFSGGDPVEVSSVEEGFEDSWFLAKVIE  376

Query  935   SIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWW  756
               G +K+L+EY+ L+ +D  EPL+E+ + F IRP P      +  +  +EVDA YN+GWW
Sbjct  377   YRGTDKWLVEYEKLKAEDGKEPLREEVNVFQIRPRPQETVMVNPLEKLDEVDALYNDGWW  436

Query  755   EGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
              G++ KVL   NY+V+F  T+E ++F    +RPHQEWID KW
Sbjct  437   FGVVKKVLAKSNYLVHFPKTDEVLKFHVSRLRPHQEWIDGKW  478


 Score =   215 bits (548),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 152/474 (32%), Positives = 235/474 (50%), Gaps = 55/474 (12%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGN---GKLLVQYQDLKTD-DGTDYLIEEVDASCIRPC  1326
             VE+  D+ GF  SWY   V+ V  +    K  V+Y  L  D +G   L E VDA+ +RP 
Sbjct  34    VEISSDEVGFRGSWYLGEVVAVPSSDSTTKCEVEYTTLFFDKEGRKRLKEVVDAAQLRPA  93

Query  1325  PP---EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLR  1155
              P   E  +     + + VDA+  +GWWEG V++VLGD ++ V F +  E + F   +LR
Sbjct  94    VPAMSEREKERDVAVGEDVDAFYSDGWWEGTVTEVLGDGRFSVYFRASKEQIRFRRDELR  153

Query  1154  PHQEWKNNNWVAATKIDLPRSSSD--------VMLNskvvkvkskSDRKALGPKFSKGML  999
              H+EW N  W    +        +         +    + +V  ++ R+     FS G +
Sbjct  154   FHREWVNGAWKPPIEEREEEEEEEEEEERQILAVFVDLLSRVDPETAREIAKQMFSIGTI  213

Query  998   VEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLI  819
             VE +S EEG+ GSW++A + + +                  E  KE AD  +IRP PP  
Sbjct  214   VEVSSDEEGFKGSWFSAKVIEHV-----------------DEKTKE-ADFLHIRPPPPAD  255

Query  818   HRFDRFKMFEEVDAWYNEGWWEG-LISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
                D F + +++DA+YN+ WW G +I  + +G+  V + +T  E++ F   G+R H++WI
Sbjct  256   EDID-FAVRDKIDAFYNDAWWVGDVIESMKEGIVGVCFRYT-GEKMRFGRQGLRLHRDWI  313

Query  641   DKKWDIAFRK-----SNNNLP-----NPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
             +  W +  ++     +   +P      PK  I + H  G         G  VEV   EEG
Sbjct  314   NGTWQLPLKRGEMKRATKKVPCDRNVRPKKAIDKEHFSG---------GDPVEVSSVEEG  364

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPL  312
              + SW+ A ++   G  K+LVE+  LK + G + L +E +   +RP       V+    L
Sbjct  365   FEDSWFLAKVIEYRGTDKWLVEYEKLKAEDGKEPLREEVNVFQIRPRPQETVMVNPLEKL  424

Query  311   EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +EVDA  N+GW  G V +VL  + Y V+F  T+E+L+F    LR HQEWI+G W
Sbjct  425   DEVDALYNDGWWFGVVKKVLAKSNYLVHFPKTDEVLKFHVSRLRPHQEWIDGKW  478


 Score =   154 bits (390),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 109/325 (34%), Positives = 159/325 (49%), Gaps = 39/325 (12%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             PET    A+  F+ G  VEV    + F   WF A V+     K + A             
Sbjct  197   PETAREIAKQMFSIGTIVEVSSDEEGFKGSWFSAKVIEHVDEKTKEA-------------  243

Query  1901  DDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVA  1722
                     +++H   +RP PP +    F V +  D FY N  W  G V E ++  +  V 
Sbjct  244   --------DFLH---IRPPPPADEDIDFAVRDKIDAFY-NDAWWVGDVIESMKEGIVGVC  291

Query  1721  LGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRI  1542
                    E ++  +  LR+HRDW +G W  PL+  ++ +  ++         P    +R 
Sbjct  292   F--RYTGEKMRFGRQGLRLHRDWINGTWQLPLKRGEMKRATKK--------VPCDRNVRP  341

Query  1541  KCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYL  1362
             K  +      FS   PVEV   +EGFE SW+ + V+E  G  K LV+Y+ LK +DG + L
Sbjct  342   K--KAIDKEHFSGGDPVEVSSVEEGFEDSWFLAKVIEYRGTDKWLVEYEKLKAEDGKEPL  399

Query  1361  IEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
              EEV+   IRP P E   ++P + LD+VDA   +GWW G V KVL  + Y+V F   +E+
Sbjct  400   REEVNVFQIRPRPQETVMVNPLEKLDEVDALYNDGWWFGVVKKVLAKSNYLVHFPKTDEV  459

Query  1181  LTFEASDLRPHQEWKNNNWVAATKI  1107
             L F  S LRPHQEW +  W+A++K+
Sbjct  460   LKFHVSRLRPHQEWIDGKWIASSKV  484


 Score = 85.9 bits (211),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 75/133 (56%), Gaps = 7/133 (5%)
 Frame = -3

Query  527  GAKVEVKDDEEGNQGSWYPALILRLIGN---GKYLVEFRTLKCDF-GTDLLVQEADALSV  360
            GA VE+  DE G +GSWY   ++ +  +    K  VE+ TL  D  G   L +  DA  +
Sbjct  31   GAAVEISSDEVGFRGSWYLGEVVAVPSSDSTTKCEVEYTTLFFDKEGRKRLKEVVDAAQL  90

Query  359  RPSAPILQRVDRFRPL---EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHH  189
            RP+ P +   ++ R +   E+VDA+ ++GW  G V EVL   ++ V FR + E + FR  
Sbjct  91   RPAVPAMSEREKERDVAVGEDVDAFYSDGWWEGTVTEVLGDGRFSVYFRASKEQIRFRRD  150

Query  188  GLRLHQEWINGAW  150
             LR H+EW+NGAW
Sbjct  151  ELRFHREWVNGAW  163



>ref|XP_007145017.1| hypothetical protein PHAVU_007G202900g [Phaseolus vulgaris]
 gb|ESW17011.1| hypothetical protein PHAVU_007G202900g [Phaseolus vulgaris]
Length=302

 Score =   215 bits (548),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 113/290 (39%), Positives = 172/290 (59%), Gaps = 21/290 (7%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD-GTDYLIEEVDASCIRPC-PP  1320
             VE+  + EGF  SW++  ++  L + + L++Y +L  D+  +  L E +D   +RP  P 
Sbjct  23    VEISSEDEGFRGSWFSGTIIRQLPSDRFLIEYHNLMADEKSSKRLREALDIRQLRPILPS  82

Query  1319  EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEW  1140
             E  +I  FK  D+VDA+  +GWWEG++++ L + K+ V F +  E L F    LR H+EW
Sbjct  83    ETGQI--FKFGDEVDAFYNDGWWEGYITEELDNNKFAVYFRASKEQLVFSKEQLRIHREW  140

Query  1139  KNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGS  960
              ++ WV   + D   S+  V                    +F KG +VE +S E+G+ G+
Sbjct  141   FDHTWVPPLRQDKGESNEAVKTE-----------------EFGKGAIVEVSSDEDGFSGA  183

Query  959   WYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVD  780
             W+ A + ++ G +KF++EYQTL  DD++  LKE+  A +IRP PP  +   RF + +EVD
Sbjct  184   WFAATVVEAKGNDKFVVEYQTLLADDDANLLKEEIGAMHIRPPPPETNIDGRFNLLDEVD  243

Query  779   AWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             A YN+GWW G+ISK+L G  YVVYF ++NEE+EF H  +R HQ+WI  KW
Sbjct  244   ALYNDGWWVGVISKILTGSKYVVYFRSSNEELEFQHSDLRLHQDWIHGKW  293


 Score =   211 bits (538),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/287 (39%), Positives = 165/287 (57%), Gaps = 14/287 (5%)
 Frame = -3

Query  1007  GMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEP-LKEKADAFNIRPC  831
             G +VE +S +EG+ GSW++  I   +  ++FL+EY  L  D++S   L+E  D   +RP 
Sbjct  20    GTIVEISSEDEGFRGSWFSGTIIRQLPSDRFLIEYHNLMADEKSSKRLREALDIRQLRPI  79

Query  830   PPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQ  651
              P       FK  +EVDA+YN+GWWEG I++ LD   + VYF  + E++ F+   +R H+
Sbjct  80    LP-SETGQIFKFGDEVDAFYNDGWWEGYITEELDNNKFAVYFRASKEQLVFSKEQLRIHR  138

Query  650   EWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYP  471
             EW D  W    R+             +  S        F  GA VEV  DE+G  G+W+ 
Sbjct  139   EWFDHTWVPPLRQD------------KGESNEAVKTEEFGKGAIVEVSSDEDGFSGAWFA  186

Query  470   ALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWS  291
             A ++   GN K++VE++TL  D   +LL +E  A+ +RP  P      RF  L+EVDA  
Sbjct  187   ATVVEAKGNDKFVVEYQTLLADDDANLLKEEIGAMHIRPPPPETNIDGRFNLLDEVDALY  246

Query  290   NNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             N+GW VG + ++L G+KY V FR++NE LEF+H  LRLHQ+WI+G W
Sbjct  247   NDGWWVGVISKILTGSKYVVYFRSSNEELEFQHSDLRLHQDWIHGKW  293


 Score =   184 bits (468),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 108/296 (36%), Positives = 153/296 (52%), Gaps = 35/296 (12%)
 Frame = -3

Query  1991  WFPAAVLR--PSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCYF  1818
             WF   ++R  PS R         +E+  L +D+   KR +E + +  +RP  P E    F
Sbjct  36    WFSGTIIRQLPSDR-------FLIEYHNLMADEKSSKRLREALDIRQLRPILPSETGQIF  88

Query  1817  RVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCW  1638
             + G+  D FY N GW  G + E L+N+ + V      + E +   + QLR+HR+W D  W
Sbjct  89    KFGDEVDAFY-NDGWWEGYITEELDNNKFAVYF--RASKEQLVFSKEQLRIHREWFDHTW  145

Query  1637  VPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFER  1458
             VPPL + + +     K  E                       F K   VEV  D++GF  
Sbjct  146   VPPLRQDKGESNEAVKTEE-----------------------FGKGAIVEVSSDEDGFSG  182

Query  1457  SWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKV  1278
             +W+A+ V+E  GN K +V+YQ L  DD  + L EE+ A  IRP PPE +    F LLD+V
Sbjct  183   AWFAATVVEAKGNDKFVVEYQTLLADDDANLLKEEIGAMHIRPPPPETNIDGRFNLLDEV  242

Query  1277  DAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             DA   +GWW G +SK+L  +KY+V F S NE L F+ SDLR HQ+W +  WV  +K
Sbjct  243   DALYNDGWWVGVISKILTGSKYVVYFRSSNEELEFQHSDLRLHQDWIHGKWVMLSK  298



>ref|XP_006382365.1| hypothetical protein POPTR_0005s01460g [Populus trichocarpa]
 gb|ERP60162.1| hypothetical protein POPTR_0005s01460g [Populus trichocarpa]
Length=342

 Score =   216 bits (551),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 119/325 (37%), Positives = 176/325 (54%), Gaps = 38/325 (12%)
 Frame = -3

Query  1025  GPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDE-SEPLKEKADA  849
              P F  G  VE  S EEG+ GS+YT  +  +   +KF++EY  L  D+E ++PL+E  + 
Sbjct  14    NPHFKPGSKVEIMSEEEGFRGSFYTGTVVKATRTSKFIVEYDKLFEDEEGTKPLQETVNE  73

Query  848   FNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHH  669
             F IRP  P   + + FK  EEVDA++N+GWWEG+I++V +  N+ V+F +T E+IEF   
Sbjct  74    FQIRPIAPREKKRE-FKFSEEVDAFHNDGWWEGVITEVNEDGNFAVFFRSTKEQIEFGEE  132

Query  668   GIRPHQEWIDKKWDIAF--------------------------------RKSNNNLPNPK  585
              +R H+EW++  W                                    R+ N  +P+  
Sbjct  133   DLRLHREWVNGAWKPTLEGEEEEEVKEKENEGSRNKRKLVEEEVTKEVKRRVNKKVPD--  190

Query  584   PGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCD  405
                 +        +  F  G  VEV  DE+G +G+W+ A I+  +G  KYL+E++TL+ +
Sbjct  191   --TTQEKPIESPKDAKFSKGMLVEVSSDEDGFKGAWFAATIVEPVGKDKYLIEYQTLRTE  248

Query  404   FGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNF  225
               +D L +E D + +RP  P    +DRF+ LEEVDA  N+ W VG V +V    KY V F
Sbjct  249   DDSDFLREEIDTVHIRPHPPQTIIIDRFKKLEEVDALYNDAWWVGVVSKVNTFPKYSVFF  308

Query  224   RTTNEILEFRHHGLRLHQEWINGAW  150
             + +NE LEF+H  LR HQ+WING W
Sbjct  309   KDSNEELEFQHSDLRPHQDWINGKW  333


 Score =   214 bits (545),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 120/312 (38%), Positives = 172/312 (55%), Gaps = 25/312 (8%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD-GTDYLIEEVDASCIRPCPPE  1317
             VE+  ++EGF  S+Y   V++     K +V+Y  L  D+ GT  L E V+   IRP  P 
Sbjct  23    VEIMSEEEGFRGSFYTGTVVKATRTSKFIVEYDKLFEDEEGTKPLQETVNEFQIRPIAPR  82

Query  1316  IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWK  1137
               +   FK  ++VDA+  +GWWEG +++V  D  + V F S  E + F   DLR H+EW 
Sbjct  83    -EKKREFKFSEEVDAFHNDGWWEGVITEVNEDGNFAVFFRSTKEQIEFGEEDLRLHREWV  141

Query  1136  NNNWVAAT--------------------KIDLPRSSSDVMLNskvvkvkskSDRKALGPK  1017
             N  W                        K+     + +V          +  ++    PK
Sbjct  142   NGAWKPTLEGEEEEEVKEKENEGSRNKRKLVEEEVTKEVKRRVNKKVPDTTQEKPIESPK  201

Query  1016  ---FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAF  846
                FSKGMLVE +S E+G+ G+W+ A I + +G +K+L+EYQTLRT+D+S+ L+E+ D  
Sbjct  202   DAKFSKGMLVEVSSDEDGFKGAWFAATIVEPVGKDKYLIEYQTLRTEDDSDFLREEIDTV  261

Query  845   NIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHG  666
             +IRP PP     DRFK  EEVDA YN+ WW G++SKV     Y V+F  +NEE+EF H  
Sbjct  262   HIRPHPPQTIIIDRFKKLEEVDALYNDAWWVGVVSKVNTFPKYSVFFKDSNEELEFQHSD  321

Query  665   IRPHQEWIDKKW  630
             +RPHQ+WI+ KW
Sbjct  322   LRPHQDWINGKW  333


 Score =   177 bits (449),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 110/329 (33%), Positives = 170/329 (52%), Gaps = 23/329 (7%)
 Frame = -3

Query  2045  QFNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVH  1866
              F  G +VE++  +     F  +    +V K  R  +  VE++ L  D++  K  +E V+
Sbjct  16    HFKPGSKVEIMSEEE---GFRGSFYTGTVVKATRTSKFIVEYDKLFEDEEGTKPLQETVN  72

Query  1865  LSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKV  1686
                +RP  P E    F+  E  D F+ N GW  G + E+ E+  + V        E ++ 
Sbjct  73    EFQIRPIAPREKKREFKFSEEVDAFH-NDGWWEGVITEVNEDGNFAVFF--RSTKEQIEF  129

Query  1685  EQWQLRVHRDWKDGCWVPPLEESQVD---------QQYQQKKSEDFLMTPSGVKLRIKCT  1533
              +  LR+HR+W +G W P LE  + +          + ++K  E+ +      ++  K  
Sbjct  130   GEEDLRLHREWVNGAWKPTLEGEEEEEVKEKENEGSRNKRKLVEEEVTKEVKRRVNKKVP  189

Query  1532  RGSCVR--------KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD  1377
               +  +        KFSK M VEV  D++GF+ +W+A+ ++E +G  K L++YQ L+T+D
Sbjct  190   DTTQEKPIESPKDAKFSKGMLVEVSSDEDGFKGAWFAATIVEPVGKDKYLIEYQTLRTED  249

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
              +D+L EE+D   IRP PP+   I  FK L++VDA   + WW G VSKV    KY V F 
Sbjct  250   DSDFLREEIDTVHIRPHPPQTIIIDRFKKLEEVDALYNDAWWVGVVSKVNTFPKYSVFFK  309

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATK  1110
               NE L F+ SDLRPHQ+W N  WV  +K
Sbjct  310   DSNEELEFQHSDLRPHQDWINGKWVTPSK  338



>ref|XP_010652537.1| PREDICTED: uncharacterized protein LOC100243428 [Vitis vinifera]
Length=1416

 Score =   230 bits (586),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 162/465 (35%), Positives = 241/465 (52%), Gaps = 58/465 (12%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEV------LGNGKLLVQYQDLKTDD-GTDYLIEE  1353
             FSK   VEV  D++GF+ +WY + ++E           + LV+YQDL  DD G+  L E 
Sbjct  8     FSKGSLVEVSSDEDGFKGAWYVATILESPPKSASKKRSRALVEYQDLLVDDVGSKPLTEV  67

Query  1352  VDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTF  1173
             VD S +RP PP     + F + D VDA+  +GWW G ++++  D+K  V F +  + + F
Sbjct  68    VDTSFLRPLPPP-EADTNFCVNDIVDAFYRDGWWTGVITRISEDSKCTVFFQNPPDEIQF  126

Query  1172  EASDLRPHQEWKNNNWVAATK---IDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGM  1002
             + SDLR H+EW +  W+   K   I +  S +++                     F +G 
Sbjct  127   DRSDLRVHKEWVDGKWIRPEKQRVIAIMESGAEI---------------------FRQGS  165

Query  1001  LVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQ-TLRTDDESEPLKEKADAFNIRPCPP  825
             LVE     +G  GSWY A I  +   ++ L+EYQ  L   D S  L+E  D   +RP PP
Sbjct  166   LVEVRINNDGCRGSWYVAKIIMA-EKSRALVEYQDLLDGKDGSRRLREVVDTLFLRPLPP  224

Query  824   LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEW  645
             L      F  ++ VD +Y++GW  G+I  + D   Y V+F  +N EI+     +R H+EW
Sbjct  225   L-ETNASFGEYDIVDTFYHDGWCTGVIICIKDS-KYTVFF--SNNEIQVDRSDLRLHKEW  280

Query  644   IDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPAL  465
             ++ KW +  RK              R +G I     F  GA VEV  +E+ ++ +W+PA+
Sbjct  281   VNGKW-VQPRK-------------ERTTGLI-----FSPGAAVEVTLNEQSSRDAWFPAI  321

Query  464   ILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNN  285
             + R IG G Y+V+ ++LK      +L    D L +RPS P L+   +F  LE+VDA+ + 
Sbjct  322   VRREIGLGSYVVQCQSLKNSGEAGVLDVTVDNLHIRPSPPRLEG-RKFGLLEKVDAFYDY  380

Query  284   GWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             GW  G V +VL G +Y V F+ TN   EF H  LR H EW++G W
Sbjct  381   GWWNGIVTKVLTGRRYVVFFKHTNMEKEFIHSDLRPHMEWVDGKW  425


 Score =   216 bits (550),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 153/475 (32%), Positives = 225/475 (47%), Gaps = 61/475 (13%)
 Frame = -3

Query  2042  FNKGDRVEVLM-RDNFP-IWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMKRRKEY  1872
             F+KG  VEV    D F   W+ A +L  P    +++  +  VE++ L  DD   K   E 
Sbjct  8     FSKGSLVEVSSDEDGFKGAWYVATILESPPKSASKKRSRALVEYQDLLVDDVGSKPLTEV  67

Query  1871  VHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESV  1692
             V  S +RP PP E    F V +  D FY + GW  G +  I E+S   V    ++  + +
Sbjct  68    VDTSFLRPLPPPEADTNFCVNDIVDAFYRD-GWWTGVITRISEDSKCTVFF--QNPPDEI  124

Query  1691  KVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRK  1512
             + ++  LRVH++W DG W+ P                         K R+     S    
Sbjct  125   QFDRSDLRVHKEWVDGKWIRP------------------------EKQRVIAIMESGAEI  160

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDL-KTDDGTDYLIEEVDASCI  1335
             F +   VEV+ + +G   SWY + ++ +    + LV+YQDL    DG+  L E VD   +
Sbjct  161   FRQGSLVEVRINNDGCRGSWYVAKII-MAEKSRALVEYQDLLDGKDGSRRLREVVDTLFL  219

Query  1334  RPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLR  1155
             RP PP +   + F   D VD +  +GW  G V   + D+KY V F   N  +  + SDLR
Sbjct  220   RPLPP-LETNASFGEYDIVDTFYHDGWCTG-VIICIKDSKYTVFFS--NNEIQVDRSDLR  275

Query  1154  PHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEE  975
              H+EW N  WV   K                         +  G  FS G  VE T  E+
Sbjct  276   LHKEWVNGKWVQPRK------------------------ERTTGLIFSPGAAVEVTLNEQ  311

Query  974   GYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKM  795
                 +W+ A++   IG   ++++ Q+L+   E+  L    D  +IRP PP +    +F +
Sbjct  312   SSRDAWFPAIVRREIGLGSYVVQCQSLKNSGEAGVLDVTVDNLHIRPSPPRLE-GRKFGL  370

Query  794   FEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
              E+VDA+Y+ GWW G+++KVL G  YVV+F  TN E EF H  +RPH EW+D KW
Sbjct  371   LEKVDAFYDYGWWNGIVTKVLTGRRYVVFFKHTNMEKEFIHSDLRPHMEWVDGKW  425


 Score =   127 bits (320),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 98/325 (30%), Positives = 151/325 (46%), Gaps = 45/325 (14%)
 Frame = -3

Query  2042  FNKGDRVEVLMRDNF--PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYV  1869
             F +G  VEV + ++     W+ A ++   + +  RA    VE++ L    D  +R +E V
Sbjct  161   FRQGSLVEVRINNDGCRGSWYVAKII---MAEKSRA---LVEYQDLLDGKDGSRRLREVV  214

Query  1868  HLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVK  1689
                 +RP PP E    F   +  D FY + GW  G +   +++S Y V   + +    ++
Sbjct  215   DTLFLRPLPPLETNASFGEYDIVDTFYHD-GWCTGVII-CIKDSKYTVFFSNNE----IQ  268

Query  1688  VEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKF  1509
             V++  LR+H++W +G WV P +E          ++   + +P                  
Sbjct  269   VDRSDLRLHKEWVNGKWVQPRKE----------RTTGLIFSPGAA---------------  303

Query  1508  SKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRP  1329
                  VEV  +++    +W+ ++V   +G G  +VQ Q LK       L   VD   IRP
Sbjct  304   -----VEVTLNEQSSRDAWFPAIVRREIGLGSYVVQCQSLKNSGEAGVLDVTVDNLHIRP  358

Query  1328  CPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPH  1149
              PP +     F LL+KVDA+   GWW G V+KVL   +Y+V F   N    F  SDLRPH
Sbjct  359   SPPRLEG-RKFGLLEKVDAFYDYGWWNGIVTKVLTGRRYVVFFKHTNMEKEFIHSDLRPH  417

Query  1148  QEWKNNNWVAATKIDLPRSSSDVML  1074
              EW +  WV AT+  L  + SD  L
Sbjct  418   MEWVDGKWVGATQEVLGTTYSDEQL  442


 Score =   108 bits (270),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 86/133 (65%), Gaps = 6/133 (5%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIG--PNKFLLEYQTLRTD-DESEPLKEKADAF  846
               KG  VE +S EEG  GSWYTA +   +     K  +EY TL ++ D+S+PL+E  DA 
Sbjct  1277  LKKGEKVEVSSEEEGLRGSWYTATVLRPVTKKTKKIYVEYHTLMSEEDDSKPLRESVDAI  1336

Query  845   NIRPCPPL-IHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHH  669
              +RP PP  + R  RFK+ EEVDA+Y++GWWEG++++VL+   Y V+F T+ E+I+F   
Sbjct  1337  LVRPYPPREVGR--RFKLMEEVDAFYSDGWWEGVVTQVLENSRYSVFFRTSREQIDFHQV  1394

Query  668   GIRPHQEWIDKKW  630
              +R H+EW+   W
Sbjct  1395  DLRLHREWVRGNW  1407


 Score = 99.0 bits (245),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 73/126 (58%), Gaps = 6/126 (5%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCYFRV  1812
             W+ A VLRP  +K ++   IYVE+ TL S++D  K  +E V    VRP PP E    F++
Sbjct  1296  WYTATVLRPVTKKTKK---IYVEYHTLMSEEDDSKPLRESVDAILVRPYPPREVGRRFKL  1352

Query  1811  GESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVP  1632
              E  D FY + GW  G V ++LENS Y V      + E +   Q  LR+HR+W  G WVP
Sbjct  1353  MEEVDAFYSD-GWWEGVVTQVLENSRYSVFF--RTSREQIDFHQVDLRLHREWVRGNWVP  1409

Query  1631  PLEESQ  1614
             PLEESQ
Sbjct  1410  PLEESQ  1415


 Score = 87.8 bits (216),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 72/120 (60%), Gaps = 6/120 (5%)
 Frame = -3

Query  1469  GFERSWYASVVMEVLG--NGKLLVQYQDLKTD-DGTDYLIEEVDASCIRPCPP-EIHRIS  1302
             G   SWY + V+  +     K+ V+Y  L ++ D +  L E VDA  +RP PP E+ R  
Sbjct  1291  GLRGSWYTATVLRPVTKKTKKIYVEYHTLMSEEDDSKPLRESVDAILVRPYPPREVGRR-  1349

Query  1301  PFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWV  1122
              FKL+++VDA+  +GWWEG V++VL +++Y V F +  E + F   DLR H+EW   NWV
Sbjct  1350  -FKLMEEVDAFYSDGWWEGVVTQVLENSRYSVFFRTSREQIDFHQVDLRLHREWVRGNWV  1408


 Score = 84.3 bits (207),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 72/118 (61%), Gaps = 4/118 (3%)
 Frame = -3

Query  494   GNQGSWYPALILRLIG--NGKYLVEFRTLKCDFGTDLLVQEA-DALSVRPSAPILQRVDR  324
             G +GSWY A +LR +     K  VE+ TL  +      ++E+ DA+ VRP  P  +   R
Sbjct  1291  GLRGSWYTATVLRPVTKKTKKIYVEYHTLMSEEDDSKPLRESVDAILVRPYPP-REVGRR  1349

Query  323   FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             F+ +EEVDA+ ++GW  G V +VLE ++Y V FRT+ E ++F    LRLH+EW+ G W
Sbjct  1350  FKLMEEVDAFYSDGWWEGVVTQVLENSRYSVFFRTSREQIDFHQVDLRLHREWVRGNW  1407



>ref|XP_006433561.1| hypothetical protein CICLE_v10001744mg [Citrus clementina]
 gb|ESR46801.1| hypothetical protein CICLE_v10001744mg [Citrus clementina]
Length=310

 Score =   214 bits (546),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 121/296 (41%), Positives = 169/296 (57%), Gaps = 16/296 (5%)
 Frame = -3

Query  1025  GPKFSKGMLVEATSFEEGYHGSWYTAVIFD---SIGPNKFLLEYQTL-RTDDESEPLKEK  858
             G  F+ G  VE +S + G+ GSW+   +     +  P K+L+EY  L  T+   +PLKE 
Sbjct  21    GTPFNPGSQVEISSNDVGFRGSWFMGTVIRRPMARNPTKYLVEYSRLFETEAGKKPLKEV  80

Query  857   ADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEF  678
              D   +RP  P   +  +FK+ EEVDA+YN+GWWEG+I++V DG  + VYF  + E+I+F
Sbjct  81    VDLDLLRPLAPR-EKERQFKLGEEVDAFYNDGWWEGVITEVDDG-KFAVYFRNSKEQIKF  138

Query  677   AHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDE  498
             A   +R H+EWI  +W           P  +            +E  FC G  VEV  DE
Sbjct  139   AAEDLRLHREWIKGEWK----------PPLEDDTETEEPDKFNTEGLFCKGTLVEVSSDE  188

Query  497   EGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFR  318
             +G QG+W+ A I+   G  KYLVE+++L+ +   + L +E D   +RPS P    VDRF 
Sbjct  189   DGFQGAWFAATIVEPTGKDKYLVEYQSLRTEDDKEFLKEEIDIKHIRPSPPETLMVDRFN  248

Query  317   PLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              L+EVDA  N+GW VG + +V   +KY V F+TT E L F H  LRLHQ+WING W
Sbjct  249   KLDEVDALYNDGWWVGVISKVCSNSKYVVYFKTTKEELTFEHSDLRLHQDWINGKW  304


 Score =   202 bits (515),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 165/301 (55%), Gaps = 21/301 (7%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVME---VLGNGKLLVQYQDL-KTDDGTDYLIEEVDA  1344
             F+    VE+  +  GF  SW+   V+         K LV+Y  L +T+ G   L E VD 
Sbjct  24    FNPGSQVEISSNDVGFRGSWFMGTVIRRPMARNPTKYLVEYSRLFETEAGKKPLKEVVDL  83

Query  1343  SCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEAS  1164
               +RP  P   +   FKL ++VDA+  +GWWEG +++V  D K+ V F +  E + F A 
Sbjct  84    DLLRPLAPR-EKERQFKLGEEVDAFYNDGWWEGVITEV-DDGKFAVYFRNSKEQIKFAAE  141

Query  1163  DLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATS  984
             DLR H+EW    W    + D      D              + + L   F KG LVE +S
Sbjct  142   DLRLHREWIKGEWKPPLEDDTETEEPDKF------------NTEGL---FCKGTLVEVSS  186

Query  983   FEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDR  804
              E+G+ G+W+ A I +  G +K+L+EYQ+LRT+D+ E LKE+ D  +IRP PP     DR
Sbjct  187   DEDGFQGAWFAATIVEPTGKDKYLVEYQSLRTEDDKEFLKEEIDIKHIRPSPPETLMVDR  246

Query  803   FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDI  624
             F   +EVDA YN+GWW G+ISKV     YVVYF TT EE+ F H  +R HQ+WI+ KW  
Sbjct  247   FNKLDEVDALYNDGWWVGVISKVCSNSKYVVYFKTTKEELTFEHSDLRLHQDWINGKWVT  306

Query  623   A  621
             A
Sbjct  307   A  307


 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 168/325 (52%), Gaps = 29/325 (9%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVLMRD-NF-PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             P+    ++   FN G +VE+   D  F   WF   V+R  + +N    +  VE+  L   
Sbjct  13    PKPRTDNSGTPFNPGSQVEISSNDVGFRGSWFMGTVIRRPMARN--PTKYLVEYSRLFET  70

Query  1901  DDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVA  1722
             +   K  KE V L  +RP  P E    F++GE  D FY N GW  G + E+ +      A
Sbjct  71    EAGKKPLKEVVDLDLLRPLAPREKERQFKLGEEVDAFY-NDGWWEGVITEVDDGKF---A  126

Query  1721  LGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRI  1542
             +   ++ E +K     LR+HR+W  G W PPLE+    ++  +  +E             
Sbjct  127   VYFRNSKEQIKFAAEDLRLHREWIKGEWKPPLEDDTETEEPDKFNTEGL-----------  175

Query  1541  KCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYL  1362
                       F K   VEV  D++GF+ +W+A+ ++E  G  K LV+YQ L+T+D  ++L
Sbjct  176   ----------FCKGTLVEVSSDEDGFQGAWFAATIVEPTGKDKYLVEYQSLRTEDDKEFL  225

Query  1361  IEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
              EE+D   IRP PPE   +  F  LD+VDA   +GWW G +SKV  ++KY+V F +  E 
Sbjct  226   KEEIDIKHIRPSPPETLMVDRFNKLDEVDALYNDGWWVGVISKVCSNSKYVVYFKTTKEE  285

Query  1181  LTFEASDLRPHQEWKNNNWVAATKI  1107
             LTFE SDLR HQ+W N  WV A+++
Sbjct  286   LTFEHSDLRLHQDWINGKWVTASQV  310


 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 81/137 (59%), Gaps = 6/137 (4%)
 Frame = -3

Query  548  SETTFCIGAKVEVKDDEEGNQGSWYPALILR--LIGN-GKYLVEF-RTLKCDFGTDLLVQ  381
            S T F  G++VE+  ++ G +GSW+   ++R  +  N  KYLVE+ R  + + G   L +
Sbjct  20   SGTPFNPGSQVEISSNDVGFRGSWFMGTVIRRPMARNPTKYLVEYSRLFETEAGKKPLKE  79

Query  380  EADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILE  201
              D   +RP AP  ++  +F+  EEVDA+ N+GW  G + EV +G K+ V FR + E ++
Sbjct  80   VVDLDLLRPLAP-REKERQFKLGEEVDAFYNDGWWEGVITEVDDG-KFAVYFRNSKEQIK  137

Query  200  FRHHGLRLHQEWINGAW  150
            F    LRLH+EWI G W
Sbjct  138  FAAEDLRLHREWIKGEW  154



>ref|XP_006472232.1| PREDICTED: uncharacterized protein LOC102630729 [Citrus sinensis]
Length=339

 Score =   214 bits (545),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 173/315 (55%), Gaps = 28/315 (9%)
 Frame = -3

Query  1025  GPKFSKGMLVEATSFEEGYHGSWYTAVIF---DSIGPNKFLLEYQTL-RTDDESEPLKEK  858
             G  F+ G  VE +S + G+ GSW+   +     +  P K+L+EY  L  T+   +PLKE 
Sbjct  21    GTPFNPGSQVEISSNDVGFRGSWFMGTVIRRPTARNPTKYLVEYSRLFETETGKKPLKEV  80

Query  857   ADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEF  678
              D   +RP  P   +  +FK+ EEVDA+YN+GWWEG+I++V DG  + VYF  + E+I+F
Sbjct  81    VDLDLLRPLAPR-EKERQFKLGEEVDAFYNDGWWEGVITEVDDG-KFAVYFRNSKEQIKF  138

Query  677   AHHGIRPHQEWIDKKW------DIAFRKSNNN-------------LPNPKPGIMRRHSGG  555
             A   +R H+EWI  +W      D    K   N               N KP         
Sbjct  139   AAEDLRLHREWIKGEWKPPLEDDTETEKLATNSKEEPDKVKTEELFSNSKP---EEEPDK  195

Query  554   IASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEA  375
               +E  FC G  VEV  DE+G QG+W+ A I+   G  KYLVE+++L+ +   + L +E 
Sbjct  196   FNTEGLFCKGTLVEVSSDEDGFQGAWFAATIVEPTGKDKYLVEYQSLRTEDDKEFLKEEI  255

Query  374   DALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFR  195
             D   +RPS P    VDRF  L+EVDA  N+GW VG + +V   +KY V F+TT E L F 
Sbjct  256   DIKHIRPSPPETLMVDRFNKLDEVDALYNDGWWVGVISKVCSNSKYVVYFKTTKEELTFE  315

Query  194   HHGLRLHQEWINGAW  150
             H  LRLHQ+WING W
Sbjct  316   HSDLRLHQDWINGKW  330


 Score =   187 bits (475),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 118/329 (36%), Positives = 174/329 (53%), Gaps = 13/329 (4%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVLMRD-NF-PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             P+    ++   FN G +VE+   D  F   WF   V+R    +N    +  VE+  L   
Sbjct  13    PKPRTDNSGTPFNPGSQVEISSNDVGFRGSWFMGTVIRRPTARN--PTKYLVEYSRLFET  70

Query  1901  DDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVA  1722
             +   K  KE V L  +RP  P E    F++GE  D FY N GW  G + E+ ++  + V 
Sbjct  71    ETGKKPLKEVVDLDLLRPLAPREKERQFKLGEEVDAFY-NDGWWEGVITEV-DDGKFAVY  128

Query  1721  LGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQY--QQKKSEDFLMTP---SG  1557
                 ++ E +K     LR+HR+W  G W PPLE+    ++     K+  D + T    S 
Sbjct  129   F--RNSKEQIKFAAEDLRLHREWIKGEWKPPLEDDTETEKLATNSKEEPDKVKTEELFSN  186

Query  1556  VKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD  1377
              K   +  + +    F K   VEV  D++GF+ +W+A+ ++E  G  K LV+YQ L+T+D
Sbjct  187   SKPEEEPDKFNTEGLFCKGTLVEVSSDEDGFQGAWFAATIVEPTGKDKYLVEYQSLRTED  246

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
               ++L EE+D   IRP PPE   +  F  LD+VDA   +GWW G +SKV  ++KY+V F 
Sbjct  247   DKEFLKEEIDIKHIRPSPPETLMVDRFNKLDEVDALYNDGWWVGVISKVCSNSKYVVYFK  306

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             +  E LTFE SDLR HQ+W N  WV A++
Sbjct  307   TTKEELTFEHSDLRLHQDWINGKWVTASQ  335


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = -3

Query  548  SETTFCIGAKVEVKDDEEGNQGSWYPALILR---LIGNGKYLVEF-RTLKCDFGTDLLVQ  381
            S T F  G++VE+  ++ G +GSW+   ++R        KYLVE+ R  + + G   L +
Sbjct  20   SGTPFNPGSQVEISSNDVGFRGSWFMGTVIRRPTARNPTKYLVEYSRLFETETGKKPLKE  79

Query  380  EADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILE  201
              D   +RP AP  ++  +F+  EEVDA+ N+GW  G + EV +G K+ V FR + E ++
Sbjct  80   VVDLDLLRPLAP-REKERQFKLGEEVDAFYNDGWWEGVITEVDDG-KFAVYFRNSKEQIK  137

Query  200  FRHHGLRLHQEWINGAW  150
            F    LRLH+EWI G W
Sbjct  138  FAAEDLRLHREWIKGEW  154



>emb|CDP15234.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   212 bits (540),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 118/298 (40%), Positives = 175/298 (59%), Gaps = 9/298 (3%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDY-LIEEVDASCI  1335
             F K   VE+  D++GF  SW+A  V+  L N K+LV+Y+ L  DD     L EE+D   +
Sbjct  4     FIKGAEVEISSDEDGFRGSWFAGTVIRKLKNDKILVEYKTLMQDDSRKIPLREEIDVVQL  63

Query  1334  RP-CPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDL  1158
             RP  P E HR   FK+ ++VD +  +GWWEG ++ V    K+ V F S  EL  F  S L
Sbjct  64    RPPAPRETHR--EFKVSEEVDVYFNDGWWEGVITGVSKTGKFAVFFRSSRELSKFHPSKL  121

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFE  978
             R H+EW N  WV   +I+ P+    V +    +  K K  ++ +  KFS+G  VE    E
Sbjct  122   RLHREWVNGTWVPQLEIE-PKEDKKVSI----LPAKRKPGKETVEEKFSRGATVEVRIDE  176

Query  977   EGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFK  798
             +G+ G+W  A +      +K+L++Y++LR ++++E LKE+  + NIRP PP     D FK
Sbjct  177   DGFQGAWIPATVIKRFDEDKYLIQYRSLRNEEDTEFLKEEVASINIRPHPPETAFVDCFK  236

Query  797   MFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDI  624
             + ++VDA +N+ WWEG+IS+VL    Y++YF  T + ++F H  +R HQEWID KW I
Sbjct  237   VNDKVDALFNDCWWEGVISRVLREKKYIIYFPGTEDAVKFKHSDLRQHQEWIDGKWVI  294


 Score =   195 bits (495),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/293 (36%), Positives = 167/293 (57%), Gaps = 8/293 (3%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESE-PLKEKADAFNI  840
             F KG  VE +S E+G+ GSW+   +   +  +K L+EY+TL  DD  + PL+E+ D   +
Sbjct  4     FIKGAEVEISSDEDGFRGSWFAGTVIRKLKNDKILVEYKTLMQDDSRKIPLREEIDVVQL  63

Query  839   RP-CPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGI  663
             RP  P   HR   FK+ EEVD ++N+GWWEG+I+ V     + V+F ++ E  +F    +
Sbjct  64    RPPAPRETHR--EFKVSEEVDVYFNDGWWEGVITGVSKTGKFAVFFRSSRELSKFHPSKL  121

Query  662   RPHQEWIDKKW--DIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGN  489
             R H+EW++  W   +      +   +  P   +R  G    E  F  GA VEV+ DE+G 
Sbjct  122   RLHREWVNGTWVPQLEIEPKEDKKVSILPA--KRKPGKETVEEKFSRGATVEVRIDEDGF  179

Query  488   QGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLE  309
             QG+W PA +++     KYL+++R+L+ +  T+ L +E  ++++RP  P    VD F+  +
Sbjct  180   QGAWIPATVIKRFDEDKYLIQYRSLRNEEDTEFLKEEVASINIRPHPPETAFVDCFKVND  239

Query  308   EVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +VDA  N+ W  G +  VL   KY + F  T + ++F+H  LR HQEWI+G W
Sbjct  240   KVDALFNDCWWEGVISRVLREKKYIIYFPGTEDAVKFKHSDLRQHQEWIDGKW  292


 Score =   166 bits (420),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/312 (33%), Positives = 164/312 (53%), Gaps = 21/312 (7%)
 Frame = -3

Query  2042  FNKGDRVEVLM-RDNF-PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYV  1869
             F KG  VE+    D F   WF   V+R       +  +I VE++TL  DD      +E +
Sbjct  4     FIKGAEVEISSDEDGFRGSWFAGTVIR-----KLKNDKILVEYKTLMQDDSRKIPLREEI  58

Query  1868  HLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVK  1689
              +  +RP  P E    F+V E  DV++ N GW  G +  + +   + V      + E  K
Sbjct  59    DVVQLRPPAPRETHREFKVSEEVDVYF-NDGWWEGVITGVSKTGKFAVFF--RSSRELSK  115

Query  1688  VEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKF  1509
                 +LR+HR+W +G WVP LE        + K+ +   + P+    + K  + +   KF
Sbjct  116   FHPSKLRLHREWVNGTWVPQLE-------IEPKEDKKVSILPA----KRKPGKETVEEKF  164

Query  1508  SKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRP  1329
             S+   VEV+ D++GF+ +W  + V++     K L+QY+ L+ ++ T++L EEV +  IRP
Sbjct  165   SRGATVEVRIDEDGFQGAWIPATVIKRFDEDKYLIQYRSLRNEEDTEFLKEEVASINIRP  224

Query  1328  CPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPH  1149
              PPE   +  FK+ DKVDA   + WWEG +S+VL + KY++ F    + + F+ SDLR H
Sbjct  225   HPPETAFVDCFKVNDKVDALFNDCWWEGVISRVLREKKYIIYFPGTEDAVKFKHSDLRQH  284

Query  1148  QEWKNNNWVAAT  1113
             QEW +  WV  +
Sbjct  285   QEWIDGKWVIPS  296


 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 72/147 (49%), Gaps = 14/147 (10%)
 Frame = -3

Query  2057  SAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKR  1884
             + E +F++G  VEV +  D F   W PA V+     K     +  +++ +L +++D    
Sbjct  159   TVEEKFSRGATVEVRIDEDGFQGAWIPATVI-----KRFDEDKYLIQYRSLRNEEDTEFL  213

Query  1883  RKEYVHLSAVRPAPPGEPCC-YFRVGESADVFYENRGWRRGTVDEILENSMYMVAL-GDE  1710
             ++E   ++ +RP PP       F+V +  D  + N  W  G +  +L    Y++   G E
Sbjct  214   KEEVASIN-IRPHPPETAFVDCFKVNDKVDALF-NDCWWEGVISRVLREKKYIIYFPGTE  271

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPP  1629
             DAV   K +   LR H++W DG WV P
Sbjct  272   DAV---KFKHSDLRQHQEWIDGKWVIP  295



>ref|XP_006433562.1| hypothetical protein CICLE_v10001744mg [Citrus clementina]
 gb|ESR46802.1| hypothetical protein CICLE_v10001744mg [Citrus clementina]
 gb|KDO81631.1| hypothetical protein CISIN_1g019553mg [Citrus sinensis]
 gb|KDO81632.1| hypothetical protein CISIN_1g019553mg [Citrus sinensis]
Length=339

 Score =   213 bits (543),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 173/315 (55%), Gaps = 28/315 (9%)
 Frame = -3

Query  1025  GPKFSKGMLVEATSFEEGYHGSWYTAVIFD---SIGPNKFLLEYQTL-RTDDESEPLKEK  858
             G  F+ G  VE +S + G+ GSW+   +     +  P K+L+EY  L  T+   +PLKE 
Sbjct  21    GTPFNPGSQVEISSNDVGFRGSWFMGTVIRRPMARNPTKYLVEYSRLFETEAGKKPLKEV  80

Query  857   ADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEF  678
              D   +RP  P   +  +FK+ EEVDA+YN+GWWEG+I++V DG  + VYF  + E+I+F
Sbjct  81    VDLDLLRPLAPR-EKERQFKLGEEVDAFYNDGWWEGVITEVDDG-KFAVYFRNSKEQIKF  138

Query  677   AHHGIRPHQEWIDKKW------DIAFRKSNNN-------------LPNPKPGIMRRHSGG  555
             A   +R H+EWI  +W      D    K   N               N KP         
Sbjct  139   AAEDLRLHREWIKGEWKPPLEDDTETEKLATNSKEEPDKVKTEELFSNSKP---EEEPDK  195

Query  554   IASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEA  375
               +E  FC G  VEV  DE+G QG+W+ A I+   G  KYLVE+++L+ +   + L +E 
Sbjct  196   FNTEGLFCKGTLVEVSSDEDGFQGAWFAATIVEPTGKDKYLVEYQSLRTEDDKEFLKEEI  255

Query  374   DALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFR  195
             D   +RPS P    VDRF  L+EVDA  N+GW VG + +V   +KY V F+TT E L F 
Sbjct  256   DIKHIRPSPPETLMVDRFNKLDEVDALYNDGWWVGVISKVCSNSKYVVYFKTTKEELTFE  315

Query  194   HHGLRLHQEWINGAW  150
             H  LRLHQ+WING W
Sbjct  316   HSDLRLHQDWINGKW  330


 Score =   187 bits (475),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 118/329 (36%), Positives = 175/329 (53%), Gaps = 13/329 (4%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVLMRD-NF-PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             P+    ++   FN G +VE+   D  F   WF   V+R  + +N    +  VE+  L   
Sbjct  13    PKPRTDNSGTPFNPGSQVEISSNDVGFRGSWFMGTVIRRPMARN--PTKYLVEYSRLFET  70

Query  1901  DDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVA  1722
             +   K  KE V L  +RP  P E    F++GE  D FY N GW  G + E+ ++  + V 
Sbjct  71    EAGKKPLKEVVDLDLLRPLAPREKERQFKLGEEVDAFY-NDGWWEGVITEV-DDGKFAVY  128

Query  1721  LGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQY--QQKKSEDFLMTP---SG  1557
                 ++ E +K     LR+HR+W  G W PPLE+    ++     K+  D + T    S 
Sbjct  129   F--RNSKEQIKFAAEDLRLHREWIKGEWKPPLEDDTETEKLATNSKEEPDKVKTEELFSN  186

Query  1556  VKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD  1377
              K   +  + +    F K   VEV  D++GF+ +W+A+ ++E  G  K LV+YQ L+T+D
Sbjct  187   SKPEEEPDKFNTEGLFCKGTLVEVSSDEDGFQGAWFAATIVEPTGKDKYLVEYQSLRTED  246

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
               ++L EE+D   IRP PPE   +  F  LD+VDA   +GWW G +SKV  ++KY+V F 
Sbjct  247   DKEFLKEEIDIKHIRPSPPETLMVDRFNKLDEVDALYNDGWWVGVISKVCSNSKYVVYFK  306

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             +  E LTFE SDLR HQ+W N  WV A++
Sbjct  307   TTKEELTFEHSDLRLHQDWINGKWVTASQ  335


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 81/137 (59%), Gaps = 6/137 (4%)
 Frame = -3

Query  548  SETTFCIGAKVEVKDDEEGNQGSWYPALILR--LIGN-GKYLVEF-RTLKCDFGTDLLVQ  381
            S T F  G++VE+  ++ G +GSW+   ++R  +  N  KYLVE+ R  + + G   L +
Sbjct  20   SGTPFNPGSQVEISSNDVGFRGSWFMGTVIRRPMARNPTKYLVEYSRLFETEAGKKPLKE  79

Query  380  EADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILE  201
              D   +RP AP  ++  +F+  EEVDA+ N+GW  G + EV +G K+ V FR + E ++
Sbjct  80   VVDLDLLRPLAP-REKERQFKLGEEVDAFYNDGWWEGVITEVDDG-KFAVYFRNSKEQIK  137

Query  200  FRHHGLRLHQEWINGAW  150
            F    LRLH+EWI G W
Sbjct  138  FAAEDLRLHREWIKGEW  154



>ref|XP_009382482.1| PREDICTED: uncharacterized protein LOC103970431 [Musa acuminata 
subsp. malaccensis]
Length=429

 Score =   216 bits (549),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 157/459 (34%), Positives = 225/459 (49%), Gaps = 61/459 (13%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWY-ASVVMEVLGNGKLLVQYQDLKTD-DGTDYLIEEVDASCIRPCPP  1320
             VEV  D++GF  +++   VV  +   G+  V Y  +  D D +  L E VDA  +RP PP
Sbjct  13    VEVSSDEDGFRGAYFEGRVVRSMPKLGRYTVDYDAIVDDADESRRLREIVDARHVRPRPP  72

Query  1319  E----IHRISPFKLLDKVDAWVGNGWWEGHVSKVLG--DAKYMVCFGSMNELLTFEASDL  1158
                  + R      L  VDA+  + WW G VS V      +Y +CF    E + F A +L
Sbjct  73    RRLPGVGRWVALHQL--VDAFHNDAWWVGVVSAVPTGRQRRYRICFPPSREEMEFGADEL  130

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFE  978
             R H EW +  WV    + +PR+                         +  G  VE    +
Sbjct  131   RAHFEWVDGEWVLPKSLGVPRTP------------------------YGIGTQVEVARLK  166

Query  977   EGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCP---PLIHRFD  807
             E    +W++AV+  +I  N FL+EY  LR DD  E ++E  D+ ++RPC    P++    
Sbjct  167   ESVPVAWFSAVVVKTIWNNCFLVEYINLRKDDGKELIREIVDSQHVRPCVLHVPIV----  222

Query  806   RFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWD  627
             +F   + V+A+Y  GWW G+I+K+     Y V     ++E EF H  +R   + +D +W 
Sbjct  223   KFDQLDGVEAFYENGWWPGVITKINAESWYTVKSIHWDKEREFCHTMLRLRYDLVDGQW-  281

Query  626   IAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIG  447
                          KP  M     G         G  VEV  DEEG  G+W+ A +L  +G
Sbjct  282   -----------TQKPQNMVMMDIGR--------GKMVEVSSDEEGFLGAWFTATVLESMG  322

Query  446   NGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQ  267
               K+LV++  LK D  T LL +  DAL +RP+ P +     FR LEEVDA  N+GW VG 
Sbjct  323   KNKFLVQYHNLKTDDETQLLTETVDALHIRPTPPEIPVDGEFRNLEEVDASHNDGWWVGV  382

Query  266   VCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             + +VL+G +Y V FR   E +EF H+ LRLHQ+WING W
Sbjct  383   ISKVLDGRRYMVYFRPWKEEMEFGHNDLRLHQDWINGRW  421


 Score =   209 bits (531),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 153/482 (32%), Positives = 236/482 (49%), Gaps = 66/482 (14%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEVLM-RDNF-PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             M+    F  GD VEV    D F   +F   V    VR   + G+  V+++ +  D D  +
Sbjct  1     MAPPEGFRTGDEVEVSSDEDGFRGAYFEGRV----VRSMPKLGRYTVDYDAIVDDADESR  56

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFR---VGESADVFYENRGWRRGTVDEILENSMYMVALG  1716
             R +E V    VRP PP       R   + +  D F+ N  W  G V  +         + 
Sbjct  57    RLREIVDARHVRPRPPRRLPGVGRWVALHQLVDAFH-NDAWWVGVVSAVPTGRQRRYRIC  115

Query  1715  DEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKC  1536
                + E ++    +LR H +W DG WV P             KS     TP G+  +++ 
Sbjct  116   FPPSREEMEFGADELRAHFEWVDGEWVLP-------------KSLGVPRTPYGIGTQVEV  162

Query  1535  TRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIE  1356
              R        + +PV           +W+++VV++ + N   LV+Y +L+ DDG + + E
Sbjct  163   AR------LKESVPV-----------AWFSAVVVKTIWNNCFLVEYINLRKDDGKELIRE  205

Query  1355  EVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
              VD+  +RPC   +  I  F  LD V+A+  NGWW G ++K+  ++ Y V     ++   
Sbjct  206   IVDSQHVRPCVLHVP-IVKFDQLDGVEAFYENGWWPGVITKINAESWYTVKSIHWDKERE  264

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
             F  + LR   +  +  W         +  + VM++                    +G +V
Sbjct  265   FCHTMLRLRYDLVDGQWTQ-------KPQNMVMMD------------------IGRGKMV  299

Query  995   EATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIH  816
             E +S EEG+ G+W+TA + +S+G NKFL++Y  L+TDDE++ L E  DA +IRP PP I 
Sbjct  300   EVSSDEEGFLGAWFTATVLESMGKNKFLVQYHNLKTDDETQLLTETVDALHIRPTPPEIP  359

Query  815   RFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDK  636
                 F+  EEVDA +N+GWW G+ISKVLDG  Y+VYF    EE+EF H+ +R HQ+WI+ 
Sbjct  360   VDGEFRNLEEVDASHNDGWWVGVISKVLDGRRYMVYFRPWKEEMEFGHNDLRLHQDWING  419

Query  635   KW  630
             +W
Sbjct  420   RW  421


 Score =   137 bits (346),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 111/315 (35%), Positives = 152/315 (48%), Gaps = 43/315 (14%)
 Frame = -3

Query  2042  FNKGDRVEVL-MRDNFPI-WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYV  1869
             +  G +VEV  ++++ P+ WF A V++ ++  N       VE+  L  DD     R E V
Sbjct  154   YGIGTQVEVARLKESVPVAWFSAVVVK-TIWNNC----FLVEYINLRKDDGKELIR-EIV  207

Query  1868  HLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVK  1689
                 VRP     P   F   +  + FYEN GW  G + +I   S Y V     D  +  +
Sbjct  208   DSQHVRPCVLHVPIVKFDQLDGVEAFYEN-GWWPGVITKINAESWYTVKSIHWD--KERE  264

Query  1688  VEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKF  1509
                  LR+  D  DG W               +K ++ +M   G        RG  V   
Sbjct  265   FCHTMLRLRYDLVDGQWT--------------QKPQNMVMMDIG--------RGKMV---  299

Query  1508  SKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRP  1329
                   EV  D+EGF  +W+ + V+E +G  K LVQY +LKTDD T  L E VDA  IRP
Sbjct  300   ------EVSSDEEGFLGAWFTATVLESMGKNKFLVQYHNLKTDDETQLLTETVDALHIRP  353

Query  1328  CPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPH  1149
              PPEI     F+ L++VDA   +GWW G +SKVL   +YMV F    E + F  +DLR H
Sbjct  354   TPPEIPVDGEFRNLEEVDASHNDGWWVGVISKVLDGRRYMVYFRPWKEEMEFGHNDLRLH  413

Query  1148  QEWKNNNWV-AATKI  1107
             Q+W N  WV A+TK+
Sbjct  414   QDWINGRWVRASTKL  428


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 74/141 (52%), Gaps = 6/141 (4%)
 Frame = -3

Query  554  IASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGN-GKYLVEFRTLKCDFGTDLLVQE  378
            +A    F  G +VEV  DE+G +G+++   ++R +   G+Y V++  +  D      ++E
Sbjct  1    MAPPEGFRTGDEVEVSSDEDGFRGAYFEGRVVRSMPKLGRYTVDYDAIVDDADESRRLRE  60

Query  377  -ADALSVRPSAPILQR-VDRFRPLEE-VDAWSNNGWRVGQVCEVLEG--AKYRVNFRTTN  213
              DA  VRP  P     V R+  L + VDA+ N+ W VG V  V  G   +YR+ F  + 
Sbjct  61   IVDARHVRPRPPRRLPGVGRWVALHQLVDAFHNDAWWVGVVSAVPTGRQRRYRICFPPSR  120

Query  212  EILEFRHHGLRLHQEWINGAW  150
            E +EF    LR H EW++G W
Sbjct  121  EEMEFGADELRAHFEWVDGEW  141



>gb|KDP23367.1| hypothetical protein JCGZ_23200 [Jatropha curcas]
Length=333

 Score =   213 bits (541),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 172/302 (57%), Gaps = 15/302 (5%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLG--NG-KLLVQYQDLKTDD-GTDYLIEEVDASCIRPC  1326
             VE+  D +GF  SWY   V+      NG K LVQY+ L +D+ G   L E +D   +RP 
Sbjct  24    VEISSDDDGFRGSWYEGTVVRRASSKNGNKYLVQYEKLFSDESGKKPLRETLDCVQLRPA  83

Query  1325  PPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQ  1146
              P   +   FK  +KVDA+  +GWWEG ++    D ++ V F    E + FE  DLR H+
Sbjct  84    APR-EKKRKFKFGEKVDAYHNDGWWEGSITSEREDGRFAVFFRGTREQIVFEEEDLRLHR  142

Query  1145  EWKNNNWVAATKIDLPRSSSDVM-------LNskvvkvkskSDRK---ALGPKFSKGMLV  996
             EW +  W    K     +  +          N     + +   R     L  KF+KGMLV
Sbjct  143   EWVDGEWEPPLKEVQEENEKEEELLEEKQVANENAKSLIATDVRPIEVVLEEKFNKGMLV  202

Query  995   EATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIH  816
             E +S EEG+ G+WY A I +++G NK+L+EYQ+LR +D+S+ L+E+ DA +IRP PP   
Sbjct  203   EVSSDEEGFEGAWYAATIVETVGNNKYLIEYQSLRKEDDSDFLQEEIDASHIRPYPPETI  262

Query  815   RFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDK  636
               DRFK+ +EVDA YN+GWW G+I+KV   + YVVYF  + EE+ F H  +R HQ+WI  
Sbjct  263   LIDRFKLLDEVDASYNDGWWVGVIAKVHADMKYVVYFRDSGEEMVFRHSDLRLHQDWIGG  322

Query  635   KW  630
             +W
Sbjct  323   QW  324


 Score =   202 bits (514),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 114/312 (37%), Positives = 172/312 (55%), Gaps = 24/312 (8%)
 Frame = -3

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTAVIF---DSIGPNKFLLEYQTLRTDDESE-PLKEKA  855
             P    G  VE +S ++G+ GSWY   +     S   NK+L++Y+ L +D+  + PL+E  
Sbjct  16    PHLKAGSRVEISSDDDGFRGSWYEGTVVRRASSKNGNKYLVQYEKLFSDESGKKPLRETL  75

Query  854   DAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFA  675
             D   +RP  P   +  +FK  E+VDA++N+GWWEG I+   +   + V+F  T E+I F 
Sbjct  76    DCVQLRPAAPR-EKKRKFKFGEKVDAYHNDGWWEGSITSEREDGRFAVFFRGTREQIVFE  134

Query  674   HHGIRPHQEWIDKKWDIAFRK-----------------SNNNLPNPKPGIMRRHSGGIAS  546
                +R H+EW+D +W+   ++                 +N N  +     +R     +  
Sbjct  135   EEDLRLHREWVDGEWEPPLKEVQEENEKEEELLEEKQVANENAKSLIATDVRPIE--VVL  192

Query  545   ETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADAL  366
             E  F  G  VEV  DEEG +G+WY A I+  +GN KYL+E+++L+ +  +D L +E DA 
Sbjct  193   EEKFNKGMLVEVSSDEEGFEGAWYAATIVETVGNNKYLIEYQSLRKEDDSDFLQEEIDAS  252

Query  365   SVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHG  186
              +RP  P    +DRF+ L+EVDA  N+GW VG + +V    KY V FR + E + FRH  
Sbjct  253   HIRPYPPETILIDRFKLLDEVDASYNDGWWVGVIAKVHADMKYVVYFRDSGEEMVFRHSD  312

Query  185   LRLHQEWINGAW  150
             LRLHQ+WI G W
Sbjct  313   LRLHQDWIGGQW  324


 Score =   194 bits (493),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 118/316 (37%), Positives = 171/316 (54%), Gaps = 11/316 (3%)
 Frame = -3

Query  2051  EAQFNKGDRVEVLMRDN--FPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRK  1878
             E     G RVE+   D+     W+   V+R +  KN    +  V++E L SD+   K  +
Sbjct  15    EPHLKAGSRVEISSDDDGFRGSWYEGTVVRRASSKN--GNKYLVQYEKLFSDESGKKPLR  72

Query  1877  EYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVE  1698
             E +    +RPA P E    F+ GE  D  Y N GW  G++    E+  + V        E
Sbjct  73    ETLDCVQLRPAAPREKKRKFKFGEKVDA-YHNDGWWEGSITSEREDGRFAVFF--RGTRE  129

Query  1697  SVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVK----LRIKCTR  1530
              +  E+  LR+HR+W DG W PPL+E Q + + +++  E+  +     K      ++   
Sbjct  130   QIVFEEEDLRLHREWVDGEWEPPLKEVQEENEKEEELLEEKQVANENAKSLIATDVRPIE  189

Query  1529  GSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEV  1350
                  KF+K M VEV  D+EGFE +WYA+ ++E +GN K L++YQ L+ +D +D+L EE+
Sbjct  190   VVLEEKFNKGMLVEVSSDEEGFEGAWYAATIVETVGNNKYLIEYQSLRKEDDSDFLQEEI  249

Query  1349  DASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFE  1170
             DAS IRP PPE   I  FKLLD+VDA   +GWW G ++KV  D KY+V F    E + F 
Sbjct  250   DASHIRPYPPETILIDRFKLLDEVDASYNDGWWVGVIAKVHADMKYVVYFRDSGEEMVFR  309

Query  1169  ASDLRPHQEWKNNNWV  1122
              SDLR HQ+W    W+
Sbjct  310   HSDLRLHQDWIGGQWI  325



>ref|XP_011038968.1| PREDICTED: uncharacterized protein LOC105135672 isoform X2 [Populus 
euphratica]
Length=346

 Score =   211 bits (536),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/329 (36%), Positives = 173/329 (53%), Gaps = 42/329 (13%)
 Frame = -3

Query  1025  GPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDE-SEPLKEKADA  849
              P F  G  VE  S EEG+ GS+YT  +  +   +KF++EY  L  D+E ++PL+E  + 
Sbjct  14    NPHFKPGSKVEIMSEEEGFRGSFYTGTVVKATRTSKFIVEYDKLFEDEEGTKPLQETVNE  73

Query  848   FNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHH  669
             F IRP  P   + + FK  EEVDA++N+GWWEG+I++V +   + V+F +T E+IEF   
Sbjct  74    FQIRPIAPREKKRE-FKFSEEVDAFHNDGWWEGVITEVNEDGKFAVFFRSTKEQIEFGEE  132

Query  668   GIRPHQEWIDKKWDIAF------------------------------------RKSNNNL  597
              +R H+EW++  W                                        R+ N  +
Sbjct  133   DLRLHREWVNGAWKPTLEGEEEEEEKEEVKEKENEGSRNKRKLVEEEVTKEVKRRVNKKM  192

Query  596   PNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRT  417
             P+      +        +  F  G  VEV  DE+G +G+W+ A I+  +G  KYL+E+ T
Sbjct  193   PD----TTQEKPIESPKDAKFSKGMLVEVSSDEDGFKGAWFAATIVEPVGKDKYLIEYHT  248

Query  416   LKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKY  237
             L+ +  +  L +E D + +RP  P    +DRF+ LEEVDA  N+ W VG V +V    KY
Sbjct  249   LRTEDDSGFLREEIDTVHIRPHPPQTIIIDRFKKLEEVDALYNDAWWVGVVSKVNTFPKY  308

Query  236   RVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              V F+ +NE LEFRH  LR HQ+WING W
Sbjct  309   SVFFKDSNEELEFRHSDLRPHQDWINGKW  337


 Score =   211 bits (536),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/316 (38%), Positives = 171/316 (54%), Gaps = 29/316 (9%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD-GTDYLIEEVDASCIRPCPPE  1317
             VE+  ++EGF  S+Y   V++     K +V+Y  L  D+ GT  L E V+   IRP  P 
Sbjct  23    VEIMSEEEGFRGSFYTGTVVKATRTSKFIVEYDKLFEDEEGTKPLQETVNEFQIRPIAPR  82

Query  1316  IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWK  1137
               +   FK  ++VDA+  +GWWEG +++V  D K+ V F S  E + F   DLR H+EW 
Sbjct  83    -EKKREFKFSEEVDAFHNDGWWEGVITEVNEDGKFAVFFRSTKEQIEFGEEDLRLHREWV  141

Query  1136  NNNWVAAT------------------------KIDLPRSSSDVMLNskvvkvkskSDRKA  1029
             N  W                            K+     + +V          +  ++  
Sbjct  142   NGAWKPTLEGEEEEEEKEEVKEKENEGSRNKRKLVEEEVTKEVKRRVNKKMPDTTQEKPI  201

Query  1028  LGPK---FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEK  858
               PK   FSKGMLVE +S E+G+ G+W+ A I + +G +K+L+EY TLRT+D+S  L+E+
Sbjct  202   ESPKDAKFSKGMLVEVSSDEDGFKGAWFAATIVEPVGKDKYLIEYHTLRTEDDSGFLREE  261

Query  857   ADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEF  678
              D  +IRP PP     DRFK  EEVDA YN+ WW G++SKV     Y V+F  +NEE+EF
Sbjct  262   IDTVHIRPHPPQTIIIDRFKKLEEVDALYNDAWWVGVVSKVNTFPKYSVFFKDSNEELEF  321

Query  677   AHHGIRPHQEWIDKKW  630
              H  +RPHQ+WI+ KW
Sbjct  322   RHSDLRPHQDWINGKW  337


 Score =   171 bits (433),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 109/338 (32%), Positives = 170/338 (50%), Gaps = 37/338 (11%)
 Frame = -3

Query  2045  QFNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVH  1866
              F  G +VE++  +     F  +    +V K  R  +  VE++ L  D++  K  +E V+
Sbjct  16    HFKPGSKVEIMSEEE---GFRGSFYTGTVVKATRTSKFIVEYDKLFEDEEGTKPLQETVN  72

Query  1865  LSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKV  1686
                +RP  P E    F+  E  D F+ N GW  G + E+ E+  + V        E ++ 
Sbjct  73    EFQIRPIAPREKKREFKFSEEVDAFH-NDGWWEGVITEVNEDGKFAVFF--RSTKEQIEF  129

Query  1685  EQWQLRVHRDWKDGCWVPPLE--------------------------ESQVDQQYQQKKS  1584
              +  LR+HR+W +G W P LE                          E +V ++ +++ +
Sbjct  130   GEEDLRLHREWVNGAWKPTLEGEEEEEEKEEVKEKENEGSRNKRKLVEEEVTKEVKRRVN  189

Query  1583  EDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLV  1404
             +   M  +  +  I+  + +   KFSK M VEV  D++GF+ +W+A+ ++E +G  K L+
Sbjct  190   KK--MPDTTQEKPIESPKDA---KFSKGMLVEVSSDEDGFKGAWFAATIVEPVGKDKYLI  244

Query  1403  QYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLG  1224
             +Y  L+T+D + +L EE+D   IRP PP+   I  FK L++VDA   + WW G VSKV  
Sbjct  245   EYHTLRTEDDSGFLREEIDTVHIRPHPPQTIIIDRFKKLEEVDALYNDAWWVGVVSKVNT  304

Query  1223  DAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
               KY V F   NE L F  SDLRPHQ+W N  WV  +K
Sbjct  305   FPKYSVFFKDSNEELEFRHSDLRPHQDWINGKWVTPSK  342



>ref|XP_011038969.1| PREDICTED: uncharacterized protein LOC105135672 isoform X3 [Populus 
euphratica]
Length=344

 Score =   211 bits (536),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/330 (36%), Positives = 173/330 (52%), Gaps = 43/330 (13%)
 Frame = -3

Query  1025  GPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDE-SEPLKEKADA  849
              P F  G  VE  S EEG+ GS+YT  +  +   +KF++EY  L  D+E ++PL+E  + 
Sbjct  14    NPHFKPGSKVEIMSEEEGFRGSFYTGTVVKATRTSKFIVEYDKLFEDEEGTKPLQETVNE  73

Query  848   FNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHH  669
             F IRP  P   + + FK  EEVDA++N+GWWEG+I++V +   + V+F +T E+IEF   
Sbjct  74    FQIRPIAPREKKRE-FKFSEEVDAFHNDGWWEGVITEVNEDGKFAVFFRSTKEQIEFGEE  132

Query  668   GIRPHQEWIDKKWDIAF-------------------------------------RKSNNN  600
              +R H+EW++  W                                         R+ N  
Sbjct  133   DLRLHREWVNGAWKPTLEGEEEEEEKEEVKEKENEQGSRNKRKLVEEEVTKEVKRRVNKK  192

Query  599   LPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFR  420
             +P+      +        +  F  G  VEV  DE+G +G+W+ A I+  +G  KYL+E+ 
Sbjct  193   MPD----TTQEKPIESPKDAKFSKGMLVEVSSDEDGFKGAWFAATIVEPVGKDKYLIEYH  248

Query  419   TLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAK  240
             TL+ +  +  L +E D + +RP  P    +DRF+ LEEVDA  N+ W VG V +V    K
Sbjct  249   TLRTEDDSGFLREEIDTVHIRPHPPQTIIIDRFKKLEEVDALYNDAWWVGVVSKVNTFPK  308

Query  239   YRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             Y V F+ +NE LEFRH  LR HQ+WING W
Sbjct  309   YSVFFKDSNEELEFRHSDLRPHQDWINGKW  338


 Score =   210 bits (535),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/317 (38%), Positives = 171/317 (54%), Gaps = 30/317 (9%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD-GTDYLIEEVDASCIRPCPPE  1317
             VE+  ++EGF  S+Y   V++     K +V+Y  L  D+ GT  L E V+   IRP  P 
Sbjct  23    VEIMSEEEGFRGSFYTGTVVKATRTSKFIVEYDKLFEDEEGTKPLQETVNEFQIRPIAPR  82

Query  1316  IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWK  1137
               +   FK  ++VDA+  +GWWEG +++V  D K+ V F S  E + F   DLR H+EW 
Sbjct  83    -EKKREFKFSEEVDAFHNDGWWEGVITEVNEDGKFAVFFRSTKEQIEFGEEDLRLHREWV  141

Query  1136  NNNWVAAT-------------------------KIDLPRSSSDVMLNskvvkvkskSDRK  1032
             N  W                             K+     + +V          +  ++ 
Sbjct  142   NGAWKPTLEGEEEEEEKEEVKEKENEQGSRNKRKLVEEEVTKEVKRRVNKKMPDTTQEKP  201

Query  1031  ALGPK---FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKE  861
                PK   FSKGMLVE +S E+G+ G+W+ A I + +G +K+L+EY TLRT+D+S  L+E
Sbjct  202   IESPKDAKFSKGMLVEVSSDEDGFKGAWFAATIVEPVGKDKYLIEYHTLRTEDDSGFLRE  261

Query  860   KADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIE  681
             + D  +IRP PP     DRFK  EEVDA YN+ WW G++SKV     Y V+F  +NEE+E
Sbjct  262   EIDTVHIRPHPPQTIIIDRFKKLEEVDALYNDAWWVGVVSKVNTFPKYSVFFKDSNEELE  321

Query  680   FAHHGIRPHQEWIDKKW  630
             F H  +RPHQ+WI+ KW
Sbjct  322   FRHSDLRPHQDWINGKW  338


 Score =   172 bits (437),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 110/335 (33%), Positives = 165/335 (49%), Gaps = 28/335 (8%)
 Frame = -3

Query  2045  QFNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVH  1866
              F  G +VE++  +     F  +    +V K  R  +  VE++ L  D++  K  +E V+
Sbjct  16    HFKPGSKVEIMSEEE---GFRGSFYTGTVVKATRTSKFIVEYDKLFEDEEGTKPLQETVN  72

Query  1865  LSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKV  1686
                +RP  P E    F+  E  D F+ N GW  G + E+ E+  + V        E ++ 
Sbjct  73    EFQIRPIAPREKKREFKFSEEVDAFH-NDGWWEGVITEVNEDGKFAVFF--RSTKEQIEF  129

Query  1685  EQWQLRVHRDWKDGCWVPPLEESQVD------------QQYQQKKSEDFLMTPSGVKLRI  1542
              +  LR+HR+W +G W P LE  + +            Q  + K+          VK R+
Sbjct  130   GEEDLRLHREWVNGAWKPTLEGEEEEEEKEEVKEKENEQGSRNKRKLVEEEVTKEVKRRV  189

Query  1541  KCTRGSCVR----------KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQD  1392
                     +          KFSK M VEV  D++GF+ +W+A+ ++E +G  K L++Y  
Sbjct  190   NKKMPDTTQEKPIESPKDAKFSKGMLVEVSSDEDGFKGAWFAATIVEPVGKDKYLIEYHT  249

Query  1391  LKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKY  1212
             L+T+D + +L EE+D   IRP PP+   I  FK L++VDA   + WW G VSKV    KY
Sbjct  250   LRTEDDSGFLREEIDTVHIRPHPPQTIIIDRFKKLEEVDALYNDAWWVGVVSKVNTFPKY  309

Query  1211  MVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKI  1107
              V F   NE L F  SDLRPHQ+W N  WV  +K+
Sbjct  310   SVFFKDSNEELEFRHSDLRPHQDWINGKWVTPSKL  344



>ref|XP_011038967.1| PREDICTED: uncharacterized protein LOC105135672 isoform X1 [Populus 
euphratica]
Length=347

 Score =   210 bits (535),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/330 (36%), Positives = 173/330 (52%), Gaps = 43/330 (13%)
 Frame = -3

Query  1025  GPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDE-SEPLKEKADA  849
              P F  G  VE  S EEG+ GS+YT  +  +   +KF++EY  L  D+E ++PL+E  + 
Sbjct  14    NPHFKPGSKVEIMSEEEGFRGSFYTGTVVKATRTSKFIVEYDKLFEDEEGTKPLQETVNE  73

Query  848   FNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHH  669
             F IRP  P   + + FK  EEVDA++N+GWWEG+I++V +   + V+F +T E+IEF   
Sbjct  74    FQIRPIAPREKKRE-FKFSEEVDAFHNDGWWEGVITEVNEDGKFAVFFRSTKEQIEFGEE  132

Query  668   GIRPHQEWIDKKWDIAF-------------------------------------RKSNNN  600
              +R H+EW++  W                                         R+ N  
Sbjct  133   DLRLHREWVNGAWKPTLEGEEEEEEKEEVKEKENEQGSRNKRKLVEEEVTKEVKRRVNKK  192

Query  599   LPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFR  420
             +P+      +        +  F  G  VEV  DE+G +G+W+ A I+  +G  KYL+E+ 
Sbjct  193   MPD----TTQEKPIESPKDAKFSKGMLVEVSSDEDGFKGAWFAATIVEPVGKDKYLIEYH  248

Query  419   TLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAK  240
             TL+ +  +  L +E D + +RP  P    +DRF+ LEEVDA  N+ W VG V +V    K
Sbjct  249   TLRTEDDSGFLREEIDTVHIRPHPPQTIIIDRFKKLEEVDALYNDAWWVGVVSKVNTFPK  308

Query  239   YRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             Y V F+ +NE LEFRH  LR HQ+WING W
Sbjct  309   YSVFFKDSNEELEFRHSDLRPHQDWINGKW  338


 Score =   210 bits (535),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/317 (38%), Positives = 171/317 (54%), Gaps = 30/317 (9%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD-GTDYLIEEVDASCIRPCPPE  1317
             VE+  ++EGF  S+Y   V++     K +V+Y  L  D+ GT  L E V+   IRP  P 
Sbjct  23    VEIMSEEEGFRGSFYTGTVVKATRTSKFIVEYDKLFEDEEGTKPLQETVNEFQIRPIAPR  82

Query  1316  IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWK  1137
               +   FK  ++VDA+  +GWWEG +++V  D K+ V F S  E + F   DLR H+EW 
Sbjct  83    -EKKREFKFSEEVDAFHNDGWWEGVITEVNEDGKFAVFFRSTKEQIEFGEEDLRLHREWV  141

Query  1136  NNNWVAAT-------------------------KIDLPRSSSDVMLNskvvkvkskSDRK  1032
             N  W                             K+     + +V          +  ++ 
Sbjct  142   NGAWKPTLEGEEEEEEKEEVKEKENEQGSRNKRKLVEEEVTKEVKRRVNKKMPDTTQEKP  201

Query  1031  ALGPK---FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKE  861
                PK   FSKGMLVE +S E+G+ G+W+ A I + +G +K+L+EY TLRT+D+S  L+E
Sbjct  202   IESPKDAKFSKGMLVEVSSDEDGFKGAWFAATIVEPVGKDKYLIEYHTLRTEDDSGFLRE  261

Query  860   KADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIE  681
             + D  +IRP PP     DRFK  EEVDA YN+ WW G++SKV     Y V+F  +NEE+E
Sbjct  262   EIDTVHIRPHPPQTIIIDRFKKLEEVDALYNDAWWVGVVSKVNTFPKYSVFFKDSNEELE  321

Query  680   FAHHGIRPHQEWIDKKW  630
             F H  +RPHQ+WI+ KW
Sbjct  322   FRHSDLRPHQDWINGKW  338


 Score =   172 bits (435),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 110/334 (33%), Positives = 164/334 (49%), Gaps = 28/334 (8%)
 Frame = -3

Query  2045  QFNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVH  1866
              F  G +VE++  +     F  +    +V K  R  +  VE++ L  D++  K  +E V+
Sbjct  16    HFKPGSKVEIMSEEE---GFRGSFYTGTVVKATRTSKFIVEYDKLFEDEEGTKPLQETVN  72

Query  1865  LSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKV  1686
                +RP  P E    F+  E  D F+ N GW  G + E+ E+  + V        E ++ 
Sbjct  73    EFQIRPIAPREKKREFKFSEEVDAFH-NDGWWEGVITEVNEDGKFAVFF--RSTKEQIEF  129

Query  1685  EQWQLRVHRDWKDGCWVPPLEESQVD------------QQYQQKKSEDFLMTPSGVKLRI  1542
              +  LR+HR+W +G W P LE  + +            Q  + K+          VK R+
Sbjct  130   GEEDLRLHREWVNGAWKPTLEGEEEEEEKEEVKEKENEQGSRNKRKLVEEEVTKEVKRRV  189

Query  1541  KCTRGSCVR----------KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQD  1392
                     +          KFSK M VEV  D++GF+ +W+A+ ++E +G  K L++Y  
Sbjct  190   NKKMPDTTQEKPIESPKDAKFSKGMLVEVSSDEDGFKGAWFAATIVEPVGKDKYLIEYHT  249

Query  1391  LKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKY  1212
             L+T+D + +L EE+D   IRP PP+   I  FK L++VDA   + WW G VSKV    KY
Sbjct  250   LRTEDDSGFLREEIDTVHIRPHPPQTIIIDRFKKLEEVDALYNDAWWVGVVSKVNTFPKY  309

Query  1211  MVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
              V F   NE L F  SDLRPHQ+W N  WV  +K
Sbjct  310   SVFFKDSNEELEFRHSDLRPHQDWINGKWVTPSK  343



>ref|XP_002277366.3| PREDICTED: uncharacterized protein LOC100266586 isoform X1 [Vitis 
vinifera]
Length=327

 Score =   209 bits (531),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/308 (38%), Positives = 184/308 (60%), Gaps = 20/308 (6%)
 Frame = -3

Query  1538  CTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK----LLVQYQDLKTDD-G  1374
              T  S +  F K   +E+  D++GF  +W+A  V++     K    ++V+Y+ +  D+ G
Sbjct  26    LTPNSPMDYFKKGAEIEISSDEDGFRGAWFAGTVVKPPAKKKNKTLVVVEYKTIMADESG  85

Query  1373  TDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGS  1194
              + L E +D   +RP PP     + F++ ++VDA+  +GWWEG +++   ++++ V F +
Sbjct  86    ANPLRETMDVLQLRPPPPRERSRT-FQISEEVDAYYNDGWWEGVITEAHENSRFAVFFRT  144

Query  1193  MNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKF  1014
               E L F  +DLR H+EW N NWV   + +  ++     ++              +   F
Sbjct  145   SREQLEFSENDLRLHREWINGNWVPPLEEEKVKTEEKSAVD--------------VSSVF  190

Query  1013  SKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRP  834
             S+G LVE +S E+G+ G+W+ A I   IG +K ++EY++LRTDD+++ L+E+ DA +IRP
Sbjct  191   SEGTLVEVSSDEDGFQGAWFAATIVKVIGKDKLMIEYKSLRTDDDTDFLREEVDALHIRP  250

Query  833   CPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPH  654
              PP     DRF + EEVDA YN+GWW G+ISKVL    YVVYF +TNEE++F H  +R H
Sbjct  251   YPPETVVVDRFNLLEEVDALYNDGWWVGVISKVLSRSCYVVYFRSTNEEMKFDHSDLRLH  310

Query  653   QEWIDKKW  630
             Q+WID KW
Sbjct  311   QDWIDGKW  318


 Score =   207 bits (526),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 173/294 (59%), Gaps = 15/294 (5%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK----FLLEYQTLRTDDE-SEPLKEKAD  852
             F KG  +E +S E+G+ G+W+   +       K     ++EY+T+  D+  + PL+E  D
Sbjct  35    FKKGAEIEISSDEDGFRGAWFAGTVVKPPAKKKNKTLVVVEYKTIMADESGANPLRETMD  94

Query  851   AFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
                +RP PP       F++ EEVDA+YN+GWWEG+I++  +   + V+F T+ E++EF+ 
Sbjct  95    VLQLRPPPPRERS-RTFQISEEVDAYYNDGWWEGVITEAHENSRFAVFFRTSREQLEFSE  153

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
             + +R H+EWI+  W           P  +  +       +   + F  G  VEV  DE+G
Sbjct  154   NDLRLHREWINGNW---------VPPLEEEKVKTEEKSAVDVSSVFSEGTLVEVSSDEDG  204

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPL  312
              QG+W+ A I+++IG  K ++E+++L+ D  TD L +E DAL +RP  P    VDRF  L
Sbjct  205   FQGAWFAATIVKVIGKDKLMIEYKSLRTDDDTDFLREEVDALHIRPYPPETVVVDRFNLL  264

Query  311   EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             EEVDA  N+GW VG + +VL  + Y V FR+TNE ++F H  LRLHQ+WI+G W
Sbjct  265   EEVDALYNDGWWVGVISKVLSRSCYVVYFRSTNEEMKFDHSDLRLHQDWIDGKW  318


 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/313 (36%), Positives = 177/313 (57%), Gaps = 26/313 (8%)
 Frame = -3

Query  2042  FNKGDRVEVLM-RDNF-PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYV  1869
             F KG  +E+    D F   WF   V++P  +K  +   + VE++T+ +D+      +E +
Sbjct  35    FKKGAEIEISSDEDGFRGAWFAGTVVKPPAKKKNKT-LVVVEYKTIMADESGANPLRETM  93

Query  1868  HLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVK  1689
              +  +RP PP E    F++ E  D +Y N GW  G + E  ENS + V      + E ++
Sbjct  94    DVLQLRPPPPRERSRTFQISEEVDAYY-NDGWWEGVITEAHENSRFAVFF--RTSREQLE  150

Query  1688  VEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKF  1509
               +  LR+HR+W +G WVPPLEE +V  + +           S V +    + G+ V   
Sbjct  151   FSENDLRLHREWINGNWVPPLEEEKVKTEEK-----------SAVDVSSVFSEGTLV---  196

Query  1508  SKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRP  1329
                   EV  D++GF+ +W+A+ +++V+G  KL+++Y+ L+TDD TD+L EEVDA  IRP
Sbjct  197   ------EVSSDEDGFQGAWFAATIVKVIGKDKLMIEYKSLRTDDDTDFLREEVDALHIRP  250

Query  1328  CPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPH  1149
              PPE   +  F LL++VDA   +GWW G +SKVL  + Y+V F S NE + F+ SDLR H
Sbjct  251   YPPETVVVDRFNLLEEVDALYNDGWWVGVISKVLSRSCYVVYFRSTNEEMKFDHSDLRLH  310

Query  1148  QEWKNNNWVAATK  1110
             Q+W +  WV A++
Sbjct  311   QDWIDGKWVKASQ  323



>ref|XP_010659717.1| PREDICTED: uncharacterized protein LOC100266586 isoform X2 [Vitis 
vinifera]
Length=325

 Score =   208 bits (530),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 117/308 (38%), Positives = 184/308 (60%), Gaps = 20/308 (6%)
 Frame = -3

Query  1538  CTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK----LLVQYQDLKTDD-G  1374
              T  S +  F K   +E+  D++GF  +W+A  V++     K    ++V+Y+ +  D+ G
Sbjct  24    LTPNSPMDYFKKGAEIEISSDEDGFRGAWFAGTVVKPPAKKKNKTLVVVEYKTIMADESG  83

Query  1373  TDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGS  1194
              + L E +D   +RP PP     + F++ ++VDA+  +GWWEG +++   ++++ V F +
Sbjct  84    ANPLRETMDVLQLRPPPPRERSRT-FQISEEVDAYYNDGWWEGVITEAHENSRFAVFFRT  142

Query  1193  MNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKF  1014
               E L F  +DLR H+EW N NWV   + +  ++     ++              +   F
Sbjct  143   SREQLEFSENDLRLHREWINGNWVPPLEEEKVKTEEKSAVD--------------VSSVF  188

Query  1013  SKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRP  834
             S+G LVE +S E+G+ G+W+ A I   IG +K ++EY++LRTDD+++ L+E+ DA +IRP
Sbjct  189   SEGTLVEVSSDEDGFQGAWFAATIVKVIGKDKLMIEYKSLRTDDDTDFLREEVDALHIRP  248

Query  833   CPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPH  654
              PP     DRF + EEVDA YN+GWW G+ISKVL    YVVYF +TNEE++F H  +R H
Sbjct  249   YPPETVVVDRFNLLEEVDALYNDGWWVGVISKVLSRSCYVVYFRSTNEEMKFDHSDLRLH  308

Query  653   QEWIDKKW  630
             Q+WID KW
Sbjct  309   QDWIDGKW  316


 Score =   207 bits (526),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 173/294 (59%), Gaps = 15/294 (5%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK----FLLEYQTLRTDDE-SEPLKEKAD  852
             F KG  +E +S E+G+ G+W+   +       K     ++EY+T+  D+  + PL+E  D
Sbjct  33    FKKGAEIEISSDEDGFRGAWFAGTVVKPPAKKKNKTLVVVEYKTIMADESGANPLRETMD  92

Query  851   AFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
                +RP PP       F++ EEVDA+YN+GWWEG+I++  +   + V+F T+ E++EF+ 
Sbjct  93    VLQLRPPPPRERS-RTFQISEEVDAYYNDGWWEGVITEAHENSRFAVFFRTSREQLEFSE  151

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
             + +R H+EWI+  W           P  +  +       +   + F  G  VEV  DE+G
Sbjct  152   NDLRLHREWINGNW---------VPPLEEEKVKTEEKSAVDVSSVFSEGTLVEVSSDEDG  202

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPL  312
              QG+W+ A I+++IG  K ++E+++L+ D  TD L +E DAL +RP  P    VDRF  L
Sbjct  203   FQGAWFAATIVKVIGKDKLMIEYKSLRTDDDTDFLREEVDALHIRPYPPETVVVDRFNLL  262

Query  311   EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             EEVDA  N+GW VG + +VL  + Y V FR+TNE ++F H  LRLHQ+WI+G W
Sbjct  263   EEVDALYNDGWWVGVISKVLSRSCYVVYFRSTNEEMKFDHSDLRLHQDWIDGKW  316


 Score =   181 bits (458),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 114/313 (36%), Positives = 177/313 (57%), Gaps = 26/313 (8%)
 Frame = -3

Query  2042  FNKGDRVEVLM-RDNF-PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYV  1869
             F KG  +E+    D F   WF   V++P  +K  +   + VE++T+ +D+      +E +
Sbjct  33    FKKGAEIEISSDEDGFRGAWFAGTVVKPPAKKKNKT-LVVVEYKTIMADESGANPLRETM  91

Query  1868  HLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVK  1689
              +  +RP PP E    F++ E  D +Y N GW  G + E  ENS + V      + E ++
Sbjct  92    DVLQLRPPPPRERSRTFQISEEVDAYY-NDGWWEGVITEAHENSRFAVFF--RTSREQLE  148

Query  1688  VEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKF  1509
               +  LR+HR+W +G WVPPLEE +V  + +           S V +    + G+ V   
Sbjct  149   FSENDLRLHREWINGNWVPPLEEEKVKTEEK-----------SAVDVSSVFSEGTLV---  194

Query  1508  SKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRP  1329
                   EV  D++GF+ +W+A+ +++V+G  KL+++Y+ L+TDD TD+L EEVDA  IRP
Sbjct  195   ------EVSSDEDGFQGAWFAATIVKVIGKDKLMIEYKSLRTDDDTDFLREEVDALHIRP  248

Query  1328  CPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPH  1149
              PPE   +  F LL++VDA   +GWW G +SKVL  + Y+V F S NE + F+ SDLR H
Sbjct  249   YPPETVVVDRFNLLEEVDALYNDGWWVGVISKVLSRSCYVVYFRSTNEEMKFDHSDLRLH  308

Query  1148  QEWKNNNWVAATK  1110
             Q+W +  WV A++
Sbjct  309   QDWIDGKWVKASQ  321



>emb|CBI39618.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   208 bits (529),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 117/308 (38%), Positives = 184/308 (60%), Gaps = 20/308 (6%)
 Frame = -3

Query  1538  CTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK----LLVQYQDLKTDD-G  1374
              T  S +  F K   +E+  D++GF  +W+A  V++     K    ++V+Y+ +  D+ G
Sbjct  14    LTPNSPMDYFKKGAEIEISSDEDGFRGAWFAGTVVKPPAKKKNKTLVVVEYKTIMADESG  73

Query  1373  TDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGS  1194
              + L E +D   +RP PP     + F++ ++VDA+  +GWWEG +++   ++++ V F +
Sbjct  74    ANPLRETMDVLQLRPPPPRERSRT-FQISEEVDAYYNDGWWEGVITEAHENSRFAVFFRT  132

Query  1193  MNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKF  1014
               E L F  +DLR H+EW N NWV   + +  ++     ++              +   F
Sbjct  133   SREQLEFSENDLRLHREWINGNWVPPLEEEKVKTEEKSAVD--------------VSSVF  178

Query  1013  SKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRP  834
             S+G LVE +S E+G+ G+W+ A I   IG +K ++EY++LRTDD+++ L+E+ DA +IRP
Sbjct  179   SEGTLVEVSSDEDGFQGAWFAATIVKVIGKDKLMIEYKSLRTDDDTDFLREEVDALHIRP  238

Query  833   CPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPH  654
              PP     DRF + EEVDA YN+GWW G+ISKVL    YVVYF +TNEE++F H  +R H
Sbjct  239   YPPETVVVDRFNLLEEVDALYNDGWWVGVISKVLSRSCYVVYFRSTNEEMKFDHSDLRLH  298

Query  653   QEWIDKKW  630
             Q+WID KW
Sbjct  299   QDWIDGKW  306


 Score =   207 bits (526),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 173/294 (59%), Gaps = 15/294 (5%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK----FLLEYQTLRTDDE-SEPLKEKAD  852
             F KG  +E +S E+G+ G+W+   +       K     ++EY+T+  D+  + PL+E  D
Sbjct  23    FKKGAEIEISSDEDGFRGAWFAGTVVKPPAKKKNKTLVVVEYKTIMADESGANPLRETMD  82

Query  851   AFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
                +RP PP       F++ EEVDA+YN+GWWEG+I++  +   + V+F T+ E++EF+ 
Sbjct  83    VLQLRPPPPRERS-RTFQISEEVDAYYNDGWWEGVITEAHENSRFAVFFRTSREQLEFSE  141

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
             + +R H+EWI+  W           P  +  +       +   + F  G  VEV  DE+G
Sbjct  142   NDLRLHREWINGNW---------VPPLEEEKVKTEEKSAVDVSSVFSEGTLVEVSSDEDG  192

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPL  312
              QG+W+ A I+++IG  K ++E+++L+ D  TD L +E DAL +RP  P    VDRF  L
Sbjct  193   FQGAWFAATIVKVIGKDKLMIEYKSLRTDDDTDFLREEVDALHIRPYPPETVVVDRFNLL  252

Query  311   EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             EEVDA  N+GW VG + +VL  + Y V FR+TNE ++F H  LRLHQ+WI+G W
Sbjct  253   EEVDALYNDGWWVGVISKVLSRSCYVVYFRSTNEEMKFDHSDLRLHQDWIDGKW  306


 Score =   181 bits (459),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 114/313 (36%), Positives = 177/313 (57%), Gaps = 26/313 (8%)
 Frame = -3

Query  2042  FNKGDRVEVLM-RDNF-PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYV  1869
             F KG  +E+    D F   WF   V++P  +K  +   + VE++T+ +D+      +E +
Sbjct  23    FKKGAEIEISSDEDGFRGAWFAGTVVKPPAKKKNKT-LVVVEYKTIMADESGANPLRETM  81

Query  1868  HLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVK  1689
              +  +RP PP E    F++ E  D +Y N GW  G + E  ENS + V      + E ++
Sbjct  82    DVLQLRPPPPRERSRTFQISEEVDAYY-NDGWWEGVITEAHENSRFAVFF--RTSREQLE  138

Query  1688  VEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKF  1509
               +  LR+HR+W +G WVPPLEE +V  + +           S V +    + G+ V   
Sbjct  139   FSENDLRLHREWINGNWVPPLEEEKVKTEEK-----------SAVDVSSVFSEGTLV---  184

Query  1508  SKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRP  1329
                   EV  D++GF+ +W+A+ +++V+G  KL+++Y+ L+TDD TD+L EEVDA  IRP
Sbjct  185   ------EVSSDEDGFQGAWFAATIVKVIGKDKLMIEYKSLRTDDDTDFLREEVDALHIRP  238

Query  1328  CPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPH  1149
              PPE   +  F LL++VDA   +GWW G +SKVL  + Y+V F S NE + F+ SDLR H
Sbjct  239   YPPETVVVDRFNLLEEVDALYNDGWWVGVISKVLSRSCYVVYFRSTNEEMKFDHSDLRLH  298

Query  1148  QEWKNNNWVAATK  1110
             Q+W +  WV A++
Sbjct  299   QDWIDGKWVKASQ  311



>ref|XP_010659718.1| PREDICTED: uncharacterized protein LOC100266586 isoform X3 [Vitis 
vinifera]
Length=296

 Score =   207 bits (527),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/299 (38%), Positives = 181/299 (61%), Gaps = 20/299 (7%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK----LLVQYQDLKTDD-GTDYLIEEVD  1347
             F K   +E+  D++GF  +W+A  V++     K    ++V+Y+ +  D+ G + L E +D
Sbjct  4     FKKGAEIEISSDEDGFRGAWFAGTVVKPPAKKKNKTLVVVEYKTIMADESGANPLRETMD  63

Query  1346  ASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEA  1167
                +RP PP     + F++ ++VDA+  +GWWEG +++   ++++ V F +  E L F  
Sbjct  64    VLQLRPPPPRERSRT-FQISEEVDAYYNDGWWEGVITEAHENSRFAVFFRTSREQLEFSE  122

Query  1166  SDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEAT  987
             +DLR H+EW N NWV   + +  ++     ++              +   FS+G LVE +
Sbjct  123   NDLRLHREWINGNWVPPLEEEKVKTEEKSAVD--------------VSSVFSEGTLVEVS  168

Query  986   SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFD  807
             S E+G+ G+W+ A I   IG +K ++EY++LRTDD+++ L+E+ DA +IRP PP     D
Sbjct  169   SDEDGFQGAWFAATIVKVIGKDKLMIEYKSLRTDDDTDFLREEVDALHIRPYPPETVVVD  228

Query  806   RFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             RF + EEVDA YN+GWW G+ISKVL    YVVYF +TNEE++F H  +R HQ+WID KW
Sbjct  229   RFNLLEEVDALYNDGWWVGVISKVLSRSCYVVYFRSTNEEMKFDHSDLRLHQDWIDGKW  287


 Score =   207 bits (526),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 173/294 (59%), Gaps = 15/294 (5%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK----FLLEYQTLRTDDE-SEPLKEKAD  852
             F KG  +E +S E+G+ G+W+   +       K     ++EY+T+  D+  + PL+E  D
Sbjct  4     FKKGAEIEISSDEDGFRGAWFAGTVVKPPAKKKNKTLVVVEYKTIMADESGANPLRETMD  63

Query  851   AFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
                +RP PP       F++ EEVDA+YN+GWWEG+I++  +   + V+F T+ E++EF+ 
Sbjct  64    VLQLRPPPPRERS-RTFQISEEVDAYYNDGWWEGVITEAHENSRFAVFFRTSREQLEFSE  122

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
             + +R H+EWI+  W           P  +  +       +   + F  G  VEV  DE+G
Sbjct  123   NDLRLHREWINGNW---------VPPLEEEKVKTEEKSAVDVSSVFSEGTLVEVSSDEDG  173

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPL  312
              QG+W+ A I+++IG  K ++E+++L+ D  TD L +E DAL +RP  P    VDRF  L
Sbjct  174   FQGAWFAATIVKVIGKDKLMIEYKSLRTDDDTDFLREEVDALHIRPYPPETVVVDRFNLL  233

Query  311   EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             EEVDA  N+GW VG + +VL  + Y V FR+TNE ++F H  LRLHQ+WI+G W
Sbjct  234   EEVDALYNDGWWVGVISKVLSRSCYVVYFRSTNEEMKFDHSDLRLHQDWIDGKW  287


 Score =   181 bits (460),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 114/313 (36%), Positives = 176/313 (56%), Gaps = 26/313 (8%)
 Frame = -3

Query  2042  FNKGDRVEVLM-RDNF-PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYV  1869
             F KG  +E+    D F   WF   V++P  +K  +   + VE++T+ +D+      +E +
Sbjct  4     FKKGAEIEISSDEDGFRGAWFAGTVVKPPAKKKNKT-LVVVEYKTIMADESGANPLRETM  62

Query  1868  HLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVK  1689
              +  +RP PP E    F++ E  D +Y N GW  G + E  ENS + V      + E ++
Sbjct  63    DVLQLRPPPPRERSRTFQISEEVDAYY-NDGWWEGVITEAHENSRFAVFF--RTSREQLE  119

Query  1688  VEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKF  1509
               +  LR+HR+W +G WVPPLEE +V  +             S V +    + G+ V   
Sbjct  120   FSENDLRLHREWINGNWVPPLEEEKVKTE-----------EKSAVDVSSVFSEGTLV---  165

Query  1508  SKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRP  1329
                   EV  D++GF+ +W+A+ +++V+G  KL+++Y+ L+TDD TD+L EEVDA  IRP
Sbjct  166   ------EVSSDEDGFQGAWFAATIVKVIGKDKLMIEYKSLRTDDDTDFLREEVDALHIRP  219

Query  1328  CPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPH  1149
              PPE   +  F LL++VDA   +GWW G +SKVL  + Y+V F S NE + F+ SDLR H
Sbjct  220   YPPETVVVDRFNLLEEVDALYNDGWWVGVISKVLSRSCYVVYFRSTNEEMKFDHSDLRLH  279

Query  1148  QEWKNNNWVAATK  1110
             Q+W +  WV A++
Sbjct  280   QDWIDGKWVKASQ  292



>ref|XP_002512533.1| hypothetical protein RCOM_1435690 [Ricinus communis]
 gb|EEF49985.1| hypothetical protein RCOM_1435690 [Ricinus communis]
Length=363

 Score =   207 bits (528),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/333 (36%), Positives = 171/333 (51%), Gaps = 43/333 (13%)
 Frame = -3

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTAVIF---DSIGPNKFLLEYQTLRTDDESE-PLKEKA  855
             P F  G +VE +S ++G+ GSWYT  I     S  PNK+L+EY+ L +D+  + PLKE  
Sbjct  16    PHFKNGTVVEVSSDDDGFRGSWYTGKIIKRASSRSPNKYLIEYEKLFSDESGKNPLKEIL  75

Query  854   DAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFA  675
             D   +RP  P   +  RF+  E+VDA++N+GWWEG I++      + V+F  T E+I F 
Sbjct  76    DLAQLRPLAPR-EKKRRFRFGEKVDAYHNDGWWEGSITEECKDGKFAVFFRGTREQIVFG  134

Query  674   HHGIRPHQEWIDKKWDIAFR----KSNNNLPNPKPGIMRRHSGGI---------------  552
                +R H+EW+D +W         K      N  P  M      I               
Sbjct  135   EEDLRLHREWVDDQWKPPLEDESLKEEKEEANETPLCMLYLEKSILILGGQNLDWMCISR  194

Query  551   -------------------ASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLV  429
                                 +E  F  G ++EV  DEEG QG+W+ A I+  +G  KYL+
Sbjct  195   IIEDARKVPTTLEVNHIEAETEENFSKGMEIEVSSDEEGFQGAWFAATIIEAVGKDKYLI  254

Query  428   EFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLE  249
             E++ L+ +  TD L +E D   +RP  P +  V+ F+ L+EVDA  N+GW VG + +VL 
Sbjct  255   EYKNLRTEDDTDFLREEIDIAHLRPCPPEIIMVNSFKLLDEVDALYNDGWWVGVISKVLA  314

Query  248   GAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
               KY V FR T+E + FRH  LRLH +WI G W
Sbjct  315   DCKYTVYFRDTSEEMTFRHSELRLHHDWIAGEW  347


 Score =   193 bits (491),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/340 (33%), Positives = 178/340 (52%), Gaps = 56/340 (16%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGN---GKLLVQYQDLKTDD-GTDYLIEEVDA  1344
             F     VEV  D +GF  SWY   +++   +    K L++Y+ L +D+ G + L E +D 
Sbjct  18    FKNGTVVEVSSDDDGFRGSWYTGKIIKRASSRSPNKYLIEYEKLFSDESGKNPLKEILDL  77

Query  1343  SCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEAS  1164
             + +RP  P   +   F+  +KVDA+  +GWWEG +++   D K+ V F    E + F   
Sbjct  78    AQLRPLAPR-EKKRRFRFGEKVDAYHNDGWWEGSITEECKDGKFAVFFRGTREQIVFGEE  136

Query  1163  DLRPHQEW----------------------------------------KNNNWVAATKI-  1107
             DLR H+EW                                        +N +W+  ++I 
Sbjct  137   DLRLHREWVDDQWKPPLEDESLKEEKEEANETPLCMLYLEKSILILGGQNLDWMCISRII  196

Query  1106  -DLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSI  930
              D  +  + + +N    + +           FSKGM +E +S EEG+ G+W+ A I +++
Sbjct  197   EDARKVPTTLEVNHIEAETEE---------NFSKGMEIEVSSDEEGFQGAWFAATIIEAV  247

Query  929   GPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEG  750
             G +K+L+EY+ LRT+D+++ L+E+ D  ++RPCPP I   + FK+ +EVDA YN+GWW G
Sbjct  248   GKDKYLIEYKNLRTEDDTDFLREEIDIAHLRPCPPEIIMVNSFKLLDEVDALYNDGWWVG  307

Query  749   LISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             +ISKVL    Y VYF  T+EE+ F H  +R H +WI  +W
Sbjct  308   VISKVLADCKYTVYFRDTSEEMTFRHSELRLHHDWIAGEW  347


 Score =   191 bits (485),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/356 (33%), Positives = 178/356 (50%), Gaps = 46/356 (13%)
 Frame = -3

Query  2045  QFNKGDRVEVLMRDN--FPIWFPAAVLRPSVRKNQRAGQIY-VEFETLCSDDDPMKRRKE  1875
              F  G  VEV   D+     W+   +++   R + R+   Y +E+E L SD+      KE
Sbjct  17    HFKNGTVVEVSSDDDGFRGSWYTGKIIK---RASSRSPNKYLIEYEKLFSDESGKNPLKE  73

Query  1874  YVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVES  1695
              + L+ +RP  P E    FR GE  D  Y N GW  G++ E  ++  + V        E 
Sbjct  74    ILDLAQLRPLAPREKKRRFRFGEKVDA-YHNDGWWEGSITEECKDGKFAVFF--RGTREQ  130

Query  1694  VKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKS-----------------------  1584
             +   +  LR+HR+W D  W PPLE+  + ++ ++                          
Sbjct  131   IVFGEEDLRLHREWVDDQWKPPLEDESLKEEKEEANETPLCMLYLEKSILILGGQNLDWM  190

Query  1583  ------EDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLG  1422
                   ED    P+   L +          FSK M +EV  D+EGF+ +W+A+ ++E +G
Sbjct  191   CISRIIEDARKVPT--TLEVNHIEAETEENFSKGMEIEVSSDEEGFQGAWFAATIIEAVG  248

Query  1421  NGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGH  1242
               K L++Y++L+T+D TD+L EE+D + +RPCPPEI  ++ FKLLD+VDA   +GWW G 
Sbjct  249   KDKYLIEYKNLRTEDDTDFLREEIDIAHLRPCPPEIIMVNSFKLLDEVDALYNDGWWVGV  308

Query  1241  VSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVML  1074
             +SKVL D KY V F   +E +TF  S+LR H +W    W+      LP S  D +L
Sbjct  309   ISKVLADCKYTVYFRDTSEEMTFRHSELRLHHDWIAGEWI------LPSSVRDDIL  358



>gb|KCW45884.1| hypothetical protein EUGRSUZ_L00253 [Eucalyptus grandis]
Length=304

 Score =   205 bits (522),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 118/307 (38%), Positives = 173/307 (56%), Gaps = 14/307 (5%)
 Frame = -3

Query  1499  MPVEVKGDKEGFERSWYASVVMEVLGNGK--LLVQYQDLKTDD-GTDYLIEEVDASCIRP  1329
             M VE+    +GF  SWYA+ V+           V+++++  D+ GT  + EEV  S IRP
Sbjct  1     MLVEIASTDDGFRGSWYAATVVRRPSRRSSSYAVEFREIYEDEEGTRRVTEEVAGSQIRP  60

Query  1328  CPPE-IHRISPFKLLDKVDAWVGNGWWEGHV-SKVLGDAKYMVCFGSMNELLTFEASDLR  1155
              PPE  +    F++ D+V+A   +GWWEG V  ++ G  ++ V F    E + FE  DLR
Sbjct  61    VPPEEANPKRDFRVGDEVEARYNDGWWEGVVVDRMRGGRRFGVSFREWRERVVFEVGDLR  120

Query  1154  PHQEWKNNNWVAATKIDLPRSSSDV--MLNskvvkvkskSDRKALGPKFSKGMLVEATSF  981
               +EW   +W       LP   +D          +++ K  +K    +F+KG  VE +S 
Sbjct  121   LRREWVRGSW-------LPPGDADAEDRQQKAQSQMEMKVAKKMKSNEFTKGTPVEVSSD  173

Query  980   EEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRF  801
             E+GY G+W+ AV+ + +   K+L+E++  RT+D +E LKE+ADA +IRPCPP I   D F
Sbjct  174   EDGYRGAWFAAVVVEEVSKGKYLVEFKNFRTEDGAELLKEEADALHIRPCPPEIIVADHF  233

Query  800   KMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
              +F+EVDA +N+ WW G++SKVL    Y VYF  T EE+ F H  +R HQEWI  +W  A
Sbjct  234   NLFDEVDALHNDSWWVGVVSKVLSRSRYTVYFRDTKEELVFQHSNLRLHQEWIGGRWMTA  293

Query  620   FRKSNNN  600
                  NN
Sbjct  294   SLDPKNN  300


 Score =   179 bits (454),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 103/290 (36%), Positives = 152/290 (52%), Gaps = 5/290 (2%)
 Frame = -3

Query  1004  MLVEATSFEEGYHGSWYTAVIFDSIGPNK--FLLEYQTLRTDDE-SEPLKEKADAFNIRP  834
             MLVE  S ++G+ GSWY A +          + +E++ +  D+E +  + E+     IRP
Sbjct  1     MLVEIASTDDGFRGSWYAATVVRRPSRRSSSYAVEFREIYEDEEGTRRVTEEVAGSQIRP  60

Query  833   CPPLIHRFDR-FKMFEEVDAWYNEGWWEGLI-SKVLDGLNYVVYFWTTNEEIEFAHHGIR  660
              PP      R F++ +EV+A YN+GWWEG++  ++  G  + V F    E + F    +R
Sbjct  61    VPPEEANPKRDFRVGDEVEARYNDGWWEGVVVDRMRGGRRFGVSFREWRERVVFEVGDLR  120

Query  659   PHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGS  480
               +EW+   W         +        M            F  G  VEV  DE+G +G+
Sbjct  121   LRREWVRGSWLPPGDADAEDRQQKAQSQMEMKVAKKMKSNEFTKGTPVEVSSDEDGYRGA  180

Query  479   WYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVD  300
             W+ A+++  +  GKYLVEF+  + + G +LL +EADAL +RP  P +   D F   +EVD
Sbjct  181   WFAAVVVEEVSKGKYLVEFKNFRTEDGAELLKEEADALHIRPCPPEIIVADHFNLFDEVD  240

Query  299   AWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             A  N+ W VG V +VL  ++Y V FR T E L F+H  LRLHQEWI G W
Sbjct  241   ALHNDSWWVGVVSKVLSRSRYTVYFRDTKEELVFQHSNLRLHQEWIGGRW  290


 Score =   173 bits (439),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 100/274 (36%), Positives = 149/274 (54%), Gaps = 15/274 (5%)
 Frame = -3

Query  1928  VEFETLCSDDDPMKRRKEYVHLSAVRPAPPGE--PCCYFRVGESADVFYENRGWRRGTVD  1755
             VEF  +  D++  +R  E V  S +RP PP E  P   FRVG+  +  Y +  W    VD
Sbjct  34    VEFREIYEDEEGTRRVTEEVAGSQIRPVPPEEANPKRDFRVGDEVEARYNDGWWEGVVVD  93

Query  1754  EILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDF  1575
              +     + V+    +  E V  E   LR+ R+W  G W+PP      D + +Q+K++  
Sbjct  94    RMRGGRRFGVSF--REWRERVVFEVGDLRLRREWVRGSWLPP---GDADAEDRQQKAQS-  147

Query  1574  LMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQ  1395
                    ++ +K  +     +F+K  PVEV  D++G+  +W+A+VV+E +  GK LV+++
Sbjct  148   -------QMEMKVAKKMKSNEFTKGTPVEVSSDEDGYRGAWFAAVVVEEVSKGKYLVEFK  200

Query  1394  DLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAK  1215
             + +T+DG + L EE DA  IRPCPPEI     F L D+VDA   + WW G VSKVL  ++
Sbjct  201   NFRTEDGAELLKEEADALHIRPCPPEIIVADHFNLFDEVDALHNDSWWVGVVSKVLSRSR  260

Query  1214  YMVCFGSMNELLTFEASDLRPHQEWKNNNWVAAT  1113
             Y V F    E L F+ S+LR HQEW    W+ A+
Sbjct  261   YTVYFRDTKEELVFQHSNLRLHQEWIGGRWMTAS  294



>gb|EYU38408.1| hypothetical protein MIMGU_mgv1a009346mg [Erythranthe guttata]
Length=345

 Score =   206 bits (525),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 132/328 (40%), Positives = 188/328 (57%), Gaps = 32/328 (10%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGN-----GKLLVQYQDLKTDD-GTDYLIEEV  1350
             F K   VE+  D+EGF  S YA  V+   GN      K++V+Y+ L  D  G   L EEV
Sbjct  13    FKKGADVEISSDEEGFRGSLYAGTVIRPPGNLTSRSAKVMVEYKTLMEDKAGKRRLREEV  72

Query  1349  DASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLG-DAKYMVCFGSMNELLTF  1173
             +   +RP PPE +R S FK  D+VDA+  +GWWEG +++V+G D KY V F    E +TF
Sbjct  73    ELVQLRPPPPEENRPS-FKFSDEVDAYYNDGWWEGIITQVVGEDNKYSVFFRGSREQITF  131

Query  1172  EASDLRPHQEWKNNNWV----------AAT---KIDLPRSSSDVMLNskvvkvkskSDRK  1032
             +AS+LR H+EW N  WV          AA    K +  RS + +           +S ++
Sbjct  132   KASNLRLHREWANGMWVPPLEPAEPSPAAAETPKSESRRSKTSIPAAKTPKSEGRRSKKR  191

Query  1031  ALGP-----------KFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTD  885
             +L              F+ G  VE  + EEG+ G+W+ A +  ++   K+L+EYQTLR D
Sbjct  192   SLSNEVEANEEVVERTFNPGEHVEVQNDEEGFEGAWFGATVMKNLKEGKYLVEYQTLRND  251

Query  884   DESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYF  705
             D++  L+E+ D+ +IRP PP +   DRF++ +EVDA  N+GWW G ISKVL    Y VYF
Sbjct  252   DDTNFLREEVDSLHIRPVPPDVELIDRFEVDDEVDASCNDGWWRGTISKVLKNDRYSVYF  311

Query  704   WTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
              T++EE++F H  +R HQEWI+ KW+ A
Sbjct  312   KTSDEELKFNHSDLRVHQEWINGKWNTA  339


 Score =   190 bits (482),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 121/325 (37%), Positives = 182/325 (56%), Gaps = 37/325 (11%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIG-----PNKFLLEYQTLRTDDESEP-LKEKA  855
             F KG  VE +S EEG+ GS Y   +    G       K ++EY+TL  D   +  L+E+ 
Sbjct  13    FKKGADVEISSDEEGFRGSLYAGTVIRPPGNLTSRSAKVMVEYKTLMEDKAGKRRLREEV  72

Query  854   DAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLN-YVVYFWTTNEEIEF  678
             +   +RP PP  +R   FK  +EVDA+YN+GWWEG+I++V+   N Y V+F  + E+I F
Sbjct  73    ELVQLRPPPPEENRPS-FKFSDEVDAYYNDGWWEGIITQVVGEDNKYSVFFRGSREQITF  131

Query  677   AHHGIRPHQEWIDKKW-----------------DIAFRKSNNNLP---NPKPGIMRRHSG  558
                 +R H+EW +  W                     R+S  ++P    PK    R    
Sbjct  132   KASNLRLHREWANGMWVPPLEPAEPSPAAAETPKSESRRSKTSIPAAKTPKSEGRRSKKR  191

Query  557   GIASET---------TFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCD  405
              +++E          TF  G  VEV++DEEG +G+W+ A +++ +  GKYLVE++TL+ D
Sbjct  192   SLSNEVEANEEVVERTFNPGEHVEVQNDEEGFEGAWFGATVMKNLKEGKYLVEYQTLRND  251

Query  404   FGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNF  225
               T+ L +E D+L +RP  P ++ +DRF   +EVDA  N+GW  G + +VL+  +Y V F
Sbjct  252   DDTNFLREEVDSLHIRPVPPDVELIDRFEVDDEVDASCNDGWWRGTISKVLKNDRYSVYF  311

Query  224   RTTNEILEFRHHGLRLHQEWINGAW  150
             +T++E L+F H  LR+HQEWING W
Sbjct  312   KTSDEELKFNHSDLRVHQEWINGKW  336


 Score =   184 bits (466),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 115/312 (37%), Positives = 167/312 (54%), Gaps = 22/312 (7%)
 Frame = -3

Query  1988  FPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCYFRVG  1809
             +   V+RP      R+ ++ VE++TL  D    +R +E V L  +RP PP E    F+  
Sbjct  33    YAGTVIRPPGNLTSRSAKVMVEYKTLMEDKAGKRRLREEVELVQLRPPPPEENRPSFKFS  92

Query  1808  ESADVFYENRGWRRGTVDEIL-ENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVP  1632
             +  D +Y N GW  G + +++ E++ Y V      + E +  +   LR+HR+W +G WVP
Sbjct  93    DEVDAYY-NDGWWEGIITQVVGEDNKYSVFF--RGSREQITFKASNLRLHREWANGMWVP  149

Query  1631  PLE---------ESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCV---------RKFS  1506
             PLE         E+   +  + K S     TP     R K    S           R F+
Sbjct  150   PLEPAEPSPAAAETPKSESRRSKTSIPAAKTPKSEGRRSKKRSLSNEVEANEEVVERTFN  209

Query  1505  KEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPC  1326
                 VEV+ D+EGFE +W+ + VM+ L  GK LV+YQ L+ DD T++L EEVD+  IRP 
Sbjct  210   PGEHVEVQNDEEGFEGAWFGATVMKNLKEGKYLVEYQTLRNDDDTNFLREEVDSLHIRPV  269

Query  1325  PPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQ  1146
             PP++  I  F++ D+VDA   +GWW G +SKVL + +Y V F + +E L F  SDLR HQ
Sbjct  270   PPDVELIDRFEVDDEVDASCNDGWWRGTISKVLKNDRYSVYFKTSDEELKFNHSDLRVHQ  329

Query  1145  EWKNNNWVAATK  1110
             EW N  W  A+K
Sbjct  330   EWINGKWNTASK  341



>ref|XP_010039538.1| PREDICTED: uncharacterized protein LOC104428241 isoform X2 [Eucalyptus 
grandis]
Length=340

 Score =   206 bits (524),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 118/312 (38%), Positives = 174/312 (56%), Gaps = 17/312 (5%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK--LLVQYQDLKTDD-GTDYLIEEVDAS  1341
             F   M VE+    +GF  SWYA+ V+           V+++++  D+ GT  + EEV  S
Sbjct  34    FEVGMLVEIASTDDGFRGSWYAATVVRRPSRRSSSYAVEFREIYEDEEGTRRVTEEVAGS  93

Query  1340  CIRPCPPE-IHRISPFKLLDKVDAWVGNGWWEGHV-SKVLGDAKYMVCFGSMNELLTFEA  1167
              IRP PPE  +    F++ D+V+A   +GWWEG V  ++ G  ++ V F    E + FE 
Sbjct  94    QIRPVPPEEANPKRDFRVGDEVEARYNDGWWEGVVVDRMRGGRRFGVSFREWRERVVFEV  153

Query  1166  SDLRPHQEWKNNNWVA---ATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
              DLR  +EW   +W+    A   D  ++ S + +            +K    +F+KG  V
Sbjct  154   GDLRLRREWVRGSWLPPGDADAEDRQKAQSQMEMKVA---------KKMKSNEFTKGTPV  204

Query  995   EATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIH  816
             E +S E+GY G+W+ AV+ + +   K+L+E++  RT+D +E LKE+ADA +IRPCPP I 
Sbjct  205   EVSSDEDGYRGAWFAAVVVEEVSKGKYLVEFKNFRTEDGAELLKEEADALHIRPCPPEII  264

Query  815   RFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDK  636
               D F +F+EVDA +N+ WW G++SKVL    Y VYF  T EE+ F H  +R HQEWI  
Sbjct  265   VADHFNLFDEVDALHNDSWWVGVVSKVLSRSRYTVYFRDTKEELVFQHSNLRLHQEWIGG  324

Query  635   KWDIAFRKSNNN  600
             +W  A     NN
Sbjct  325   RWMTASLDPKNN  336


 Score =   184 bits (466),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 106/296 (36%), Positives = 160/296 (54%), Gaps = 6/296 (2%)
 Frame = -3

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK--FLLEYQTLRTDDE-SEPLKEKAD  852
             P F  GMLVE  S ++G+ GSWY A +          + +E++ +  D+E +  + E+  
Sbjct  32    PNFEVGMLVEIASTDDGFRGSWYAATVVRRPSRRSSSYAVEFREIYEDEEGTRRVTEEVA  91

Query  851   AFNIRPCPPLIHRFDR-FKMFEEVDAWYNEGWWEGLI-SKVLDGLNYVVYFWTTNEEIEF  678
                IRP PP      R F++ +EV+A YN+GWWEG++  ++  G  + V F    E + F
Sbjct  92    GSQIRPVPPEEANPKRDFRVGDEVEARYNDGWWEGVVVDRMRGGRRFGVSFREWRERVVF  151

Query  677   AHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDE  498
                 +R  +EW+   W         +    +  +  + +  + S   F  G  VEV  DE
Sbjct  152   EVGDLRLRREWVRGSWLPPGDADAEDRQKAQSQMEMKVAKKMKS-NEFTKGTPVEVSSDE  210

Query  497   EGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFR  318
             +G +G+W+ A+++  +  GKYLVEF+  + + G +LL +EADAL +RP  P +   D F 
Sbjct  211   DGYRGAWFAAVVVEEVSKGKYLVEFKNFRTEDGAELLKEEADALHIRPCPPEIIVADHFN  270

Query  317   PLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
               +EVDA  N+ W VG V +VL  ++Y V FR T E L F+H  LRLHQEWI G W
Sbjct  271   LFDEVDALHNDSWWVGVVSKVLSRSRYTVYFRDTKEELVFQHSNLRLHQEWIGGRW  326


 Score =   174 bits (440),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 101/274 (37%), Positives = 146/274 (53%), Gaps = 16/274 (6%)
 Frame = -3

Query  1928  VEFETLCSDDDPMKRRKEYVHLSAVRPAPPGE--PCCYFRVGESADVFYENRGWRRGTVD  1755
             VEF  +  D++  +R  E V  S +RP PP E  P   FRVG+  +  Y +  W    VD
Sbjct  71    VEFREIYEDEEGTRRVTEEVAGSQIRPVPPEEANPKRDFRVGDEVEARYNDGWWEGVVVD  130

Query  1754  EILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDF  1575
              +     + V+    +  E V  E   LR+ R+W  G W+PP +    D+Q  Q + E  
Sbjct  131   RMRGGRRFGVSF--REWRERVVFEVGDLRLRREWVRGSWLPPGDADAEDRQKAQSQME--  186

Query  1574  LMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQ  1395
                       +K  +     +F+K  PVEV  D++G+  +W+A+VV+E +  GK LV+++
Sbjct  187   ----------MKVAKKMKSNEFTKGTPVEVSSDEDGYRGAWFAAVVVEEVSKGKYLVEFK  236

Query  1394  DLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAK  1215
             + +T+DG + L EE DA  IRPCPPEI     F L D+VDA   + WW G VSKVL  ++
Sbjct  237   NFRTEDGAELLKEEADALHIRPCPPEIIVADHFNLFDEVDALHNDSWWVGVVSKVLSRSR  296

Query  1214  YMVCFGSMNELLTFEASDLRPHQEWKNNNWVAAT  1113
             Y V F    E L F+ S+LR HQEW    W+ A+
Sbjct  297   YTVYFRDTKEELVFQHSNLRLHQEWIGGRWMTAS  330



>ref|XP_010039536.1| PREDICTED: uncharacterized protein LOC104428241 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010039537.1| PREDICTED: uncharacterized protein LOC104428241 isoform X1 [Eucalyptus 
grandis]
Length=341

 Score =   206 bits (524),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/309 (38%), Positives = 174/309 (56%), Gaps = 10/309 (3%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK--LLVQYQDLKTDD-GTDYLIEEVDAS  1341
             F   M VE+    +GF  SWYA+ V+           V+++++  D+ GT  + EEV  S
Sbjct  34    FEVGMLVEIASTDDGFRGSWYAATVVRRPSRRSSSYAVEFREIYEDEEGTRRVTEEVAGS  93

Query  1340  CIRPCPPE-IHRISPFKLLDKVDAWVGNGWWEGHV-SKVLGDAKYMVCFGSMNELLTFEA  1167
              IRP PPE  +    F++ D+V+A   +GWWEG V  ++ G  ++ V F    E + FE 
Sbjct  94    QIRPVPPEEANPKRDFRVGDEVEARYNDGWWEGVVVDRMRGGRRFGVSFREWRERVVFEV  153

Query  1166  SDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEAT  987
              DLR  +EW   +W+     D     ++        +++ K  +K    +F+KG  VE +
Sbjct  154   GDLRLRREWVRGSWLPPGDAD-----AEDRQQKAQSQMEMKVAKKMKSNEFTKGTPVEVS  208

Query  986   SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFD  807
             S E+GY G+W+ AV+ + +   K+L+E++  RT+D +E LKE+ADA +IRPCPP I   D
Sbjct  209   SDEDGYRGAWFAAVVVEEVSKGKYLVEFKNFRTEDGAELLKEEADALHIRPCPPEIIVAD  268

Query  806   RFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWD  627
              F +F+EVDA +N+ WW G++SKVL    Y VYF  T EE+ F H  +R HQEWI  +W 
Sbjct  269   HFNLFDEVDALHNDSWWVGVVSKVLSRSRYTVYFRDTKEELVFQHSNLRLHQEWIGGRWM  328

Query  626   IAFRKSNNN  600
              A     NN
Sbjct  329   TASLDPKNN  337


 Score =   186 bits (471),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 106/296 (36%), Positives = 155/296 (52%), Gaps = 5/296 (2%)
 Frame = -3

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK--FLLEYQTLRTDDE-SEPLKEKAD  852
             P F  GMLVE  S ++G+ GSWY A +          + +E++ +  D+E +  + E+  
Sbjct  32    PNFEVGMLVEIASTDDGFRGSWYAATVVRRPSRRSSSYAVEFREIYEDEEGTRRVTEEVA  91

Query  851   AFNIRPCPPLIHRFDR-FKMFEEVDAWYNEGWWEGLI-SKVLDGLNYVVYFWTTNEEIEF  678
                IRP PP      R F++ +EV+A YN+GWWEG++  ++  G  + V F    E + F
Sbjct  92    GSQIRPVPPEEANPKRDFRVGDEVEARYNDGWWEGVVVDRMRGGRRFGVSFREWRERVVF  151

Query  677   AHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDE  498
                 +R  +EW+   W         +        M            F  G  VEV  DE
Sbjct  152   EVGDLRLRREWVRGSWLPPGDADAEDRQQKAQSQMEMKVAKKMKSNEFTKGTPVEVSSDE  211

Query  497   EGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFR  318
             +G +G+W+ A+++  +  GKYLVEF+  + + G +LL +EADAL +RP  P +   D F 
Sbjct  212   DGYRGAWFAAVVVEEVSKGKYLVEFKNFRTEDGAELLKEEADALHIRPCPPEIIVADHFN  271

Query  317   PLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
               +EVDA  N+ W VG V +VL  ++Y V FR T E L F+H  LRLHQEWI G W
Sbjct  272   LFDEVDALHNDSWWVGVVSKVLSRSRYTVYFRDTKEELVFQHSNLRLHQEWIGGRW  327


 Score =   173 bits (439),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/274 (36%), Positives = 149/274 (54%), Gaps = 15/274 (5%)
 Frame = -3

Query  1928  VEFETLCSDDDPMKRRKEYVHLSAVRPAPPGE--PCCYFRVGESADVFYENRGWRRGTVD  1755
             VEF  +  D++  +R  E V  S +RP PP E  P   FRVG+  +  Y +  W    VD
Sbjct  71    VEFREIYEDEEGTRRVTEEVAGSQIRPVPPEEANPKRDFRVGDEVEARYNDGWWEGVVVD  130

Query  1754  EILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDF  1575
              +     + V+    +  E V  E   LR+ R+W  G W+PP      D + +Q+K++  
Sbjct  131   RMRGGRRFGVSF--REWRERVVFEVGDLRLRREWVRGSWLPP---GDADAEDRQQKAQS-  184

Query  1574  LMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQ  1395
                    ++ +K  +     +F+K  PVEV  D++G+  +W+A+VV+E +  GK LV+++
Sbjct  185   -------QMEMKVAKKMKSNEFTKGTPVEVSSDEDGYRGAWFAAVVVEEVSKGKYLVEFK  237

Query  1394  DLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAK  1215
             + +T+DG + L EE DA  IRPCPPEI     F L D+VDA   + WW G VSKVL  ++
Sbjct  238   NFRTEDGAELLKEEADALHIRPCPPEIIVADHFNLFDEVDALHNDSWWVGVVSKVLSRSR  297

Query  1214  YMVCFGSMNELLTFEASDLRPHQEWKNNNWVAAT  1113
             Y V F    E L F+ S+LR HQEW    W+ A+
Sbjct  298   YTVYFRDTKEELVFQHSNLRLHQEWIGGRWMTAS  331



>ref|XP_010247734.1| PREDICTED: uncharacterized protein LOC104590698 [Nelumbo nucifera]
Length=294

 Score =   202 bits (514),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 166/296 (56%), Gaps = 21/296 (7%)
 Frame = -3

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDSIG-----PNKFLLEYQTLRTDDESEPLKEKA  855
             +F +G L+E    ++G+ G+W+ A +  S+      P  ++     ++  D+S+PLKE  
Sbjct  5     QFPRGALIEVCCDDDGFRGAWFEATVLRSVTRRQNKPQLYIEYSHLVQEQDQSKPLKEFV  64

Query  854   DAFNIRPCPPLIHRFD-RFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEF  678
             +  N RP PP     D  FK+ EEVDA++N+ WWEG++++VLD   Y V+F  T E+IEF
Sbjct  65    NVVNARPRPP--RDIDPTFKLSEEVDAFHNDAWWEGIVTQVLDNSRYSVFFRGTKEQIEF  122

Query  677   AHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDE  498
               + +R H+EWID  W+            PK   +   S    SE  +  G  VEV  +E
Sbjct  123   GKNDLRRHREWIDGSWN-----------PPKEVQLNLDSTPSNSEDKYDKGTLVEVSSNE  171

Query  497   EGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFR  318
             EG QG W+ A I++  G  KY VE++TL  D G  L  + AD   +RP  P   +VD F 
Sbjct  172   EGFQGVWFTATIVKASGKNKYTVEYQTLITDKGKPLR-EVADTAHIRPLPP-ETKVDSFG  229

Query  317   PLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
               EEVDA   +GW VG + +V   +KY V FR TNE LEF+H  LR+H +WI+G W
Sbjct  230   RFEEVDALYKDGWWVGVISKVTSRSKYIVYFRNTNEELEFKHSDLRVHYDWIDGKW  285


 Score =   200 bits (509),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 120/306 (39%), Positives = 170/306 (56%), Gaps = 36/306 (12%)
 Frame = -3

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVMEVL----GNGKLLVQYQDL-KTDDGTDYLIEEV  1350
             +F +   +EV  D +GF  +W+ + V+  +       +L ++Y  L +  D +  L E V
Sbjct  5     QFPRGALIEVCCDDDGFRGAWFEATVLRSVTRRQNKPQLYIEYSHLVQEQDQSKPLKEFV  64

Query  1349  DASCIRPCPPEIHRISP-FKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTF  1173
             +    RP PP    I P FKL ++VDA+  + WWEG V++VL +++Y V F    E + F
Sbjct  65    NVVNARPRPP--RDIDPTFKLSEEVDAFHNDAWWEGIVTQVLDNSRYSVFFRGTKEQIEF  122

Query  1172  EASDLRPHQEWKNNNWVAATKIDL-----PRSSSDVMLNskvvkvkskSDRKALGPKFSK  1008
               +DLR H+EW + +W    ++ L     P +S D                     K+ K
Sbjct  123   GKNDLRRHREWIDGSWNPPKEVQLNLDSTPSNSED---------------------KYDK  161

Query  1007  GMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCP  828
             G LVE +S EEG+ G W+TA I  + G NK+ +EYQTL TD + +PL+E AD  +IRP P
Sbjct  162   GTLVEVSSNEEGFQGVWFTATIVKASGKNKYTVEYQTLITD-KGKPLREVADTAHIRPLP  220

Query  827   PLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQE  648
             P   + D F  FEEVDA Y +GWW G+ISKV     Y+VYF  TNEE+EF H  +R H +
Sbjct  221   PET-KVDSFGRFEEVDALYKDGWWVGVISKVTSRSKYIVYFRNTNEELEFKHSDLRVHYD  279

Query  647   WIDKKW  630
             WID KW
Sbjct  280   WIDGKW  285


 Score =   182 bits (462),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 116/318 (36%), Positives = 166/318 (52%), Gaps = 32/318 (10%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDN--FPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRR  1881
             AE QF +G  +EV   D+     WF A VLR SV + Q   Q+Y+E+  L  + D  K  
Sbjct  2     AETQFPRGALIEVCCDDDGFRGAWFEATVLR-SVTRRQNKPQLYIEYSHLVQEQDQSKPL  60

Query  1880  KEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVAL-GDEDA  1704
             KE+V++   RP PP +    F++ E  D F+ N  W  G V ++L+NS Y V   G ++ 
Sbjct  61    KEFVNVVNARPRPPRDIDPTFKLSEEVDAFH-NDAWWEGIVTQVLDNSRYSVFFRGTKEQ  119

Query  1703  VESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGS  1524
             +E  K +   LR HR+W DG W PP E                      V+L +  T  +
Sbjct  120   IEFGKND---LRRHREWIDGSWNPPKE----------------------VQLNLDSTPSN  154

Query  1523  CVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDA  1344
                K+ K   VEV  ++EGF+  W+ + +++  G  K  V+YQ L TD G   L E  D 
Sbjct  155   SEDKYDKGTLVEVSSNEEGFQGVWFTATIVKASGKNKYTVEYQTLITDKGKP-LREVADT  213

Query  1343  SCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEAS  1164
             + IRP PPE  ++  F   ++VDA   +GWW G +SKV   +KY+V F + NE L F+ S
Sbjct  214   AHIRPLPPET-KVDSFGRFEEVDALYKDGWWVGVISKVTSRSKYIVYFRNTNEELEFKHS  272

Query  1163  DLRPHQEWKNNNWVAATK  1110
             DLR H +W +  WV A+K
Sbjct  273   DLRVHYDWIDGKWVRASK  290


 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 81/139 (58%), Gaps = 8/139 (6%)
 Frame = -3

Query  548  SETTFCIGAKVEVKDDEEGNQGSWYPALILRLI----GNGKYLVEFRTLKCDFGTDLLVQ  381
            +ET F  GA +EV  D++G +G+W+ A +LR +       +  +E+  L  +      ++
Sbjct  2    AETQFPRGALIEVCCDDDGFRGAWFEATVLRSVTRRQNKPQLYIEYSHLVQEQDQSKPLK  61

Query  380  E-ADALSVRPSAPILQRVD-RFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEI  207
            E  + ++ RP  P  + +D  F+  EEVDA+ N+ W  G V +VL+ ++Y V FR T E 
Sbjct  62   EFVNVVNARPRPP--RDIDPTFKLSEEVDAFHNDAWWEGIVTQVLDNSRYSVFFRGTKEQ  119

Query  206  LEFRHHGLRLHQEWINGAW  150
            +EF  + LR H+EWI+G+W
Sbjct  120  IEFGKNDLRRHREWIDGSW  138



>ref|XP_003555795.1| PREDICTED: uncharacterized protein LOC100805605 [Glycine max]
Length=323

 Score =   201 bits (511),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/296 (39%), Positives = 169/296 (57%), Gaps = 5/296 (2%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEV-DASCI  1335
             F     VEV  + +GF  SW+   V+  L + + LV+Y +L  DD T   + EV     +
Sbjct  22    FKPGTAVEVSSEDDGFRGSWFTGTVIRRLASERFLVEYDNLLADDKTTKKLREVLGLRHL  81

Query  1334  RPCPP-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDL  1158
             RP PP E  R   FK  D+VDA+  +GWWEGH+++ L + ++ V F    E L F    L
Sbjct  82    RPLPPTETDR--EFKFGDEVDAFHNDGWWEGHITQELENERFAVYFRVSKEQLVFSKEQL  139

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFE  978
             R H+EW N++WV   +    R   +      ++    KS     G     G +VE +S E
Sbjct  140   RLHREWLNHDWVPPLQQKQQRQQGNGESKKVLLTPNVKSVETVKGKGIGVGAIVEVSSDE  199

Query  977   EGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFK  798
             +G+ G+W+ A + +++G +KFL+EY  L  DD+S+ L+E+ DA +IRP P       +F 
Sbjct  200   DGFSGAWFAATVVEALGKDKFLVEYHDLLADDDSQ-LREEIDALHIRPHPLDTDVDGQFS  258

Query  797   MFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             + +EVDA+YN+GWW G+ISK L    YVVYF ++NEE+EF +  +R HQ+WI  KW
Sbjct  259   ILDEVDAFYNDGWWVGVISKALADSRYVVYFRSSNEELEFENSQLRLHQDWIGGKW  314


 Score =   188 bits (478),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 113/303 (37%), Positives = 171/303 (56%), Gaps = 24/303 (8%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDES-EPLKEKADAFNI  840
             F  G  VE +S ++G+ GSW+T  +   +   +FL+EY  L  DD++ + L+E     ++
Sbjct  22    FKPGTAVEVSSEDDGFRGSWFTGTVIRRLASERFLVEYDNLLADDKTTKKLREVLGLRHL  81

Query  839   RPCPPLIHRFDR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGI  663
             RP PP     DR FK  +EVDA++N+GWWEG I++ L+   + VYF  + E++ F+   +
Sbjct  82    RPLPPT--ETDREFKFGDEVDAFHNDGWWEGHITQELENERFAVYFRVSKEQLVFSKEQL  139

Query  662   RPHQEWIDKKW----------DIAFRKSNNNLPNPKPGIMRRHSG-GIASETTFCIGAKV  516
             R H+EW++  W               +S   L  P    +    G GI       +GA V
Sbjct  140   RLHREWLNHDWVPPLQQKQQRQQGNGESKKVLLTPNVKSVETVKGKGIG------VGAIV  193

Query  515   EVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQ  336
             EV  DE+G  G+W+ A ++  +G  K+LVE+  L  D  + L  +E DAL +RP  P+  
Sbjct  194   EVSSDEDGFSGAWFAATVVEALGKDKFLVEYHDLLADDDSQLR-EEIDALHIRPH-PLDT  251

Query  335   RVD-RFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWIN  159
              VD +F  L+EVDA+ N+GW VG + + L  ++Y V FR++NE LEF +  LRLHQ+WI 
Sbjct  252   DVDGQFSILDEVDAFYNDGWWVGVISKALADSRYVVYFRSSNEELEFENSQLRLHQDWIG  311

Query  158   GAW  150
             G W
Sbjct  312   GKW  314


 Score =   180 bits (457),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 116/313 (37%), Positives = 167/313 (53%), Gaps = 17/313 (5%)
 Frame = -3

Query  2042  FNKGDRVEVLMRDNF--PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYV  1869
             F  G  VEV   D+     WF   V+R    +     +  VE++ L +DD   K+ +E +
Sbjct  22    FKPGTAVEVSSEDDGFRGSWFTGTVIRRLASE-----RFLVEYDNLLADDKTTKKLREVL  76

Query  1868  HLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVK  1689
              L  +RP PP E    F+ G+  D F+ N GW  G + + LEN  + V      + E + 
Sbjct  77    GLRHLRPLPPTETDREFKFGDEVDAFH-NDGWWEGHITQELENERFAVYF--RVSKEQLV  133

Query  1688  VEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKF  1509
               + QLR+HR+W +  WVPPL++ Q  +Q    +S+  L+TP+   +     +G  V   
Sbjct  134   FSKEQLRLHREWLNHDWVPPLQQKQQ-RQQGNGESKKVLLTPNVKSVETVKGKGIGVGAI  192

Query  1508  SKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRP  1329
                  VEV  D++GF  +W+A+ V+E LG  K LV+Y DL  DD +  L EE+DA  IRP
Sbjct  193   -----VEVSSDEDGFSGAWFAATVVEALGKDKFLVEYHDLLADDDSQ-LREEIDALHIRP  246

Query  1328  CPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPH  1149
              P +      F +LD+VDA+  +GWW G +SK L D++Y+V F S NE L FE S LR H
Sbjct  247   HPLDTDVDGQFSILDEVDAFYNDGWWVGVISKALADSRYVVYFRSSNEELEFENSQLRLH  306

Query  1148  QEWKNNNWVAATK  1110
             Q+W    WV   K
Sbjct  307   QDWIGGKWVMPCK  319



>ref|XP_004230328.1| PREDICTED: uncharacterized protein LOC101255538 [Solanum lycopersicum]
Length=327

 Score =   201 bits (510),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/312 (37%), Positives = 175/312 (56%), Gaps = 20/312 (6%)
 Frame = -3

Query  1028  LGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPN------------------KFLLEY  903
             L   F+ G  VE +S E+G+ G+WY  ++   I                     + L+EY
Sbjct  8     LNTYFTNGAEVEISSDEDGFRGAWYEGIVVRPIQKKQRRNKDEDDDDDESSNKLRVLVEY  67

Query  902   QTLRTDDESE-PLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDG  726
             +TL  D + + PLKE      +RP PP   R  +F++ +EVDA+YN+GWWEG++ ++   
Sbjct  68    KTLMADKKGKRPLKEAMTLVQLRPRPPPERR-RKFEVSDEVDAYYNDGWWEGVVMELSGD  126

Query  725   LNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIAS  546
               Y V+F  T +++EF    IR H+EW + KW  +F        + K  +         +
Sbjct  127   GKYSVFFRGTRDQLEFEESQIRIHREWANGKWTPSFGDEGEEKQDEKELVSTETKPNNKA  186

Query  545   ETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADAL  366
                F  G+ VEV  DEEG +G+W+ A I++L+ NG YL+E++ L+ +  T  L +E D L
Sbjct  187   AEFFSKGSLVEVSSDEEGFEGAWFVATIVKLLDNGNYLIEYQNLRNNDDTAFLQEETDRL  246

Query  365   SVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHG  186
              +RPS P +   + F+ LEEVDA  N+GW VG + +VL+G +Y+V F+ +NE LEF+H  
Sbjct  247   HIRPSPPDVGSFESFKVLEEVDALHNDGWWVGVISKVLKGQRYKVYFKASNEELEFKHAD  306

Query  185   LRLHQEWINGAW  150
             +RLH +W NG W
Sbjct  307   VRLHLDWTNGKW  318


 Score =   194 bits (492),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 113/312 (36%), Positives = 167/312 (54%), Gaps = 23/312 (7%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNG------------------KLLVQYQDLK  1386
             F+    VE+  D++GF  +WY  +V+  +                     ++LV+Y+ L 
Sbjct  12    FTNGAEVEISSDEDGFRGAWYEGIVVRPIQKKQRRNKDEDDDDDESSNKLRVLVEYKTLM  71

Query  1385  TDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMV  1206
              D      ++E          P   R   F++ D+VDA+  +GWWEG V ++ GD KY V
Sbjct  72    ADKKGKRPLKEAMTLVQLRPRPPPERRRKFEVSDEVDAYYNDGWWEGVVMELSGDGKYSV  131

Query  1205  CFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKAL  1026
              F    + L FE S +R H+EW N  W  +   +      +  L    V  ++K + KA 
Sbjct  132   FFRGTRDQLEFEESQIRIHREWANGKWTPSFGDEGEEKQDEKEL----VSTETKPNNKA-  186

Query  1025  GPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAF  846
                FSKG LVE +S EEG+ G+W+ A I   +    +L+EYQ LR +D++  L+E+ D  
Sbjct  187   AEFFSKGSLVEVSSDEEGFEGAWFVATIVKLLDNGNYLIEYQNLRNNDDTAFLQEETDRL  246

Query  845   NIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHG  666
             +IRP PP +  F+ FK+ EEVDA +N+GWW G+ISKVL G  Y VYF  +NEE+EF H  
Sbjct  247   HIRPSPPDVGSFESFKVLEEVDALHNDGWWVGVISKVLKGQRYKVYFKASNEELEFKHAD  306

Query  665   IRPHQEWIDKKW  630
             +R H +W + KW
Sbjct  307   VRLHLDWTNGKW  318


 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 113/337 (34%), Positives = 172/337 (51%), Gaps = 31/337 (9%)
 Frame = -3

Query  2072  ETHAMSAEAQFNKGDRVEVLM-RDNF-PIWFPAAVLRPSVRKNQRAG-------------  1938
             ET        F  G  VE+    D F   W+   V+RP  +K +R               
Sbjct  2     ETETEMLNTYFTNGAEVEISSDEDGFRGAWYEGIVVRPIQKKQRRNKDEDDDDDESSNKL  61

Query  1937  QIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTV  1758
             ++ VE++TL +D    +  KE + L  +RP PP E    F V +  D +Y N GW  G V
Sbjct  62    RVLVEYKTLMADKKGKRPLKEAMTLVQLRPRPPPERRRKFEVSDEVDAYY-NDGWWEGVV  120

Query  1757  DEILENSMYMVAL-GDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSE  1581
              E+  +  Y V   G  D +E    E+ Q+R+HR+W +G W P   +     + ++K+ E
Sbjct  121   MELSGDGKYSVFFRGTRDQLE---FEESQIRIHREWANGKWTPSFGD-----EGEEKQDE  172

Query  1580  DFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQ  1401
               L++                  FSK   VEV  D+EGFE +W+ + ++++L NG  L++
Sbjct  173   KELVSTE------TKPNNKAAEFFSKGSLVEVSSDEEGFEGAWFVATIVKLLDNGNYLIE  226

Query  1400  YQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGD  1221
             YQ+L+ +D T +L EE D   IRP PP++     FK+L++VDA   +GWW G +SKVL  
Sbjct  227   YQNLRNNDDTAFLQEETDRLHIRPSPPDVGSFESFKVLEEVDALHNDGWWVGVISKVLKG  286

Query  1220  AKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
              +Y V F + NE L F+ +D+R H +W N  WV A++
Sbjct  287   QRYKVYFKASNEELEFKHADVRLHLDWTNGKWVRASQ  323



>gb|KHN02811.1| hypothetical protein glysoja_043259 [Glycine soja]
Length=351

 Score =   201 bits (510),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 114/296 (39%), Positives = 169/296 (57%), Gaps = 5/296 (2%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEV-DASCI  1335
             F     VEV  + +GF  SW+   V+  L + + LV+Y +L  DD T   + EV     +
Sbjct  22    FKPGTAVEVSSEDDGFRGSWFTGTVIRRLASERFLVEYDNLLADDKTTKKLREVLGLRHL  81

Query  1334  RPCPP-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDL  1158
             RP PP E  R   FK  D+VDA+  +GWWEGH+++ L + ++ V F    E L F    L
Sbjct  82    RPLPPTETDR--EFKFGDEVDAFHNDGWWEGHITQELENERFAVYFRVSKEQLVFSKEQL  139

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFE  978
             R H+EW N++WV   +    R   +      ++    KS     G     G +VE +S E
Sbjct  140   RLHREWLNHDWVPPLQQQQQRQQGNGESKKVLLTPNVKSVETVKGKGIGVGAIVEVSSDE  199

Query  977   EGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFK  798
             +G+ G+W+ A + +++G +KFL+EY  L  DD+S+ L+E+ DA +IRP P       +F 
Sbjct  200   DGFSGAWFAATVVEALGKDKFLVEYHDLLADDDSQ-LREEIDALHIRPHPLDTDVDGQFS  258

Query  797   MFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             + +EVDA+YN+GWW G+ISK L    YVVYF ++NEE+EF +  +R HQ+WI  KW
Sbjct  259   ILDEVDAFYNDGWWVGVISKALADSRYVVYFRSSNEELEFENSQLRLHQDWIGGKW  314


 Score =   188 bits (477),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 113/303 (37%), Positives = 171/303 (56%), Gaps = 24/303 (8%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDES-EPLKEKADAFNI  840
             F  G  VE +S ++G+ GSW+T  +   +   +FL+EY  L  DD++ + L+E     ++
Sbjct  22    FKPGTAVEVSSEDDGFRGSWFTGTVIRRLASERFLVEYDNLLADDKTTKKLREVLGLRHL  81

Query  839   RPCPPLIHRFDR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGI  663
             RP PP     DR FK  +EVDA++N+GWWEG I++ L+   + VYF  + E++ F+   +
Sbjct  82    RPLPPT--ETDREFKFGDEVDAFHNDGWWEGHITQELENERFAVYFRVSKEQLVFSKEQL  139

Query  662   RPHQEWIDKKW----------DIAFRKSNNNLPNPKPGIMRRHSG-GIASETTFCIGAKV  516
             R H+EW++  W               +S   L  P    +    G GI       +GA V
Sbjct  140   RLHREWLNHDWVPPLQQQQQRQQGNGESKKVLLTPNVKSVETVKGKGIG------VGAIV  193

Query  515   EVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQ  336
             EV  DE+G  G+W+ A ++  +G  K+LVE+  L  D  + L  +E DAL +RP  P+  
Sbjct  194   EVSSDEDGFSGAWFAATVVEALGKDKFLVEYHDLLADDDSQLR-EEIDALHIRPH-PLDT  251

Query  335   RVD-RFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWIN  159
              VD +F  L+EVDA+ N+GW VG + + L  ++Y V FR++NE LEF +  LRLHQ+WI 
Sbjct  252   DVDGQFSILDEVDAFYNDGWWVGVISKALADSRYVVYFRSSNEELEFENSQLRLHQDWIG  311

Query  158   GAW  150
             G W
Sbjct  312   GKW  314


 Score =   181 bits (459),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 116/316 (37%), Positives = 169/316 (53%), Gaps = 17/316 (5%)
 Frame = -3

Query  2042  FNKGDRVEVLMRDNF--PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYV  1869
             F  G  VEV   D+     WF   V+R    +     +  VE++ L +DD   K+ +E +
Sbjct  22    FKPGTAVEVSSEDDGFRGSWFTGTVIRRLASE-----RFLVEYDNLLADDKTTKKLREVL  76

Query  1868  HLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVK  1689
              L  +RP PP E    F+ G+  D F+ N GW  G + + LEN  + V      + E + 
Sbjct  77    GLRHLRPLPPTETDREFKFGDEVDAFH-NDGWWEGHITQELENERFAVYF--RVSKEQLV  133

Query  1688  VEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKF  1509
               + QLR+HR+W +  WVPPL++ Q  +Q    +S+  L+TP+   +     +G  V   
Sbjct  134   FSKEQLRLHREWLNHDWVPPLQQQQQ-RQQGNGESKKVLLTPNVKSVETVKGKGIGVGAI  192

Query  1508  SKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRP  1329
                  VEV  D++GF  +W+A+ V+E LG  K LV+Y DL  DD +  L EE+DA  IRP
Sbjct  193   -----VEVSSDEDGFSGAWFAATVVEALGKDKFLVEYHDLLADDDSQ-LREEIDALHIRP  246

Query  1328  CPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPH  1149
              P +      F +LD+VDA+  +GWW G +SK L D++Y+V F S NE L FE S LR H
Sbjct  247   HPLDTDVDGQFSILDEVDAFYNDGWWVGVISKALADSRYVVYFRSSNEELEFENSQLRLH  306

Query  1148  QEWKNNNWVAATKIDL  1101
             Q+W    WV   K++ 
Sbjct  307   QDWIGGKWVMPCKVEF  322



>ref|XP_009595575.1| PREDICTED: uncharacterized protein LOC104091847 [Nicotiana tomentosiformis]
Length=330

 Score =   198 bits (504),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 118/313 (38%), Positives = 170/313 (54%), Gaps = 22/313 (7%)
 Frame = -3

Query  1028  LGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPN------------KFLLEYQTLRTD  885
             L   F+ G  VE +S EEG+ G+WY   +   I               + L+EY+TL  D
Sbjct  11    LNTYFTNGAEVEVSSDEEGFRGAWYEGTVIRPISKKLRRNDDEDDKKLRVLVEYKTLMAD  70

Query  884   DESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLN---YV  714
              +     ++  +       P   R  RF + EEVDA++NEGWWEG++ +VL G     Y 
Sbjct  71    KKGTRRLQETLSLVQLRPRPPRERRRRFNVSEEVDAYHNEGWWEGVVMEVLGGSGGRRYS  130

Query  713   VYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMR-----RHSGGIA  549
             V+F  T ++++F    +R H+EW + KW     +        +          + S G A
Sbjct  131   VFFRGTRDQLDFDESQLRTHREWANGKWTPPLEQGEEEEDEDEVEETLASTDIKPSNGAA  190

Query  548   SETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADA  369
                 F  G+ VEV  DEEG +G+W+ A +++L+ NG YL+E++ L+ D  T  L +EAD 
Sbjct  191   E--NFSEGSLVEVSSDEEGFEGAWFAATVVKLLDNGNYLIEYQNLRNDDDTAFLQEEADR  248

Query  368   LSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHH  189
             L VRP  P +  V  F+ LE+VDA  N+GW VG V +VL+G +YRV+FR  NE LEF+H 
Sbjct  249   LYVRPRPPDIGSVKSFKVLEKVDALYNDGWWVGVVSKVLKGQRYRVHFRGNNEELEFKHA  308

Query  188   GLRLHQEWINGAW  150
              LRLH +WING W
Sbjct  309   DLRLHLDWINGKW  321


 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 115/305 (38%), Positives = 169/305 (55%), Gaps = 23/305 (8%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAG-------QIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGE  1833
             W+   V+RP  +K +R         ++ VE++TL +D    +R +E + L  +RP PP E
Sbjct  34    WYEGTVIRPISKKLRRNDDEDDKKLRVLVEYKTLMADKKGTRRLQETLSLVQLRPRPPRE  93

Query  1832  PCCYFRVGESADVFYENRGWRRGTVDEILENS---MYMVAL-GDEDAVESVKVEQWQLRV  1665
                 F V E  D  Y N GW  G V E+L  S    Y V   G  D ++    ++ QLR 
Sbjct  94    RRRRFNVSEEVDA-YHNEGWWEGVVMEVLGGSGGRRYSVFFRGTRDQLD---FDESQLRT  149

Query  1664  HRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEV  1485
             HR+W +G W PPLE+ + ++   + +        +     IK + G+    FS+   VEV
Sbjct  150   HREWANGKWTPPLEQGEEEEDEDEVEE-------TLASTDIKPSNGAA-ENFSEGSLVEV  201

Query  1484  KGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRI  1305
               D+EGFE +W+A+ V+++L NG  L++YQ+L+ DD T +L EE D   +RP PP+I  +
Sbjct  202   SSDEEGFEGAWFAATVVKLLDNGNYLIEYQNLRNDDDTAFLQEEADRLYVRPRPPDIGSV  261

Query  1304  SPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNW  1125
               FK+L+KVDA   +GWW G VSKVL   +Y V F   NE L F+ +DLR H +W N  W
Sbjct  262   KSFKVLEKVDALYNDGWWVGVVSKVLKGQRYRVHFRGNNEELEFKHADLRLHLDWINGKW  321

Query  1124  VAATK  1110
             V A++
Sbjct  322   VTASQ  326



>ref|XP_009779475.1| PREDICTED: uncharacterized protein LOC104228663 [Nicotiana sylvestris]
Length=327

 Score =   194 bits (494),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/311 (39%), Positives = 172/311 (55%), Gaps = 20/311 (6%)
 Frame = -3

Query  1028  LGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPN------------KFLLEYQTLRTD  885
             L   F+ G  VE +S EEG+ G+WY   +   I               + L+EY+TL  D
Sbjct  11    LNTYFTNGAEVEVSSDEEGFRGAWYEGTVIRPISKKLRRNDDEDDKKLRVLVEYKTLMAD  70

Query  884   DE-SEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLD---GLNY  717
              + +  LKE      +RP PP   R   F + EEVDA++NEGWWEG++ +VL    G  Y
Sbjct  71    KKGTRRLKETLSLVQLRPRPPPERRR-IFNVSEEVDAYHNEGWWEGVVMEVLGDSGGRKY  129

Query  716   VVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRR--HSGGIASE  543
              V+F  T ++++F    +R H+EW + KW     +   +    +  +          A+E
Sbjct  130   SVFFRGTRDQLDFDESQLRTHREWANGKWTPPLEQGEEDEDEVEETLASTDIKPSNDAAE  189

Query  542   TTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALS  363
               F  G+ VEV  DEEG +G+W+ A +++L+ NG YL+E++ L+ D  T  L +EAD L 
Sbjct  190   N-FSEGSLVEVSSDEEGFEGAWFTATVVKLLDNGNYLIEYQNLRNDDDTAFLQEEADRLY  248

Query  362   VRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGL  183
             VRP  P +     F+ LEEVDA  N+GW VG V +VL+G +YRV F+  NE LEF H  L
Sbjct  249   VRPRPPDIGPFKSFKVLEEVDALYNDGWWVGVVSKVLKGQRYRVQFKGNNEELEFNHADL  308

Query  182   RLHQEWINGAW  150
             RLH +WING W
Sbjct  309   RLHLDWINGKW  319


 Score =   192 bits (487),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 114/309 (37%), Positives = 160/309 (52%), Gaps = 19/309 (6%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNG------------KLLVQYQDLKTDDGTD  1368
             F+    VEV  D+EGF  +WY   V+  +               ++LV+Y+ L  D    
Sbjct  15    FTNGAEVEVSSDEEGFRGAWYEGTVIRPISKKLRRNDDEDDKKLRVLVEYKTLMADKKGT  74

Query  1367  YLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDA---KYMVCFG  1197
               ++E  +       P   R   F + ++VDA+   GWWEG V +VLGD+   KY V F 
Sbjct  75    RRLKETLSLVQLRPRPPPERRRIFNVSEEVDAYHNEGWWEGVVMEVLGDSGGRKYSVFFR  134

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPK  1017
                + L F+ S LR H+EW N  W       L +   D     + +              
Sbjct  135   GTRDQLDFDESQLRTHREWANGKWTPP----LEQGEEDEDEVEETLASTDIKPSNDAAEN  190

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             FS+G LVE +S EEG+ G+W+TA +   +    +L+EYQ LR DD++  L+E+AD   +R
Sbjct  191   FSEGSLVEVSSDEEGFEGAWFTATVVKLLDNGNYLIEYQNLRNDDDTAFLQEEADRLYVR  250

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             P PP I  F  FK+ EEVDA YN+GWW G++SKVL G  Y V F   NEE+EF H  +R 
Sbjct  251   PRPPDIGPFKSFKVLEEVDALYNDGWWVGVVSKVLKGQRYRVQFKGNNEELEFNHADLRL  310

Query  656   HQEWIDKKW  630
             H +WI+ KW
Sbjct  311   HLDWINGKW  319


 Score =   176 bits (446),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 113/305 (37%), Positives = 163/305 (53%), Gaps = 25/305 (8%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAG-------QIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGE  1833
             W+   V+RP  +K +R         ++ VE++TL +D    +R KE + L  +RP PP E
Sbjct  34    WYEGTVIRPISKKLRRNDDEDDKKLRVLVEYKTLMADKKGTRRLKETLSLVQLRPRPPPE  93

Query  1832  PCCYFRVGESADVFYENRGWRRGTVDEILENS---MYMVAL-GDEDAVESVKVEQWQLRV  1665
                 F V E  D  Y N GW  G V E+L +S    Y V   G  D ++    ++ QLR 
Sbjct  94    RRRIFNVSEEVDA-YHNEGWWEGVVMEVLGDSGGRKYSVFFRGTRDQLD---FDESQLRT  149

Query  1664  HRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEV  1485
             HR+W +G W PPLE+ + D+   ++      + PS                FS+   VEV
Sbjct  150   HREWANGKWTPPLEQGEEDEDEVEETLASTDIKPSN----------DAAENFSEGSLVEV  199

Query  1484  KGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRI  1305
               D+EGFE +W+ + V+++L NG  L++YQ+L+ DD T +L EE D   +RP PP+I   
Sbjct  200   SSDEEGFEGAWFTATVVKLLDNGNYLIEYQNLRNDDDTAFLQEEADRLYVRPRPPDIGPF  259

Query  1304  SPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNW  1125
               FK+L++VDA   +GWW G VSKVL   +Y V F   NE L F  +DLR H +W N  W
Sbjct  260   KSFKVLEEVDALYNDGWWVGVVSKVLKGQRYRVQFKGNNEELEFNHADLRLHLDWINGKW  319

Query  1124  VAATK  1110
             V  ++
Sbjct  320   VTPSQ  324



>gb|ACR38755.1| unknown [Zea mays]
 gb|AFW82727.1| LOW QUALITY PROTEIN: RNA binding protein [Zea mays]
Length=443

 Score =   197 bits (500),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 137/462 (30%), Positives = 222/462 (48%), Gaps = 52/462 (11%)
 Frame = -3

Query  1517  RKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK-LLVQYQDLKTDDGTDYLIEEV---  1350
             + F+   PVEV  D+ G   + +A+VV+      +   V+Y  L   +G+D  + E    
Sbjct  19    KGFNPGDPVEVVPDEAGLHGAHFAAVVVGPSAKPRGYTVEYDSLLESEGSDRPLREALPA  78

Query  1349  -DASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEG-HVSKVLGDAKYMVCFGSMNELLT  1176
                    P PP     +P      VDA + + WW G  +++    +K  VCF    E++ 
Sbjct  79    RSLRPRPPPPPAPASEAPPAEHAAVDALIDDAWWLGVALARAGAPSKVRVCFPETREVME  138

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
             F+A+D+RPH EW +  W +   +++P++                         ++KGM +
Sbjct  139   FDAADVRPHLEWVDGEWRSPDNMEIPKTMP-----------------------YAKGMQI  175

Query  995   EATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIH  816
             E +  E+    +W  AV+  +I  N  L++Y TL     +   +E  D  ++RPCPP   
Sbjct  176   EVSKLEDNSVVAWSPAVVAKTIWKNNLLVDY-TLSKCYGTTLSEEIVDVKHVRPCPPQAS  234

Query  815   RFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDK  636
                 F + +EV+A+  + WW G+I+ VL    Y         E+E     +R   +W+  
Sbjct  235   EIS-FCINDEVEAFQGDCWWLGVITNVLPEFKYTFKSTHLGTEVEVNQKFLRLRYDWVGD  293

Query  635   KWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILR  456
             +W+    + + N+P  K                F  G KVEV  D+EG +G+W+ A +++
Sbjct  294   QWE----QESKNVPKAK----------------FTQGVKVEVCSDDEGFRGAWFEATVVK  333

Query  455   LIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWR  276
              +G+ K+LVE+ TLK D GT  L +  +A  +RP  P +   D F+ L+EVDA+ N+ W 
Sbjct  334   AVGS-KFLVEYATLKADDGTKPLKESVEARHIRPCPPDIPATDGFKLLDEVDAFCNDAWW  392

Query  275   VGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             VG V +VL   +  V FR   E +EF H  LRLH +W+ G W
Sbjct  393   VGVVSKVLGEKRCTVYFRPWKEEMEFEHAQLRLHCDWMGGRW  434


 Score =   172 bits (437),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/391 (30%), Positives = 189/391 (48%), Gaps = 69/391 (18%)
 Frame = -3

Query  1766  GTVDEILENSMYM-VALGDEDAVESVKV-----------EQWQLRVHRDWKDGCWVPPLE  1623
               VD +++++ ++ VAL    A   V+V           +   +R H +W DG W     
Sbjct  101   AAVDALIDDAWWLGVALARAGAPSKVRVCFPETREVMEFDAADVRPHLEWVDGEW-----  155

Query  1622  ESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYAS  1443
                        +S D +  P  +              ++K M +EV   ++    +W  +
Sbjct  156   -----------RSPDNMEIPKTMP-------------YAKGMQIEVSKLEDNSVVAWSPA  191

Query  1442  VVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVG  1263
             VV + +    LLV Y  L    GT    E VD   +RPCPP+   IS F + D+V+A+ G
Sbjct  192   VVAKTIWKNNLLVDYT-LSKCYGTTLSEEIVDVKHVRPCPPQASEIS-FCINDEVEAFQG  249

Query  1262  NGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSD  1083
             + WW G ++ VL + KY      +   +      LR   +W  + W   +K ++P++   
Sbjct  250   DCWWLGVITNVLPEFKYTFKSTHLGTEVEVNQKFLRLRYDWVGDQWEQESK-NVPKA---  305

Query  1082  VMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEY  903
                                  KF++G+ VE  S +EG+ G+W+ A +  ++G +KFL+EY
Sbjct  306   ---------------------KFTQGVKVEVCSDDEGFRGAWFEATVVKAVG-SKFLVEY  343

Query  902   QTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGL  723
              TL+ DD ++PLKE  +A +IRPCPP I   D FK+ +EVDA+ N+ WW G++SKVL   
Sbjct  344   ATLKADDGTKPLKESVEARHIRPCPPDIPATDGFKLLDEVDAFCNDAWWVGVVSKVLGEK  403

Query  722   NYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
                VYF    EE+EF H  +R H +W+  +W
Sbjct  404   RCTVYFRPWKEEMEFEHAQLRLHCDWMGGRW  434


 Score =   127 bits (320),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 100/325 (31%), Positives = 152/325 (47%), Gaps = 48/325 (15%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVL-MRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDD  1899
             P+   +     + KG ++EV  + DN  + +  AV+  ++ KN     + V++    S  
Sbjct  158   PDNMEIPKTMPYAKGMQIEVSKLEDNSVVAWSPAVVAKTIWKNN----LLVDY--TLSKC  211

Query  1898  DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYM---  1728
                   +E V +  VRP PP      F + +  + F +   W  G +  +L    Y    
Sbjct  212   YGTTLSEEIVDVKHVRPCPPQASEISFCINDEVEAF-QGDCWWLGVITNVLPEFKYTFKS  270

Query  1727  VALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKL  1548
               LG E     V+V Q  LR+  DW             V  Q++Q+              
Sbjct  271   THLGTE-----VEVNQKFLRLRYDW-------------VGDQWEQE--------------  298

Query  1547  RIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTD  1368
                 ++     KF++ + VEV  D EGF  +W+ + V++ +G+ K LV+Y  LK DDGT 
Sbjct  299   ----SKNVPKAKFTQGVKVEVCSDDEGFRGAWFEATVVKAVGS-KFLVEYATLKADDGTK  353

Query  1367  YLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMN  1188
              L E V+A  IRPCPP+I     FKLLD+VDA+  + WW G VSKVLG+ +  V F    
Sbjct  354   PLKESVEARHIRPCPPDIPATDGFKLLDEVDAFCNDAWWVGVVSKVLGEKRCTVYFRPWK  413

Query  1187  ELLTFEASDLRPHQEWKNNNWVAAT  1113
             E + FE + LR H +W    W+ A+
Sbjct  414   EEMEFEHAQLRLHCDWMGGRWMRAS  438



>ref|XP_006375718.1| hypothetical protein POPTR_0013s00840g [Populus trichocarpa]
 gb|ERP53515.1| hypothetical protein POPTR_0013s00840g [Populus trichocarpa]
Length=345

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/327 (35%), Positives = 170/327 (52%), Gaps = 37/327 (11%)
 Frame = -3

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDE-SEPLKEKADAF  846
             P F  G  VE  S E G+ GS+Y   +  +    +F + Y+ L  D+E ++PL+E  + F
Sbjct  11    PNFKPGSKVEIMSDEAGFRGSFYIGTVVKATRTPEFTVRYEKLFEDEEGTKPLQETVNEF  70

Query  845   NIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHG  666
              IRP  P   + + FK  EEVDA++N+GWWEG+I++V +   + V+F +T E+IEF    
Sbjct  71    QIRPIAPREKKRE-FKFSEEVDAFHNDGWWEGVITEVNENGKFAVFFRSTKEQIEFVEED  129

Query  665   IRPHQEWIDKKWDIAF------------------------RKSNNNLPNPKPGIMRRHSG  558
             +R H+EW++ +W                            + S  +       + RR S 
Sbjct  130   LRLHREWVNGEWKPPLDGEEEKGEIEEVKEKGNKDSRKKKKLSEEDENEVTKEVKRRVSE  189

Query  557   GIASET-----------TFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLK  411
              + + T            F  G  VEV  DE+G +G+W+ A I+  +G  KYLVE+++L+
Sbjct  190   KVPNTTPVKPIESLKDVKFSKGMLVEVSSDEDGFKGAWFAASIVEPVGKDKYLVEYKSLR  249

Query  410   CDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRV  231
              +  +  L +E + + +RP  P    VD F+ LEEVDA  N+ W VG V +V    KY V
Sbjct  250   TEDDSGFLREEVNTMHIRPPPPQTVVVDHFKKLEEVDALYNDVWWVGVVSKVNTFPKYVV  309

Query  230   NFRTTNEILEFRHHGLRLHQEWINGAW  150
              F+   E LEF+H  LR HQ+WING W
Sbjct  310   YFKDNGEELEFKHSDLRPHQDWINGKW  336


 Score =   173 bits (438),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 115/339 (34%), Positives = 174/339 (51%), Gaps = 30/339 (9%)
 Frame = -3

Query  2057  SAEAQFNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRK  1878
             + +  F  G +VE++  +     F  +    +V K  R  +  V +E L  D++  K  +
Sbjct  8     NQDPNFKPGSKVEIMSDE---AGFRGSFYIGTVVKATRTPEFTVRYEKLFEDEEGTKPLQ  64

Query  1877  EYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVE  1698
             E V+   +RP  P E    F+  E  D F+ N GW  G + E+ EN  + V        E
Sbjct  65    ETVNEFQIRPIAPREKKREFKFSEEVDAFH-NDGWWEGVITEVNENGKFAVFF--RSTKE  121

Query  1697  SVKVEQWQLRVHRDWKDGCWVPPLE-------------ESQVDQQYQQKKSE-DFLMTPS  1560
              ++  +  LR+HR+W +G W PPL+             +   D + ++K SE D      
Sbjct  122   QIEFVEEDLRLHREWVNGEWKPPLDGEEEKGEIEEVKEKGNKDSRKKKKLSEEDENEVTK  181

Query  1559  GVKLRI--KCTRGSCVR--------KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKL  1410
              VK R+  K    + V+        KFSK M VEV  D++GF+ +W+A+ ++E +G  K 
Sbjct  182   EVKRRVSEKVPNTTPVKPIESLKDVKFSKGMLVEVSSDEDGFKGAWFAASIVEPVGKDKY  241

Query  1409  LVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKV  1230
             LV+Y+ L+T+D + +L EEV+   IRP PP+   +  FK L++VDA   + WW G VSKV
Sbjct  242   LVEYKSLRTEDDSGFLREEVNTMHIRPPPPQTVVVDHFKKLEEVDALYNDVWWVGVVSKV  301

Query  1229  LGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAAT  1113
                 KY+V F    E L F+ SDLRPHQ+W N  WVA +
Sbjct  302   NTFPKYVVYFKDNGEELEFKHSDLRPHQDWINGKWVAPS  340



>ref|XP_007031194.1| Agenet domain-containing protein, putative [Theobroma cacao]
 gb|EOY11696.1| Agenet domain-containing protein, putative [Theobroma cacao]
Length=381

 Score =   193 bits (491),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/352 (34%), Positives = 179/352 (51%), Gaps = 62/352 (18%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGN---GKLLVQYQDLKTDD-GTDYLIEEVDASCIRPC  1326
             VE+  +  GF  SWY   +++ +      K LV+Y  L  D+ GT  L E ++A+ +RP 
Sbjct  27    VEISSNDPGFRGSWYIGTIIKRVSKRNPNKFLVEYTHLFQDEAGTKPLKETINAADLRPL  86

Query  1325  PPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQ  1146
              P   R   FK  ++VDA+  +GWWEG ++K L + K+ V F    E L F    LR H+
Sbjct  87    APR-ERARKFKFGEEVDAYHHDGWWEGMITKELENGKFHVYFKRSKEQLEFGEDQLRLHR  145

Query  1145  EWKNNNW--------------------------------------------VAATKIDLP  1098
             EW N +W                                            V   K++  
Sbjct  146   EWINGSWKPPLEEDEQVEEKVSEEKEVKPNNGKTEEMISNSTIIENNSDKEVIEGKLESD  205

Query  1097  RSSSDVML--NskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYH-----------GSW  957
             ++ +   L  ++   + K +SD+   G K   G +     F EG H           G+W
Sbjct  206   KAVTQEKLEWDNAATEEKLESDKAGSGEKLECGEITTEEKFSEGAHVEVTSDEDGFEGAW  265

Query  956   YTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDA  777
             + A I  ++G +++L++Y++LRT+D+++ LKE+ D  +IRPCPP I   DRFK  +EVDA
Sbjct  266   FAATIVKAMGKDRYLIQYESLRTEDDTDFLKEEFDTLHIRPCPPEIVVADRFKKLDEVDA  325

Query  776   WYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
             +YN+GWW GL+SKVL    Y V+F TTNE+++F H  +R HQ+WID KW  A
Sbjct  326   FYNDGWWVGLVSKVLSDSKYEVFFRTTNEKMKFKHSELRLHQDWIDGKWVAA  377


 Score =   187 bits (476),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 111/345 (32%), Positives = 175/345 (51%), Gaps = 56/345 (16%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCYFRV  1812
             W+   +++   ++N    +  VE+  L  D+   K  KE ++ + +RP  P E    F+ 
Sbjct  40    WYIGTIIKRVSKRN--PNKFLVEYTHLFQDEAGTKPLKETINAADLRPLAPRERARKFKF  97

Query  1811  GESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVP  1632
             GE  D ++ + GW  G + + LEN  + V    + + E ++  + QLR+HR+W +G W P
Sbjct  98    GEEVDAYHHD-GWWEGMITKELENGKFHVYF--KRSKEQLEFGEDQLRLHREWINGSWKP  154

Query  1631  PLEESQ-------------------------------------------VDQQYQQKK--  1587
             PLEE +                                            D+   Q+K  
Sbjct  155   PLEEDEQVEEKVSEEKEVKPNNGKTEEMISNSTIIENNSDKEVIEGKLESDKAVTQEKLE  214

Query  1586  ------SEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVL  1425
                    E      +G   +++C   +   KFS+   VEV  D++GFE +W+A+ +++ +
Sbjct  215   WDNAATEEKLESDKAGSGEKLECGEITTEEKFSEGAHVEVTSDEDGFEGAWFAATIVKAM  274

Query  1424  GNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEG  1245
             G  + L+QY+ L+T+D TD+L EE D   IRPCPPEI     FK LD+VDA+  +GWW G
Sbjct  275   GKDRYLIQYESLRTEDDTDFLKEEFDTLHIRPCPPEIVVADRFKKLDEVDAFYNDGWWVG  334

Query  1244  HVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
              VSKVL D+KY V F + NE + F+ S+LR HQ+W +  WVAA++
Sbjct  335   LVSKVLSDSKYEVFFRTTNEKMKFKHSELRLHQDWIDGKWVAASQ  379


 Score =   142 bits (357),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 94/137 (69%), Gaps = 0/137 (0%)
 Frame = -3

Query  560  GGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQ  381
            G I +E  F  GA VEV  DE+G +G+W+ A I++ +G  +YL+++ +L+ +  TD L +
Sbjct  238  GEITTEEKFSEGAHVEVTSDEDGFEGAWFAATIVKAMGKDRYLIQYESLRTEDDTDFLKE  297

Query  380  EADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILE  201
            E D L +RP  P +   DRF+ L+EVDA+ N+GW VG V +VL  +KY V FRTTNE ++
Sbjct  298  EFDTLHIRPCPPEIVVADRFKKLDEVDAFYNDGWWVGLVSKVLSDSKYEVFFRTTNEKMK  357

Query  200  FRHHGLRLHQEWINGAW  150
            F+H  LRLHQ+WI+G W
Sbjct  358  FKHSELRLHQDWIDGKW  374


 Score =   107 bits (267),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 82/135 (61%), Gaps = 5/135 (4%)
 Frame = -3

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTAVIFDSIG---PNKFLLEYQTLRTDDE-SEPLKEKA  855
             P    G  VE +S + G+ GSWY   I   +    PNKFL+EY  L  D+  ++PLKE  
Sbjct  19    PGLEPGSQVEISSNDPGFRGSWYIGTIIKRVSKRNPNKFLVEYTHLFQDEAGTKPLKETI  78

Query  854   DAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFA  675
             +A ++RP  P   R  +FK  EEVDA++++GWWEG+I+K L+   + VYF  + E++EF 
Sbjct  79    NAADLRPLAPR-ERARKFKFGEEVDAYHHDGWWEGMITKELENGKFHVYFKRSKEQLEFG  137

Query  674   HHGIRPHQEWIDKKW  630
                +R H+EWI+  W
Sbjct  138   EDQLRLHREWINGSW  152


 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 79/130 (61%), Gaps = 5/130 (4%)
 Frame = -3

Query  527  GAKVEVKDDEEGNQGSWYPALILRLIGN---GKYLVEFRTLKCD-FGTDLLVQEADALSV  360
            G++VE+  ++ G +GSWY   I++ +      K+LVE+  L  D  GT  L +  +A  +
Sbjct  24   GSQVEISSNDPGFRGSWYIGTIIKRVSKRNPNKFLVEYTHLFQDEAGTKPLKETINAADL  83

Query  359  RPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLR  180
            RP AP  +R  +F+  EEVDA+ ++GW  G + + LE  K+ V F+ + E LEF    LR
Sbjct  84   RPLAP-RERARKFKFGEEVDAYHHDGWWEGMITKELENGKFHVYFKRSKEQLEFGEDQLR  142

Query  179  LHQEWINGAW  150
            LH+EWING+W
Sbjct  143  LHREWINGSW  152



>ref|NP_001151949.1| RNA binding protein [Zea mays]
 gb|ACG45114.1| RNA binding protein [Zea mays]
Length=443

 Score =   195 bits (495),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 136/462 (29%), Positives = 221/462 (48%), Gaps = 52/462 (11%)
 Frame = -3

Query  1517  RKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK-LLVQYQDLKTDDGTDYLIEEV---  1350
             + F+   PVEV  ++ G   + +A+VV+      +   V+Y  L   +G+D  + E    
Sbjct  19    KGFNPGDPVEVVPBEAGLHGAHFAAVVVGPSAKPRGYTVEYDSLLESEGSDRPLREALPA  78

Query  1349  -DASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEG-HVSKVLGDAKYMVCFGSMNELLT  1176
                    P PP     +P      VDA + + WW G  +++    +K  VCF    E++ 
Sbjct  79    RSLRPRPPPPPAPASEAPPAEHAAVDALIDDAWWLGVALARAGAPSKVRVCFPETREVME  138

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
             F+A+D+RPH EW +  W +   +++P++                         ++KGM +
Sbjct  139   FDAADVRPHLEWVDGEWRSPDNMEIPKTMP-----------------------YAKGMQI  175

Query  995   EATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIH  816
             E +  E+    +W  AV+   I  N  L++Y TL     +   +E  D  ++RPCPP   
Sbjct  176   EVSKLEDNSVVAWSPAVVAKIIWKNNLLVDY-TLSKCYGTTLSEEIVDVKHVRPCPPQAS  234

Query  815   RFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDK  636
                 F + +EV+A+  + WW G+I+ VL    Y         E+E     +R   +W+  
Sbjct  235   EIS-FCINDEVEAFQGDCWWLGVITNVLPEFKYTFKSTHLGTEVEVNQKFLRLRYDWVGD  293

Query  635   KWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILR  456
             +W+    + + N+P  K                F  G KVEV  D+EG +G+W+ A +++
Sbjct  294   QWE----QESKNVPKAK----------------FTQGVKVEVCSDDEGFRGAWFEATVVK  333

Query  455   LIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWR  276
              +G+ K+LVE+ TLK D GT  L +  +A  +RP  P +   D F+ L+EVDA+ N+ W 
Sbjct  334   AVGS-KFLVEYATLKADDGTKPLKESVEARHIRPCPPDIPATDGFKLLDEVDAFCNDAWW  392

Query  275   VGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             VG V +VL   +  V FR   E +EF H  LRLH +W+ G W
Sbjct  393   VGVVSKVLGEKRCTVYFRPWKEEMEFEHAQLRLHCDWMGGRW  434


 Score =   174 bits (440),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 119/391 (30%), Positives = 190/391 (49%), Gaps = 69/391 (18%)
 Frame = -3

Query  1766  GTVDEILENSMYM-VALGDEDAVESVKV-----------EQWQLRVHRDWKDGCWVPPLE  1623
               VD +++++ ++ VAL    A   V+V           +   +R H +W DG W     
Sbjct  101   AAVDALIDDAWWLGVALARAGAPSKVRVCFPETREVMEFDAADVRPHLEWVDGEW-----  155

Query  1622  ESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYAS  1443
                        +S D +  P  +              ++K M +EV   ++    +W  +
Sbjct  156   -----------RSPDNMEIPKTMP-------------YAKGMQIEVSKLEDNSVVAWSPA  191

Query  1442  VVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVG  1263
             VV +++    LLV Y  L    GT    E VD   +RPCPP+   IS F + D+V+A+ G
Sbjct  192   VVAKIIWKNNLLVDYT-LSKCYGTTLSEEIVDVKHVRPCPPQASEIS-FCINDEVEAFQG  249

Query  1262  NGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSD  1083
             + WW G ++ VL + KY      +   +      LR   +W  + W   +K ++P++   
Sbjct  250   DCWWLGVITNVLPEFKYTFKSTHLGTEVEVNQKFLRLRYDWVGDQWEQESK-NVPKA---  305

Query  1082  VMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEY  903
                                  KF++G+ VE  S +EG+ G+W+ A +  ++G +KFL+EY
Sbjct  306   ---------------------KFTQGVKVEVCSDDEGFRGAWFEATVVKAVG-SKFLVEY  343

Query  902   QTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGL  723
              TL+ DD ++PLKE  +A +IRPCPP I   D FK+ +EVDA+ N+ WW G++SKVL   
Sbjct  344   ATLKADDGTKPLKESVEARHIRPCPPDIPATDGFKLLDEVDAFCNDAWWVGVVSKVLGEK  403

Query  722   NYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
                VYF    EE+EF H  +R H +W+  +W
Sbjct  404   RCTVYFRPWKEEMEFEHAQLRLHCDWMGGRW  434


 Score =   126 bits (317),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 100/325 (31%), Positives = 151/325 (46%), Gaps = 48/325 (15%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVL-MRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDD  1899
             P+   +     + KG ++EV  + DN  + +  AV+   + KN     + V++    S  
Sbjct  158   PDNMEIPKTMPYAKGMQIEVSKLEDNSVVAWSPAVVAKIIWKNN----LLVDY--TLSKC  211

Query  1898  DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYM---  1728
                   +E V +  VRP PP      F + +  + F +   W  G +  +L    Y    
Sbjct  212   YGTTLSEEIVDVKHVRPCPPQASEISFCINDEVEAF-QGDCWWLGVITNVLPEFKYTFKS  270

Query  1727  VALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKL  1548
               LG E     V+V Q  LR+  DW             V  Q++Q+              
Sbjct  271   THLGTE-----VEVNQKFLRLRYDW-------------VGDQWEQE--------------  298

Query  1547  RIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTD  1368
                 ++     KF++ + VEV  D EGF  +W+ + V++ +G+ K LV+Y  LK DDGT 
Sbjct  299   ----SKNVPKAKFTQGVKVEVCSDDEGFRGAWFEATVVKAVGS-KFLVEYATLKADDGTK  353

Query  1367  YLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMN  1188
              L E V+A  IRPCPP+I     FKLLD+VDA+  + WW G VSKVLG+ +  V F    
Sbjct  354   PLKESVEARHIRPCPPDIPATDGFKLLDEVDAFCNDAWWVGVVSKVLGEKRCTVYFRPWK  413

Query  1187  ELLTFEASDLRPHQEWKNNNWVAAT  1113
             E + FE + LR H +W    W+ A+
Sbjct  414   EEMEFEHAQLRLHCDWMGGRWMRAS  438



>ref|XP_010092962.1| hypothetical protein L484_018899 [Morus notabilis]
 gb|EXB53015.1| hypothetical protein L484_018899 [Morus notabilis]
Length=305

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/296 (38%), Positives = 168/296 (57%), Gaps = 16/296 (5%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEI  1314
             VE+  D+ GF+ S+Y   V+ +  +   LV+Y+ L T+     L EEV    +RP PP  
Sbjct  18    VEISSDEPGFQGSFYLGTVISLCSSDSYLVEYKTLVTESSRP-LREEVGLFQVRPPPPSP  76

Query  1313  HRIS--PFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEW  1140
                +   F + D+VD +  +GWWE  V+  LG+ ++ V F S  E + F   ++R H++W
Sbjct  77    SPGARWIFGMGDEVDVYHNDGWWEAVVTADLGNGRFEVFFRSYKEQMEFSKENMRLHRDW  136

Query  1139  KNNNWV---AATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGY  969
                 WV         + +S +++ +N           ++ +  KF KG LVE +S E+G+
Sbjct  137   IGGGWVPHVEEEHEQVEKSQTEMEING---------SKETVQEKFVKGELVEVSSDEDGF  187

Query  968   HGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFE  789
              G+W++A I +  G +KFL+EYQ+LRT+D+ + L E  D  +IRPCP        F++ E
Sbjct  188   EGAWFSATIVEPTGTDKFLVEYQSLRTEDDKDFLTEDIDILHIRPCPAETLVVG-FRLLE  246

Query  788   EVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
             EVD  YN+GWW G++SKVL    Y+VYF  T EE+EF H  +R H EWID KW +A
Sbjct  247   EVDCLYNDGWWVGVVSKVLGDSRYIVYFKDTKEEMEFHHFQMRLHHEWIDGKWVVA  302


 Score =   181 bits (458),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/293 (36%), Positives = 161/293 (55%), Gaps = 5/293 (2%)
 Frame = -3

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFN  843
             P F  G  VE +S E G+ GS+Y   +      + +L+EY+TL T+  S PL+E+   F 
Sbjct  10    PIFRPGSAVEISSDEPGFQGSFYLGTVISLCSSDSYLVEYKTLVTES-SRPLREEVGLFQ  68

Query  842   IRPCPPLIHRFDR--FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHH  669
             +RP PP      R  F M +EVD ++N+GWWE +++  L    + V+F +  E++EF+  
Sbjct  69    VRPPPPSPSPGARWIFGMGDEVDVYHNDGWWEAVVTADLGNGRFEVFFRSYKEQMEFSKE  128

Query  668   GIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGN  489
              +R H++WI   W +   +  +         M  +      +  F  G  VEV  DE+G 
Sbjct  129   NMRLHRDWIGGGW-VPHVEEEHEQVEKSQTEMEINGSKETVQEKFVKGELVEVSSDEDGF  187

Query  488   QGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLE  309
             +G+W+ A I+   G  K+LVE+++L+ +   D L ++ D L +RP  P    V  FR LE
Sbjct  188   EGAWFSATIVEPTGTDKFLVEYQSLRTEDDKDFLTEDIDILHIRP-CPAETLVVGFRLLE  246

Query  308   EVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             EVD   N+GW VG V +VL  ++Y V F+ T E +EF H  +RLH EWI+G W
Sbjct  247   EVDCLYNDGWWVGVVSKVLGDSRYIVYFKDTKEEMEFHHFQMRLHHEWIDGKW  299


 Score =   152 bits (383),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 103/317 (32%), Positives = 152/317 (48%), Gaps = 37/317 (12%)
 Frame = -3

Query  2003  NFPIWFPAAVLRPSVRKNQRAGQIYV-EFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPC  1827
             N PI+ P + +  S  +    G  Y+    +LCS D  +    EY  L      P  E  
Sbjct  8     NKPIFRPGSAVEISSDEPGFQGSFYLGTVISLCSSDSYLV---EYKTLVTESSRPLREEV  64

Query  1826  CYFRV-----------------GESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVE  1698
               F+V                 G+  DV Y N GW    V   L N  + V        E
Sbjct  65    GLFQVRPPPPSPSPGARWIFGMGDEVDV-YHNDGWWEAVVTADLGNGRFEVFF--RSYKE  121

Query  1697  SVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCV  1518
              ++  +  +R+HRDW  G WVP +EE     +  Q + E            I  ++ +  
Sbjct  122   QMEFSKENMRLHRDWIGGGWVPHVEEEHEQVEKSQTEME------------INGSKETVQ  169

Query  1517  RKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASC  1338
              KF K   VEV  D++GFE +W+++ ++E  G  K LV+YQ L+T+D  D+L E++D   
Sbjct  170   EKFVKGELVEVSSDEDGFEGAWFSATIVEPTGTDKFLVEYQSLRTEDDKDFLTEDIDILH  229

Query  1337  IRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDL  1158
             IRPCP E   +  F+LL++VD    +GWW G VSKVLGD++Y+V F    E + F    +
Sbjct  230   IRPCPAET-LVVGFRLLEEVDCLYNDGWWVGVVSKVLGDSRYIVYFKDTKEEMEFHHFQM  288

Query  1157  RPHQEWKNNNWVAATKI  1107
             R H EW +  WV A+++
Sbjct  289   RLHHEWIDGKWVVASEV  305



>gb|KCW61329.1| hypothetical protein EUGRSUZ_H04076 [Eucalyptus grandis]
 gb|KCW61330.1| hypothetical protein EUGRSUZ_H04076 [Eucalyptus grandis]
Length=240

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 146/240 (61%), Gaps = 12/240 (5%)
 Frame = -3

Query  1820  FRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWK-DG  1644
             FRVGE  D F E+ GW  G + EI E+S Y+VA+G     E V+  Q +LR HR+W  DG
Sbjct  5     FRVGEEVDAFRED-GWHFGEIREIREDSRYLVAVGG--GSEEVEFGQRELRRHREWSGDG  61

Query  1643  CWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVR--KFSKEMPVEVKGDKE  1470
              W PPL   ++     Q+KS    + P  +K +I   +G+ +   +F K   VEV  D++
Sbjct  62    VWTPPLAGGEL-----QEKSSTMELKPFKIKFKIGLDKGTSLPPPEFGKGKTVEVSSDEK  116

Query  1469  GFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKL  1290
             G+E SW+++ V++ +GN K LV+Y  LKTDD T+ L EE  +  IRP PP +     FK 
Sbjct  117   GYEGSWFSATVIDYIGNDKYLVEYLTLKTDDETEPLREEAYSRYIRPYPPYLP-ARRFKQ  175

Query  1289  LDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             LDKVDAW  +GWW G +SKVL  ++Y+V F + NE L F  S+LR HQ+W +  WV A++
Sbjct  176   LDKVDAWYNDGWWVGVISKVLKGSQYIVYFSTSNEELIFNESNLRLHQDWSDGKWVIASR  235


 Score =   184 bits (467),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 148/236 (63%), Gaps = 5/236 (2%)
 Frame = -3

Query  1298  FKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNN-WV  1122
             F++ ++VDA+  +GW  G + ++  D++Y+V  G  +E + F   +LR H+EW  +  W 
Sbjct  5     FRVGEEVDAFREDGWHFGEIREIREDSRYLVAVGGGSEEVEFGQRELRRHREWSGDGVWT  64

Query  1121  AA-TKIDLPRSSSDVMLNskvvkvkskSDRKAL--GPKFSKGMLVEATSFEEGYHGSWYT  951
                   +L   SS + L    +K K   D+      P+F KG  VE +S E+GY GSW++
Sbjct  65    PPLAGGELQEKSSTMELKPFKIKFKIGLDKGTSLPPPEFGKGKTVEVSSDEKGYEGSWFS  124

Query  950   AVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWY  771
             A + D IG +K+L+EY TL+TDDE+EPL+E+A +  IRP PP +    RFK  ++VDAWY
Sbjct  125   ATVIDYIGNDKYLVEYLTLKTDDETEPLREEAYSRYIRPYPPYLPA-RRFKQLDKVDAWY  183

Query  770   NEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNN  603
             N+GWW G+ISKVL G  Y+VYF T+NEE+ F    +R HQ+W D KW IA R S +
Sbjct  184   NDGWWVGVISKVLKGSQYIVYFSTSNEELIFNESNLRLHQDWSDGKWVIASRGSRS  239


 Score =   146 bits (369),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 90/229 (39%), Positives = 129/229 (56%), Gaps = 10/229 (4%)
 Frame = -3

Query  809  DRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI-DKK  633
            +RF++ EEVDA+  +GW  G I ++ +   Y+V     +EE+EF    +R H+EW  D  
Sbjct  3    ERFRVGEEVDAFREDGWHFGEIREIREDSRYLVAVGGGSEEVEFGQRELRRHREWSGDGV  62

Query  632  W-------DIAFRKSNNNL-PNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSW  477
            W       ++  + S   L P      +    G       F  G  VEV  DE+G +GSW
Sbjct  63   WTPPLAGGELQEKSSTMELKPFKIKFKIGLDKGTSLPPPEFGKGKTVEVSSDEKGYEGSW  122

Query  476  YPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDA  297
            + A ++  IGN KYLVE+ TLK D  T+ L +EA +  +RP  P L    RF+ L++VDA
Sbjct  123  FSATVIDYIGNDKYLVEYLTLKTDDETEPLREEAYSRYIRPYPPYLP-ARRFKQLDKVDA  181

Query  296  WSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
            W N+GW VG + +VL+G++Y V F T+NE L F    LRLHQ+W +G W
Sbjct  182  WYNDGWWVGVISKVLKGSQYIVYFSTSNEELIFNESNLRLHQDWSDGKW  230


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 68/139 (49%), Gaps = 11/139 (8%)
 Frame = -3

Query  2045  QFNKGDRVEVLMRDNF--PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEY  1872
             +F KG  VEV   +      WF A V+      N +     VE+ TL +DD+    R+E 
Sbjct  102   EFGKGKTVEVSSDEKGYEGSWFSATVI--DYIGNDK---YLVEYLTLKTDDETEPLREE-  155

Query  1871  VHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESV  1692
              +   +RP PP  P   F+  +  D +Y N GW  G + ++L+ S Y+V     +  E +
Sbjct  156   AYSRYIRPYPPYLPARRFKQLDKVDAWY-NDGWWVGVISKVLKGSQYIVYFSTSN--EEL  212

Query  1691  KVEQWQLRVHRDWKDGCWV  1635
                +  LR+H+DW DG WV
Sbjct  213   IFNESNLRLHQDWSDGKWV  231



>gb|KCW61331.1| hypothetical protein EUGRSUZ_H04076 [Eucalyptus grandis]
Length=300

 Score =   184 bits (467),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 104/243 (43%), Positives = 148/243 (61%), Gaps = 12/243 (5%)
 Frame = -3

Query  1820  FRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWK-DG  1644
             FRVGE  D F E+ GW  G + EI E+S Y+VA+G     E V+  Q +LR HR+W  DG
Sbjct  5     FRVGEEVDAFRED-GWHFGEIREIREDSRYLVAVGG--GSEEVEFGQRELRRHREWSGDG  61

Query  1643  CWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVR--KFSKEMPVEVKGDKE  1470
              W PPL   ++     Q+KS    + P  +K +I   +G+ +   +F K   VEV  D++
Sbjct  62    VWTPPLAGGEL-----QEKSSTMELKPFKIKFKIGLDKGTSLPPPEFGKGKTVEVSSDEK  116

Query  1469  GFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKL  1290
             G+E SW+++ V++ +GN K LV+Y  LKTDD T+ L EE  +  IRP PP +     FK 
Sbjct  117   GYEGSWFSATVIDYIGNDKYLVEYLTLKTDDETEPLREEAYSRYIRPYPPYLP-ARRFKQ  175

Query  1289  LDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             LDKVDAW  +GWW G +SKVL  ++Y+V F + NE L F  S+LR HQ+W +  WV A++
Sbjct  176   LDKVDAWYNDGWWVGVISKVLKGSQYIVYFSTSNEELIFNESNLRLHQDWSDGKWVIASR  235

Query  1109  IDL  1101
              ++
Sbjct  236   DEM  238


 Score =   181 bits (458),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 146/232 (63%), Gaps = 5/232 (2%)
 Frame = -3

Query  1298  FKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNN-WV  1122
             F++ ++VDA+  +GW  G + ++  D++Y+V  G  +E + F   +LR H+EW  +  W 
Sbjct  5     FRVGEEVDAFREDGWHFGEIREIREDSRYLVAVGGGSEEVEFGQRELRRHREWSGDGVWT  64

Query  1121  AA-TKIDLPRSSSDVMLNskvvkvkskSDRKAL--GPKFSKGMLVEATSFEEGYHGSWYT  951
                   +L   SS + L    +K K   D+      P+F KG  VE +S E+GY GSW++
Sbjct  65    PPLAGGELQEKSSTMELKPFKIKFKIGLDKGTSLPPPEFGKGKTVEVSSDEKGYEGSWFS  124

Query  950   AVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWY  771
             A + D IG +K+L+EY TL+TDDE+EPL+E+A +  IRP PP +    RFK  ++VDAWY
Sbjct  125   ATVIDYIGNDKYLVEYLTLKTDDETEPLREEAYSRYIRPYPPYLPA-RRFKQLDKVDAWY  183

Query  770   NEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFR  615
             N+GWW G+ISKVL G  Y+VYF T+NEE+ F    +R HQ+W D KW IA R
Sbjct  184   NDGWWVGVISKVLKGSQYIVYFSTSNEELIFNESNLRLHQDWSDGKWVIASR  235


 Score =   145 bits (365),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 90/229 (39%), Positives = 129/229 (56%), Gaps = 10/229 (4%)
 Frame = -3

Query  809  DRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI-DKK  633
            +RF++ EEVDA+  +GW  G I ++ +   Y+V     +EE+EF    +R H+EW  D  
Sbjct  3    ERFRVGEEVDAFREDGWHFGEIREIREDSRYLVAVGGGSEEVEFGQRELRRHREWSGDGV  62

Query  632  W-------DIAFRKSNNNL-PNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSW  477
            W       ++  + S   L P      +    G       F  G  VEV  DE+G +GSW
Sbjct  63   WTPPLAGGELQEKSSTMELKPFKIKFKIGLDKGTSLPPPEFGKGKTVEVSSDEKGYEGSW  122

Query  476  YPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDA  297
            + A ++  IGN KYLVE+ TLK D  T+ L +EA +  +RP  P L    RF+ L++VDA
Sbjct  123  FSATVIDYIGNDKYLVEYLTLKTDDETEPLREEAYSRYIRPYPPYLP-ARRFKQLDKVDA  181

Query  296  WSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
            W N+GW VG + +VL+G++Y V F T+NE L F    LRLHQ+W +G W
Sbjct  182  WYNDGWWVGVISKVLKGSQYIVYFSTSNEELIFNESNLRLHQDWSDGKW  230


 Score = 86.3 bits (212),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  791  EEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRK  612
            E VDAWYN+GWW G IS++L GL Y VYF T++EE+EF HH +RPHQEWI  +W I  R 
Sbjct  237  EMVDAWYNDGWWVGHISQILGGLKYKVYFMTSSEELEFEHHNLRPHQEWIGGRWIITSRG  296

Query  611  SNN  603
            S +
Sbjct  297  SRS  299


 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 63/111 (57%), Gaps = 6/111 (5%)
 Frame = -3

Query  482  SWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEV  303
             W+  +I +++   +Y+V F T       +L+  E++ L +       + V   R  E V
Sbjct  186  GWWVGVISKVLKGSQYIVYFSTSN----EELIFNESN-LRLHQDWSDGKWVIASRD-EMV  239

Query  302  DAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
            DAW N+GW VG + ++L G KY+V F T++E LEF HH LR HQEWI G W
Sbjct  240  DAWYNDGWWVGHISQILGGLKYKVYFMTSSEELEFEHHNLRPHQEWIGGRW  290


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -3

Query  1280  VDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             VDAW  +GWW GH+S++LG  KY V F + +E L FE  +LRPHQEW    W+  ++
Sbjct  239   VDAWYNDGWWVGHISQILGGLKYKVYFMTSSEELEFEHHNLRPHQEWIGGRWIITSR  295


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 72/151 (48%), Gaps = 11/151 (7%)
 Frame = -3

Query  2045  QFNKGDRVEVLMRDNF--PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEY  1872
             +F KG  VEV   +      WF A V+      N +     VE+ TL +DD+    R+E 
Sbjct  102   EFGKGKTVEVSSDEKGYEGSWFSATVI--DYIGNDK---YLVEYLTLKTDDETEPLREE-  155

Query  1871  VHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESV  1692
              +   +RP PP  P   F+  +  D +Y N GW  G + ++L+ S Y+V     +  E +
Sbjct  156   AYSRYIRPYPPYLPARRFKQLDKVDAWY-NDGWWVGVISKVLKGSQYIVYFSTSN--EEL  212

Query  1691  KVEQWQLRVHRDWKDGCWVPPLEESQVDQQY  1599
                +  LR+H+DW DG WV    +  VD  Y
Sbjct  213   IFNESNLRLHQDWSDGKWVIASRDEMVDAWY  243



>ref|XP_004309084.1| PREDICTED: uncharacterized protein LOC101298667 [Fragaria vesca 
subsp. vesca]
Length=299

 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/305 (35%), Positives = 164/305 (54%), Gaps = 26/305 (9%)
 Frame = -3

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNG-KLLVQYQDLKTD-----DGTDYLIEE  1353
             +F     VEV         S + + ++    +G +L V+Y  +KT       G   + +E
Sbjct  8     QFQIGAHVEVTSPVHNMRGSLFPARIVAASADGTRLTVEYDKVKTRLYRKVTGHSSVRDE  67

Query  1352  VDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTF  1173
             V A+ IRP PP     + FK+ D VDA++  GWWEG V++ L DA++ V F  + +   F
Sbjct  68    VHAALIRPSPPREEGFAGFKVGDGVDAFLAGGWWEGVVTEELDDARFEVFFQVVRQRFEF  127

Query  1172  EASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKA-LGPKFSKGMLV  996
             EA ++R H+EW    WV   +                   + + ++KA L  +  KG  V
Sbjct  128   EAEEMRIHREWVKGAWVPPIR-------------------EEEKEKKAQLKEEIRKGTEV  168

Query  995   EATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIH  816
             E ++ E+G+ GSW+ A +   +   KFL+ Y++L+TDD  E L E+ D  ++RPCPP  +
Sbjct  169   EVSNDEDGFQGSWFAATVVQVVANAKFLVRYKSLKTDDGKEFLTEEIDEEHLRPCPPETY  228

Query  815   RFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDK  636
               D + + + VDA++NEGWWEG I KVL G  Y V+F  T++++ F H  +RP Q WID 
Sbjct  229   MVDCYGLNDLVDAYWNEGWWEGKICKVLHGGRYRVFFEGTDDKMVFDHSDLRPRQVWIDG  288

Query  635   KWDIA  621
              W +A
Sbjct  289   TWVMA  293


 Score =   177 bits (450),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/328 (33%), Positives = 169/328 (52%), Gaps = 44/328 (13%)
 Frame = -3

Query  2063  AMSAEAQFNKGDRVEVL-----MRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFET----L  1911
             A  + +QF  G  VEV      MR +    FPA ++  S    +    + VE++     L
Sbjct  2     AADSSSQFQIGAHVEVTSPVHNMRGSL---FPARIVAASADGTR----LTVEYDKVKTRL  54

Query  1910  CSDDDPMKRRKEYVHLSAVRPAPPGEP-CCYFRVGESADVFYENRGWRRGTVDEILENSM  1734
                       ++ VH + +RP+PP E     F+VG+  D F    GW  G V E L+++ 
Sbjct  55    YRKVTGHSSVRDEVHAALIRPSPPREEGFAGFKVGDGVDAFLAG-GWWEGVVTEELDDAR  113

Query  1733  YMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGV  1554
             + V    +   +  + E  ++R+HR+W  G WVPP+ E + +++ Q K+           
Sbjct  114   FEVFF--QVVRQRFEFEAEEMRIHREWVKGAWVPPIREEEKEKKAQLKE-----------  160

Query  1553  KLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDG  1374
                          +  K   VEV  D++GF+ SW+A+ V++V+ N K LV+Y+ LKTDDG
Sbjct  161   -------------EIRKGTEVEVSNDEDGFQGSWFAATVVQVVANAKFLVRYKSLKTDDG  207

Query  1373  TDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGS  1194
              ++L EE+D   +RPCPPE + +  + L D VDA+   GWWEG + KVL   +Y V F  
Sbjct  208   KEFLTEEIDEEHLRPCPPETYMVDCYGLNDLVDAYWNEGWWEGKICKVLHGGRYRVFFEG  267

Query  1193  MNELLTFEASDLRPHQEWKNNNWVAATK  1110
              ++ + F+ SDLRP Q W +  WV A++
Sbjct  268   TDDKMVFDHSDLRPRQVWIDGTWVMASQ  295


 Score =   166 bits (419),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 151/296 (51%), Gaps = 19/296 (6%)
 Frame = -3

Query  1019  KFSKGMLVEATSFEEGYHGSWYTA-VIFDSIGPNKFLLEYQTLRTD-----DESEPLKEK  858
             +F  G  VE TS      GS + A ++  S    +  +EY  ++T           ++++
Sbjct  8     QFQIGAHVEVTSPVHNMRGSLFPARIVAASADGTRLTVEYDKVKTRLYRKVTGHSSVRDE  67

Query  857   ADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEF  678
               A  IRP PP    F  FK+ + VDA+   GWWEG++++ LD   + V+F    +  EF
Sbjct  68    VHAALIRPSPPREEGFAGFKVGDGVDAFLAGGWWEGVVTEELDDARFEVFFQVVRQRFEF  127

Query  677   AHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDE  498
                 +R H+EW+   W    R+            +R+             G +VEV +DE
Sbjct  128   EAEEMRIHREWVKGAWVPPIREEEKEKKAQLKEEIRK-------------GTEVEVSNDE  174

Query  497   EGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFR  318
             +G QGSW+ A +++++ N K+LV +++LK D G + L +E D   +RP  P    VD + 
Sbjct  175   DGFQGSWFAATVVQVVANAKFLVRYKSLKTDDGKEFLTEEIDEEHLRPCPPETYMVDCYG  234

Query  317   PLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
               + VDA+ N GW  G++C+VL G +YRV F  T++ + F H  LR  Q WI+G W
Sbjct  235   LNDLVDAYWNEGWWEGKICKVLHGGRYRVFFEGTDDKMVFDHSDLRPRQVWIDGTW  290


 Score = 73.9 bits (180),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 69/139 (50%), Gaps = 6/139 (4%)
 Frame = -3

Query  548  SETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYL-VEFRTLKCDF-----GTDLL  387
            S + F IGA VEV       +GS +PA I+    +G  L VE+  +K        G   +
Sbjct  5    SSSQFQIGAHVEVTSPVHNMRGSLFPARIVAASADGTRLTVEYDKVKTRLYRKVTGHSSV  64

Query  386  VQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEI  207
              E  A  +RPS P  +    F+  + VDA+   GW  G V E L+ A++ V F+   + 
Sbjct  65   RDEVHAALIRPSPPREEGFAGFKVGDGVDAFLAGGWWEGVVTEELDDARFEVFFQVVRQR  124

Query  206  LEFRHHGLRLHQEWINGAW  150
             EF    +R+H+EW+ GAW
Sbjct  125  FEFEAEEMRIHREWVKGAW  143



>ref|XP_007220527.1| hypothetical protein PRUPE_ppa009113mg [Prunus persica]
 gb|EMJ21726.1| hypothetical protein PRUPE_ppa009113mg [Prunus persica]
Length=306

 Score =   184 bits (467),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/287 (38%), Positives = 158/287 (55%), Gaps = 25/287 (9%)
 Frame = -3

Query  1448  ASVVMEVLGNGKLLVQYQDLKTD-DGT----------DYLIEEVDASCIRPCPPEIHRIS  1302
             A ++ +     KL V+Y  +K   DG           + + EEVD + IRP PPE  +  
Sbjct  28    AKIIGKSRDKTKLKVEYNKVKAKIDGNLGRRKRHQQRNEVEEEVDVALIRPLPPEESKYC  87

Query  1301  PFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWV  1122
              FKL D VDA+   GWWEG ++ V+ D+ + + F    E   FE+ +LR H+EW   +W+
Sbjct  88    CFKLGDVVDAFFCGGWWEGVITDVMKDSTFGIYFRFAKEEFEFESEELRLHREWVKGSWL  147

Query  1121  AATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVI  942
                    P    DV    +         +  +   F +G  VE  + E+G+ G+W+ A I
Sbjct  148   P------PLQQGDVSTTEEP--------KLWMKEDFVQGTQVEICTDEDGFQGAWFAANI  193

Query  941   FDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEG  762
                +G +KFL+ Y++++TDD  E L E+ DA +IRPCPP     + F + EEVDA+YN+G
Sbjct  194   VKVMGKDKFLIRYKSIKTDDGKEFLTEEVDAQHIRPCPPETVVVESFSLNEEVDAFYNDG  253

Query  761   WWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
             WWEG+I KVL G  Y VYF  T +E+ F H  +RP Q+WID+ W +A
Sbjct  254   WWEGVIRKVLRGPRYRVYFKGTKDELLFEHSDLRPRQDWIDRTWVMA  300


 Score =   174 bits (442),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 115/332 (35%), Positives = 178/332 (54%), Gaps = 52/332 (16%)
 Frame = -3

Query  2048  AQFNKGDRVEVL-----MRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSD-DDPMK  1887
             + F  GD VEV      MR      FPA ++  S  K +    + VE+  + +  D  + 
Sbjct  4     SNFKIGDEVEVTSPIHNMRGTL---FPAKIIGKSRDKTK----LKVEYNKVKAKIDGNLG  56

Query  1886  RRK---------EYVHLSAVRPAPPGEP--CCYFRVGESADVFYENRGWRRGTVDEILEN  1740
             RRK         E V ++ +RP PP E   CC F++G+  D F+   GW  G + +++++
Sbjct  57    RRKRHQQRNEVEEEVDVALIRPLPPEESKYCC-FKLGDVVDAFFCG-GWWEGVITDVMKD  114

Query  1739  SMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQK--KSEDFLMT  1566
             S + +      A E  + E  +LR+HR+W  G W+PPL++  V    + K    EDF+  
Sbjct  115   STFGIYF--RFAKEEFEFESEELRLHREWVKGSWLPPLQQGDVSTTEEPKLWMKEDFV--  170

Query  1565  PSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLK  1386
               G ++ I CT                  D++GF+ +W+A+ +++V+G  K L++Y+ +K
Sbjct  171   -QGTQVEI-CT------------------DEDGFQGAWFAANIVKVMGKDKFLIRYKSIK  210

Query  1385  TDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMV  1206
             TDDG ++L EEVDA  IRPCPPE   +  F L ++VDA+  +GWWEG + KVL   +Y V
Sbjct  211   TDDGKEFLTEEVDAQHIRPCPPETVVVESFSLNEEVDAFYNDGWWEGVIRKVLRGPRYRV  270

Query  1205  CFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
              F    + L FE SDLRP Q+W +  WV A++
Sbjct  271   YFKGTKDELLFEHSDLRPRQDWIDRTWVMASQ  302


 Score =   157 bits (397),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 100/306 (33%), Positives = 157/306 (51%), Gaps = 23/306 (8%)
 Frame = -3

Query  1028  LGPKFSKGMLVEATSFEEGYHGSWYTA-VIFDSIGPNKFLLEYQTLRTD-----------  885
             +G  F  G  VE TS      G+ + A +I  S    K  +EY  ++             
Sbjct  2     VGSNFKIGDEVEVTSPIHNMRGTLFPAKIIGKSRDKTKLKVEYNKVKAKIDGNLGRRKRH  61

Query  884   DESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYF  705
              +   ++E+ D   IRP PP   ++  FK+ + VDA++  GWWEG+I+ V+    + +YF
Sbjct  62    QQRNEVEEEVDVALIRPLPPEESKYCCFKLGDVVDAFFCGGWWEGVITDVMKDSTFGIYF  121

Query  704   WTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPG-IMRRHSGGIASETTFCI  528
                 EE EF    +R H+EW+   W          LP  + G +       +  +  F  
Sbjct  122   RFAKEEFEFESEELRLHREWVKGSW----------LPPLQQGDVSTTEEPKLWMKEDFVQ  171

Query  527   GAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSA  348
             G +VE+  DE+G QG+W+ A I++++G  K+L+ ++++K D G + L +E DA  +RP  
Sbjct  172   GTQVEICTDEDGFQGAWFAANIVKVMGKDKFLIRYKSIKTDDGKEFLTEEVDAQHIRPCP  231

Query  347   PILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQE  168
             P    V+ F   EEVDA+ N+GW  G + +VL G +YRV F+ T + L F H  LR  Q+
Sbjct  232   PETVVVESFSLNEEVDAFYNDGWWEGVIRKVLRGPRYRVYFKGTKDELLFEHSDLRPRQD  291

Query  167   WINGAW  150
             WI+  W
Sbjct  292   WIDRTW  297



>ref|XP_002440532.1| hypothetical protein SORBIDRAFT_09g002650 [Sorghum bicolor]
 gb|EES18962.1| hypothetical protein SORBIDRAFT_09g002650 [Sorghum bicolor]
Length=447

 Score =   188 bits (477),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 138/484 (29%), Positives = 218/484 (45%), Gaps = 56/484 (12%)
 Frame = -3

Query  1571  MTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVM--EVLGNGKLLVQY  1398
             M P     R         + F+   PVEV  D+ G   + +A+VV+       G   V+Y
Sbjct  1     MRPPRTPGRRDAASPQTPKGFNPGDPVEVVPDEPGLRGAHFAAVVVGPSAKPRGGYTVEY  60

Query  1397  QDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLD-------KVDAWVGNGWWEG-H  1242
               L   + +D  + E   +      P                    VDA + + WW G  
Sbjct  61    DSLLESEDSDRRLREALPARSLRPRPPPPPAPASGSGPPPPAEHAAVDALIDDAWWLGVA  120

Query  1241  VSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskv  1062
             + +     K  VCF    E++ F+A+D+RPH EW    W +   +++P++          
Sbjct  121   LGRAGAPGKVRVCFPETREVMEFDAADVRPHLEWVAGQWRSPDSMEIPKTMP--------  172

Query  1061  vkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDD  882
                            ++KGM +E +  EE    +W  AV+  +I  N  L++Y T+    
Sbjct  173   ---------------YAKGMQIEVSKLEENSVVAWSPAVVAKTIWKNNLLVDY-TVSKCY  216

Query  881   ESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFW  702
              +   +E  D  ++RPCPP       F + +EV+A+  + WW G+I+KV     Y     
Sbjct  217   GTALSEEIVDVKHVRPCPPQASEIS-FCINDEVEAFQGDCWWLGVITKVHPEFKYTFKSA  275

Query  701   TTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGA  522
                 E+E   + +R   +W+D +W+   + S N                  ++  F  G 
Sbjct  276   HLGTEVEVNQNSLRLRYDWVDDQWE---QVSKN-----------------VAKLKFTQGV  315

Query  521   KVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPI  342
             KVEV  D+EG +G+W+ A I++ +G+ K+LVE+ TLK D  T  L +  +A  +RP  P 
Sbjct  316   KVEVCSDDEGFRGAWFEATIVKPVGS-KFLVEYATLKDDDDTKPLKETVEARHIRPCPPE  374

Query  341   LQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWI  162
             +   D F+ L+EVDA+ N+GW VG V +VL   +  V FR   E  EF H  LRLH +W+
Sbjct  375   IPVSDGFKLLDEVDAFCNDGWWVGVVSKVLGEKRCMVYFRPWKEENEFEHAQLRLHSDWM  434

Query  161   NGAW  150
              G W
Sbjct  435   GGRW  438


 Score =   128 bits (321),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 103/328 (31%), Positives = 152/328 (46%), Gaps = 54/328 (16%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEV--LMRDNFPIWFPAAVLRPSVRKNQRAGQIYVE--FETLC  1908
             P++  +     + KG ++EV  L  ++   W PA V + ++ KN       V   + T  
Sbjct  162   PDSMEIPKTMPYAKGMQIEVSKLEENSVVAWSPAVVAK-TIWKNNLLVDYTVSKCYGTAL  220

Query  1907  SDDDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYM  1728
             S+        E V +  VRP PP      F + +  + F +   W  G + ++     Y 
Sbjct  221   SE--------EIVDVKHVRPCPPQASEISFCINDEVEAF-QGDCWWLGVITKVHPEFKYT  271

Query  1727  ---VALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSG  1557
                  LG E     V+V Q  LR+  DW             VD Q++Q            
Sbjct  272   FKSAHLGTE-----VEVNQNSLRLRYDW-------------VDDQWEQ------------  301

Query  1556  VKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD  1377
                    ++     KF++ + VEV  D EGF  +W+ + +++ +G+ K LV+Y  LK DD
Sbjct  302   ------VSKNVAKLKFTQGVKVEVCSDDEGFRGAWFEATIVKPVGS-KFLVEYATLKDDD  354

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
              T  L E V+A  IRPCPPEI     FKLLD+VDA+  +GWW G VSKVLG+ + MV F 
Sbjct  355   DTKPLKETVEARHIRPCPPEIPVSDGFKLLDEVDAFCNDGWWVGVVSKVLGEKRCMVYFR  414

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAAT  1113
                E   FE + LR H +W    W+ A+
Sbjct  415   PWKEENEFEHAQLRLHSDWMGGRWMRAS  442



>ref|XP_004960400.1| PREDICTED: uncharacterized protein LOC101759837 isoform X2 [Setaria 
italica]
Length=443

 Score =   187 bits (475),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 138/468 (29%), Positives = 219/468 (47%), Gaps = 68/468 (15%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK-LLVQYQDLKTDDGTDYLIEEVDASCI  1335
             FS   PVEV  D+ G   +++A+VV+      +   V+Y  L   + +D  + E   +  
Sbjct  21    FSPGDPVEVLPDEPGLRGAYFAAVVVGPSTKPRGYTVEYDALLESEDSDRKLREAVPARS  80

Query  1334  RPC------------PPEIHRISPFKLLDKVDAWVGNGWWEG-HVSKVLGDAKYMVCFGS  1194
                             P +H          VDA   + WW G  +    G  K  VCF  
Sbjct  81    LRPRPPPLRAPASGEAPAVHA--------SVDALHDDAWWLGVALGGADGAGKVKVCFPE  132

Query  1193  MNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKF  1014
               E++ F+A+D+RPH EW +  W +   +++P++                         +
Sbjct  133   TREVMEFDATDIRPHLEWADGEWCSPDSMEIPKTMP-----------------------Y  169

Query  1013  SKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRP  834
             +KGM +E +  E+    +W  AV+  +I  N  L+EY   ++D  +   +E  D  ++RP
Sbjct  170   TKGMQIEVSKLEDDSVVAWLPAVVAKTIWKNNLLVEYTVSKSDGIALS-EEIVDVKHVRP  228

Query  833   CPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPH  654
             CPP       F + +EV+A+   GWW G+I+ V   L Y         E++ +   +R  
Sbjct  229   CPPQASAI-HFCINDEVEAFRGGGWWLGVITDVHPELKYTFKPAHLGVEVQLSQKLLRLR  287

Query  653   QEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWY  474
              +W+D +W    ++S N L                 +  F  GAKVEV  D+EG  G+W+
Sbjct  288   CDWVDGQWK---QESQNTL-----------------KAKFKQGAKVEVSSDDEGFHGAWF  327

Query  473   PALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAW  294
              A +L+  G+ K++VE+ TLK D  T  L +  ++  +RP  P +  VD F+ L+EVDA+
Sbjct  328   EATVLKSAGS-KFVVEYATLKADDETKPLTEAVESRHIRPPPPHIPVVDGFKLLDEVDAF  386

Query  293   SNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              N+ W VG V +V+   KY V F+   E LEF H  LRLH +W+ G W
Sbjct  387   CNDAWWVGVVSKVISNQKYMVYFKRWREELEFEHGQLRLHCDWMGGRW  434


 Score =   121 bits (304),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 102/326 (31%), Positives = 152/326 (47%), Gaps = 50/326 (15%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEV--LMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             P++  +     + KG ++EV  L  D+   W PA V +   + N     + VE+    S 
Sbjct  158   PDSMEIPKTMPYTKGMQIEVSKLEDDSVVAWLPAVVAKTIWKNN-----LLVEYTV--SK  210

Query  1901  DDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEI---LENSMY  1731
              D +   +E V +  VRP PP     +F + +  + F    GW  G + ++   L+ +  
Sbjct  211   SDGIALSEEIVDVKHVRPCPPQASAIHFCINDEVEAF-RGGGWWLGVITDVHPELKYTFK  269

Query  1730  MVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVK  1551
                LG E     V++ Q  LR+  DW DG W              +++S++ L       
Sbjct  270   PAHLGVE-----VQLSQKLLRLRCDWVDGQW--------------KQESQNTLKA-----  305

Query  1550  LRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGT  1371
                         KF +   VEV  D EGF  +W+ + V++  G+ K +V+Y  LK DD T
Sbjct  306   ------------KFKQGAKVEVSSDDEGFHGAWFEATVLKSAGS-KFVVEYATLKADDET  352

Query  1370  DYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSM  1191
               L E V++  IRP PP I  +  FKLLD+VDA+  + WW G VSKV+ + KYMV F   
Sbjct  353   KPLTEAVESRHIRPPPPHIPVVDGFKLLDEVDAFCNDAWWVGVVSKVISNQKYMVYFKRW  412

Query  1190  NELLTFEASDLRPHQEWKNNNWVAAT  1113
              E L FE   LR H +W    W+ A 
Sbjct  413   REELEFEHGQLRLHCDWMGGRWMRAA  438



>ref|XP_007051196.1| Domain of Uncharacterized protein function 724 6, putative isoform 
3 [Theobroma cacao]
 gb|EOX95353.1| Domain of Uncharacterized protein function 724 6, putative isoform 
3 [Theobroma cacao]
Length=872

 Score =   193 bits (490),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 112/305 (37%), Positives = 161/305 (53%), Gaps = 35/305 (11%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNG------KLLVQYQDLKTDDGTDYLIEEV  1350
             F K  PVEV  D+EGF  +WY + ++E           K LVQY+ L  +DG+  L E V
Sbjct  16    FGKATPVEVSSDEEGFRGAWYLATILEFPPKSTSKKRKKALVQYKTLLAEDGSSPLTEHV  75

Query  1349  DASCIRPCPPEIHRISP--FKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
             D + +RP PP+        F++ D VDA   +GWW G V +VL  +KY V F +  +++ 
Sbjct  76    DPAFVRPLPPQEKEEDGQVFEVNDVVDARYRDGWWTGVVRRVLEKSKYRVYFDNPPDVIE  135

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
             FE+ DLR H +W +  WV   K                        +++ G  FS G  V
Sbjct  136   FESKDLRVHWDWIDGKWVRPEK------------------------QQSTGSIFSSGTAV  171

Query  995   EATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIH  816
             E +  +E     W+ A++   +G N FL++YQ+ R DDES  +K   D+ +IRP PP   
Sbjct  172   EVSIDKESIRDVWFPALVIKELGENSFLVKYQSSRNDDESGTVKVVVDSLHIRPTPP--R  229

Query  815   RFDR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWID  639
               DR +++ E VD  YN GW  G+I+KVL G  Y V+F   NE+ E  H  IRP+ EWI+
Sbjct  230   YADRNYELLERVDTTYNFGWRSGVITKVLTGRRYNVFFKHGNEDKELTHTDIRPNVEWIN  289

Query  638   KKWDI  624
              KW++
Sbjct  290   GKWEV  294


 Score =   170 bits (431),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 106/298 (36%), Positives = 156/298 (52%), Gaps = 30/298 (10%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFD------SIGPNKFLLEYQTLRTDDESEPLKEKA  855
             F K   VE +S EEG+ G+WY A I +      S    K L++Y+TL  +D S PL E  
Sbjct  16    FGKATPVEVSSDEEGFRGAWYLATILEFPPKSTSKKRKKALVQYKTLLAEDGSSPLTEHV  75

Query  854   DAFNIRPCPPLIHRFDR--FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIE  681
             D   +RP PP     D   F++ + VDA Y +GWW G++ +VL+   Y VYF    + IE
Sbjct  76    DPAFVRPLPPQEKEEDGQVFEVNDVVDARYRDGWWTGVVRRVLEKSKYRVYFDNPPDVIE  135

Query  680   FAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDD  501
             F    +R H +WID KW              +P   ++ S G    + F  G  VEV  D
Sbjct  136   FESKDLRVHWDWIDGKW-------------VRP--EKQQSTG----SIFSSGTAVEVSID  176

Query  500   EEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDR-  324
             +E  +  W+PAL+++ +G   +LV++++ + D  +  +    D+L +RP+ P  +  DR 
Sbjct  177   KESIRDVWFPALVIKELGENSFLVKYQSSRNDDESGTVKVVVDSLHIRPTPP--RYADRN  234

Query  323   FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +  LE VD   N GWR G + +VL G +Y V F+  NE  E  H  +R + EWING W
Sbjct  235   YELLERVDTTYNFGWRSGVITKVLTGRRYNVFFKHGNEDKELTHTDIRPNVEWINGKW  292


 Score =   121 bits (303),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 102/325 (31%), Positives = 149/325 (46%), Gaps = 46/325 (14%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVLMRDN--FPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCS  1905
             P+T A+  +  F K   VEV   +      W+ A +L  P    +++  +  V+++TL +
Sbjct  6     PDTDALQQQP-FGKATPVEVSSDEEGFRGAWYLATILEFPPKSTSKKRKKALVQYKTLLA  64

Query  1904  DD--DPMKRRKEYVHLSAVRPAPPGEP---CCYFRVGESADVFYENRGWRRGTVDEILEN  1740
             +D   P+    E+V  + VRP PP E       F V +  D  Y + GW  G V  +LE 
Sbjct  65    EDGSSPLT---EHVDPAFVRPLPPQEKEEDGQVFEVNDVVDARYRD-GWWTGVVRRVLEK  120

Query  1739  SMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPS  1560
             S Y V   +   V  ++ E   LRVH DW DG WV P        + QQ           
Sbjct  121   SKYRVYFDNPPDV--IEFESKDLRVHWDWIDGKWVRP--------EKQQ-----------  159

Query  1559  GVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTD  1380
                     + GS    FS    VEV  DKE     W+ ++V++ LG    LV+YQ  + D
Sbjct  160   --------STGSI---FSSGTAVEVSIDKESIRDVWFPALVIKELGENSFLVKYQSSRND  208

Query  1379  DGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCF  1200
             D +  +   VD+  IRP PP  +    ++LL++VD     GW  G ++KVL   +Y V F
Sbjct  209   DESGTVKVVVDSLHIRPTPPR-YADRNYELLERVDTTYNFGWRSGVITKVLTGRRYNVFF  267

Query  1199  GSMNELLTFEASDLRPHQEWKNNNW  1125
                NE      +D+RP+ EW N  W
Sbjct  268   KHGNEDKELTHTDIRPNVEWINGKW  292



>ref|XP_008234600.1| PREDICTED: uncharacterized protein LOC103333529 [Prunus mume]
Length=306

 Score =   183 bits (464),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/287 (38%), Positives = 158/287 (55%), Gaps = 25/287 (9%)
 Frame = -3

Query  1448  ASVVMEVLGNGKLLVQYQDLKTD-DGT----------DYLIEEVDASCIRPCPPEIHRIS  1302
             A ++ +     KL V+Y  +K   DG           + + EEVD + IRP PP+  +  
Sbjct  28    AKIIGKSRDKTKLKVEYNKVKAKIDGNLSRRKRHQQRNEVEEEVDVALIRPLPPQESKYC  87

Query  1301  PFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWV  1122
              FKL D VDA+   GWWEG ++ V+ D+ + V F    E   FE+ +LR H+EW   +W+
Sbjct  88    CFKLGDVVDAFFCGGWWEGVITDVMKDSTFGVYFRFAKEKFEFESEELRLHREWVKGSWL  147

Query  1121  AATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVI  942
                    P    DV    +         +  +   F +G  VE  + E+G+ G+W+ A I
Sbjct  148   P------PLQQGDVSTTEEP--------KPWMKEGFVQGTQVEICTDEDGFQGAWFAANI  193

Query  941   FDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEG  762
                +G +KFL+ Y++++TDD  E L E+ DA +IRPCPP     + F + EEVDA+YN+G
Sbjct  194   VKVMGKDKFLIRYKSIKTDDGKEFLTEEVDAQHIRPCPPETVVVESFSLNEEVDAFYNDG  253

Query  761   WWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
             WWEG+I KVL G  Y VYF  T +E+ F H  +RP Q+WID+ W +A
Sbjct  254   WWEGVIRKVLRGPRYRVYFKGTKDELLFEHSDLRPRQDWIDRTWVMA  300


 Score =   173 bits (438),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 115/332 (35%), Positives = 177/332 (53%), Gaps = 52/332 (16%)
 Frame = -3

Query  2048  AQFNKGDRVEVL-----MRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSD-DDPMK  1887
             + F  GD VEV      MR      FPA ++  S  K +    + VE+  + +  D  + 
Sbjct  4     SNFKIGDEVEVTSPIHNMRGTL---FPAKIIGKSRDKTK----LKVEYNKVKAKIDGNLS  56

Query  1886  RRK---------EYVHLSAVRPAPPGEP--CCYFRVGESADVFYENRGWRRGTVDEILEN  1740
             RRK         E V ++ +RP PP E   CC F++G+  D F+   GW  G + +++++
Sbjct  57    RRKRHQQRNEVEEEVDVALIRPLPPQESKYCC-FKLGDVVDAFFCG-GWWEGVITDVMKD  114

Query  1739  SMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQK--KSEDFLMT  1566
             S + V      A E  + E  +LR+HR+W  G W+PPL++  V    + K    E F+  
Sbjct  115   STFGVYF--RFAKEKFEFESEELRLHREWVKGSWLPPLQQGDVSTTEEPKPWMKEGFV--  170

Query  1565  PSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLK  1386
               G ++ I CT                  D++GF+ +W+A+ +++V+G  K L++Y+ +K
Sbjct  171   -QGTQVEI-CT------------------DEDGFQGAWFAANIVKVMGKDKFLIRYKSIK  210

Query  1385  TDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMV  1206
             TDDG ++L EEVDA  IRPCPPE   +  F L ++VDA+  +GWWEG + KVL   +Y V
Sbjct  211   TDDGKEFLTEEVDAQHIRPCPPETVVVESFSLNEEVDAFYNDGWWEGVIRKVLRGPRYRV  270

Query  1205  CFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
              F    + L FE SDLRP Q+W +  WV A++
Sbjct  271   YFKGTKDELLFEHSDLRPRQDWIDRTWVMASQ  302


 Score =   160 bits (404),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 100/306 (33%), Positives = 159/306 (52%), Gaps = 23/306 (8%)
 Frame = -3

Query  1028  LGPKFSKGMLVEATSFEEGYHGSWYTA-VIFDSIGPNKFLLEYQTLRTD-----------  885
             +G  F  G  VE TS      G+ + A +I  S    K  +EY  ++             
Sbjct  2     VGSNFKIGDEVEVTSPIHNMRGTLFPAKIIGKSRDKTKLKVEYNKVKAKIDGNLSRRKRH  61

Query  884   DESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYF  705
              +   ++E+ D   IRP PP   ++  FK+ + VDA++  GWWEG+I+ V+    + VYF
Sbjct  62    QQRNEVEEEVDVALIRPLPPQESKYCCFKLGDVVDAFFCGGWWEGVITDVMKDSTFGVYF  121

Query  704   WTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSN-NNLPNPKPGIMRRHSGGIASETTFCI  528
                 E+ EF    +R H+EW+   W    ++ + +    PKP +          +  F  
Sbjct  122   RFAKEKFEFESEELRLHREWVKGSWLPPLQQGDVSTTEEPKPWM----------KEGFVQ  171

Query  527   GAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSA  348
             G +VE+  DE+G QG+W+ A I++++G  K+L+ ++++K D G + L +E DA  +RP  
Sbjct  172   GTQVEICTDEDGFQGAWFAANIVKVMGKDKFLIRYKSIKTDDGKEFLTEEVDAQHIRPCP  231

Query  347   PILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQE  168
             P    V+ F   EEVDA+ N+GW  G + +VL G +YRV F+ T + L F H  LR  Q+
Sbjct  232   PETVVVESFSLNEEVDAFYNDGWWEGVIRKVLRGPRYRVYFKGTKDELLFEHSDLRPRQD  291

Query  167   WINGAW  150
             WI+  W
Sbjct  292   WIDRTW  297



>ref|XP_007051195.1| Domain of Uncharacterized protein function 724 6, putative isoform 
2 [Theobroma cacao]
 gb|EOX95352.1| Domain of Uncharacterized protein function 724 6, putative isoform 
2 [Theobroma cacao]
Length=894

 Score =   192 bits (487),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 112/303 (37%), Positives = 159/303 (52%), Gaps = 35/303 (12%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNG------KLLVQYQDLKTDDGTDYLIEEV  1350
             F K  PVEV  D+EGF  +WY + ++E           K LVQY+ L  +DG+  L E V
Sbjct  16    FGKATPVEVSSDEEGFRGAWYLATILEFPPKSTSKKRKKALVQYKTLLAEDGSSPLTEHV  75

Query  1349  DASCIRPCPPEIHRISP--FKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
             D + +RP PP+        F++ D VDA   +GWW G V +VL  +KY V F +  +++ 
Sbjct  76    DPAFVRPLPPQEKEEDGQVFEVNDVVDARYRDGWWTGVVRRVLEKSKYRVYFDNPPDVIE  135

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
             FE+ DLR H +W +  WV   K                        +++ G  FS G  V
Sbjct  136   FESKDLRVHWDWIDGKWVRPEK------------------------QQSTGSIFSSGTAV  171

Query  995   EATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIH  816
             E +  +E     W+ A++   +G N FL++YQ+ R DDES  +K   D+ +IRP PP   
Sbjct  172   EVSIDKESIRDVWFPALVIKELGENSFLVKYQSSRNDDESGTVKVVVDSLHIRPTPP--R  229

Query  815   RFDR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWID  639
               DR +++ E VD  YN GW  G+I+KVL G  Y V+F   NE+ E  H  IRP+ EWI+
Sbjct  230   YADRNYELLERVDTTYNFGWRSGVITKVLTGRRYNVFFKHGNEDKELTHTDIRPNVEWIN  289

Query  638   KKW  630
              KW
Sbjct  290   GKW  292


 Score =   171 bits (432),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 106/298 (36%), Positives = 156/298 (52%), Gaps = 30/298 (10%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFD------SIGPNKFLLEYQTLRTDDESEPLKEKA  855
             F K   VE +S EEG+ G+WY A I +      S    K L++Y+TL  +D S PL E  
Sbjct  16    FGKATPVEVSSDEEGFRGAWYLATILEFPPKSTSKKRKKALVQYKTLLAEDGSSPLTEHV  75

Query  854   DAFNIRPCPPLIHRFDR--FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIE  681
             D   +RP PP     D   F++ + VDA Y +GWW G++ +VL+   Y VYF    + IE
Sbjct  76    DPAFVRPLPPQEKEEDGQVFEVNDVVDARYRDGWWTGVVRRVLEKSKYRVYFDNPPDVIE  135

Query  680   FAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDD  501
             F    +R H +WID KW              +P   ++ S G    + F  G  VEV  D
Sbjct  136   FESKDLRVHWDWIDGKW-------------VRP--EKQQSTG----SIFSSGTAVEVSID  176

Query  500   EEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDR-  324
             +E  +  W+PAL+++ +G   +LV++++ + D  +  +    D+L +RP+ P  +  DR 
Sbjct  177   KESIRDVWFPALVIKELGENSFLVKYQSSRNDDESGTVKVVVDSLHIRPTPP--RYADRN  234

Query  323   FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +  LE VD   N GWR G + +VL G +Y V F+  NE  E  H  +R + EWING W
Sbjct  235   YELLERVDTTYNFGWRSGVITKVLTGRRYNVFFKHGNEDKELTHTDIRPNVEWINGKW  292


 Score =   125 bits (314),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 104/330 (32%), Positives = 153/330 (46%), Gaps = 46/330 (14%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVLMRDN--FPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCS  1905
             P+T A+  +  F K   VEV   +      W+ A +L  P    +++  +  V+++TL +
Sbjct  6     PDTDALQQQP-FGKATPVEVSSDEEGFRGAWYLATILEFPPKSTSKKRKKALVQYKTLLA  64

Query  1904  DD--DPMKRRKEYVHLSAVRPAPPGEP---CCYFRVGESADVFYENRGWRRGTVDEILEN  1740
             +D   P+    E+V  + VRP PP E       F V +  D  Y + GW  G V  +LE 
Sbjct  65    EDGSSPLT---EHVDPAFVRPLPPQEKEEDGQVFEVNDVVDARYRD-GWWTGVVRRVLEK  120

Query  1739  SMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPS  1560
             S Y V   +   V  ++ E   LRVH DW DG WV P        + QQ           
Sbjct  121   SKYRVYFDNPPDV--IEFESKDLRVHWDWIDGKWVRP--------EKQQ-----------  159

Query  1559  GVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTD  1380
                     + GS    FS    VEV  DKE     W+ ++V++ LG    LV+YQ  + D
Sbjct  160   --------STGSI---FSSGTAVEVSIDKESIRDVWFPALVIKELGENSFLVKYQSSRND  208

Query  1379  DGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCF  1200
             D +  +   VD+  IRP PP  +    ++LL++VD     GW  G ++KVL   +Y V F
Sbjct  209   DESGTVKVVVDSLHIRPTPPR-YADRNYELLERVDTTYNFGWRSGVITKVLTGRRYNVFF  267

Query  1199  GSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
                NE      +D+RP+ EW N  WV+ +K
Sbjct  268   KHGNEDKELTHTDIRPNVEWINGKWVSKSK  297



>ref|XP_007051194.1| Domain of Uncharacterized protein function 724 6, putative isoform 
1 [Theobroma cacao]
 gb|EOX95351.1| Domain of Uncharacterized protein function 724 6, putative isoform 
1 [Theobroma cacao]
Length=923

 Score =   191 bits (486),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 112/303 (37%), Positives = 159/303 (52%), Gaps = 35/303 (12%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNG------KLLVQYQDLKTDDGTDYLIEEV  1350
             F K  PVEV  D+EGF  +WY + ++E           K LVQY+ L  +DG+  L E V
Sbjct  16    FGKATPVEVSSDEEGFRGAWYLATILEFPPKSTSKKRKKALVQYKTLLAEDGSSPLTEHV  75

Query  1349  DASCIRPCPPEIHRISP--FKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
             D + +RP PP+        F++ D VDA   +GWW G V +VL  +KY V F +  +++ 
Sbjct  76    DPAFVRPLPPQEKEEDGQVFEVNDVVDARYRDGWWTGVVRRVLEKSKYRVYFDNPPDVIE  135

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
             FE+ DLR H +W +  WV   K                        +++ G  FS G  V
Sbjct  136   FESKDLRVHWDWIDGKWVRPEK------------------------QQSTGSIFSSGTAV  171

Query  995   EATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIH  816
             E +  +E     W+ A++   +G N FL++YQ+ R DDES  +K   D+ +IRP PP   
Sbjct  172   EVSIDKESIRDVWFPALVIKELGENSFLVKYQSSRNDDESGTVKVVVDSLHIRPTPP--R  229

Query  815   RFDR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWID  639
               DR +++ E VD  YN GW  G+I+KVL G  Y V+F   NE+ E  H  IRP+ EWI+
Sbjct  230   YADRNYELLERVDTTYNFGWRSGVITKVLTGRRYNVFFKHGNEDKELTHTDIRPNVEWIN  289

Query  638   KKW  630
              KW
Sbjct  290   GKW  292


 Score =   171 bits (432),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 106/298 (36%), Positives = 156/298 (52%), Gaps = 30/298 (10%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFD------SIGPNKFLLEYQTLRTDDESEPLKEKA  855
             F K   VE +S EEG+ G+WY A I +      S    K L++Y+TL  +D S PL E  
Sbjct  16    FGKATPVEVSSDEEGFRGAWYLATILEFPPKSTSKKRKKALVQYKTLLAEDGSSPLTEHV  75

Query  854   DAFNIRPCPPLIHRFDR--FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIE  681
             D   +RP PP     D   F++ + VDA Y +GWW G++ +VL+   Y VYF    + IE
Sbjct  76    DPAFVRPLPPQEKEEDGQVFEVNDVVDARYRDGWWTGVVRRVLEKSKYRVYFDNPPDVIE  135

Query  680   FAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDD  501
             F    +R H +WID KW              +P   ++ S G    + F  G  VEV  D
Sbjct  136   FESKDLRVHWDWIDGKW-------------VRP--EKQQSTG----SIFSSGTAVEVSID  176

Query  500   EEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDR-  324
             +E  +  W+PAL+++ +G   +LV++++ + D  +  +    D+L +RP+ P  +  DR 
Sbjct  177   KESIRDVWFPALVIKELGENSFLVKYQSSRNDDESGTVKVVVDSLHIRPTPP--RYADRN  234

Query  323   FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +  LE VD   N GWR G + +VL G +Y V F+  NE  E  H  +R + EWING W
Sbjct  235   YELLERVDTTYNFGWRSGVITKVLTGRRYNVFFKHGNEDKELTHTDIRPNVEWINGKW  292


 Score =   125 bits (314),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 104/330 (32%), Positives = 153/330 (46%), Gaps = 46/330 (14%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVLMRDN--FPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCS  1905
             P+T A+  +  F K   VEV   +      W+ A +L  P    +++  +  V+++TL +
Sbjct  6     PDTDALQQQP-FGKATPVEVSSDEEGFRGAWYLATILEFPPKSTSKKRKKALVQYKTLLA  64

Query  1904  DD--DPMKRRKEYVHLSAVRPAPPGEP---CCYFRVGESADVFYENRGWRRGTVDEILEN  1740
             +D   P+    E+V  + VRP PP E       F V +  D  Y + GW  G V  +LE 
Sbjct  65    EDGSSPLT---EHVDPAFVRPLPPQEKEEDGQVFEVNDVVDARYRD-GWWTGVVRRVLEK  120

Query  1739  SMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPS  1560
             S Y V   +   V  ++ E   LRVH DW DG WV P        + QQ           
Sbjct  121   SKYRVYFDNPPDV--IEFESKDLRVHWDWIDGKWVRP--------EKQQ-----------  159

Query  1559  GVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTD  1380
                     + GS    FS    VEV  DKE     W+ ++V++ LG    LV+YQ  + D
Sbjct  160   --------STGSI---FSSGTAVEVSIDKESIRDVWFPALVIKELGENSFLVKYQSSRND  208

Query  1379  DGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCF  1200
             D +  +   VD+  IRP PP  +    ++LL++VD     GW  G ++KVL   +Y V F
Sbjct  209   DESGTVKVVVDSLHIRPTPPR-YADRNYELLERVDTTYNFGWRSGVITKVLTGRRYNVFF  267

Query  1199  GSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
                NE      +D+RP+ EW N  WV+ +K
Sbjct  268   KHGNEDKELTHTDIRPNVEWINGKWVSKSK  297



>ref|XP_004960399.1| PREDICTED: uncharacterized protein LOC101759837 isoform X1 [Setaria 
italica]
Length=444

 Score =   184 bits (466),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 138/469 (29%), Positives = 220/469 (47%), Gaps = 69/469 (15%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK-LLVQYQDLKTDDGTDYLIEEVDASCI  1335
             FS   PVEV  D+ G   +++A+VV+      +   V+Y  L   + +D  + E   +  
Sbjct  21    FSPGDPVEVLPDEPGLRGAYFAAVVVGPSTKPRGYTVEYDALLESEDSDRKLREAVPARS  80

Query  1334  RPC------------PPEIHRISPFKLLDKVDAWVGNGWWEG-HVSKVLGDAKYMVCFGS  1194
                             P +H          VDA   + WW G  +    G  K  VCF  
Sbjct  81    LRPRPPPLRAPASGEAPAVHA--------SVDALHDDAWWLGVALGGADGAGKVKVCFPE  132

Query  1193  MNELLTFEASDLRPHQEWKNNNWVAA-TKIDLPRSSSDVMLNskvvkvkskSDRKALGPK  1017
               E++ F+A+D+RPH EW +  W +  + +++P++                         
Sbjct  133   TREVMEFDATDIRPHLEWADGEWCSPDSMVEIPKTMP-----------------------  169

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             ++KGM +E +  E+    +W  AV+  +I  N  L+EY   ++D  +   +E  D  ++R
Sbjct  170   YTKGMQIEVSKLEDDSVVAWLPAVVAKTIWKNNLLVEYTVSKSDGIALS-EEIVDVKHVR  228

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             PCPP       F + +EV+A+   GWW G+I+ V   L Y         E++ +   +R 
Sbjct  229   PCPPQASAI-HFCINDEVEAFRGGGWWLGVITDVHPELKYTFKPAHLGVEVQLSQKLLRL  287

Query  656   HQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSW  477
               +W+D +W    ++S N L                 +  F  GAKVEV  D+EG  G+W
Sbjct  288   RCDWVDGQWK---QESQNTL-----------------KAKFKQGAKVEVSSDDEGFHGAW  327

Query  476   YPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDA  297
             + A +L+  G+ K++VE+ TLK D  T  L +  ++  +RP  P +  VD F+ L+EVDA
Sbjct  328   FEATVLKSAGS-KFVVEYATLKADDETKPLTEAVESRHIRPPPPHIPVVDGFKLLDEVDA  386

Query  296   WSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             + N+ W VG V +V+   KY V F+   E LEF H  LRLH +W+ G W
Sbjct  387   FCNDAWWVGVVSKVISNQKYMVYFKRWREELEFEHGQLRLHCDWMGGRW  435


 Score =   120 bits (301),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 103/330 (31%), Positives = 155/330 (47%), Gaps = 56/330 (17%)
 Frame = -3

Query  2087  VIDVPETHAMSAEAQFNKGDRVEV--LMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFET  1914
             ++++P+T        + KG ++EV  L  D+   W PA V +   + N     + VE+  
Sbjct  161   MVEIPKTMP------YTKGMQIEVSKLEDDSVVAWLPAVVAKTIWKNN-----LLVEYTV  209

Query  1913  LCSDDDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEI---LE  1743
               S  D +   +E V +  VRP PP     +F + +  + F    GW  G + ++   L+
Sbjct  210   --SKSDGIALSEEIVDVKHVRPCPPQASAIHFCINDEVEAF-RGGGWWLGVITDVHPELK  266

Query  1742  NSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTP  1563
              +     LG E     V++ Q  LR+  DW DG W              +++S++ L   
Sbjct  267   YTFKPAHLGVE-----VQLSQKLLRLRCDWVDGQW--------------KQESQNTLKA-  306

Query  1562  SGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKT  1383
                             KF +   VEV  D EGF  +W+ + V++  G+ K +V+Y  LK 
Sbjct  307   ----------------KFKQGAKVEVSSDDEGFHGAWFEATVLKSAGS-KFVVEYATLKA  349

Query  1382  DDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVC  1203
             DD T  L E V++  IRP PP I  +  FKLLD+VDA+  + WW G VSKV+ + KYMV 
Sbjct  350   DDETKPLTEAVESRHIRPPPPHIPVVDGFKLLDEVDAFCNDAWWVGVVSKVISNQKYMVY  409

Query  1202  FGSMNELLTFEASDLRPHQEWKNNNWVAAT  1113
             F    E L FE   LR H +W    W+ A 
Sbjct  410   FKRWREELEFEHGQLRLHCDWMGGRWMRAA  439



>emb|CBI36980.3| unnamed protein product [Vitis vinifera]
Length=1074

 Score =   189 bits (480),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/301 (36%), Positives = 161/301 (53%), Gaps = 33/301 (11%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEV------LGNGKLLVQYQDLKTDD-GTDYLIEE  1353
             FSK   VEV  D++GF+ +WY + ++E           + LV+YQDL  DD G+  L E 
Sbjct  8     FSKGSLVEVSSDEDGFKGAWYVATILESPPKSASKKRSRALVEYQDLLVDDVGSKPLTEV  67

Query  1352  VDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTF  1173
             VD S +RP PP     + F + D VDA+  +GWW G ++++  D+K  V F +  + + F
Sbjct  68    VDTSFLRPLPPP-EADTNFCVNDIVDAFYRDGWWTGVITRISEDSKCTVFFQNPPDEIQF  126

Query  1172  EASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVE  993
             + SDLR H+EW +  W+   K                        ++  G  FS G  VE
Sbjct  127   DRSDLRVHKEWVDGKWIRPEK------------------------QRTTGLIFSPGAAVE  162

Query  992   ATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHR  813
              T  E+    +W+ A++   IG   ++++ Q+L+   E+  L    D  +IRP PP +  
Sbjct  163   VTLNEQSSRDAWFPAIVRREIGLGSYVVQCQSLKNSGEAGVLDVTVDNLHIRPSPPRLE-  221

Query  812   FDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKK  633
               +F + E+VDA+Y+ GWW G+++KVL G  YVV+F  TN E EF H  +RPH EW+D K
Sbjct  222   GRKFGLLEKVDAFYDYGWWNGIVTKVLTGRRYVVFFKHTNMEKEFIHSDLRPHMEWVDGK  281

Query  632   W  630
             W
Sbjct  282   W  282


 Score =   179 bits (454),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 164/296 (55%), Gaps = 28/296 (9%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPN------KFLLEYQTLRTDD-ESEPLKEK  858
             FSKG LVE +S E+G+ G+WY A I +S   +      + L+EYQ L  DD  S+PL E 
Sbjct  8     FSKGSLVEVSSDEDGFKGAWYVATILESPPKSASKKRSRALVEYQDLLVDDVGSKPLTEV  67

Query  857   ADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEF  678
              D   +RP PP       F + + VDA+Y +GWW G+I+++ +     V+F    +EI+F
Sbjct  68    VDTSFLRPLPP-PEADTNFCVNDIVDAFYRDGWWTGVITRISEDSKCTVFFQNPPDEIQF  126

Query  677   AHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDE  498
                 +R H+EW+D KW I   K             +R +G I     F  GA VEV  +E
Sbjct  127   DRSDLRVHKEWVDGKW-IRPEK-------------QRTTGLI-----FSPGAAVEVTLNE  167

Query  497   EGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFR  318
             + ++ +W+PA++ R IG G Y+V+ ++LK      +L    D L +RPS P L+   +F 
Sbjct  168   QSSRDAWFPAIVRREIGLGSYVVQCQSLKNSGEAGVLDVTVDNLHIRPSPPRLEG-RKFG  226

Query  317   PLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              LE+VDA+ + GW  G V +VL G +Y V F+ TN   EF H  LR H EW++G W
Sbjct  227   LLEKVDAFYDYGWWNGIVTKVLTGRRYVVFFKHTNMEKEFIHSDLRPHMEWVDGKW  282


 Score =   140 bits (353),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 104/326 (32%), Positives = 153/326 (47%), Gaps = 37/326 (11%)
 Frame = -3

Query  2042  FNKGDRVEVLM-RDNFP-IWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDDPMKRRKEY  1872
             F+KG  VEV    D F   W+ A +L  P    +++  +  VE++ L  DD   K   E 
Sbjct  8     FSKGSLVEVSSDEDGFKGAWYVATILESPPKSASKKRSRALVEYQDLLVDDVGSKPLTEV  67

Query  1871  VHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESV  1692
             V  S +RP PP E    F V +  D FY + GW  G +  I E+S   V    ++  + +
Sbjct  68    VDTSFLRPLPPPEADTNFCVNDIVDAFYRD-GWWTGVITRISEDSKCTVFF--QNPPDEI  124

Query  1691  KVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRK  1512
             + ++  LRVH++W DG W+ P          +++++   + +P                 
Sbjct  125   QFDRSDLRVHKEWVDGKWIRP----------EKQRTTGLIFSPGAA--------------  160

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIR  1332
                   VEV  +++    +W+ ++V   +G G  +VQ Q LK       L   VD   IR
Sbjct  161   ------VEVTLNEQSSRDAWFPAIVRREIGLGSYVVQCQSLKNSGEAGVLDVTVDNLHIR  214

Query  1331  PCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRP  1152
             P PP +     F LL+KVDA+   GWW G V+KVL   +Y+V F   N    F  SDLRP
Sbjct  215   PSPPRLEG-RKFGLLEKVDAFYDYGWWNGIVTKVLTGRRYVVFFKHTNMEKEFIHSDLRP  273

Query  1151  HQEWKNNNWVAATKIDLPRSSSDVML  1074
             H EW +  WV AT+  L  + SD  L
Sbjct  274   HMEWVDGKWVGATQEVLGTTYSDEQL  299



>gb|ACF82602.1| unknown [Zea mays]
Length=307

 Score =   173 bits (438),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 106/344 (31%), Positives = 171/344 (50%), Gaps = 46/344 (13%)
 Frame = -3

Query  1181  LTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGM  1002
             + F+A+D+RPH EW +  W +   +++P++                         ++KGM
Sbjct  1     MEFDAADVRPHLEWVDGEWRSPDNMEIPKTMP-----------------------YAKGM  37

Query  1001  LVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPL  822
              +E +  E+    +W  AV+  +I  N  L++Y TL     +   +E  D  ++RPCPP 
Sbjct  38    QIEVSKLEDNSVVAWSPAVVAKTIWKNNLLVDY-TLSKCYGTTLSEEIVDVKHVRPCPPQ  96

Query  821   IHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
                   F + +EV+A+  + WW G+I+ VL    Y         E+E     +R   +W+
Sbjct  97    ASEIS-FCINDEVEAFQGDCWWLGVITNVLPEFKYTFKSTHLGTEVEVNQKFLRLRYDWV  155

Query  641   DKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALI  462
               +W+    + + N+P  K                F  G KVEV  D+EG +G+W+ A +
Sbjct  156   GDQWE----QESKNVPKAK----------------FTQGVKVEVCSDDEGFRGAWFEATV  195

Query  461   LRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNG  282
             ++ +G+ K+LVE+ TLK D GT  L +  +A  +RP  P +   D F+ L+EVDA+ N+ 
Sbjct  196   VKAVGS-KFLVEYATLKADDGTKPLKESVEARHIRPCPPDIPATDGFKLLDEVDAFCNDA  254

Query  281   WRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             W VG V +VL   +  V FR   E +EF H  LRLH +W+ G W
Sbjct  255   WWVGVVSKVLGEKRCTVYFRPWKEEMEFEHAQLRLHCDWMGGRW  298


 Score =   171 bits (433),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 102/294 (35%), Positives = 158/294 (54%), Gaps = 28/294 (10%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIR  1332
             ++K M +EV   ++    +W  +VV + +    LLV Y  L    GT    E VD   +R
Sbjct  33    YAKGMQIEVSKLEDNSVVAWSPAVVAKTIWKNNLLVDYT-LSKCYGTTLSEEIVDVKHVR  91

Query  1331  PCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRP  1152
             PCPP+   IS F + D+V+A+ G+ WW G ++ VL + KY      +   +      LR 
Sbjct  92    PCPPQASEIS-FCINDEVEAFQGDCWWLGVITNVLPEFKYTFKSTHLGTEVEVNQKFLRL  150

Query  1151  HQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEG  972
               +W  + W   +K ++P++                        KF++G+ VE  S +EG
Sbjct  151   RYDWVGDQWEQESK-NVPKA------------------------KFTQGVKVEVCSDDEG  185

Query  971   YHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMF  792
             + G+W+ A +  ++G +KFL+EY TL+ DD ++PLKE  +A +IRPCPP I   D FK+ 
Sbjct  186   FRGAWFEATVVKAVG-SKFLVEYATLKADDGTKPLKESVEARHIRPCPPDIPATDGFKLL  244

Query  791   EEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             +EVDA+ N+ WW G++SKVL      VYF    EE+EF H  +R H +W+  +W
Sbjct  245   DEVDAFCNDAWWVGVVSKVLGEKRCTVYFRPWKEEMEFEHAQLRLHCDWMGGRW  298


 Score =   128 bits (322),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 102/325 (31%), Positives = 154/325 (47%), Gaps = 48/325 (15%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVL-MRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDD  1899
             P+   +     + KG ++EV  + DN  + +  AV+  ++ KN     + V++ TL S  
Sbjct  22    PDNMEIPKTMPYAKGMQIEVSKLEDNSVVAWSPAVVAKTIWKNN----LLVDY-TL-SKC  75

Query  1898  DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYM---  1728
                   +E V +  VRP PP      F + +  + F +   W  G +  +L    Y    
Sbjct  76    YGTTLSEEIVDVKHVRPCPPQASEISFCINDEVEAF-QGDCWWLGVITNVLPEFKYTFKS  134

Query  1727  VALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKL  1548
               LG E     V+V Q  LR+  DW             V  Q++Q+              
Sbjct  135   THLGTE-----VEVNQKFLRLRYDW-------------VGDQWEQE--------------  162

Query  1547  RIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTD  1368
                 ++     KF++ + VEV  D EGF  +W+ + V++ +G+ K LV+Y  LK DDGT 
Sbjct  163   ----SKNVPKAKFTQGVKVEVCSDDEGFRGAWFEATVVKAVGS-KFLVEYATLKADDGTK  217

Query  1367  YLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMN  1188
              L E V+A  IRPCPP+I     FKLLD+VDA+  + WW G VSKVLG+ +  V F    
Sbjct  218   PLKESVEARHIRPCPPDIPATDGFKLLDEVDAFCNDAWWVGVVSKVLGEKRCTVYFRPWK  277

Query  1187  ELLTFEASDLRPHQEWKNNNWVAAT  1113
             E + FE + LR H +W    W+ A+
Sbjct  278   EEMEFEHAQLRLHCDWMGGRWMRAS  302



>ref|XP_009361222.1| PREDICTED: uncharacterized protein LOC103951536 [Pyrus x bretschneideri]
Length=306

 Score =   172 bits (437),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 109/290 (38%), Positives = 155/290 (53%), Gaps = 26/290 (9%)
 Frame = -3

Query  1457  SWYASVVMEVLGNGKLLVQYQDLKT----------DDGTDYLIEEVDASCIRPCPPEIHR  1308
             ++ A +V +     K  V+Y  +K             G   L EEVDA+ +RP PP    
Sbjct  26    TFQAKIVAKSRTKSKFKVEYNRVKARIDRKISGGHKGGKAALREEVDAALLRPPPPRESD  85

Query  1307  ISPFKLLDKVDAWVGNGWWEGHV-SKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNN  1131
                FKL D VDA+   GWWEG V S VL D    V F    E   FE  +LR H+EW+  
Sbjct  86    YR-FKLGDVVDAFFCGGWWEGVVVSDVLVDNTLGVYFRFAKEKFEFEPEELRLHREWEKG  144

Query  1130  NWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYT  951
             +WV       P    DV+         +K  +  +  +  +G  VE  + E+G+ G+W+ 
Sbjct  145   SWVP------PLQQGDVL--------DAKEPKIQMKEELMEGTTVEVCTDEDGFQGAWFA  190

Query  950   AVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWY  771
             A I   +  +KF + Y+T++TDD  E L E+ DA +IRP PP +   + F + EEVDA+Y
Sbjct  191   ANIVKVMEKDKFFIRYKTIKTDDNKELLTEEVDAEHIRPRPPKVVAAESFSLTEEVDAFY  250

Query  770   NEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
             N+GWWEG+I KVL G  Y VYF  T++E+ F H  +RP Q+W+D+ W +A
Sbjct  251   NDGWWEGVIRKVLPGRRYKVYFKGTDDELMFQHSDLRPRQDWMDRTWVMA  300


 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 141/257 (55%), Gaps = 22/257 (9%)
 Frame = -3

Query  1880  KEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAV  1701
             +E V  + +RP PP E    F++G+  D F+    W    V ++L ++   V      A 
Sbjct  68    REEVDAALLRPPPPRESDYRFKLGDVVDAFFCGGWWEGVVVSDVLVDNTLGVYF--RFAK  125

Query  1700  ESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSC  1521
             E  + E  +LR+HR+W+ G WVPPL++  V    + K           ++++ +   G+ 
Sbjct  126   EKFEFEPEELRLHREWEKGSWVPPLQQGDVLDAKEPK-----------IQMKEELMEGTT  174

Query  1520  VRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDAS  1341
             V         EV  D++GF+ +W+A+ +++V+   K  ++Y+ +KTDD  + L EEVDA 
Sbjct  175   V---------EVCTDEDGFQGAWFAANIVKVMEKDKFFIRYKTIKTDDNKELLTEEVDAE  225

Query  1340  CIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
              IRP PP++     F L ++VDA+  +GWWEG + KVL   +Y V F   ++ L F+ SD
Sbjct  226   HIRPRPPKVVAAESFSLTEEVDAFYNDGWWEGVIRKVLPGRRYKVYFKGTDDELMFQHSD  285

Query  1160  LRPHQEWKNNNWVAATK  1110
             LRP Q+W +  WV A++
Sbjct  286   LRPRQDWMDRTWVMASQ  302


 Score =   145 bits (366),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 99/303 (33%), Positives = 157/303 (52%), Gaps = 22/303 (7%)
 Frame = -3

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTA-VIFDSIGPNKFLLEYQTLRTDDESE---------  873
             P F  G  VE TS      G+ + A ++  S   +KF +EY  ++   + +         
Sbjct  5     PHFEVGDEVEVTSPIHNMRGTTFQAKIVAKSRTKSKFKVEYNRVKARIDRKISGGHKGGK  64

Query  872   -PLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLI-SKVLDGLNYVVYFWT  699
               L+E+ DA  +RP PP    + RFK+ + VDA++  GWWEG++ S VL      VYF  
Sbjct  65    AALREEVDAALLRPPPPRESDY-RFKLGDVVDAFFCGGWWEGVVVSDVLVDNTLGVYFRF  123

Query  698   TNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAK  519
               E+ EF    +R H+EW    W +   +  + L   +P I  +             G  
Sbjct  124   AKEKFEFEPEELRLHREWEKGSW-VPPLQQGDVLDAKEPKIQMKEE--------LMEGTT  174

Query  518   VEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPIL  339
             VEV  DE+G QG+W+ A I++++   K+ + ++T+K D   +LL +E DA  +RP  P +
Sbjct  175   VEVCTDEDGFQGAWFAANIVKVMEKDKFFIRYKTIKTDDNKELLTEEVDAEHIRPRPPKV  234

Query  338   QRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWIN  159
                + F   EEVDA+ N+GW  G + +VL G +Y+V F+ T++ L F+H  LR  Q+W++
Sbjct  235   VAAESFSLTEEVDAFYNDGWWEGVIRKVLPGRRYKVYFKGTDDELMFQHSDLRPRQDWMD  294

Query  158   GAW  150
               W
Sbjct  295   RTW  297



>ref|XP_009351875.1| PREDICTED: uncharacterized protein LOC103943322 [Pyrus x bretschneideri]
 ref|XP_009351876.1| PREDICTED: uncharacterized protein LOC103943322 [Pyrus x bretschneideri]
Length=305

 Score =   172 bits (435),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/253 (40%), Positives = 143/253 (57%), Gaps = 16/253 (6%)
 Frame = -3

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHV-SKVLGDAKYMVCF  1200
             G   L EEVDA+ +RP PP       FKL D VDA+   GWWEG V + VL D  + V F
Sbjct  62    GNAALREEVDAALLRPSPPR-ESDYRFKLGDVVDAFFCGGWWEGVVVTDVLVDNTFGVYF  120

Query  1199  GSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGP  1020
                 E   FE  +LR H+EW N +W+       P    DV+         ++  +  +  
Sbjct  121   RFAKEKFEFEPEELRLHREWVNGSWIP------PLQQGDVL--------DAEEAKIRMKE  166

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNI  840
             +  +G  VE  + E+G+ G+W+ A I + +  +KFL+ Y+ ++TDD  E L E+ DA ++
Sbjct  167   ELIEGTAVEVCTDEDGFQGAWFAANIVEVMEKDKFLIRYKAIKTDDNRELLTEEVDAMHV  226

Query  839   RPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIR  660
             RP PP +     F + EEVDA+YN+GWWEG+I KVL G  Y VYF  T++E+   H  +R
Sbjct  227   RPRPPKVVVAGSFSLTEEVDAFYNDGWWEGVIRKVLHGRRYKVYFKGTDDELLLQHSDLR  286

Query  659   PHQEWIDKKWDIA  621
             P Q+WID+ W +A
Sbjct  287   PRQDWIDRTWVMA  299


 Score =   157 bits (398),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 101/326 (31%), Positives = 168/326 (52%), Gaps = 37/326 (11%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVL--MRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPM---  1890
             A+A F  GD VEV   + +     FPA +    V K++   +  VE+    +  D     
Sbjct  2     ADAHFEVGDEVEVTSPIHNMRGTTFPAKI----VAKSRTKSKFKVEYNRAKARIDRKIGG  57

Query  1889  ------KRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYM  1728
                      +E V  + +RP+PP E    F++G+  D F+    W    V ++L ++ + 
Sbjct  58    GHKGGNAALREEVDAALLRPSPPRESDYRFKLGDVVDAFFCGGWWEGVVVTDVLVDNTFG  117

Query  1727  VALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKL  1548
             V      A E  + E  +LR+HR+W +G W+PPL++  V    + K           +++
Sbjct  118   VYF--RFAKEKFEFEPEELRLHREWVNGSWIPPLQQGDVLDAEEAK-----------IRM  164

Query  1547  RIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTD  1368
             + +   G+ V         EV  D++GF+ +W+A+ ++EV+   K L++Y+ +KTDD  +
Sbjct  165   KEELIEGTAV---------EVCTDEDGFQGAWFAANIVEVMEKDKFLIRYKAIKTDDNRE  215

Query  1367  YLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMN  1188
              L EEVDA  +RP PP++     F L ++VDA+  +GWWEG + KVL   +Y V F   +
Sbjct  216   LLTEEVDAMHVRPRPPKVVVAGSFSLTEEVDAFYNDGWWEGVIRKVLHGRRYKVYFKGTD  275

Query  1187  ELLTFEASDLRPHQEWKNNNWVAATK  1110
             + L  + SDLRP Q+W +  WV A++
Sbjct  276   DELLLQHSDLRPRQDWIDRTWVMASQ  301


 Score =   145 bits (366),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 100/302 (33%), Positives = 157/302 (52%), Gaps = 24/302 (8%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTA-VIFDSIGPNKFLLEYQ--TLRTDDE--------SEP  870
             F  G  VE TS      G+ + A ++  S   +KF +EY     R D +        +  
Sbjct  6     FEVGDEVEVTSPIHNMRGTTFPAKIVAKSRTKSKFKVEYNRAKARIDRKIGGGHKGGNAA  65

Query  869   LKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLI-SKVLDGLNYVVYFWTTN  693
             L+E+ DA  +RP PP    + RFK+ + VDA++  GWWEG++ + VL    + VYF    
Sbjct  66    LREEVDAALLRPSPPRESDY-RFKLGDVVDAFFCGGWWEGVVVTDVLVDNTFGVYFRFAK  124

Query  692   EEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPG-IMRRHSGGIASETTFCIGAKV  516
             E+ EF    +R H+EW++  W          +P  + G ++      I  +     G  V
Sbjct  125   EKFEFEPEELRLHREWVNGSW----------IPPLQQGDVLDAEEAKIRMKEELIEGTAV  174

Query  515   EVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQ  336
             EV  DE+G QG+W+ A I+ ++   K+L+ ++ +K D   +LL +E DA+ VRP  P + 
Sbjct  175   EVCTDEDGFQGAWFAANIVEVMEKDKFLIRYKAIKTDDNRELLTEEVDAMHVRPRPPKVV  234

Query  335   RVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWING  156
                 F   EEVDA+ N+GW  G + +VL G +Y+V F+ T++ L  +H  LR  Q+WI+ 
Sbjct  235   VAGSFSLTEEVDAFYNDGWWEGVIRKVLHGRRYKVYFKGTDDELLLQHSDLRPRQDWIDR  294

Query  155   AW  150
              W
Sbjct  295   TW  296



>ref|XP_008376873.1| PREDICTED: uncharacterized protein LOC103439987 isoform X2 [Malus 
domestica]
Length=306

 Score =   171 bits (434),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 108/287 (38%), Positives = 152/287 (53%), Gaps = 26/287 (9%)
 Frame = -3

Query  1448  ASVVMEVLGNGKLLVQYQDLKT----------DDGTDYLIEEVDASCIRPCPPEIHRISP  1299
             A +V +     K  V+Y  +K             G   L EEVDA+ +RP PP       
Sbjct  29    AKIVAKSRTKSKFKVEYNRVKARIDRKISGGHKGGKAALREEVDAALLRPPPPRQSDYR-  87

Query  1298  FKLLDKVDAWVGNGWWEGHV-SKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWV  1122
             FKL D VDA+   GWWEG V S VL D    V F    E   FE  +LR H+EW   +WV
Sbjct  88    FKLGDVVDAFFCGGWWEGVVVSDVLVDNTLGVYFRFAKEKFEFEPEELRLHREWVKGSWV  147

Query  1121  AATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVI  942
                    P    DV+         +K  +  +  +  +G  VE  + E+G+ G+W+ A I
Sbjct  148   P------PLQQGDVL--------DAKEPKTGMNEELIEGTTVEVCTDEDGFQGAWFAANI  193

Query  941   FDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEG  762
                +  +KF + Y+T++TDD  E L E+ DA +IRP PP +   + F + E+VDA+YN+G
Sbjct  194   VKVMEKDKFFIRYKTIKTDDNKELLTEEVDAKHIRPRPPKVVAAESFSLTEDVDAFYNDG  253

Query  761   WWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
             WWEG+I KVL G  Y VYF  T++E+ F H  +RP Q+W+D+ W +A
Sbjct  254   WWEGVIRKVLPGRRYKVYFKGTDDELMFQHSDLRPRQDWMDRTWVMA  300


 Score =   151 bits (381),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 100/328 (30%), Positives = 160/328 (49%), Gaps = 37/328 (11%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEVL--MRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDD---  1896
             M+    F  GD VEV   + +     FPA +    V K++   +  VE+  + +  D   
Sbjct  1     MADATHFEVGDEVEVTSPIHNMRGTTFPAKI----VAKSRTKSKFKVEYNRVKARIDRKI  56

Query  1895  ------PMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSM  1734
                        +E V  + +RP PP +    F++G+  D F+    W    V ++L ++ 
Sbjct  57    SGGHKGGKAALREEVDAALLRPPPPRQSDYRFKLGDVVDAFFCGGWWEGVVVSDVLVDNT  116

Query  1733  YMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGV  1554
               V      A E  + E  +LR+HR+W  G WVPPL++  V                   
Sbjct  117   LGVYF--RFAKEKFEFEPEELRLHREWVKGSWVPPLQQGDV-------------------  155

Query  1553  KLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDG  1374
              L  K  +     +  +   VEV  D++GF+ +W+A+ +++V+   K  ++Y+ +KTDD 
Sbjct  156   -LDAKEPKTGMNEELIEGTTVEVCTDEDGFQGAWFAANIVKVMEKDKFFIRYKTIKTDDN  214

Query  1373  TDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGS  1194
              + L EEVDA  IRP PP++     F L + VDA+  +GWWEG + KVL   +Y V F  
Sbjct  215   KELLTEEVDAKHIRPRPPKVVAAESFSLTEDVDAFYNDGWWEGVIRKVLPGRRYKVYFKG  274

Query  1193  MNELLTFEASDLRPHQEWKNNNWVAATK  1110
              ++ L F+ SDLRP Q+W +  WV A++
Sbjct  275   TDDELMFQHSDLRPRQDWMDRTWVMASQ  302


 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 157/302 (52%), Gaps = 24/302 (8%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTA-VIFDSIGPNKFLLEYQTLRTDDESE----------P  870
             F  G  VE TS      G+ + A ++  S   +KF +EY  ++   + +           
Sbjct  7     FEVGDEVEVTSPIHNMRGTTFPAKIVAKSRTKSKFKVEYNRVKARIDRKISGGHKGGKAA  66

Query  869   LKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLI-SKVLDGLNYVVYFWTTN  693
             L+E+ DA  +RP PP    + RFK+ + VDA++  GWWEG++ S VL      VYF    
Sbjct  67    LREEVDAALLRPPPPRQSDY-RFKLGDVVDAFFCGGWWEGVVVSDVLVDNTLGVYFRFAK  125

Query  692   EEIEFAHHGIRPHQEWIDKKWDIAFRKSNN-NLPNPKPGIMRRHSGGIASETTFCIGAKV  516
             E+ EF    +R H+EW+   W    ++ +  +   PK G+                G  V
Sbjct  126   EKFEFEPEELRLHREWVKGSWVPPLQQGDVLDAKEPKTGM----------NEELIEGTTV  175

Query  515   EVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQ  336
             EV  DE+G QG+W+ A I++++   K+ + ++T+K D   +LL +E DA  +RP  P + 
Sbjct  176   EVCTDEDGFQGAWFAANIVKVMEKDKFFIRYKTIKTDDNKELLTEEVDAKHIRPRPPKVV  235

Query  335   RVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWING  156
               + F   E+VDA+ N+GW  G + +VL G +Y+V F+ T++ L F+H  LR  Q+W++ 
Sbjct  236   AAESFSLTEDVDAFYNDGWWEGVIRKVLPGRRYKVYFKGTDDELMFQHSDLRPRQDWMDR  295

Query  155   AW  150
              W
Sbjct  296   TW  297


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 69/147 (47%), Gaps = 13/147 (9%)
 Frame = -3

Query  554  IASETTFCIGAKVEVKDDEEGNQGSWYPA-LILRLIGNGKYLVEFRTLKCDF--------  402
            +A  T F +G +VEV       +G+ +PA ++ +     K+ VE+  +K           
Sbjct  1    MADATHFEVGDEVEVTSPIHNMRGTTFPAKIVAKSRTKSKFKVEYNRVKARIDRKISGGH  60

Query  401  --GTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVC-EVLEGAKYRV  231
              G   L +E DA  +RP  P  Q   RF+  + VDA+   GW  G V  +VL      V
Sbjct  61   KGGKAALREEVDAALLRPPPP-RQSDYRFKLGDVVDAFFCGGWWEGVVVSDVLVDNTLGV  119

Query  230  NFRTTNEILEFRHHGLRLHQEWINGAW  150
             FR   E  EF    LRLH+EW+ G+W
Sbjct  120  YFRFAKEKFEFEPEELRLHREWVKGSW  146



>ref|XP_008376872.1| PREDICTED: uncharacterized protein LOC103439987 isoform X1 [Malus 
domestica]
Length=326

 Score =   171 bits (434),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 108/287 (38%), Positives = 152/287 (53%), Gaps = 26/287 (9%)
 Frame = -3

Query  1448  ASVVMEVLGNGKLLVQYQDLKT----------DDGTDYLIEEVDASCIRPCPPEIHRISP  1299
             A +V +     K  V+Y  +K             G   L EEVDA+ +RP PP       
Sbjct  29    AKIVAKSRTKSKFKVEYNRVKARIDRKISGGHKGGKAALREEVDAALLRPPPPRQSDYR-  87

Query  1298  FKLLDKVDAWVGNGWWEGHV-SKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWV  1122
             FKL D VDA+   GWWEG V S VL D    V F    E   FE  +LR H+EW   +WV
Sbjct  88    FKLGDVVDAFFCGGWWEGVVVSDVLVDNTLGVYFRFAKEKFEFEPEELRLHREWVKGSWV  147

Query  1121  AATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVI  942
                    P    DV+         +K  +  +  +  +G  VE  + E+G+ G+W+ A I
Sbjct  148   P------PLQQGDVL--------DAKEPKTGMNEELIEGTTVEVCTDEDGFQGAWFAANI  193

Query  941   FDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEG  762
                +  +KF + Y+T++TDD  E L E+ DA +IRP PP +   + F + E+VDA+YN+G
Sbjct  194   VKVMEKDKFFIRYKTIKTDDNKELLTEEVDAKHIRPRPPKVVAAESFSLTEDVDAFYNDG  253

Query  761   WWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA  621
             WWEG+I KVL G  Y VYF  T++E+ F H  +RP Q+W+D+ W +A
Sbjct  254   WWEGVIRKVLPGRRYKVYFKGTDDELMFQHSDLRPRQDWMDRTWVMA  300


 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 101/331 (31%), Positives = 162/331 (49%), Gaps = 37/331 (11%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEVL--MRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDD---  1896
             M+    F  GD VEV   + +     FPA +    V K++   +  VE+  + +  D   
Sbjct  1     MADATHFEVGDEVEVTSPIHNMRGTTFPAKI----VAKSRTKSKFKVEYNRVKARIDRKI  56

Query  1895  ------PMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSM  1734
                        +E V  + +RP PP +    F++G+  D F+    W    V ++L ++ 
Sbjct  57    SGGHKGGKAALREEVDAALLRPPPPRQSDYRFKLGDVVDAFFCGGWWEGVVVSDVLVDNT  116

Query  1733  YMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGV  1554
               V      A E  + E  +LR+HR+W  G WVPPL++  V                   
Sbjct  117   LGVYF--RFAKEKFEFEPEELRLHREWVKGSWVPPLQQGDV-------------------  155

Query  1553  KLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDG  1374
              L  K  +     +  +   VEV  D++GF+ +W+A+ +++V+   K  ++Y+ +KTDD 
Sbjct  156   -LDAKEPKTGMNEELIEGTTVEVCTDEDGFQGAWFAANIVKVMEKDKFFIRYKTIKTDDN  214

Query  1373  TDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGS  1194
              + L EEVDA  IRP PP++     F L + VDA+  +GWWEG + KVL   +Y V F  
Sbjct  215   KELLTEEVDAKHIRPRPPKVVAAESFSLTEDVDAFYNDGWWEGVIRKVLPGRRYKVYFKG  274

Query  1193  MNELLTFEASDLRPHQEWKNNNWVAATKIDL  1101
              ++ L F+ SDLRP Q+W +  WV A+++ L
Sbjct  275   TDDELMFQHSDLRPRQDWMDRTWVMASQLAL  305


 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 157/302 (52%), Gaps = 24/302 (8%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTA-VIFDSIGPNKFLLEYQTLRTDDESE----------P  870
             F  G  VE TS      G+ + A ++  S   +KF +EY  ++   + +           
Sbjct  7     FEVGDEVEVTSPIHNMRGTTFPAKIVAKSRTKSKFKVEYNRVKARIDRKISGGHKGGKAA  66

Query  869   LKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLI-SKVLDGLNYVVYFWTTN  693
             L+E+ DA  +RP PP    + RFK+ + VDA++  GWWEG++ S VL      VYF    
Sbjct  67    LREEVDAALLRPPPPRQSDY-RFKLGDVVDAFFCGGWWEGVVVSDVLVDNTLGVYFRFAK  125

Query  692   EEIEFAHHGIRPHQEWIDKKWDIAFRKSNN-NLPNPKPGIMRRHSGGIASETTFCIGAKV  516
             E+ EF    +R H+EW+   W    ++ +  +   PK G+                G  V
Sbjct  126   EKFEFEPEELRLHREWVKGSWVPPLQQGDVLDAKEPKTGM----------NEELIEGTTV  175

Query  515   EVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQ  336
             EV  DE+G QG+W+ A I++++   K+ + ++T+K D   +LL +E DA  +RP  P + 
Sbjct  176   EVCTDEDGFQGAWFAANIVKVMEKDKFFIRYKTIKTDDNKELLTEEVDAKHIRPRPPKVV  235

Query  335   RVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWING  156
               + F   E+VDA+ N+GW  G + +VL G +Y+V F+ T++ L F+H  LR  Q+W++ 
Sbjct  236   AAESFSLTEDVDAFYNDGWWEGVIRKVLPGRRYKVYFKGTDDELMFQHSDLRPRQDWMDR  295

Query  155   AW  150
              W
Sbjct  296   TW  297


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 69/147 (47%), Gaps = 13/147 (9%)
 Frame = -3

Query  554  IASETTFCIGAKVEVKDDEEGNQGSWYPA-LILRLIGNGKYLVEFRTLKCDF--------  402
            +A  T F +G +VEV       +G+ +PA ++ +     K+ VE+  +K           
Sbjct  1    MADATHFEVGDEVEVTSPIHNMRGTTFPAKIVAKSRTKSKFKVEYNRVKARIDRKISGGH  60

Query  401  --GTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVC-EVLEGAKYRV  231
              G   L +E DA  +RP  P  Q   RF+  + VDA+   GW  G V  +VL      V
Sbjct  61   KGGKAALREEVDAALLRPPPP-RQSDYRFKLGDVVDAFFCGGWWEGVVVSDVLVDNTLGV  119

Query  230  NFRTTNEILEFRHHGLRLHQEWINGAW  150
             FR   E  EF    LRLH+EW+ G+W
Sbjct  120  YFRFAKEKFEFEPEELRLHREWVKGSW  146



>gb|EPS73094.1| hypothetical protein M569_01661, partial [Genlisea aurea]
Length=297

 Score =   170 bits (431),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 155/303 (51%), Gaps = 24/303 (8%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEV-----LGNGKLLVQYQDL-KTDDGTDYLIEEV  1350
             F +   VE+    EGF RSWYA  V+         + K+LV+Y+ L +++     L EEV
Sbjct  9     FKEGAEVEISSSDEGFRRSWYAGAVIRPPEDPNRASSKVLVEYKTLTESERKKTPLQEEV  68

Query  1349  DASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFE  1170
             +   +RP PP + R   FKL D+VDA+  +GWWEG +++VL + ++ V F    E ++F+
Sbjct  69    ELVQLRP-PPPVERGRSFKLNDEVDAYYNDGWWEGVITQVLAEDEFSVFFPGTREQISFK  127

Query  1169  ASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEA  990
             +S LR H+EW    WV                        S   +   G  F +G  VEA
Sbjct  128   SSHLRLHREWVQGKWVC--------------YKLAPSPSSSSKRKSRQGEHFCEGDQVEA  173

Query  989   TSFEEGYHGSWYTAVIFDSIGP---NKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLI  819
                 +G+ G+W+ A I         + +L+EY  +R DD S  L+ + D  NIRP PP  
Sbjct  174   HIEGDGFEGAWFAAKIVKKSSSSSKHNYLIEYADIREDDYSGFLRSEVDRKNIRPRPPYH  233

Query  818   HRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWID  639
                D F++   V+A Y +GWW G+I +V    NY+VYF  T +E+ F H  +R HQEW  
Sbjct  234   VSVDSFQVGAAVEALYADGWWAGVIRRVFINGNYLVYFEGTGDEMRFNHSQLRIHQEWRQ  293

Query  638   KKW  630
              KW
Sbjct  294   GKW  296


 Score =   156 bits (395),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 101/298 (34%), Positives = 155/298 (52%), Gaps = 19/298 (6%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYT-AVIFDSIGPN----KFLLEYQTL-RTDDESEPLKEKA  855
             F +G  VE +S +EG+  SWY  AVI     PN    K L+EY+TL  ++ +  PL+E+ 
Sbjct  9     FKEGAEVEISSSDEGFRRSWYAGAVIRPPEDPNRASSKVLVEYKTLTESERKKTPLQEEV  68

Query  854   DAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFA  675
             +   +RP PP + R   FK+ +EVDA+YN+GWWEG+I++VL    + V+F  T E+I F 
Sbjct  69    ELVQLRPPPP-VERGRSFKLNDEVDAYYNDGWWEGVITQVLAEDEFSVFFPGTREQISFK  127

Query  674   HHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEE  495
                +R H+EW+  KW       + +  + +      H         FC G +VE   + +
Sbjct  128   SSHLRLHREWVQGKWVCYKLAPSPSSSSKRKSRQGEH---------FCEGDQVEAHIEGD  178

Query  494   GNQGSWYPALILRLIGNG---KYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDR  324
             G +G+W+ A I++   +     YL+E+  ++ D  +  L  E D  ++RP  P    VD 
Sbjct  179   GFEGAWFAAKIVKKSSSSSKHNYLIEYADIREDDYSGFLRSEVDRKNIRPRPPYHVSVDS  238

Query  323   FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             F+    V+A   +GW  G +  V     Y V F  T + + F H  LR+HQEW  G W
Sbjct  239   FQVGAAVEALYADGWWAGVIRRVFINGNYLVYFEGTGDEMRFNHSQLRIHQEWRQGKW  296


 Score =   127 bits (319),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 87/311 (28%), Positives = 143/311 (46%), Gaps = 28/311 (9%)
 Frame = -3

Query  2042  FNKGDRVEVLMRDNF--PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYV  1869
             F +G  VE+   D      W+  AV+RP    N+ + ++ VE++TL   +      +E V
Sbjct  9     FKEGAEVEISSSDEGFRRSWYAGAVIRPPEDPNRASSKVLVEYKTLTESERKKTPLQEEV  68

Query  1868  HLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVK  1689
              L  +RP PP E    F++ +  D +Y N GW  G + ++L    + V        E + 
Sbjct  69    ELVQLRPPPPVERGRSFKLNDEVDAYY-NDGWWEGVITQVLAEDEFSVFF--PGTREQIS  125

Query  1688  VEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKF  1509
              +   LR+HR+W  G WV           Y+       L        + K  +G     F
Sbjct  126   FKSSHLRLHREWVQGKWVC----------YK-------LAPSPSSSSKRKSRQGE---HF  165

Query  1508  SKEMPVEVKGDKEGFERSWYASVVMEVLGNG---KLLVQYQDLKTDDGTDYLIEEVDASC  1338
              +   VE   + +GFE +W+A+ +++   +      L++Y D++ DD + +L  EVD   
Sbjct  166   CEGDQVEAHIEGDGFEGAWFAAKIVKKSSSSSKHNYLIEYADIREDDYSGFLRSEVDRKN  225

Query  1337  IRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDL  1158
             IRP PP    +  F++   V+A   +GWW G + +V  +  Y+V F    + + F  S L
Sbjct  226   IRPRPPYHVSVDSFQVGAAVEALYADGWWAGVIRRVFINGNYLVYFEGTGDEMRFNHSQL  285

Query  1157  RPHQEWKNNNW  1125
             R HQEW+   W
Sbjct  286   RIHQEWRQGKW  296



>ref|XP_006654960.1| PREDICTED: uncharacterized protein LOC102704061 [Oryza brachyantha]
Length=321

 Score =   171 bits (432),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 105/353 (30%), Positives = 173/353 (49%), Gaps = 46/353 (13%)
 Frame = -3

Query  1208  VCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKA  1029
             VCF    E++ F+A+D+RPH EW    W++  K+++ ++                     
Sbjct  4     VCFPETREVVEFDAADVRPHLEWVAGEWLSPEKMEISKTM--------------------  43

Query  1028  LGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADA  849
                 ++KG  VE    E     +W++A++  +I  N  L++Y   ++D  + P KE    
Sbjct  44    ---PYTKGSQVEVAKLEGNPVVAWFSAIVEKAIWKNSVLVDYNCSKSDGSALP-KEIIHL  99

Query  848   FNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHH  669
              +IRPCPP    F  F++ +EV+ +   GWW G+I++V    +Y      + +E++    
Sbjct  100   NHIRPCPPHASSFS-FRINDEVEGFQGNGWWLGVITEVHPEFSYTFQPAHSGKEVQLDQK  158

Query  668   GIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGN  489
              +R   +WID +W    ++ + N+   K G                 G+KVEV  ++EG 
Sbjct  159   TLRLRYDWIDGQW----QQVSQNVLTEKIGE----------------GSKVEVTSNDEGF  198

Query  488   QGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLE  309
              G+W+ A  ++ + N K LVE+  LK D     L +  +   VRP  P +     F  L+
Sbjct  199   CGAWFQATAVKYVNN-KILVEYDALKADDEITPLTETIEVQHVRPCPPDITVSSGFNLLD  257

Query  308   EVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             EVDA  N+GW VG + +V+   +Y V FR+T E +EF H  LR H +W+ G W
Sbjct  258   EVDACWNDGWWVGVISKVISDQRYMVYFRSTGEEIEFGHEQLRFHCDWVGGRW  310


 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/367 (29%), Positives = 170/367 (46%), Gaps = 57/367 (16%)
 Frame = -3

Query  1730  MVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVK  1551
             MVA+   +  E V+ +   +R H +W  G W+ P                         K
Sbjct  1     MVAVCFPETREVVEFDAADVRPHLEWVAGEWLSPE------------------------K  36

Query  1550  LRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGT  1371
             + I  T       ++K   VEV   +     +W++++V + +    +LV Y   K+D G+
Sbjct  37    MEISKTM-----PYTKGSQVEVAKLEGNPVVAWFSAIVEKAIWKNSVLVDYNCSKSD-GS  90

Query  1370  DYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSM  1191
                 E +  + IRPCPP     S F++ D+V+ + GNGWW G +++V  +  Y       
Sbjct  91    ALPKEIIHLNHIRPCPPHASSFS-FRINDEVEGFQGNGWWLGVITEVHPEFSYTFQPAHS  149

Query  1190  NELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFS  1011
              + +  +   LR   +W +  W   ++                           L  K  
Sbjct  150   GKEVQLDQKTLRLRYDWIDGQWQQVSQ-------------------------NVLTEKIG  184

Query  1010  KGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPC  831
             +G  VE TS +EG+ G+W+ A     +  NK L+EY  L+ DDE  PL E  +  ++RPC
Sbjct  185   EGSKVEVTSNDEGFCGAWFQATAVKYVN-NKILVEYDALKADDEITPLTETIEVQHVRPC  243

Query  830   PPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQ  651
             PP I     F + +EVDA +N+GWW G+ISKV+    Y+VYF +T EEIEF H  +R H 
Sbjct  244   PPDITVSSGFNLLDEVDACWNDGWWVGVISKVISDQRYMVYFRSTGEEIEFGHEQLRFHC  303

Query  650   EWIDKKW  630
             +W+  +W
Sbjct  304   DWVGGRW  310


 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 101/323 (31%), Positives = 154/323 (48%), Gaps = 44/323 (14%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVLMRDNFPI--WFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             PE   +S    + KG +VEV   +  P+  WF +A++  ++ KN     + V++   CS 
Sbjct  34    PEKMEISKTMPYTKGSQVEVAKLEGNPVVAWF-SAIVEKAIWKNS----VLVDYN--CSK  86

Query  1901  DDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVA  1722
              D     KE +HL+ +RP PP      FR+ +  + F  N GW  G + E+     Y   
Sbjct  87    SDGSALPKEIIHLNHIRPCPPHASSFSFRINDEVEGFQGN-GWWLGVITEVHPEFSY--T  143

Query  1721  LGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRI  1542
                  + + V+++Q  LR+  DW DG W              Q+ S++ L          
Sbjct  144   FQPAHSGKEVQLDQKTLRLRYDWIDGQW--------------QQVSQNVL----------  179

Query  1541  KCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYL  1362
                      K  +   VEV  + EGF  +W+ +  ++ + N K+LV+Y  LK DD    L
Sbjct  180   -------TEKIGEGSKVEVTSNDEGFCGAWFQATAVKYVNN-KILVEYDALKADDEITPL  231

Query  1361  IEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
              E ++   +RPCPP+I   S F LLD+VDA   +GWW G +SKV+ D +YMV F S  E 
Sbjct  232   TETIEVQHVRPCPPDITVSSGFNLLDEVDACWNDGWWVGVISKVISDQRYMVYFRSTGEE  291

Query  1181  LTFEASDLRPHQEWKNNNWVAAT  1113
             + F    LR H +W    W+ A+
Sbjct  292   IEFGHEQLRFHCDWVGGRWMRAS  314



>gb|KHG00643.1| Myosin-2 [Gossypium arboreum]
Length=917

 Score =   178 bits (452),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 111/304 (37%), Positives = 154/304 (51%), Gaps = 37/304 (12%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNG------KLLVQYQDLKTDDGTDYLIEEV  1350
              SK   VEV  D+EGF  +WY + ++E+          K  V+Y+ L  DDG   L E V
Sbjct  17    LSKGAQVEVSSDEEGFRGAWYLATILEMPPKSTSKKRKKAFVRYKALLADDGKSPLTEHV  76

Query  1349  DASCIRPCPP--EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
             D   IRP PP  + +  S F++ D VDA   +GWW G V KVL  +KY V F +  +++ 
Sbjct  77    DPGYIRPLPPNEKGNAQSGFEVNDVVDARYRDGWWTGVVRKVLSKSKYRVYFDNPPDVIE  136

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
             F+  DLR H +W + NWV   K                        +++ G  FS G  V
Sbjct  137   FDRKDLRVHWDWIDGNWVRPEK------------------------QQSTGSVFSSGTAV  172

Query  995   EATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIH  816
             E    +E     W+ A++        FL++YQ  + DDES   K   D+ +IRP PP   
Sbjct  173   EVNVDDENLRDVWFPAIVVKENEDKTFLVKYQNSKNDDESGTAKVVVDSLHIRPTPP---  229

Query  815   RF-DR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
             R+ DR +++ E VD  YN GW  G+I+KVL G  Y V+F   NE+ E +H  IRP+ EW 
Sbjct  230   RYADRNYELLERVDTTYNFGWRTGVITKVLTGRRYNVFFKHGNEDKELSHSDIRPNVEWT  289

Query  641   DKKW  630
             D KW
Sbjct  290   DGKW  293


 Score =   155 bits (393),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 102/298 (34%), Positives = 147/298 (49%), Gaps = 30/298 (10%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFD------SIGPNKFLLEYQTLRTDDESEPLKEKA  855
              SKG  VE +S EEG+ G+WY A I +      S    K  + Y+ L  DD   PL E  
Sbjct  17    LSKGAQVEVSSDEEGFRGAWYLATILEMPPKSTSKKRKKAFVRYKALLADDGKSPLTEHV  76

Query  854   DAFNIRPCPP--LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIE  681
             D   IRP PP    +    F++ + VDA Y +GWW G++ KVL    Y VYF    + IE
Sbjct  77    DPGYIRPLPPNEKGNAQSGFEVNDVVDARYRDGWWTGVVRKVLSKSKYRVYFDNPPDVIE  136

Query  680   FAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDD  501
             F    +R H +WID  W              +P   ++ S G    + F  G  VEV  D
Sbjct  137   FDRKDLRVHWDWIDGNW-------------VRP--EKQQSTG----SVFSSGTAVEVNVD  177

Query  500   EEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDR-  324
             +E  +  W+PA++++   +  +LV+++  K D  +       D+L +RP+ P  +  DR 
Sbjct  178   DENLRDVWFPAIVVKENEDKTFLVKYQNSKNDDESGTAKVVVDSLHIRPTPP--RYADRN  235

Query  323   FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +  LE VD   N GWR G + +VL G +Y V F+  NE  E  H  +R + EW +G W
Sbjct  236   YELLERVDTTYNFGWRTGVITKVLTGRRYNVFFKHGNEDKELSHSDIRPNVEWTDGKW  293


 Score =   116 bits (291),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 96/329 (29%), Positives = 149/329 (45%), Gaps = 45/329 (14%)
 Frame = -3

Query  2072  ETHAMSAEAQFNKGDRVEVLMRDNF--PIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSD  1902
             E   +  +   +KG +VEV   +      W+ A +L  P    +++  + +V ++ L +D
Sbjct  7     ENDPLQQQQPLSKGAQVEVSSDEEGFRGAWYLATILEMPPKSTSKKRKKAFVRYKALLAD  66

Query  1901  D--DPMKRRKEYVHLSAVRPAPP---GEPCCYFRVGESADVFYENRGWRRGTVDEILENS  1737
             D   P+    E+V    +RP PP   G     F V +  D  Y + GW  G V ++L  S
Sbjct  67    DGKSPLT---EHVDPGYIRPLPPNEKGNAQSGFEVNDVVDARYRD-GWWTGVVRKVLSKS  122

Query  1736  MYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSG  1557
              Y V   +   V  ++ ++  LRVH DW DG WV P        + QQ            
Sbjct  123   KYRVYFDNPPDV--IEFDRKDLRVHWDWIDGNWVRP--------EKQQ------------  160

Query  1556  VKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD  1377
                    + GS    FS    VEV  D E     W+ ++V++   +   LV+YQ+ K DD
Sbjct  161   -------STGSV---FSSGTAVEVNVDDENLRDVWFPAIVVKENEDKTFLVKYQNSKNDD  210

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
              +      VD+  IRP PP  +    ++LL++VD     GW  G ++KVL   +Y V F 
Sbjct  211   ESGTAKVVVDSLHIRPTPPR-YADRNYELLERVDTTYNFGWRTGVITKVLTGRRYNVFFK  269

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATK  1110
               NE      SD+RP+ EW +  W++ +K
Sbjct  270   HGNEDKELSHSDIRPNVEWTDGKWISKSK  298



>gb|AFW82724.1| hypothetical protein ZEAMMB73_548849 [Zea mays]
 gb|AFW82725.1| hypothetical protein ZEAMMB73_548849 [Zea mays]
 gb|AFW82726.1| hypothetical protein ZEAMMB73_548849 [Zea mays]
Length=275

 Score =   166 bits (421),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 98/276 (36%), Positives = 149/276 (54%), Gaps = 28/276 (10%)
 Frame = -3

Query  1457  SWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKV  1278
             +W  +VV + +    LLV Y  L    GT    E VD   +RPCPP+   IS F + D+V
Sbjct  19    AWSPAVVAKTIWKNNLLVDYT-LSKCYGTTLSEEIVDVKHVRPCPPQASEIS-FCINDEV  76

Query  1277  DAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLP  1098
             +A+ G+ WW G ++ VL + KY      +   +      LR   +W  + W   +K ++P
Sbjct  77    EAFQGDCWWLGVITNVLPEFKYTFKSTHLGTEVEVNQKFLRLRYDWVGDQWEQESK-NVP  135

Query  1097  RSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK  918
             ++                        KF++G+ VE  S +EG+ G+W+ A +  ++G +K
Sbjct  136   KA------------------------KFTQGVKVEVCSDDEGFRGAWFEATVVKAVG-SK  170

Query  917   FLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISK  738
             FL+EY TL+ DD ++PLKE  +A +IRPCPP I   D FK+ +EVDA+ N+ WW G++SK
Sbjct  171   FLVEYATLKADDGTKPLKESVEARHIRPCPPDIPATDGFKLLDEVDAFCNDAWWVGVVSK  230

Query  737   VLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             VL      VYF    EE+EF H  +R H +W+  +W
Sbjct  231   VLGEKRCTVYFRPWKEEMEFEHAQLRLHCDWMGGRW  266


 Score =   150 bits (378),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 144/279 (52%), Gaps = 23/279 (8%)
 Frame = -3

Query  986  SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFD  807
            S+E+    +W  AV+  +I  N  L++Y TL     +   +E  D  ++RPCPP      
Sbjct  11   SWEDNSVVAWSPAVVAKTIWKNNLLVDY-TLSKCYGTTLSEEIVDVKHVRPCPPQASEIS  69

Query  806  RFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWD  627
             F + +EV+A+  + WW G+I+ VL    Y         E+E     +R   +W+  +W+
Sbjct  70   -FCINDEVEAFQGDCWWLGVITNVLPEFKYTFKSTHLGTEVEVNQKFLRLRYDWVGDQWE  128

Query  626  IAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIG  447
                + + N+P  K                F  G KVEV  D+EG +G+W+ A +++ +G
Sbjct  129  ----QESKNVPKAK----------------FTQGVKVEVCSDDEGFRGAWFEATVVKAVG  168

Query  446  NGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQ  267
            + K+LVE+ TLK D GT  L +  +A  +RP  P +   D F+ L+EVDA+ N+ W VG 
Sbjct  169  S-KFLVEYATLKADDGTKPLKESVEARHIRPCPPDIPATDGFKLLDEVDAFCNDAWWVGV  227

Query  266  VCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
            V +VL   +  V FR   E +EF H  LRLH +W+ G W
Sbjct  228  VSKVLGEKRCTVYFRPWKEEMEFEHAQLRLHCDWMGGRW  266


 Score =   124 bits (312),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 88/259 (34%), Positives = 124/259 (48%), Gaps = 41/259 (16%)
 Frame = -3

Query  1880  KEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYM---VALGDE  1710
             +E V +  VRP PP      F + +  + F +   W  G +  +L    Y      LG E
Sbjct  50    EEIVDVKHVRPCPPQASEISFCINDEVEAF-QGDCWWLGVITNVLPEFKYTFKSTHLGTE  108

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTR  1530
                  V+V Q  LR+  DW             V  Q++Q+        P           
Sbjct  109   -----VEVNQKFLRLRYDW-------------VGDQWEQESKN----VPKA---------  137

Query  1529  GSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEV  1350
                  KF++ + VEV  D EGF  +W+ + V++ +G+ K LV+Y  LK DDGT  L E V
Sbjct  138   -----KFTQGVKVEVCSDDEGFRGAWFEATVVKAVGS-KFLVEYATLKADDGTKPLKESV  191

Query  1349  DASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFE  1170
             +A  IRPCPP+I     FKLLD+VDA+  + WW G VSKVLG+ +  V F    E + FE
Sbjct  192   EARHIRPCPPDIPATDGFKLLDEVDAFCNDAWWVGVVSKVLGEKRCTVYFRPWKEEMEFE  251

Query  1169  ASDLRPHQEWKNNNWVAAT  1113
              + LR H +W    W+ A+
Sbjct  252   HAQLRLHCDWMGGRWMRAS  270


 Score = 52.0 bits (123),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 67/149 (45%), Gaps = 16/149 (11%)
 Frame = -3

Query  2051  EAQFNKGDRVEVLMRDNF--PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRK  1878
             +A+F +G +VEV   D      WF A V++          +  VE+ TL +DD   K  K
Sbjct  136   KAKFTQGVKVEVCSDDEGFRGAWFEATVVKAV------GSKFLVEYATLKADDG-TKPLK  188

Query  1877  EYVHLSAVRPAPPGEPCC-YFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAV  1701
             E V    +RP PP  P    F++ +  D F  N  W  G V ++L      V        
Sbjct  189   ESVEARHIRPCPPDIPATDGFKLLDEVDAFC-NDAWWVGVVSKVLGEKRCTVYF--RPWK  245

Query  1700  ESVKVEQWQLRVHRDWKDGCWV---PPLE  1623
             E ++ E  QLR+H DW  G W+   P LE
Sbjct  246   EEMEFEHAQLRLHCDWMGGRWMRASPALE  274



>gb|KDP28289.1| hypothetical protein JCGZ_14060 [Jatropha curcas]
Length=929

 Score =   176 bits (447),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 109/301 (36%), Positives = 156/301 (52%), Gaps = 35/301 (12%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNG------KLLVQYQDLKTDDGTDYLIEEV  1350
             ++K   VEV  D++GF  +WY + +++           +L+V+Y+ L T+DG+  L E V
Sbjct  23    YNKGQEVEVSSDEDGFRGAWYPATIVDSPTKSASKKRKRLMVKYKTLLTEDGSAPLTELV  82

Query  1349  DASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFE  1170
             D S +RP PPE +    F+  D VDA   +GWW G V KVL  ++  V F +  E++ F+
Sbjct  83    DPSHVRPLPPE-NGDRLFQENDVVDARYRDGWWTGIVRKVLESSRCRVFFANPPEVIDFD  141

Query  1169  ASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEA  990
               DLR H EW N +WV   K                        ++  G  FS G  VE 
Sbjct  142   GKDLRVHLEWVNGHWVRPEK------------------------QQTTGSVFSSGTAVEV  177

Query  989   TSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRF  810
                +E    +W+ AV+    G   FL++YQ+    DE+   K   DA +IRP PP     
Sbjct  178   NIDQENVRDAWFPAVVIKENGDETFLVKYQSSGNSDEA-GTKVTVDALHIRPMPP--RYA  234

Query  809   DR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKK  633
             DR F++ E+VDA YN GW  G+I+K+L G  Y V+F   NE+ E  H  IRPH EWI+ +
Sbjct  235   DRNFELLEKVDAQYNFGWRAGVITKLLAGRKYNVFFKQGNEDRELYHSEIRPHVEWINGQ  294

Query  632   W  630
             W
Sbjct  295   W  295


 Score =   169 bits (428),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 106/299 (35%), Positives = 158/299 (53%), Gaps = 36/299 (12%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPN------KFLLEYQTLRTDDESEPLKEKA  855
             ++KG  VE +S E+G+ G+WY A I DS   +      + +++Y+TL T+D S PL E  
Sbjct  23    YNKGQEVEVSSDEDGFRGAWYPATIVDSPTKSASKKRKRLMVKYKTLLTEDGSAPLTELV  82

Query  854   DAFNIRPCPPLIHRFDR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEF  678
             D  ++RP PP     DR F+  + VDA Y +GWW G++ KVL+     V+F    E I+F
Sbjct  83    DPSHVRPLPP--ENGDRLFQENDVVDARYRDGWWTGIVRKVLESSRCRVFFANPPEVIDF  140

Query  677   AHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDE  498
                 +R H EW++  W                    R      + + F  G  VEV  D+
Sbjct  141   DGKDLRVHLEWVNGHW-------------------VRPEKQQTTGSVFSSGTAVEVNIDQ  181

Query  497   EGNQGSWYPALILRLIGNGKYLVEFRTL--KCDFGTDLLVQEADALSVRPSAPILQRVDR  324
             E  + +W+PA++++  G+  +LV++++     + GT + V   DAL +RP  P  +  DR
Sbjct  182   ENVRDAWFPAVVIKENGDETFLVKYQSSGNSDEAGTKVTV---DALHIRPMPP--RYADR  236

Query  323   -FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              F  LE+VDA  N GWR G + ++L G KY V F+  NE  E  H  +R H EWING W
Sbjct  237   NFELLEKVDAQYNFGWRAGVITKLLAGRKYNVFFKQGNEDRELYHSEIRPHVEWINGQW  295


 Score =   122 bits (306),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 102/316 (32%), Positives = 148/316 (47%), Gaps = 43/316 (14%)
 Frame = -3

Query  2042  FNKGDRVEVLM-RDNF-PIWFPAAVL-RPSVRKNQRAGQIYVEFETLCSDDD--PMKRRK  1878
             +NKG  VEV    D F   W+PA ++  P+   +++  ++ V+++TL ++D   P+    
Sbjct  23    YNKGQEVEVSSDEDGFRGAWYPATIVDSPTKSASKKRKRLMVKYKTLLTEDGSAPLT---  79

Query  1877  EYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVE  1698
             E V  S VRP PP      F+  +  D  Y + GW  G V ++LE+S   V   +   V 
Sbjct  80    ELVDPSHVRPLPPENGDRLFQENDVVDARYRD-GWWTGIVRKVLESSRCRVFFANPPEV-  137

Query  1697  SVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCV  1518
              +  +   LRVH +W +G WV P        + QQ                   T GS  
Sbjct  138   -IDFDGKDLRVHLEWVNGHWVRP--------EKQQ-------------------TTGSV-  168

Query  1517  RKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASC  1338
               FS    VEV  D+E    +W+ +VV++  G+   LV+YQ     D     +  VDA  
Sbjct  169   --FSSGTAVEVNIDQENVRDAWFPAVVIKENGDETFLVKYQSSGNSDEAGTKVT-VDALH  225

Query  1337  IRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDL  1158
             IRP PP  +    F+LL+KVDA    GW  G ++K+L   KY V F   NE      S++
Sbjct  226   IRPMPPR-YADRNFELLEKVDAQYNFGWRAGVITKLLAGRKYNVFFKQGNEDRELYHSEI  284

Query  1157  RPHQEWKNNNWVAATK  1110
             RPH EW N  W   +K
Sbjct  285   RPHVEWINGQWFCKSK  300



>gb|EEC78467.1| hypothetical protein OsI_18337 [Oryza sativa Indica Group]
Length=455

 Score =   170 bits (430),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 127/453 (28%), Positives = 196/453 (43%), Gaps = 43/453 (9%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEI  1314
             VEV  D+ G+  + + + V     N +       +  D     L E V AS +RP PP+ 
Sbjct  32    VEVLPDEPGYRGAHFPASVTASHANPRGYT----VAYDGSGCPLGEVVAASQLRPRPPDA  87

Query  1313  HRISPFKLLDKVDAWVGNGWW---EGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQE  1143
              R  P      VDA+ G  WW        +     +  VCF    E++ F+A+D+RPH E
Sbjct  88    PRGVPPAEHAVVDAFKGGAWWVGVALGGGRAAAGGRVAVCFPETREVVEFDAADVRPHLE  147

Query  1142  WKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHG  963
             W    W++   + + ++                         + KG  VE    E     
Sbjct  148   WVAGEWLSPENMGISKTMP-----------------------YKKGTQVEVAKLEGNSVV  184

Query  962   SWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEV  783
             +W++A +  +I  N  L++Y   + D    P KE  D  +IRP P        F + +EV
Sbjct  185   AWFSAAVEKAIWKNSLLVDYNCSKNDGSVLP-KEIVDLKHIRPHPQHASAI-IFCINDEV  242

Query  782   DAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNN  603
             + +   GWW G+I+ V     Y      + +EI+     +R   +W   +W         
Sbjct  243   EGFQGNGWWLGVITDVHPEFRYTFKAAHSGKEIQLDQKALRLRYDWTHDQW--------Q  294

Query  602   NLPNPKPGIMRRHSGGIASETT--FCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLV  429
              +    PG+         +  T  F  G+KVEV  +++G  G+W+    L+ + N K LV
Sbjct  295   QVTQMIPGLFYMLLPTFHNNVTKKFAKGSKVEVTSNDDGFHGAWFQGTALKYVNN-KILV  353

Query  428   EFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLE  249
             E+  LK D     L +  +   VRP  P +     F  L+EVDA  N+GW VG + +V  
Sbjct  354   EYDALKADDEITPLTEAIEVQHVRPCPPDIPVTSGFNLLDEVDACWNDGWWVGVISKVNS  413

Query  248   GAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             G +Y V FR++ E  EF H  LRLH +W+ G W
Sbjct  414   GDRYMVYFRSSTEETEFGHEQLRLHCDWVGGRW  446


 Score =   138 bits (348),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/323 (31%), Positives = 149/323 (46%), Gaps = 30/323 (9%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEV--LMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             PE   +S    + KG +VEV  L  ++   WF AAV + ++ KN     + V++   CS 
Sbjct  156   PENMGISKTMPYKKGTQVEVAKLEGNSVVAWFSAAVEK-AIWKNS----LLVDYN--CSK  208

Query  1901  DDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVA  1722
             +D     KE V L  +RP P       F + +  + F  N GW  G + ++     Y   
Sbjct  209   NDGSVLPKEIVDLKHIRPHPQHASAIIFCINDEVEGFQGN-GWWLGVITDVHPEFRYTFK  267

Query  1721  LGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRI  1542
                    + ++++Q  LR+  DW    W          QQ  Q       M P    + +
Sbjct  268   AAHSG--KEIQLDQKALRLRYDWTHDQW----------QQVTQ-------MIPGLFYMLL  308

Query  1541  KCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYL  1362
                  +  +KF+K   VEV  + +GF  +W+    ++ + N K+LV+Y  LK DD    L
Sbjct  309   PTFHNNVTKKFAKGSKVEVTSNDDGFHGAWFQGTALKYVNN-KILVEYDALKADDEITPL  367

Query  1361  IEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
              E ++   +RPCPP+I   S F LLD+VDA   +GWW G +SKV    +YMV F S  E 
Sbjct  368   TEAIEVQHVRPCPPDIPVTSGFNLLDEVDACWNDGWWVGVISKVNSGDRYMVYFRSSTEE  427

Query  1181  LTFEASDLRPHQEWKNNNWVAAT  1113
               F    LR H +W    W+ A+
Sbjct  428   TEFGHEQLRLHCDWVGGRWMRAS  450


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 75/294 (26%), Positives = 116/294 (39%), Gaps = 29/294 (10%)
 Frame = -3

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDS-IGPNKFLLEYQTLRTDDESEPLKEKADAFN  843
             +F  G LVE    E GY G+ + A +  S   P  + + Y     D    PL E   A  
Sbjct  25    QFRPGDLVEVLPDEPGYRGAHFPASVTASHANPRGYTVAY-----DGSGCPLGEVVAASQ  79

Query  842   IRPCPPLIHRFDRFKMFEEVDAWYNEGWW---EGLISKVLDGLNYVVYFWTTNEEIEFAH  672
             +RP PP   R         VDA+    WW        +   G    V F  T E +EF  
Sbjct  80    LRPRPPDAPRGVPPAEHAVVDAFKGGAWWVGVALGGGRAAAGGRVAVCFPETREVVEFDA  139

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
               +RPH EW+  +W                  +   + GI+    +  G +VEV   E  
Sbjct  140   ADVRPHLEWVAGEW------------------LSPENMGISKTMPYKKGTQVEVAKLEGN  181

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPL  312
             +  +W+ A + + I     LV++   K D G+ L  +  D   +RP  P       F   
Sbjct  182   SVVAWFSAAVEKAIWKNSLLVDYNCSKND-GSVLPKEIVDLKHIRPH-PQHASAIIFCIN  239

Query  311   EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +EV+ +  NGW +G + +V    +Y      + + ++     LRL  +W +  W
Sbjct  240   DEVEGFQGNGWWLGVITDVHPEFRYTFKAAHSGKEIQLDQKALRLRYDWTHDQW  293



>ref|XP_003569071.1| PREDICTED: uncharacterized protein LOC100841839 isoform X1 [Brachypodium 
distachyon]
Length=449

 Score =   169 bits (428),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 110/379 (29%), Positives = 182/379 (48%), Gaps = 48/379 (13%)
 Frame = -3

Query  1280  VDAWVGNGWWEGHVSKVLGDA--KYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKI  1107
             VDA     WW G      G A  +  VCF    E++ F+A+D+RPH EW    W      
Sbjct  108   VDALRDGAWWLGVALLGGGRAHGRVAVCFPETREVVEFDAADVRPHLEWVAGEW------  161

Query  1106  DLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIG  927
                RS  D+  + +                + KG  VE +  E+    +W+  V+  +I 
Sbjct  162   ---RSPEDLETSKRT--------------PYKKGTQVEVSKLEDNSVIAWFPGVVAKTIW  204

Query  926   PNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGL  747
              +  L++Y + ++D  S    E  +  +IRPCPP       F + ++V+ +  +GWW G+
Sbjct  205   KDNLLVDYTSSKSDGSSL-CSEIVEMRHIRPCPPRTSAI-CFSVNDDVEGFQGDGWWPGM  262

Query  746   ISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRR  567
             I +V   L Y      + ++++     +R   +W+D +W+   + S N L          
Sbjct  263   IIEVHPELKYTFKLANSGKDLQLDQKALRLRYDWVDGQWE---KVSQNWL----------  309

Query  566   HSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLL  387
                    +T F  G++VEV  ++EG +G+W+   +L+ +G+ KYLVE+  LK +  T  L
Sbjct  310   -------QTEFAKGSRVEVSSNDEGFRGAWFQGTVLKSVGH-KYLVEYDALKAEDETTPL  361

Query  386   VQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEI  207
              +      +RPS P +   + F+ L+EVDA+ N+GW VG + +V+   K  V F++  E 
Sbjct  362   TETIGEEHIRPSPPDIPVSNGFKFLDEVDAFCNDGWWVGVISKVISDQKCMVYFKSYKEE  421

Query  206   LEFRHHGLRLHQEWINGAW  150
              EF    LRLH +W+ G W
Sbjct  422   NEFGREQLRLHCDWVGGRW  440


 Score =   133 bits (335),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 100/320 (31%), Positives = 149/320 (47%), Gaps = 44/320 (14%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVL-MRDNFPI-WFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             PE    S    + KG +VEV  + DN  I WFP  V +   + N     + V++ +  SD
Sbjct  164   PEDLETSKRTPYKKGTQVEVSKLEDNSVIAWFPGVVAKTIWKDN-----LLVDYTSSKSD  218

Query  1901  DDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVA  1722
                +    E V +  +RP PP      F V +  + F +  GW  G + E+     Y   
Sbjct  219   GSSLC--SEIVEMRHIRPCPPRTSAICFSVNDDVEGF-QGDGWWPGMIIEVHPELKYTFK  275

Query  1721  LGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRI  1542
             L +    + ++++Q  LR+  DW DG W              +K S+++L T        
Sbjct  276   LANSG--KDLQLDQKALRLRYDWVDGQW--------------EKVSQNWLQT--------  311

Query  1541  KCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYL  1362
                      +F+K   VEV  + EGF  +W+   V++ +G+ K LV+Y  LK +D T  L
Sbjct  312   ---------EFAKGSRVEVSSNDEGFRGAWFQGTVLKSVGH-KYLVEYDALKAEDETTPL  361

Query  1361  IEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
              E +    IRP PP+I   + FK LD+VDA+  +GWW G +SKV+ D K MV F S  E 
Sbjct  362   TETIGEEHIRPSPPDIPVSNGFKFLDEVDAFCNDGWWVGVISKVISDQKCMVYFKSYKEE  421

Query  1181  LTFEASDLRPHQEWKNNNWV  1122
               F    LR H +W    W+
Sbjct  422   NEFGREQLRLHCDWVGGRWM  441



>ref|XP_010231824.1| PREDICTED: uncharacterized protein LOC100841839 isoform X2 [Brachypodium 
distachyon]
Length=448

 Score =   169 bits (427),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 108/379 (28%), Positives = 180/379 (47%), Gaps = 49/379 (13%)
 Frame = -3

Query  1280  VDAWVGNGWWEGHVSKVLGDA--KYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKI  1107
             VDA     WW G      G A  +  VCF    E++ F+A+D+RPH EW    W +   +
Sbjct  108   VDALRDGAWWLGVALLGGGRAHGRVAVCFPETREVVEFDAADVRPHLEWVAGEWRSPEDL  167

Query  1106  DLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIG  927
                R+                         + KG  VE +  E+    +W+  V+  +I 
Sbjct  168   TSKRT------------------------PYKKGTQVEVSKLEDNSVIAWFPGVVAKTIW  203

Query  926   PNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGL  747
              +  L++Y + ++D  S    E  +  +IRPCPP       F + ++V+ +  +GWW G+
Sbjct  204   KDNLLVDYTSSKSDGSSL-CSEIVEMRHIRPCPPRTSAI-CFSVNDDVEGFQGDGWWPGM  261

Query  746   ISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRR  567
             I +V   L Y      + ++++     +R   +W+D +W+   + S N L          
Sbjct  262   IIEVHPELKYTFKLANSGKDLQLDQKALRLRYDWVDGQWE---KVSQNWL----------  308

Query  566   HSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLL  387
                    +T F  G++VEV  ++EG +G+W+   +L+ +G+ KYLVE+  LK +  T  L
Sbjct  309   -------QTEFAKGSRVEVSSNDEGFRGAWFQGTVLKSVGH-KYLVEYDALKAEDETTPL  360

Query  386   VQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEI  207
              +      +RPS P +   + F+ L+EVDA+ N+GW VG + +V+   K  V F++  E 
Sbjct  361   TETIGEEHIRPSPPDIPVSNGFKFLDEVDAFCNDGWWVGVISKVISDQKCMVYFKSYKEE  420

Query  206   LEFRHHGLRLHQEWINGAW  150
              EF    LRLH +W+ G W
Sbjct  421   NEFGREQLRLHCDWVGGRW  439


 Score =   131 bits (329),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 98/314 (31%), Positives = 147/314 (47%), Gaps = 44/314 (14%)
 Frame = -3

Query  2057  SAEAQFNKGDRVEVL-MRDNFPI-WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKR  1884
             S    + KG +VEV  + DN  I WFP  V +   + N     + V++ +  SD   +  
Sbjct  169   SKRTPYKKGTQVEVSKLEDNSVIAWFPGVVAKTIWKDN-----LLVDYTSSKSDGSSLC-  222

Query  1883  RKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDA  1704
               E V +  +RP PP      F V +  + F +  GW  G + E+     Y   L +   
Sbjct  223   -SEIVEMRHIRPCPPRTSAICFSVNDDVEGF-QGDGWWPGMIIEVHPELKYTFKLANSG-  279

Query  1703  VESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGS  1524
              + ++++Q  LR+  DW DG W              +K S+++L T              
Sbjct  280   -KDLQLDQKALRLRYDWVDGQW--------------EKVSQNWLQT--------------  310

Query  1523  CVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDA  1344
                +F+K   VEV  + EGF  +W+   V++ +G+ K LV+Y  LK +D T  L E +  
Sbjct  311   ---EFAKGSRVEVSSNDEGFRGAWFQGTVLKSVGH-KYLVEYDALKAEDETTPLTETIGE  366

Query  1343  SCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEAS  1164
               IRP PP+I   + FK LD+VDA+  +GWW G +SKV+ D K MV F S  E   F   
Sbjct  367   EHIRPSPPDIPVSNGFKFLDEVDAFCNDGWWVGVISKVISDQKCMVYFKSYKEENEFGRE  426

Query  1163  DLRPHQEWKNNNWV  1122
              LR H +W    W+
Sbjct  427   QLRLHCDWVGGRWM  440



>ref|XP_010495955.1| PREDICTED: uncharacterized protein LOC104773104 [Camelina sativa]
Length=281

 Score =   164 bits (415),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/259 (36%), Positives = 139/259 (54%), Gaps = 20/259 (8%)
 Frame = -3

Query  896  LRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNY  717
             + +D  EPLKE  D  +IRP PP    ++ F + ++++A+YN+GWW G + + + G   
Sbjct  24   FKEEDGVEPLKEVIDFLHIRPPPPR-DEYEDFSVGDKINAFYNDGWWIGFVIEGMKGGTV  82

Query  716  VVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETT  537
             ++F  T E++ F   G+R H++W++  W          LP  K G ++R      S   
Sbjct  83   GIHFRQTGEKMRFGRQGLRLHKDWVNGTW---------QLPPLKGGQIKREKTVSCSRNV  133

Query  536  ----------FCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLL  387
                      F IG  VEV  +E+G +GSW+PA ++   GN K +VE+  LK + G + L
Sbjct  134  RPKKAIEKQEFSIGTPVEVSSEEQGFEGSWFPAKLVEYRGNDKCVVEYDNLKAEDGKEPL  193

Query  386  VQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEI  207
             +E +   +RP       V  F   ++VDA  N+GW VG + +VL  + Y V F  T E+
Sbjct  194  REEVNVSEIRPQPVEQVMVCPFEKNDKVDALYNDGWWVGVIRKVLAKSSYLVYFENTQEM  253

Query  206  LEFRHHGLRLHQEWINGAW  150
            L+F H  LRLHQEWING W
Sbjct  254  LKFHHSQLRLHQEWINGKW  272


 Score =   158 bits (399),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/269 (35%), Positives = 145/269 (54%), Gaps = 15/269 (6%)
 Frame = -3

Query  1913  LCSDDDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSM  1734
             L  ++D ++  KE +    +RP PP +    F VG+  + FY N GW  G V E ++   
Sbjct  23    LFKEEDGVEPLKEVIDFLHIRPPPPRDEYEDFSVGDKINAFY-NDGWWIGFVIEGMKGGT  81

Query  1733  YMVALGDEDAVESVKVEQWQLRVHRDWKDGCW-VPPLEESQVDQQYQQKKSEDFLMTPSG  1557
               V +      E ++  +  LR+H+DW +G W +PPL+  Q+ ++     S +       
Sbjct  82    --VGIHFRQTGEKMRFGRQGLRLHKDWVNGTWQLPPLKGGQIKREKTVSCSRN-------  132

Query  1556  VKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD  1377
                 ++  +    ++FS   PVEV  +++GFE SW+ + ++E  GN K +V+Y +LK +D
Sbjct  133   ----VRPKKAIEKQEFSIGTPVEVSSEEQGFEGSWFPAKLVEYRGNDKCVVEYDNLKAED  188

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
             G + L EEV+ S IRP P E   + PF+  DKVDA   +GWW G + KVL  + Y+V F 
Sbjct  189   GKEPLREEVNVSEIRPQPVEQVMVCPFEKNDKVDALYNDGWWVGVIRKVLAKSSYLVYFE  248

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             +  E+L F  S LR HQEW N  W+   K
Sbjct  249   NTQEMLKFHHSQLRLHQEWINGKWITNFK  277


 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/260 (35%), Positives = 136/260 (52%), Gaps = 7/260 (3%)
 Frame = -3

Query  1391  LKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKY  1212
              K +DG + L E +D   IRP PP       F + DK++A+  +GWW G V + +     
Sbjct  24    FKEEDGVEPLKEVIDFLHIRPPPPR-DEYEDFSVGDKINAFYNDGWWIGFVIEGMKGGTV  82

Query  1211  MVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRK  1032
              + F    E + F    LR H++W N  W        P     +     V   ++   +K
Sbjct  83    GIHFRQTGEKMRFGRQGLRLHKDWVNGTWQLP-----PLKGGQIKREKTVSCSRNVRPKK  137

Query  1031  ALGPK-FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKA  855
             A+  + FS G  VE +S E+G+ GSW+ A + +  G +K ++EY  L+ +D  EPL+E+ 
Sbjct  138   AIEKQEFSIGTPVEVSSEEQGFEGSWFPAKLVEYRGNDKCVVEYDNLKAEDGKEPLREEV  197

Query  854   DAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFA  675
             +   IRP P        F+  ++VDA YN+GWW G+I KVL   +Y+VYF  T E ++F 
Sbjct  198   NVSEIRPQPVEQVMVCPFEKNDKVDALYNDGWWVGVIRKVLAKSSYLVYFENTQEMLKFH  257

Query  674   HHGIRPHQEWIDKKWDIAFR  615
             H  +R HQEWI+ KW   F+
Sbjct  258   HSQLRLHQEWINGKWITNFK  277



>ref|XP_006386703.1| hypothetical protein POPTR_0002s193002g, partial [Populus trichocarpa]
 gb|ERP64500.1| hypothetical protein POPTR_0002s193002g, partial [Populus trichocarpa]
Length=429

 Score =   166 bits (419),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 103/297 (35%), Positives = 149/297 (50%), Gaps = 42/297 (14%)
 Frame = -3

Query  1469  GFERSWYASVVMEV-------------LGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRP  1329
             GF  +WY + ++E                  K +VQY+ L T+DG+  L+E+VD   IRP
Sbjct  41    GFRGAWYLATILEFPKPQSQAAVKSASKKKRKAIVQYKTLVTEDGSAPLVEQVDPHLIRP  100

Query  1328  CPPE--IHRISPFKLLDKVDAWVGNGWWEGHVSKVL-GDAKYMVCFGSMNELLTFEASDL  1158
              PP+  +     F+  + +DA + +GWW G V KVL G ++YMV F +  +++ FEA DL
Sbjct  101   LPPQYLLKNGGLFQENEAIDASLRDGWWSGVVKKVLDGGSRYMVYFDNPPDVVEFEAKDL  160

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFE  978
             R H +W + NWV                         +  R+A G  FS G  VE    +
Sbjct  161   RLHLDWVDGNWVQP-----------------------QMQRQATGSVFSSGTEVEVNLEK  197

Query  977   EGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDR-F  801
             +     W  AV+        FL++  + R  DE+ P+K   D  +IRP PPL    DR +
Sbjct  198   DNVRDIWLPAVVIKENEDKTFLVKCLSARNSDEAGPMKTIVDFLHIRPTPPLYA--DRNY  255

Query  800   KMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             ++ E VD  Y  GW  G+I+K+L G  Y V+F   NE+ E +H  IRPH EW+D KW
Sbjct  256   ELLERVDTRYGFGWRSGVITKLLAGRRYNVFFKHGNEDKELSHSKIRPHLEWVDGKW  312


 Score =   147 bits (370),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 154/306 (50%), Gaps = 37/306 (12%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK-------------FLLEYQTLRTDDES  876
             F+KG  VE +S EEG+ G+WY A I +   P                +++Y+TL T+D S
Sbjct  27    FNKGEEVEVSSDEEGFRGAWYLATILEFPKPQSQAAVKSASKKKRKAIVQYKTLVTEDGS  86

Query  875   EPLKEKADAFNIRPCPP--LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLN-YVVYF  705
              PL E+ D   IRP PP  L+     F+  E +DA   +GWW G++ KVLDG + Y+VYF
Sbjct  87    APLVEQVDPHLIRPLPPQYLLKNGGLFQENEAIDASLRDGWWSGVVKKVLDGGSRYMVYF  146

Query  704   WTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIG  525
                 + +EF    +R H +W+D  W              +P + R+ +G +     F  G
Sbjct  147   DNPPDVVEFEAKDLRLHLDWVDGNW-------------VQPQMQRQATGSV-----FSSG  188

Query  524   AKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAP  345
              +VEV  +++  +  W PA++++   +  +LV+  + +       +    D L +RP+ P
Sbjct  189   TEVEVNLEKDNVRDIWLPAVVIKENEDKTFLVKCLSARNSDEAGPMKTIVDFLHIRPTPP  248

Query  344   ILQRVDR-FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQE  168
             +    DR +  LE VD     GWR G + ++L G +Y V F+  NE  E  H  +R H E
Sbjct  249   LY--ADRNYELLERVDTRYGFGWRSGVITKLLAGRRYNVFFKHGNEDKELSHSKIRPHLE  306

Query  167   WINGAW  150
             W++G W
Sbjct  307   WVDGKW  312


 Score = 93.6 bits (231),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 124/277 (45%), Gaps = 38/277 (14%)
 Frame = -3

Query  1928  VEFETLCSDDDPMKRRKEYVHLSAVRPAPPG---EPCCYFRVGESADVFYENRGWRRGTV  1758
             V+++TL ++D       E V    +RP PP    +    F+  E+ D    + GW  G V
Sbjct  75    VQYKTLVTEDGSAPL-VEQVDPHLIRPLPPQYLLKNGGLFQENEAIDASLRD-GWWSGVV  132

Query  1757  DEILEN-SMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSE  1581
              ++L+  S YMV   +   V  V+ E   LR+H DW DG WV P        Q Q++ + 
Sbjct  133   KKVLDGGSRYMVYFDNPPDV--VEFEAKDLRLHLDWVDGNWVQP--------QMQRQAT-  181

Query  1580  DFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQ  1401
                              GS    FS    VEV  +K+     W  +VV++   +   LV+
Sbjct  182   -----------------GSV---FSSGTEVEVNLEKDNVRDIWLPAVVIKENEDKTFLVK  221

Query  1400  YQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGD  1221
                 +  D    +   VD   IRP PP ++    ++LL++VD   G GW  G ++K+L  
Sbjct  222   CLSARNSDEAGPMKTIVDFLHIRPTPP-LYADRNYELLERVDTRYGFGWRSGVITKLLAG  280

Query  1220  AKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
              +Y V F   NE      S +RPH EW +  W++ +K
Sbjct  281   RRYNVFFKHGNEDKELSHSKIRPHLEWVDGKWISKSK  317



>dbj|BAK02951.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   166 bits (419),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 114/381 (30%), Positives = 179/381 (47%), Gaps = 54/381 (14%)
 Frame = -3

Query  1280  VDAWVGNGWWEGHVSKVLG----DAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAAT  1113
             VDA     WW G    +LG    D K  VCF +  E   F+ +D+R H E     W    
Sbjct  105   VDALRDGAWWLG--VALLGGDRADGKVAVCFPATREEAEFDEADVRAHLERVAGEW----  158

Query  1112  KIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDS  933
                  RS  D+  +           ++ L   ++KG  +E    E     +W+ A++  +
Sbjct  159   -----RSPEDMETS-----------KRTL---YAKGTQIEVARLEADSVVAWFPAIVAKT  199

Query  932   IGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWE  753
             I  N  L+EY   +    SE   E  D  +IRPCPP       F + ++V+ + ++GWW 
Sbjct  200   IWKNNLLVEYPYWKG---SELCNEIVDIKHIRPCPPRASVIS-FCVNDDVEGFQDDGWWP  255

Query  752   GLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIM  573
             G I+++   L Y     T+ ++ +   + +R   +W D +W    ++   NL        
Sbjct  256   GKITEIHPKLTYTFKLATSGKKAQLHQNKLRLRYDWTDNQW----KQVAQNL--------  303

Query  572   RRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTD  393
                     S T F  G +VEV  DEEG  G+W+   +++ +G+ K+LVE+  LK D  T 
Sbjct  304   --------SGTNFTGGDRVEVSSDEEGFHGAWFEGTVVKSVGH-KFLVEYDALKDDDETT  354

Query  392   LLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTN  213
              L +      +RPS P +   + F+ L+E+DA++N+GW VG + EVL   KY+V F+   
Sbjct  355   PLKETIGEEHIRPSPPAIPVTNGFKVLDEIDAYTNDGWWVGVISEVLSDQKYKVYFKAYK  414

Query  212   EILEFRHHGLRLHQEWINGAW  150
             E  EF    LR H +W+ G W
Sbjct  415   EQNEFELEQLRRHCDWVGGRW  435


 Score =   134 bits (338),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 101/323 (31%), Positives = 143/323 (44%), Gaps = 46/323 (14%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEV--LMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             PE    S    + KG ++EV  L  D+   WFPA V +   + N      Y +   LC+ 
Sbjct  161   PEDMETSKRTLYAKGTQIEVARLEADSVVAWFPAIVAKTIWKNNLLVEYPYWKGSELCN-  219

Query  1901  DDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVA  1722
                     E V +  +RP PP      F V +  + F ++ GW  G + EI     Y   
Sbjct  220   --------EIVDIKHIRPCPPRASVISFCVNDDVEGFQDD-GWWPGKITEIHPKLTYTFK  270

Query  1721  LGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRI  1542
             L      +  ++ Q +LR+  DW D  W       QV Q              SG     
Sbjct  271   LATSG--KKAQLHQNKLRLRYDWTDNQW------KQVAQNL------------SGTN---  307

Query  1541  KCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYL  1362
                       F+    VEV  D+EGF  +W+   V++ +G+ K LV+Y  LK DD T  L
Sbjct  308   ----------FTGGDRVEVSSDEEGFHGAWFEGTVVKSVGH-KFLVEYDALKDDDETTPL  356

Query  1361  IEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
              E +    IRP PP I   + FK+LD++DA+  +GWW G +S+VL D KY V F +  E 
Sbjct  357   KETIGEEHIRPSPPAIPVTNGFKVLDEIDAYTNDGWWVGVISEVLSDQKYKVYFKAYKEQ  416

Query  1181  LTFEASDLRPHQEWKNNNWVAAT  1113
               FE   LR H +W    W+ A+
Sbjct  417   NEFELEQLRRHCDWVGGRWMQAS  439


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 65/146 (45%), Gaps = 16/146 (11%)
 Frame = -3

Query  2042  FNKGDRVEVLMRDN--FPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYV  1869
             F  GDRVEV   +      WF   V++    K        VE++ L  DDD     KE +
Sbjct  308   FTGGDRVEVSSDEEGFHGAWFEGTVVKSVGHK------FLVEYDAL-KDDDETTPLKETI  360

Query  1868  HLSAVRPAPPGEPCCY-FRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESV  1692
                 +RP+PP  P    F+V +  D  Y N GW  G + E+L +  Y V    +   E  
Sbjct  361   GEEHIRPSPPAIPVTNGFKVLDEIDA-YTNDGWWVGVISEVLSDQKYKVYF--KAYKEQN  417

Query  1691  KVEQWQLRVHRDWKDGCWV---PPLE  1623
             + E  QLR H DW  G W+   P LE
Sbjct  418   EFELEQLRRHCDWVGGRWMQASPALE  443



>gb|EMS58750.1| hypothetical protein TRIUR3_15613 [Triticum urartu]
Length=365

 Score =   164 bits (414),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 101/314 (32%), Positives = 161/314 (51%), Gaps = 20/314 (6%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIR  1332
             ++K   +EV   +     +W+ ++V + +    LLV+Y   K   G++   E ++   IR
Sbjct  26    YAKGTHIEVARLEADSVVAWFPAIVAKPIWKNNLLVEYPFGK---GSELCNEIINIKHIR  82

Query  1331  PCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRP  1152
             PCPP    IS F + D V+ +  +GWW G ++++     Y     +  + +    + LR 
Sbjct  83    PCPPRASVIS-FCVNDDVEGFQDDGWWPGKITEIHPKLTYTFKLATSGKKVQLHQNTLRL  141

Query  1151  HQEWKNNNW-VAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEE  975
               +W ++ W   A +  LP       L S          +   G KF+ G  VE +S EE
Sbjct  142   RYDWTDDQWKQVAQQFKLP-----TFLTSVAFLRPLAIFQNLSGTKFTGGDRVEVSSDEE  196

Query  974   GYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKM  795
             G+HG+W+   +  S+G +KFL+EY  L+ DDE  PLKE     +IRP PP I   + FK+
Sbjct  197   GFHGAWFQGTVVKSVG-HKFLVEYDALKDDDEITPLKETIGEEHIRPSPPAIPVTNGFKV  255

Query  794   FEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFR  615
              +E+DA+ N+GWW G+IS+VLD   Y VYF    E+ +F    +R H +W+  +W  A  
Sbjct  256   LDEIDAYTNDGWWVGVISEVLDDQKYKVYFKAYKEQNDFELEQLRRHCDWVGGRWMQA--  313

Query  614   KSNNNLPNPKPGIM  573
                    +P+PGI+
Sbjct  314   -------SPEPGII  320


 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/292 (30%), Positives = 148/292 (51%), Gaps = 10/292 (3%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             ++KG  +E    E     +W+ A++   I  N  L+EY   +    SE   E  +  +IR
Sbjct  26    YAKGTHIEVARLEADSVVAWFPAIVAKPIWKNNLLVEYPFGKG---SELCNEIINIKHIR  82

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             PCPP       F + ++V+ + ++GWW G I+++   L Y     T+ ++++   + +R 
Sbjct  83    PCPPRASVIS-FCVNDDVEGFQDDGWWPGKITEIHPKLTYTFKLATSGKKVQLHQNTLRL  141

Query  656   HQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGI---ASETTFCIGAKVEVKDDEEGNQ  486
               +W D +W    ++    LP     +       I    S T F  G +VEV  DEEG  
Sbjct  142   RYDWTDDQWKQVAQQFK--LPTFLTSVAFLRPLAIFQNLSGTKFTGGDRVEVSSDEEGFH  199

Query  485   GSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEE  306
             G+W+   +++ +G+ K+LVE+  LK D     L +      +RPS P +   + F+ L+E
Sbjct  200   GAWFQGTVVKSVGH-KFLVEYDALKDDDEITPLKETIGEEHIRPSPPAIPVTNGFKVLDE  258

Query  305   VDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +DA++N+GW VG + EVL+  KY+V F+   E  +F    LR H +W+ G W
Sbjct  259   IDAYTNDGWWVGVISEVLDDQKYKVYFKAYKEQNDFELEQLRRHCDWVGGRW  310


 Score =   144 bits (362),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 101/317 (32%), Positives = 151/317 (48%), Gaps = 25/317 (8%)
 Frame = -3

Query  2057  SAEAQFNKGDRVEV--LMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKR  1884
             S    + KG  +EV  L  D+   WFPA V +P  + N      + +   LC+       
Sbjct  21    SKRTPYAKGTHIEVARLEADSVVAWFPAIVAKPIWKNNLLVEYPFGKGSELCN-------  73

Query  1883  RKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDA  1704
               E +++  +RP PP      F V +  + F ++ GW  G + EI     Y   L     
Sbjct  74    --EIINIKHIRPCPPRASVISFCVNDDVEGF-QDDGWWPGKITEIHPKLTYTFKLATSG-  129

Query  1703  VESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGS  1524
              + V++ Q  LR+  DW D  W       QV QQ+   K   FL + + ++  +   +  
Sbjct  130   -KKVQLHQNTLRLRYDWTDDQW------KQVAQQF---KLPTFLTSVAFLR-PLAIFQNL  178

Query  1523  CVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDA  1344
                KF+    VEV  D+EGF  +W+   V++ +G+ K LV+Y  LK DD    L E +  
Sbjct  179   SGTKFTGGDRVEVSSDEEGFHGAWFQGTVVKSVGH-KFLVEYDALKDDDEITPLKETIGE  237

Query  1343  SCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEAS  1164
               IRP PP I   + FK+LD++DA+  +GWW G +S+VL D KY V F +  E   FE  
Sbjct  238   EHIRPSPPAIPVTNGFKVLDEIDAYTNDGWWVGVISEVLDDQKYKVYFKAYKEQNDFELE  297

Query  1163  DLRPHQEWKNNNWVAAT  1113
              LR H +W    W+ A+
Sbjct  298   QLRRHCDWVGGRWMQAS  314


 Score = 58.9 bits (141),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 73/170 (43%), Gaps = 13/170 (8%)
 Frame = -3

Query  2048  AQFNKGDRVEVLMRDN--FPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKE  1875
              +F  GDRVEV   +      WF   V++    K        VE++ L  DDD +   KE
Sbjct  181   TKFTGGDRVEVSSDEEGFHGAWFQGTVVKSVGHK------FLVEYDAL-KDDDEITPLKE  233

Query  1874  YVHLSAVRPAPPGEPCCY-FRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVE  1698
              +    +RP+PP  P    F+V +  D  Y N GW  G + E+L++  Y V         
Sbjct  234   TIGEEHIRPSPPAIPVTNGFKVLDEIDA-YTNDGWWVGVISEVLDDQKYKVYFKAYKEQN  292

Query  1697  SVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKL  1548
               ++EQ  LR H DW  G W+    E  +      +     +M  + +KL
Sbjct  293   DFELEQ--LRRHCDWVGGRWMQASPEPGIISTPTHESVASLVMMVAELKL  340


 Score = 52.8 bits (125),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/134 (24%), Positives = 63/134 (47%), Gaps = 4/134 (3%)
 Frame = -3

Query  551  ASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEAD  372
            +  T +  G  +EV   E  +  +W+PA++ + I     LVE+   K   G++L  +  +
Sbjct  21   SKRTPYAKGTHIEVARLEADSVVAWFPAIVAKPIWKNNLLVEYPFGK---GSELCNEIIN  77

Query  371  ALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRH  192
               +RP  P    V  F   ++V+ + ++GW  G++ E+     Y     T+ + ++   
Sbjct  78   IKHIRPCPP-RASVISFCVNDDVEGFQDDGWWPGKITEIHPKLTYTFKLATSGKKVQLHQ  136

Query  191  HGLRLHQEWINGAW  150
            + LRL  +W +  W
Sbjct  137  NTLRLRYDWTDDQW  150



>gb|KDO81633.1| hypothetical protein CISIN_1g019553mg [Citrus sinensis]
 gb|KDO81634.1| hypothetical protein CISIN_1g019553mg [Citrus sinensis]
Length=308

 Score =   160 bits (405),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 150/310 (48%), Gaps = 56/310 (18%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVME---VLGNGKLLVQYQDL-KTDDGTDYLIEEVDASCIRPC  1326
             VE+  +  GF  SW+   V+         K LV+Y  L +T+ G   L E VD   +RP 
Sbjct  30    VEISSNDVGFRGSWFMGTVIRRPMARNPTKYLVEYSRLFETEAGKKPLKEVVDLDLLRPL  89

Query  1325  PP-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPH  1149
              P E  R                                   F +  E + F A DLR H
Sbjct  90    APREKER----------------------------------QFKNSKEQIKFAAEDLRLH  115

Query  1148  QEWKNNNW------------VAATKIDLPRS--SSDVMLNskvvkvkskSDRKALGPKFS  1011
             +EW    W            +A    + P    + ++  NSK  +   K + + L   F 
Sbjct  116   REWIKGEWKPPLEDDTETEKLATNSKEEPDKVKTEELFSNSKPEEEPDKFNTEGL---FC  172

Query  1010  KGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPC  831
             KG LVE +S E+G+ G+W+ A I +  G +K+L+EYQ+LRT+D+ E LKE+ D  +IRP 
Sbjct  173   KGTLVEVSSDEDGFQGAWFAATIVEPTGKDKYLVEYQSLRTEDDKEFLKEEIDIKHIRPS  232

Query  830   PPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQ  651
             PP     DRF   +EVDA YN+GWW G+ISKV     YVVYF TT EE+ F H  +R HQ
Sbjct  233   PPETLMVDRFNKLDEVDALYNDGWWVGVISKVCSNSKYVVYFKTTKEELTFEHSDLRLHQ  292

Query  650   EWIDKKWDIA  621
             +WI+ KW  A
Sbjct  293   DWINGKWVTA  302


 Score =   159 bits (401),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 107/315 (34%), Positives = 147/315 (47%), Gaps = 59/315 (19%)
 Frame = -3

Query  1025  GPKFSKGMLVEATSFEEGYHGSWYTAVIFD---SIGPNKFLLEYQTL-RTDDESEPLKEK  858
             G  F+ G  VE +S + G+ GSW+   +     +  P K+L+EY  L  T+   +PLKE 
Sbjct  21    GTPFNPGSQVEISSNDVGFRGSWFMGTVIRRPMARNPTKYLVEYSRLFETEAGKKPLKEV  80

Query  857   ADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEF  678
              D   +RP  P   +  +FK                                 + E+I+F
Sbjct  81    VDLDLLRPLAPR-EKERQFK--------------------------------NSKEQIKF  107

Query  677   AHHGIRPHQEWIDKKW------DIAFRKSNNN-------------LPNPKPGIMRRHSGG  555
             A   +R H+EWI  +W      D    K   N               N KP         
Sbjct  108   AAEDLRLHREWIKGEWKPPLEDDTETEKLATNSKEEPDKVKTEELFSNSKP---EEEPDK  164

Query  554   IASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEA  375
               +E  FC G  VEV  DE+G QG+W+ A I+   G  KYLVE+++L+ +   + L +E 
Sbjct  165   FNTEGLFCKGTLVEVSSDEDGFQGAWFAATIVEPTGKDKYLVEYQSLRTEDDKEFLKEEI  224

Query  374   DALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFR  195
             D   +RPS P    VDRF  L+EVDA  N+GW VG + +V   +KY V F+TT E L F 
Sbjct  225   DIKHIRPSPPETLMVDRFNKLDEVDALYNDGWWVGVISKVCSNSKYVVYFKTTKEELTFE  284

Query  194   HHGLRLHQEWINGAW  150
             H  LRLHQ+WING W
Sbjct  285   HSDLRLHQDWINGKW  299


 Score =   158 bits (400),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 109/329 (33%), Positives = 158/329 (48%), Gaps = 44/329 (13%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEVLMRD-NF-PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             P+    ++   FN G +VE+   D  F   WF   V+R  + +N    +  VE+  L   
Sbjct  13    PKPRTDNSGTPFNPGSQVEISSNDVGFRGSWFMGTVIRRPMARN--PTKYLVEYSRLFET  70

Query  1901  DDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVA  1722
             +   K  KE V L  +RP  P E    F+                        NS   + 
Sbjct  71    EAGKKPLKEVVDLDLLRPLAPREKERQFK------------------------NSKEQIK  106

Query  1721  LGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQY--QQKKSEDFLMTP---SG  1557
                ED           LR+HR+W  G W PPLE+    ++     K+  D + T    S 
Sbjct  107   FAAED-----------LRLHREWIKGEWKPPLEDDTETEKLATNSKEEPDKVKTEELFSN  155

Query  1556  VKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD  1377
              K   +  + +    F K   VEV  D++GF+ +W+A+ ++E  G  K LV+YQ L+T+D
Sbjct  156   SKPEEEPDKFNTEGLFCKGTLVEVSSDEDGFQGAWFAATIVEPTGKDKYLVEYQSLRTED  215

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
               ++L EE+D   IRP PPE   +  F  LD+VDA   +GWW G +SKV  ++KY+V F 
Sbjct  216   DKEFLKEEIDIKHIRPSPPETLMVDRFNKLDEVDALYNDGWWVGVISKVCSNSKYVVYFK  275

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             +  E LTFE SDLR HQ+W N  WV A++
Sbjct  276   TTKEELTFEHSDLRLHQDWINGKWVTASQ  304



>gb|EEE62223.1| hypothetical protein OsJ_17010 [Oryza sativa Japonica Group]
Length=402

 Score =   162 bits (410),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 103/316 (33%), Positives = 156/316 (49%), Gaps = 35/316 (11%)
 Frame = -3

Query  1538  CTRGSCVRKFSKEMP------VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDD  1377
             C +G  V   SK MP      VEV   +     +W+++ V + +    LLV Y +   +D
Sbjct  100   CVQGRGV-GISKTMPYKKGTQVEVAKLEGNSVVAWFSAAVEKAIWKNSLLVDY-NCSKND  157

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
             G+    E VD   IRP P     I  F + D+V+ + GNGWW G ++ V  + +Y     
Sbjct  158   GSVLPKEIVDLKHIRPHPQHASAII-FCINDEVEGFQGNGWWLGVITDVHPEFRYTFKAA  216

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATKID-------LPRSSSDVMLNskvvkvkskSD  1038
                + +  +   LR   +W ++ W   T++        LP   ++V              
Sbjct  217   HSGKEIQLDQKALRLRYDWTHDQWQQVTQMIPGLFYMLLPTFHNNVT-------------  263

Query  1037  RKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEK  858
                   KF+KG  VE TS ++G+HG+W+       +  NK L+EY  L+ DDE  PL E 
Sbjct  264   -----KKFAKGSKVEVTSNDDGFHGAWFQGTALKYVN-NKILVEYDALKADDEITPLTEA  317

Query  857   ADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEF  678
              +  ++RPCPP I     F + +EVDA +N+GWW G+ISKV  G  Y+VYF ++ EE EF
Sbjct  318   IEVQHVRPCPPDIPVTSGFNLLDEVDACWNDGWWVGVISKVNSGDRYMVYFRSSTEETEF  377

Query  677   AHHGIRPHQEWIDKKW  630
              H  +R H +W+  +W
Sbjct  378   GHEQLRLHCDWVGGRW  393


 Score =   136 bits (343),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 89/291 (31%), Positives = 135/291 (46%), Gaps = 13/291 (4%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             + KG  VE    E     +W++A +  +I  N  L++Y   + D    P KE  D  +IR
Sbjct  114   YKKGTQVEVAKLEGNSVVAWFSAAVEKAIWKNSLLVDYNCSKNDGSVLP-KEIVDLKHIR  172

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             P P        F + +EV+ +   GWW G+I+ V     Y      + +EI+     +R 
Sbjct  173   PHPQHASAI-IFCINDEVEGFQGNGWWLGVITDVHPEFRYTFKAAHSGKEIQLDQKALRL  231

Query  656   HQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETT--FCIGAKVEVKDDEEGNQG  483
               +W   +W          +    PG+         +  T  F  G+KVEV  +++G  G
Sbjct  232   RYDWTHDQW--------QQVTQMIPGLFYMLLPTFHNNVTKKFAKGSKVEVTSNDDGFHG  283

Query  482   SWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEV  303
             +W+    L+ + N K LVE+  LK D     L +  +   VRP  P +     F  L+EV
Sbjct  284   AWFQGTALKYVNN-KILVEYDALKADDEITPLTEAIEVQHVRPCPPDIPVTSGFNLLDEV  342

Query  302   DAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             DA  N+GW VG + +V  G +Y V FR++ E  EF H  LRLH +W+ G W
Sbjct  343   DACWNDGWWVGVISKVNSGDRYMVYFRSSTEETEFGHEQLRLHCDWVGGRW  393


 Score =   134 bits (338),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 97/319 (30%), Positives = 147/319 (46%), Gaps = 30/319 (9%)
 Frame = -3

Query  2063  AMSAEAQFNKGDRVEV--LMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPM  1890
              +S    + KG +VEV  L  ++   WF AAV + ++ KN     + V++   CS +D  
Sbjct  107   GISKTMPYKKGTQVEVAKLEGNSVVAWFSAAVEK-AIWKNS----LLVDYN--CSKNDGS  159

Query  1889  KRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDE  1710
                KE V L  +RP P       F + +  + F  N GW  G + ++     Y       
Sbjct  160   VLPKEIVDLKHIRPHPQHASAIIFCINDEVEGFQGN-GWWLGVITDVHPEFRYTFKAAHS  218

Query  1709  DAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTR  1530
                + ++++Q  LR+  DW    W          QQ  Q       M P    + +    
Sbjct  219   G--KEIQLDQKALRLRYDWTHDQW----------QQVTQ-------MIPGLFYMLLPTFH  259

Query  1529  GSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEV  1350
              +  +KF+K   VEV  + +GF  +W+    ++ + N K+LV+Y  LK DD    L E +
Sbjct  260   NNVTKKFAKGSKVEVTSNDDGFHGAWFQGTALKYVNN-KILVEYDALKADDEITPLTEAI  318

Query  1349  DASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFE  1170
             +   +RPCPP+I   S F LLD+VDA   +GWW G +SKV    +YMV F S  E   F 
Sbjct  319   EVQHVRPCPPDIPVTSGFNLLDEVDACWNDGWWVGVISKVNSGDRYMVYFRSSTEETEFG  378

Query  1169  ASDLRPHQEWKNNNWVAAT  1113
                LR H +W    W+ A+
Sbjct  379   HEQLRLHCDWVGGRWMRAS  397



>gb|KDO86910.1| hypothetical protein CISIN_1g002548mg [Citrus sinensis]
Length=577

 Score =   164 bits (416),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 104/304 (34%), Positives = 152/304 (50%), Gaps = 35/304 (12%)
 Frame = -3

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVME------VLGNGKLLVQYQDLKTDDGTDYLIEE  1353
             +FSK   VEV  D+EGF  +WY + ++E           K L++Y+ L T+DG+  L E 
Sbjct  11    QFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPLTEY  70

Query  1352  VDASCIRPCPPEIHRISP-FKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
             +D + IRP PP+       F+L + V+A   +GWW G V KVL + K+ VCF +  +++ 
Sbjct  71    IDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCFDNPPDVID  130

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
             FEA DLR H +W N  WV   K                         ++ G  FS G  V
Sbjct  131   FEAIDLRVHYQWVNGKWVRPEK------------------------EQSTGSIFSPGTAV  166

Query  995   EAT-SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLI  819
             E     +E     W+ A++        F ++YQ  +  +E+  +K   D+ +IRP PP  
Sbjct  167   EVNLDNKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVKVTLDSQHIRPPPP--  224

Query  818   HRFDR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
                DR +++ E+VD  Y  GW  G+I+KVL G  Y V+F   NE+ E +H  IRPH EW 
Sbjct  225   RYVDRNYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNEDKELSHSEIRPHVEWT  284

Query  641   DKKW  630
                W
Sbjct  285   GGNW  288


 Score =   151 bits (381),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 103/299 (34%), Positives = 150/299 (50%), Gaps = 30/299 (10%)
 Frame = -3

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDS------IGPNKFLLEYQTLRTDDESEPLKEK  858
             +FSKG  VE TS EEG+ G+WY A I +S          K L+EY+ L T+D S PL E 
Sbjct  11    QFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPLTEY  70

Query  857   ADAFNIRPCPPLIHRF-DRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIE  681
              D   IRP PP      D F++ E V+A Y +GWW G + KVLD   + V F    + I+
Sbjct  71    IDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCFDNPPDVID  130

Query  680   FAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVK-D  504
             F    +R H +W++ KW    ++              + +G I     F  G  VEV  D
Sbjct  131   FEAIDLRVHYQWVNGKWVRPEKE--------------QSTGSI-----FSPGTAVEVNLD  171

Query  503   DEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDR  324
             ++E  +  W+PA++++   +G + V+++  K       +    D+  +RP  P  + VDR
Sbjct  172   NKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVKVTLDSQHIRPPPP--RYVDR  229

Query  323   -FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              +  LE+VD     GWR G + +VL G +Y V F+  NE  E  H  +R H EW  G W
Sbjct  230   NYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNEDKELSHSEIRPHVEWTGGNW  288


 Score =   114 bits (284),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 94/324 (29%), Positives = 150/324 (46%), Gaps = 47/324 (15%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDNF--PIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDD--PM  1890
             ++ QF+KG  VEV   +      W+ A +L  P    +++  +  +E++ L ++D   P+
Sbjct  8     SQIQFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPL  67

Query  1889  KRRKEYVHLSAVRPAPPGEPCC--YFRVGESADVFYENRGWRRGTVDEILENSMYMVALG  1716
                 EY+  + +RP PP +      F + E  +  Y + GW  GTV ++L+N  + V   
Sbjct  68    T---EYIDPAYIRPLPPQQEGGEDVFELNEVVEANYRD-GWWTGTVRKVLDNGKFRVCFD  123

Query  1715  DEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKC  1536
             +   V  +  E   LRVH  W +G WV P +E                            
Sbjct  124   NPPDV--IDFEAIDLRVHYQWVNGKWVRPEKEQ---------------------------  154

Query  1535  TRGSCVRKFSKEMPVEVKGD-KEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLI  1359
             + GS    FS    VEV  D KE     W+ ++V++   +G   V+YQ+ K  +    + 
Sbjct  155   STGSI---FSPGTAVEVNLDNKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVK  211

Query  1358  EEVDASCIRPCPPE-IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
               +D+  IRP PP  + R   ++LL+KVD   G GW  G ++KVL   +Y V F   NE 
Sbjct  212   VTLDSQHIRPPPPRYVDR--NYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNED  269

Query  1181  LTFEASDLRPHQEWKNNNWVAATK  1110
                  S++RPH EW   NW++ +K
Sbjct  270   KELSHSEIRPHVEWTGGNWISKSK  293


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 7/145 (5%)
 Frame = -3

Query  563  SGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILR------LIGNGKYLVEFRTLKCDF  402
            S    S+  F  G +VEV  DEEG +G+WY A IL            K L+E++ L  + 
Sbjct  3    SSDTESQIQFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTED  62

Query  401  GTDLLVQEADALSVRPSAPILQ-RVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNF  225
            G+  L +  D   +RP  P  +   D F   E V+A   +GW  G V +VL+  K+RV F
Sbjct  63   GSGPLTEYIDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCF  122

Query  224  RTTNEILEFRHHGLRLHQEWINGAW  150
                ++++F    LR+H +W+NG W
Sbjct  123  DNPPDVIDFEAIDLRVHYQWVNGKW  147



>ref|XP_009611102.1| PREDICTED: uncharacterized protein LOC104104669 isoform X2 [Nicotiana 
tomentosiformis]
Length=873

 Score =   167 bits (423),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 164/309 (53%), Gaps = 35/309 (11%)
 Frame = -3

Query  1532  RGSCVRKFS---KEMPVEVKGDKEGFERSWYASVVMEVLGNG----KLLVQYQDL-KTDD  1377
             RG   +K+S   K   VEV  D+EGF+  W+ + V+     G    ++ V+Y+ +   ++
Sbjct  2     RGGRHQKYSHLTKGATVEVTSDEEGFKGVWFEATVLGASSPGSKSKEVWVEYKSIVAEEN  61

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
             G++ L E +  S IRP PP + +I  F+L D VDA+  +GWW G V++VL D++Y V F 
Sbjct  62    GSEPLKEVLHVSFIRPVPP-VEKIERFELYDVVDAFHKDGWWTGVVTRVLEDSRYQVTFD  120

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPK  1017
             +  + L F  S+LR HQ+W    WV   K    + +  +M                    
Sbjct  121   NPPDELEFGVSELRFHQKWVKGKWVRPGK----QRTGSLM--------------------  156

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             F  G  VE +   +    +W+ + + +  G N FL+E     +D ++   K   D+F+IR
Sbjct  157   FRVGENVEVSFDSDDRRDAWFPSTVLEHCGNNSFLVEIYRRASDKKAIVEKVIVDSFHIR  216

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             P PPLI   ++F + E+VDA Y+ GWW G+I++ LD   Y+V+F  TN+E+E     +RP
Sbjct  217   PIPPLI--VNKFSLLEKVDALYDYGWWSGVITRELDDSRYIVFFKHTNKEMELNDSDLRP  274

Query  656   HQEWIDKKW  630
             H +W D +W
Sbjct  275   HMDWKDGQW  283


 Score =   162 bits (411),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 95/294 (32%), Positives = 154/294 (52%), Gaps = 27/294 (9%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGP----NKFLLEYQTLRTDDE-SEPLKEKAD  852
              +KG  VE TS EEG+ G W+ A +  +  P     +  +EY+++  ++  SEPLKE   
Sbjct  12    LTKGATVEVTSDEEGFKGVWFEATVLGASSPGSKSKEVWVEYKSIVAEENGSEPLKEVLH  71

Query  851   AFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
                IRP PP + + +RF++++ VDA++ +GWW G++++VL+   Y V F    +E+EF  
Sbjct  72    VSFIRPVPP-VEKIERFELYDVVDAFHKDGWWTGVVTRVLEDSRYQVTFDNPPDELEFGV  130

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
               +R HQ+W+  KW              +PG  R  S        F +G  VEV  D + 
Sbjct  131   SELRFHQKWVKGKW-------------VRPGKQRTGS------LMFRVGENVEVSFDSDD  171

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPL  312
              + +W+P+ +L   GN  +LVE      D    +     D+  +RP  P++  V++F  L
Sbjct  172   RRDAWFPSTVLEHCGNNSFLVEIYRRASDKKAIVEKVIVDSFHIRPIPPLI--VNKFSLL  229

Query  311   EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             E+VDA  + GW  G +   L+ ++Y V F+ TN+ +E     LR H +W +G W
Sbjct  230   EKVDALYDYGWWSGVITRELDDSRYIVFFKHTNKEMELNDSDLRPHMDWKDGQW  283


 Score =   133 bits (335),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 96/325 (30%), Positives = 161/325 (50%), Gaps = 43/325 (13%)
 Frame = -3

Query  2048  AQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKE  1875
             +   KG  VEV    + F  +WF A VL  S     ++ +++VE++++ ++++  +  KE
Sbjct  10    SHLTKGATVEVTSDEEGFKGVWFEATVLGAS-SPGSKSKEVWVEYKSIVAEENGSEPLKE  68

Query  1874  YVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVES  1695
              +H+S +RP PP E    F + +  D F+++ GW  G V  +LE+S Y V    ++  + 
Sbjct  69    VLHVSFIRPVPPVEKIERFELYDVVDAFHKD-GWWTGVVTRVLEDSRYQVTF--DNPPDE  125

Query  1694  VKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVR  1515
             ++    +LR H+ W  G WV P ++                              GS + 
Sbjct  126   LEFGVSELRFHQKWVKGKWVRPGKQRT----------------------------GSLMF  157

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEE--VDAS  1341
             +  +   VEV  D +    +W+ S V+E  GN   LV+     +D     ++E+  VD+ 
Sbjct  158   RVGEN--VEVSFDSDDRRDAWFPSTVLEHCGNNSFLVEIYRRASDKKA--IVEKVIVDSF  213

Query  1340  CIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
              IRP PP I  ++ F LL+KVDA    GWW G +++ L D++Y+V F   N+ +    SD
Sbjct  214   HIRPIPPLI--VNKFSLLEKVDALYDYGWWSGVITRELDDSRYIVFFKHTNKEMELNDSD  271

Query  1160  LRPHQEWKNNNWVA-ATKIDLPRSS  1089
             LRPH +WK+  W   A ++ +P  S
Sbjct  272   LRPHMDWKDGQWFTNAREVSIPSDS  296



>ref|XP_009611101.1| PREDICTED: uncharacterized protein LOC104104669 isoform X1 [Nicotiana 
tomentosiformis]
Length=903

 Score =   167 bits (424),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 164/309 (53%), Gaps = 35/309 (11%)
 Frame = -3

Query  1532  RGSCVRKFS---KEMPVEVKGDKEGFERSWYASVVMEVLGNG----KLLVQYQDL-KTDD  1377
             RG   +K+S   K   VEV  D+EGF+  W+ + V+     G    ++ V+Y+ +   ++
Sbjct  2     RGGRHQKYSHLTKGATVEVTSDEEGFKGVWFEATVLGASSPGSKSKEVWVEYKSIVAEEN  61

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
             G++ L E +  S IRP PP + +I  F+L D VDA+  +GWW G V++VL D++Y V F 
Sbjct  62    GSEPLKEVLHVSFIRPVPP-VEKIERFELYDVVDAFHKDGWWTGVVTRVLEDSRYQVTFD  120

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPK  1017
             +  + L F  S+LR HQ+W    WV   K    + +  +M                    
Sbjct  121   NPPDELEFGVSELRFHQKWVKGKWVRPGK----QRTGSLM--------------------  156

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             F  G  VE +   +    +W+ + + +  G N FL+E     +D ++   K   D+F+IR
Sbjct  157   FRVGENVEVSFDSDDRRDAWFPSTVLEHCGNNSFLVEIYRRASDKKAIVEKVIVDSFHIR  216

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             P PPLI   ++F + E+VDA Y+ GWW G+I++ LD   Y+V+F  TN+E+E     +RP
Sbjct  217   PIPPLI--VNKFSLLEKVDALYDYGWWSGVITRELDDSRYIVFFKHTNKEMELNDSDLRP  274

Query  656   HQEWIDKKW  630
             H +W D +W
Sbjct  275   HMDWKDGQW  283


 Score =   162 bits (410),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 95/294 (32%), Positives = 154/294 (52%), Gaps = 27/294 (9%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGP----NKFLLEYQTLRTDDE-SEPLKEKAD  852
              +KG  VE TS EEG+ G W+ A +  +  P     +  +EY+++  ++  SEPLKE   
Sbjct  12    LTKGATVEVTSDEEGFKGVWFEATVLGASSPGSKSKEVWVEYKSIVAEENGSEPLKEVLH  71

Query  851   AFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
                IRP PP + + +RF++++ VDA++ +GWW G++++VL+   Y V F    +E+EF  
Sbjct  72    VSFIRPVPP-VEKIERFELYDVVDAFHKDGWWTGVVTRVLEDSRYQVTFDNPPDELEFGV  130

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
               +R HQ+W+  KW              +PG  R  S        F +G  VEV  D + 
Sbjct  131   SELRFHQKWVKGKW-------------VRPGKQRTGS------LMFRVGENVEVSFDSDD  171

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPL  312
              + +W+P+ +L   GN  +LVE      D    +     D+  +RP  P++  V++F  L
Sbjct  172   RRDAWFPSTVLEHCGNNSFLVEIYRRASDKKAIVEKVIVDSFHIRPIPPLI--VNKFSLL  229

Query  311   EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             E+VDA  + GW  G +   L+ ++Y V F+ TN+ +E     LR H +W +G W
Sbjct  230   EKVDALYDYGWWSGVITRELDDSRYIVFFKHTNKEMELNDSDLRPHMDWKDGQW  283


 Score =   133 bits (335),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 96/325 (30%), Positives = 161/325 (50%), Gaps = 43/325 (13%)
 Frame = -3

Query  2048  AQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKE  1875
             +   KG  VEV    + F  +WF A VL  S     ++ +++VE++++ ++++  +  KE
Sbjct  10    SHLTKGATVEVTSDEEGFKGVWFEATVLGAS-SPGSKSKEVWVEYKSIVAEENGSEPLKE  68

Query  1874  YVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVES  1695
              +H+S +RP PP E    F + +  D F+++ GW  G V  +LE+S Y V    ++  + 
Sbjct  69    VLHVSFIRPVPPVEKIERFELYDVVDAFHKD-GWWTGVVTRVLEDSRYQVTF--DNPPDE  125

Query  1694  VKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVR  1515
             ++    +LR H+ W  G WV P ++                              GS + 
Sbjct  126   LEFGVSELRFHQKWVKGKWVRPGKQRT----------------------------GSLMF  157

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEE--VDAS  1341
             +  +   VEV  D +    +W+ S V+E  GN   LV+     +D     ++E+  VD+ 
Sbjct  158   RVGEN--VEVSFDSDDRRDAWFPSTVLEHCGNNSFLVEIYRRASDKKA--IVEKVIVDSF  213

Query  1340  CIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
              IRP PP I  ++ F LL+KVDA    GWW G +++ L D++Y+V F   N+ +    SD
Sbjct  214   HIRPIPPLI--VNKFSLLEKVDALYDYGWWSGVITRELDDSRYIVFFKHTNKEMELNDSD  271

Query  1160  LRPHQEWKNNNWVA-ATKIDLPRSS  1089
             LRPH +WK+  W   A ++ +P  S
Sbjct  272   LRPHMDWKDGQWFTNAREVSIPSDS  296



>ref|XP_011002743.1| PREDICTED: uncharacterized protein LOC105109662 isoform X4 [Populus 
euphratica]
Length=768

 Score =   166 bits (421),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 103/297 (35%), Positives = 149/297 (50%), Gaps = 42/297 (14%)
 Frame = -3

Query  1469  GFERSWYASVVME-------------VLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRP  1329
             GF  +WY + ++E                  K +VQY+ L T+DG+  L+E+VD   IRP
Sbjct  39    GFRGAWYLATILEFPKPQSQAAVKSASKKKRKAIVQYKTLVTEDGSAPLVEQVDPHLIRP  98

Query  1328  CPPE--IHRISPFKLLDKVDAWVGNGWWEGHVSKVL-GDAKYMVCFGSMNELLTFEASDL  1158
              PP+  +     F+  + +DA + +GWW G V KVL G ++YMV F +  +++ FEA DL
Sbjct  99    LPPQYLLKNGGLFQENEAIDASLRDGWWSGVVKKVLDGGSRYMVYFDNPPDVVEFEAKDL  158

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFE  978
             R H +W + NWV                         +  R+A G  FS G  VE    +
Sbjct  159   RLHLDWVDGNWVRP-----------------------QMQRQATGSVFSSGTEVEVNLEK  195

Query  977   EGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDR-F  801
             +     W  AV+        FL++  + R  DE+ P+K   D  +IRP PPL    DR +
Sbjct  196   DNVRDIWLPAVVIKENEDKTFLVKCLSARNSDEAGPMKTIVDFLHIRPPPPLYA--DRNY  253

Query  800   KMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             ++ E VD  Y  GW  G+I+K+L G  Y V+F   NE+ E +H  IRPH EW+D KW
Sbjct  254   ELLERVDTRYGFGWRSGVITKLLAGRRYNVFFKHGNEDKELSHSKIRPHLEWVDGKW  310


 Score =   147 bits (371),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 153/306 (50%), Gaps = 37/306 (12%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK-------------FLLEYQTLRTDDES  876
             F+KG  VE +S EEG+ G+WY A I +   P                +++Y+TL T+D S
Sbjct  25    FNKGEEVEVSSDEEGFRGAWYLATILEFPKPQSQAAVKSASKKKRKAIVQYKTLVTEDGS  84

Query  875   EPLKEKADAFNIRPCPP--LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLN-YVVYF  705
              PL E+ D   IRP PP  L+     F+  E +DA   +GWW G++ KVLDG + Y+VYF
Sbjct  85    APLVEQVDPHLIRPLPPQYLLKNGGLFQENEAIDASLRDGWWSGVVKKVLDGGSRYMVYF  144

Query  704   WTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIG  525
                 + +EF    +R H +W+D  W              +P + R+ +G +     F  G
Sbjct  145   DNPPDVVEFEAKDLRLHLDWVDGNW-------------VRPQMQRQATGSV-----FSSG  186

Query  524   AKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAP  345
              +VEV  +++  +  W PA++++   +  +LV+  + +       +    D L +RP  P
Sbjct  187   TEVEVNLEKDNVRDIWLPAVVIKENEDKTFLVKCLSARNSDEAGPMKTIVDFLHIRPPPP  246

Query  344   ILQRVDR-FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQE  168
             +    DR +  LE VD     GWR G + ++L G +Y V F+  NE  E  H  +R H E
Sbjct  247   LY--ADRNYELLERVDTRYGFGWRSGVITKLLAGRRYNVFFKHGNEDKELSHSKIRPHLE  304

Query  167   WINGAW  150
             W++G W
Sbjct  305   WVDGKW  310


 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 82/279 (29%), Positives = 126/279 (45%), Gaps = 42/279 (15%)
 Frame = -3

Query  1928  VEFETLCSDDD--PMKRRKEYVHLSAVRPAPPG---EPCCYFRVGESADVFYENRGWRRG  1764
             V+++TL ++D   P+    E V    +RP PP    +    F+  E+ D    + GW  G
Sbjct  73    VQYKTLVTEDGSAPLV---EQVDPHLIRPLPPQYLLKNGGLFQENEAIDASLRD-GWWSG  128

Query  1763  TVDEILEN-SMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKK  1587
              V ++L+  S YMV   +   V  V+ E   LR+H DW DG WV P        Q Q++ 
Sbjct  129   VVKKVLDGGSRYMVYFDNPPDV--VEFEAKDLRLHLDWVDGNWVRP--------QMQRQA  178

Query  1586  SEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLL  1407
             +                  GS    FS    VEV  +K+     W  +VV++   +   L
Sbjct  179   T------------------GSV---FSSGTEVEVNLEKDNVRDIWLPAVVIKENEDKTFL  217

Query  1406  VQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVL  1227
             V+    +  D    +   VD   IRP PP ++    ++LL++VD   G GW  G ++K+L
Sbjct  218   VKCLSARNSDEAGPMKTIVDFLHIRP-PPPLYADRNYELLERVDTRYGFGWRSGVITKLL  276

Query  1226  GDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
                +Y V F   NE      S +RPH EW +  W++ +K
Sbjct  277   AGRRYNVFFKHGNEDKELSHSKIRPHLEWVDGKWISKSK  315


 Score = 53.5 bits (127),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 78/167 (47%), Gaps = 19/167 (11%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEV-LMRDNF-PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             P+    +  + F+ G  VEV L +DN   IW PA V    +++N+    +        SD
Sbjct  172   PQMQRQATGSVFSSGTEVEVNLEKDNVRDIWLPAVV----IKENEDKTFLVKCLSARNSD  227

Query  1901  D-DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMV  1725
             +  PMK   +++H   +RP PP      + + E  D  Y   GWR G + ++L    Y V
Sbjct  228   EAGPMKTIVDFLH---IRPPPPLYADRNYELLERVDTRY-GFGWRSGVITKLLAGRRYNV  283

Query  1724  AL--GDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQV--DQQYQ  1596
                 G+ED     ++   ++R H +W DG W+   +E ++  D Q Q
Sbjct  284   FFKHGNEDK----ELSHSKIRPHLEWVDGKWISKSKEVRIVSDSQGQ  326



>ref|XP_011002742.1| PREDICTED: uncharacterized protein LOC105109662 isoform X3 [Populus 
euphratica]
Length=773

 Score =   166 bits (421),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 103/297 (35%), Positives = 149/297 (50%), Gaps = 42/297 (14%)
 Frame = -3

Query  1469  GFERSWYASVVME-------------VLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRP  1329
             GF  +WY + ++E                  K +VQY+ L T+DG+  L+E+VD   IRP
Sbjct  39    GFRGAWYLATILEFPKPQSQAAVKSASKKKRKAIVQYKTLVTEDGSAPLVEQVDPHLIRP  98

Query  1328  CPPE--IHRISPFKLLDKVDAWVGNGWWEGHVSKVL-GDAKYMVCFGSMNELLTFEASDL  1158
              PP+  +     F+  + +DA + +GWW G V KVL G ++YMV F +  +++ FEA DL
Sbjct  99    LPPQYLLKNGGLFQENEAIDASLRDGWWSGVVKKVLDGGSRYMVYFDNPPDVVEFEAKDL  158

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFE  978
             R H +W + NWV                         +  R+A G  FS G  VE    +
Sbjct  159   RLHLDWVDGNWVRP-----------------------QMQRQATGSVFSSGTEVEVNLEK  195

Query  977   EGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDR-F  801
             +     W  AV+        FL++  + R  DE+ P+K   D  +IRP PPL    DR +
Sbjct  196   DNVRDIWLPAVVIKENEDKTFLVKCLSARNSDEAGPMKTIVDFLHIRPPPPLYA--DRNY  253

Query  800   KMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             ++ E VD  Y  GW  G+I+K+L G  Y V+F   NE+ E +H  IRPH EW+D KW
Sbjct  254   ELLERVDTRYGFGWRSGVITKLLAGRRYNVFFKHGNEDKELSHSKIRPHLEWVDGKW  310


 Score =   147 bits (371),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 153/306 (50%), Gaps = 37/306 (12%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK-------------FLLEYQTLRTDDES  876
             F+KG  VE +S EEG+ G+WY A I +   P                +++Y+TL T+D S
Sbjct  25    FNKGEEVEVSSDEEGFRGAWYLATILEFPKPQSQAAVKSASKKKRKAIVQYKTLVTEDGS  84

Query  875   EPLKEKADAFNIRPCPP--LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLN-YVVYF  705
              PL E+ D   IRP PP  L+     F+  E +DA   +GWW G++ KVLDG + Y+VYF
Sbjct  85    APLVEQVDPHLIRPLPPQYLLKNGGLFQENEAIDASLRDGWWSGVVKKVLDGGSRYMVYF  144

Query  704   WTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIG  525
                 + +EF    +R H +W+D  W              +P + R+ +G +     F  G
Sbjct  145   DNPPDVVEFEAKDLRLHLDWVDGNW-------------VRPQMQRQATGSV-----FSSG  186

Query  524   AKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAP  345
              +VEV  +++  +  W PA++++   +  +LV+  + +       +    D L +RP  P
Sbjct  187   TEVEVNLEKDNVRDIWLPAVVIKENEDKTFLVKCLSARNSDEAGPMKTIVDFLHIRPPPP  246

Query  344   ILQRVDR-FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQE  168
             +    DR +  LE VD     GWR G + ++L G +Y V F+  NE  E  H  +R H E
Sbjct  247   LY--ADRNYELLERVDTRYGFGWRSGVITKLLAGRRYNVFFKHGNEDKELSHSKIRPHLE  304

Query  167   WINGAW  150
             W++G W
Sbjct  305   WVDGKW  310


 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 82/279 (29%), Positives = 126/279 (45%), Gaps = 42/279 (15%)
 Frame = -3

Query  1928  VEFETLCSDDD--PMKRRKEYVHLSAVRPAPPG---EPCCYFRVGESADVFYENRGWRRG  1764
             V+++TL ++D   P+    E V    +RP PP    +    F+  E+ D    + GW  G
Sbjct  73    VQYKTLVTEDGSAPLV---EQVDPHLIRPLPPQYLLKNGGLFQENEAIDASLRD-GWWSG  128

Query  1763  TVDEILEN-SMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKK  1587
              V ++L+  S YMV   +   V  V+ E   LR+H DW DG WV P        Q Q++ 
Sbjct  129   VVKKVLDGGSRYMVYFDNPPDV--VEFEAKDLRLHLDWVDGNWVRP--------QMQRQA  178

Query  1586  SEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLL  1407
             +                  GS    FS    VEV  +K+     W  +VV++   +   L
Sbjct  179   T------------------GSV---FSSGTEVEVNLEKDNVRDIWLPAVVIKENEDKTFL  217

Query  1406  VQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVL  1227
             V+    +  D    +   VD   IRP PP ++    ++LL++VD   G GW  G ++K+L
Sbjct  218   VKCLSARNSDEAGPMKTIVDFLHIRP-PPPLYADRNYELLERVDTRYGFGWRSGVITKLL  276

Query  1226  GDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
                +Y V F   NE      S +RPH EW +  W++ +K
Sbjct  277   AGRRYNVFFKHGNEDKELSHSKIRPHLEWVDGKWISKSK  315


 Score = 53.5 bits (127),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 78/167 (47%), Gaps = 19/167 (11%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEV-LMRDNF-PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             P+    +  + F+ G  VEV L +DN   IW PA V    +++N+    +        SD
Sbjct  172   PQMQRQATGSVFSSGTEVEVNLEKDNVRDIWLPAVV----IKENEDKTFLVKCLSARNSD  227

Query  1901  D-DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMV  1725
             +  PMK   +++H   +RP PP      + + E  D  Y   GWR G + ++L    Y V
Sbjct  228   EAGPMKTIVDFLH---IRPPPPLYADRNYELLERVDTRY-GFGWRSGVITKLLAGRRYNV  283

Query  1724  AL--GDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQV--DQQYQ  1596
                 G+ED     ++   ++R H +W DG W+   +E ++  D Q Q
Sbjct  284   FFKHGNEDK----ELSHSKIRPHLEWVDGKWISKSKEVRIVSDSQGQ  326



>gb|KDO86909.1| hypothetical protein CISIN_1g002548mg [Citrus sinensis]
Length=638

 Score =   164 bits (416),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 104/304 (34%), Positives = 152/304 (50%), Gaps = 35/304 (12%)
 Frame = -3

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVME------VLGNGKLLVQYQDLKTDDGTDYLIEE  1353
             +FSK   VEV  D+EGF  +WY + ++E           K L++Y+ L T+DG+  L E 
Sbjct  11    QFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPLTEY  70

Query  1352  VDASCIRPCPPEIHRISP-FKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
             +D + IRP PP+       F+L + V+A   +GWW G V KVL + K+ VCF +  +++ 
Sbjct  71    IDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCFDNPPDVID  130

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
             FEA DLR H +W N  WV   K                         ++ G  FS G  V
Sbjct  131   FEAIDLRVHYQWVNGKWVRPEK------------------------EQSTGSIFSPGTAV  166

Query  995   EAT-SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLI  819
             E     +E     W+ A++        F ++YQ  +  +E+  +K   D+ +IRP PP  
Sbjct  167   EVNLDNKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVKVTLDSQHIRPPPP--  224

Query  818   HRFDR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
                DR +++ E+VD  Y  GW  G+I+KVL G  Y V+F   NE+ E +H  IRPH EW 
Sbjct  225   RYVDRNYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNEDKELSHSEIRPHVEWT  284

Query  641   DKKW  630
                W
Sbjct  285   GGNW  288


 Score =   151 bits (381),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 102/299 (34%), Positives = 148/299 (49%), Gaps = 30/299 (10%)
 Frame = -3

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDS------IGPNKFLLEYQTLRTDDESEPLKEK  858
             +FSKG  VE TS EEG+ G+WY A I +S          K L+EY+ L T+D S PL E 
Sbjct  11    QFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPLTEY  70

Query  857   ADAFNIRPCPPLIHRF-DRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIE  681
              D   IRP PP      D F++ E V+A Y +GWW G + KVLD   + V F    + I+
Sbjct  71    IDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCFDNPPDVID  130

Query  680   FAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVK-D  504
             F    +R H +W++ KW                    R     ++ + F  G  VEV  D
Sbjct  131   FEAIDLRVHYQWVNGKW-------------------VRPEKEQSTGSIFSPGTAVEVNLD  171

Query  503   DEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDR  324
             ++E  +  W+PA++++   +G + V+++  K       +    D+  +RP  P  + VDR
Sbjct  172   NKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVKVTLDSQHIRPPPP--RYVDR  229

Query  323   -FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              +  LE+VD     GWR G + +VL G +Y V F+  NE  E  H  +R H EW  G W
Sbjct  230   NYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNEDKELSHSEIRPHVEWTGGNW  288


 Score =   114 bits (285),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 94/324 (29%), Positives = 150/324 (46%), Gaps = 47/324 (15%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDNF--PIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDD--PM  1890
             ++ QF+KG  VEV   +      W+ A +L  P    +++  +  +E++ L ++D   P+
Sbjct  8     SQIQFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPL  67

Query  1889  KRRKEYVHLSAVRPAPPGEPCC--YFRVGESADVFYENRGWRRGTVDEILENSMYMVALG  1716
                 EY+  + +RP PP +      F + E  +  Y + GW  GTV ++L+N  + V   
Sbjct  68    T---EYIDPAYIRPLPPQQEGGEDVFELNEVVEANYRD-GWWTGTVRKVLDNGKFRVCFD  123

Query  1715  DEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKC  1536
             +   V  +  E   LRVH  W +G WV P +E                            
Sbjct  124   NPPDV--IDFEAIDLRVHYQWVNGKWVRPEKEQ---------------------------  154

Query  1535  TRGSCVRKFSKEMPVEVKGD-KEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLI  1359
             + GS    FS    VEV  D KE     W+ ++V++   +G   V+YQ+ K  +    + 
Sbjct  155   STGSI---FSPGTAVEVNLDNKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVK  211

Query  1358  EEVDASCIRPCPPE-IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
               +D+  IRP PP  + R   ++LL+KVD   G GW  G ++KVL   +Y V F   NE 
Sbjct  212   VTLDSQHIRPPPPRYVDR--NYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNED  269

Query  1181  LTFEASDLRPHQEWKNNNWVAATK  1110
                  S++RPH EW   NW++ +K
Sbjct  270   KELSHSEIRPHVEWTGGNWISKSK  293


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 7/145 (5%)
 Frame = -3

Query  563  SGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILR------LIGNGKYLVEFRTLKCDF  402
            S    S+  F  G +VEV  DEEG +G+WY A IL            K L+E++ L  + 
Sbjct  3    SSDTESQIQFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTED  62

Query  401  GTDLLVQEADALSVRPSAPILQ-RVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNF  225
            G+  L +  D   +RP  P  +   D F   E V+A   +GW  G V +VL+  K+RV F
Sbjct  63   GSGPLTEYIDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCF  122

Query  224  RTTNEILEFRHHGLRLHQEWINGAW  150
                ++++F    LR+H +W+NG W
Sbjct  123  DNPPDVIDFEAIDLRVHYQWVNGKW  147



>ref|XP_010322317.1| PREDICTED: uncharacterized protein LOC101262656 isoform X2 [Solanum 
lycopersicum]
Length=894

 Score =   167 bits (423),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 102/292 (35%), Positives = 156/292 (53%), Gaps = 33/292 (11%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVME-VLGNGKLLVQYQDLKTDD-GTDYLIEEVDASCIRPCPP  1320
             VEV  D+EGFE  W+   ++   L   K+LV+Y+ +  DD G+  L E V  S +RP PP
Sbjct  24    VEVTSDEEGFEGVWFDGTILNYSLNKKKVLVEYRSILADDNGSKPLRELVHVSFVRPVPP  83

Query  1319  EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEW  1140
              +  +  F L D VDA   +GWW G ++KVL D++Y V F +  ++L F  SDLR H++W
Sbjct  84    -LEIVECFGLHDVVDASYKDGWWTGVITKVLDDSRYQVTFNNPPDVLEFCVSDLRLHKQW  142

Query  1139  KNNNWVAATKIDLP-RSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHG  963
              N NWV      LP +  +D ++                   FS G  VE     +    
Sbjct  143   VNGNWV------LPGKQRTDSLM-------------------FSVGKNVEVLFDRDDRRD  177

Query  962   SWYTAVIFDSIGPNKFLLE-YQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEE  786
             +W+ + + + +    FL+E Y+T+  D ++   K   D+F+IRP PP I R  +F + E+
Sbjct  178   AWFPSKVLEQLENGSFLVERYRTI--DKKASIDKVTVDSFHIRPLPPHIKR-KKFNLLEK  234

Query  785   VDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             VDA+Y+  WW G+I++ L    Y+V+F  TN + E     +RPH +W D +W
Sbjct  235   VDAFYDLAWWSGVITRELADSRYIVFFKHTNMQKELNDFDLRPHMDWKDGQW  286


 Score =   155 bits (392),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 150/292 (51%), Gaps = 26/292 (9%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFD-SIGPNKFLLEYQTLRTDDE-SEPLKEKADAFN  843
              ++G  VE TS EEG+ G W+   I + S+   K L+EY+++  DD  S+PL+E      
Sbjct  18    LTEGSTVEVTSDEEGFEGVWFDGTILNYSLNKKKVLVEYRSILADDNGSKPLRELVHVSF  77

Query  842   IRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGI  663
             +RP PPL    + F + + VDA Y +GWW G+I+KVLD   Y V F    + +EF    +
Sbjct  78    VRPVPPL-EIVECFGLHDVVDASYKDGWWTGVITKVLDDSRYQVTFNNPPDVLEFCVSDL  136

Query  662   RPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQG  483
             R H++W++  W +             PG  R  S        F +G  VEV  D +  + 
Sbjct  137   RLHKQWVNGNWVL-------------PGKQRTDS------LMFSVGKNVEVLFDRDDRRD  177

Query  482   SWYPALILRLIGNGKYLVE-FRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEE  306
             +W+P+ +L  + NG +LVE +RT+      D +    D+  +RP  P ++R  +F  LE+
Sbjct  178   AWFPSKVLEQLENGSFLVERYRTIDKKASIDKVT--VDSFHIRPLPPHIKR-KKFNLLEK  234

Query  305   VDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             VDA+ +  W  G +   L  ++Y V F+ TN   E     LR H +W +G W
Sbjct  235   VDAFYDLAWWSGVITRELADSRYIVFFKHTNMQKELNDFDLRPHMDWKDGQW  286


 Score =   138 bits (347),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 96/300 (32%), Positives = 145/300 (48%), Gaps = 42/300 (14%)
 Frame = -3

Query  1994  IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCYFR  1815
             +WF   +L  S+ K +    + VE+ ++ +DD+  K  +E VH+S VRP PP E    F 
Sbjct  36    VWFDGTILNYSLNKKK----VLVEYRSILADDNGSKPLRELVHVSFVRPVPPLEIVECFG  91

Query  1814  VGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWV  1635
             + +  D  Y++ GW  G + ++L++S Y V   +   V    V    LR+H+ W +G WV
Sbjct  92    LHDVVDASYKD-GWWTGVITKVLDDSRYQVTFNNPPDVLEFCVSD--LRLHKQWVNGNWV  148

Query  1634  PPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERS  1455
              P            K+  D LM                   FS    VEV  D++    +
Sbjct  149   LP-----------GKQRTDSLM-------------------FSVGKNVEVLFDRDDRRDA  178

Query  1454  WYASVVMEVLGNGKLLVQ-YQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKV  1278
             W+ S V+E L NG  LV+ Y+ +      D +   VD+  IRP PP I R   F LL+KV
Sbjct  179   WFPSKVLEQLENGSFLVERYRTIDKKASIDKVT--VDSFHIRPLPPHIKR-KKFNLLEKV  235

Query  1277  DAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLP  1098
             DA+    WW G +++ L D++Y+V F   N        DLRPH +WK+  W   ++ D+P
Sbjct  236   DAFYDLAWWSGVITRELADSRYIVFFKHTNMQKELNDFDLRPHMDWKDGQWFTTSR-DIP  294



>ref|XP_004229374.1| PREDICTED: uncharacterized protein LOC101262656 isoform X1 [Solanum 
lycopersicum]
Length=923

 Score =   167 bits (423),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 102/292 (35%), Positives = 156/292 (53%), Gaps = 33/292 (11%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVME-VLGNGKLLVQYQDLKTDD-GTDYLIEEVDASCIRPCPP  1320
             VEV  D+EGFE  W+   ++   L   K+LV+Y+ +  DD G+  L E V  S +RP PP
Sbjct  24    VEVTSDEEGFEGVWFDGTILNYSLNKKKVLVEYRSILADDNGSKPLRELVHVSFVRPVPP  83

Query  1319  EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEW  1140
              +  +  F L D VDA   +GWW G ++KVL D++Y V F +  ++L F  SDLR H++W
Sbjct  84    -LEIVECFGLHDVVDASYKDGWWTGVITKVLDDSRYQVTFNNPPDVLEFCVSDLRLHKQW  142

Query  1139  KNNNWVAATKIDLP-RSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHG  963
              N NWV      LP +  +D ++                   FS G  VE     +    
Sbjct  143   VNGNWV------LPGKQRTDSLM-------------------FSVGKNVEVLFDRDDRRD  177

Query  962   SWYTAVIFDSIGPNKFLLE-YQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEE  786
             +W+ + + + +    FL+E Y+T+  D ++   K   D+F+IRP PP I R  +F + E+
Sbjct  178   AWFPSKVLEQLENGSFLVERYRTI--DKKASIDKVTVDSFHIRPLPPHIKR-KKFNLLEK  234

Query  785   VDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             VDA+Y+  WW G+I++ L    Y+V+F  TN + E     +RPH +W D +W
Sbjct  235   VDAFYDLAWWSGVITRELADSRYIVFFKHTNMQKELNDFDLRPHMDWKDGQW  286


 Score =   155 bits (392),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 150/292 (51%), Gaps = 26/292 (9%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFD-SIGPNKFLLEYQTLRTDDE-SEPLKEKADAFN  843
              ++G  VE TS EEG+ G W+   I + S+   K L+EY+++  DD  S+PL+E      
Sbjct  18    LTEGSTVEVTSDEEGFEGVWFDGTILNYSLNKKKVLVEYRSILADDNGSKPLRELVHVSF  77

Query  842   IRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGI  663
             +RP PPL    + F + + VDA Y +GWW G+I+KVLD   Y V F    + +EF    +
Sbjct  78    VRPVPPL-EIVECFGLHDVVDASYKDGWWTGVITKVLDDSRYQVTFNNPPDVLEFCVSDL  136

Query  662   RPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQG  483
             R H++W++  W +             PG  R  S        F +G  VEV  D +  + 
Sbjct  137   RLHKQWVNGNWVL-------------PGKQRTDS------LMFSVGKNVEVLFDRDDRRD  177

Query  482   SWYPALILRLIGNGKYLVE-FRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEE  306
             +W+P+ +L  + NG +LVE +RT+      D +    D+  +RP  P ++R  +F  LE+
Sbjct  178   AWFPSKVLEQLENGSFLVERYRTIDKKASIDKVT--VDSFHIRPLPPHIKR-KKFNLLEK  234

Query  305   VDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             VDA+ +  W  G +   L  ++Y V F+ TN   E     LR H +W +G W
Sbjct  235   VDAFYDLAWWSGVITRELADSRYIVFFKHTNMQKELNDFDLRPHMDWKDGQW  286


 Score =   138 bits (347),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 96/300 (32%), Positives = 145/300 (48%), Gaps = 42/300 (14%)
 Frame = -3

Query  1994  IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCYFR  1815
             +WF   +L  S+ K +    + VE+ ++ +DD+  K  +E VH+S VRP PP E    F 
Sbjct  36    VWFDGTILNYSLNKKK----VLVEYRSILADDNGSKPLRELVHVSFVRPVPPLEIVECFG  91

Query  1814  VGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWV  1635
             + +  D  Y++ GW  G + ++L++S Y V   +   V    V    LR+H+ W +G WV
Sbjct  92    LHDVVDASYKD-GWWTGVITKVLDDSRYQVTFNNPPDVLEFCVSD--LRLHKQWVNGNWV  148

Query  1634  PPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERS  1455
              P            K+  D LM                   FS    VEV  D++    +
Sbjct  149   LP-----------GKQRTDSLM-------------------FSVGKNVEVLFDRDDRRDA  178

Query  1454  WYASVVMEVLGNGKLLVQ-YQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKV  1278
             W+ S V+E L NG  LV+ Y+ +      D +   VD+  IRP PP I R   F LL+KV
Sbjct  179   WFPSKVLEQLENGSFLVERYRTIDKKASIDKVT--VDSFHIRPLPPHIKR-KKFNLLEKV  235

Query  1277  DAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLP  1098
             DA+    WW G +++ L D++Y+V F   N        DLRPH +WK+  W   ++ D+P
Sbjct  236   DAFYDLAWWSGVITRELADSRYIVFFKHTNMQKELNDFDLRPHMDWKDGQWFTTSR-DIP  294



>gb|KDO86907.1| hypothetical protein CISIN_1g002548mg [Citrus sinensis]
Length=688

 Score =   165 bits (417),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 104/304 (34%), Positives = 152/304 (50%), Gaps = 35/304 (12%)
 Frame = -3

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVME------VLGNGKLLVQYQDLKTDDGTDYLIEE  1353
             +FSK   VEV  D+EGF  +WY + ++E           K L++Y+ L T+DG+  L E 
Sbjct  11    QFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPLTEY  70

Query  1352  VDASCIRPCPPEIHRISP-FKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
             +D + IRP PP+       F+L + V+A   +GWW G V KVL + K+ VCF +  +++ 
Sbjct  71    IDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCFDNPPDVID  130

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
             FEA DLR H +W N  WV   K                         ++ G  FS G  V
Sbjct  131   FEAIDLRVHYQWVNGKWVRPEK------------------------EQSTGSIFSPGTAV  166

Query  995   EAT-SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLI  819
             E     +E     W+ A++        F ++YQ  +  +E+  +K   D+ +IRP PP  
Sbjct  167   EVNLDNKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVKVTLDSQHIRPPPP--  224

Query  818   HRFDR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
                DR +++ E+VD  Y  GW  G+I+KVL G  Y V+F   NE+ E +H  IRPH EW 
Sbjct  225   RYVDRNYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNEDKELSHSEIRPHVEWT  284

Query  641   DKKW  630
                W
Sbjct  285   GGNW  288


 Score =   151 bits (381),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 104/299 (35%), Positives = 150/299 (50%), Gaps = 30/299 (10%)
 Frame = -3

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDS------IGPNKFLLEYQTLRTDDESEPLKEK  858
             +FSKG  VE TS EEG+ G+WY A I +S          K L+EY+ L T+D S PL E 
Sbjct  11    QFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPLTEY  70

Query  857   ADAFNIRPCPPLIHRF-DRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIE  681
              D   IRP PP      D F++ E V+A Y +GWW G + KVLD   + V F    + I+
Sbjct  71    IDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCFDNPPDVID  130

Query  680   FAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVK-D  504
             F    +R H +W++ KW              +P   +  S G    + F  G  VEV  D
Sbjct  131   FEAIDLRVHYQWVNGKW-------------VRP--EKEQSTG----SIFSPGTAVEVNLD  171

Query  503   DEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDR  324
             ++E  +  W+PA++++   +G + V+++  K       +    D+  +RP  P  + VDR
Sbjct  172   NKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVKVTLDSQHIRPPPP--RYVDR  229

Query  323   -FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              +  LE+VD     GWR G + +VL G +Y V F+  NE  E  H  +R H EW  G W
Sbjct  230   NYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNEDKELSHSEIRPHVEWTGGNW  288


 Score =   114 bits (284),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 94/324 (29%), Positives = 150/324 (46%), Gaps = 47/324 (15%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDNF--PIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDD--PM  1890
             ++ QF+KG  VEV   +      W+ A +L  P    +++  +  +E++ L ++D   P+
Sbjct  8     SQIQFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPL  67

Query  1889  KRRKEYVHLSAVRPAPPGEPCC--YFRVGESADVFYENRGWRRGTVDEILENSMYMVALG  1716
                 EY+  + +RP PP +      F + E  +  Y + GW  GTV ++L+N  + V   
Sbjct  68    T---EYIDPAYIRPLPPQQEGGEDVFELNEVVEANYRD-GWWTGTVRKVLDNGKFRVCFD  123

Query  1715  DEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKC  1536
             +   V  +  E   LRVH  W +G WV P +E                            
Sbjct  124   NPPDV--IDFEAIDLRVHYQWVNGKWVRPEKEQ---------------------------  154

Query  1535  TRGSCVRKFSKEMPVEVKGD-KEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLI  1359
             + GS    FS    VEV  D KE     W+ ++V++   +G   V+YQ+ K  +    + 
Sbjct  155   STGSI---FSPGTAVEVNLDNKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVK  211

Query  1358  EEVDASCIRPCPPE-IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
               +D+  IRP PP  + R   ++LL+KVD   G GW  G ++KVL   +Y V F   NE 
Sbjct  212   VTLDSQHIRPPPPRYVDR--NYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNED  269

Query  1181  LTFEASDLRPHQEWKNNNWVAATK  1110
                  S++RPH EW   NW++ +K
Sbjct  270   KELSHSEIRPHVEWTGGNWISKSK  293


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 7/145 (5%)
 Frame = -3

Query  563  SGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILR------LIGNGKYLVEFRTLKCDF  402
            S    S+  F  G +VEV  DEEG +G+WY A IL            K L+E++ L  + 
Sbjct  3    SSDTESQIQFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTED  62

Query  401  GTDLLVQEADALSVRPSAPILQ-RVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNF  225
            G+  L +  D   +RP  P  +   D F   E V+A   +GW  G V +VL+  K+RV F
Sbjct  63   GSGPLTEYIDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCF  122

Query  224  RTTNEILEFRHHGLRLHQEWINGAW  150
                ++++F    LR+H +W+NG W
Sbjct  123  DNPPDVIDFEAIDLRVHYQWVNGKW  147



>ref|XP_009758791.1| PREDICTED: uncharacterized protein LOC104211439 isoform X3 [Nicotiana 
sylvestris]
Length=882

 Score =   166 bits (421),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/299 (33%), Positives = 159/299 (53%), Gaps = 32/299 (11%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNG----KLLVQYQDL-KTDDGTDYLIEEVD  1347
              +K   VEV  D+EGF+  W+ + V+     G    ++ V+Y+ +   ++G++ L E + 
Sbjct  12    LTKGSTVEVTSDEEGFKGVWFEATVLGASSPGSKSKEVWVEYKSIVAEENGSELLKEVLH  71

Query  1346  ASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEA  1167
              S +RP PP + +I  F+L D VDA+  +GWW G V++VL D++Y V F +  + L F  
Sbjct  72    VSFVRPVPP-VEKIERFELYDDVDAFHKDGWWTGVVTRVLEDSRYQVTFDNPPDELEFGV  130

Query  1166  SDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEAT  987
             S+LR HQ+W    WV   K    + +  +M                    FS G  VE +
Sbjct  131   SELRFHQKWVKGKWVRPGK----QRTGSLM--------------------FSVGENVEVS  166

Query  986   SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFD  807
                E    +W+ + + +  G + FL+E     +D ++   K   D+F+IRP PP I   +
Sbjct  167   FDSEDRRDAWFPSTVLEHCGNSSFLVESYRRASDKKAIVEKVLVDSFHIRPIPPRI--VN  224

Query  806   RFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             +F + E+VDA Y+ GWW G+I++ LD   Y+V+F  TN+E+E     +RPH +W D +W
Sbjct  225   KFSLLEKVDALYDYGWWSGVITRELDDSRYIVFFKHTNKEMELNDSDLRPHMDWKDGQW  283


 Score =   159 bits (402),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 94/294 (32%), Positives = 153/294 (52%), Gaps = 27/294 (9%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGP----NKFLLEYQTLRTDDE-SEPLKEKAD  852
              +KG  VE TS EEG+ G W+ A +  +  P     +  +EY+++  ++  SE LKE   
Sbjct  12    LTKGSTVEVTSDEEGFKGVWFEATVLGASSPGSKSKEVWVEYKSIVAEENGSELLKEVLH  71

Query  851   AFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
                +RP PP + + +RF+++++VDA++ +GWW G++++VL+   Y V F    +E+EF  
Sbjct  72    VSFVRPVPP-VEKIERFELYDDVDAFHKDGWWTGVVTRVLEDSRYQVTFDNPPDELEFGV  130

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
               +R HQ+W+  KW              +PG  R  S        F +G  VEV  D E 
Sbjct  131   SELRFHQKWVKGKW-------------VRPGKQRTGS------LMFSVGENVEVSFDSED  171

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPL  312
              + +W+P+ +L   GN  +LVE      D    +     D+  +RP  P +  V++F  L
Sbjct  172   RRDAWFPSTVLEHCGNSSFLVESYRRASDKKAIVEKVLVDSFHIRPIPPRI--VNKFSLL  229

Query  311   EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             E+VDA  + GW  G +   L+ ++Y V F+ TN+ +E     LR H +W +G W
Sbjct  230   EKVDALYDYGWWSGVITRELDDSRYIVFFKHTNKEMELNDSDLRPHMDWKDGQW  283


 Score =   139 bits (351),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 101/325 (31%), Positives = 160/325 (49%), Gaps = 43/325 (13%)
 Frame = -3

Query  2048  AQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKE  1875
             +   KG  VEV    + F  +WF A VL  S     ++ +++VE++++ ++++  +  KE
Sbjct  10    SHLTKGSTVEVTSDEEGFKGVWFEATVLGAS-SPGSKSKEVWVEYKSIVAEENGSELLKE  68

Query  1874  YVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVES  1695
              +H+S VRP PP E    F + +  D F+++ GW  G V  +LE+S Y V    ++  + 
Sbjct  69    VLHVSFVRPVPPVEKIERFELYDDVDAFHKD-GWWTGVVTRVLEDSRYQVTF--DNPPDE  125

Query  1694  VKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVR  1515
             ++    +LR H+ W  G WV P            K+    LM                  
Sbjct  126   LEFGVSELRFHQKWVKGKWVRP-----------GKQRTGSLM------------------  156

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEE--VDAS  1341
              FS    VEV  D E    +W+ S V+E  GN   LV+     +D     ++E+  VD+ 
Sbjct  157   -FSVGENVEVSFDSEDRRDAWFPSTVLEHCGNSSFLVESYRRASDKKA--IVEKVLVDSF  213

Query  1340  CIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
              IRP PP I  ++ F LL+KVDA    GWW G +++ L D++Y+V F   N+ +    SD
Sbjct  214   HIRPIPPRI--VNKFSLLEKVDALYDYGWWSGVITRELDDSRYIVFFKHTNKEMELNDSD  271

Query  1160  LRPHQEWKNNNWVA-ATKIDLPRSS  1089
             LRPH +WK+  W   A ++ +P  S
Sbjct  272   LRPHMDWKDGQWFTNAREVSIPSDS  296



>ref|XP_011002741.1| PREDICTED: uncharacterized protein LOC105109662 isoform X2 [Populus 
euphratica]
Length=910

 Score =   166 bits (421),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 103/297 (35%), Positives = 149/297 (50%), Gaps = 42/297 (14%)
 Frame = -3

Query  1469  GFERSWYASVVME-------------VLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRP  1329
             GF  +WY + ++E                  K +VQY+ L T+DG+  L+E+VD   IRP
Sbjct  39    GFRGAWYLATILEFPKPQSQAAVKSASKKKRKAIVQYKTLVTEDGSAPLVEQVDPHLIRP  98

Query  1328  CPPE--IHRISPFKLLDKVDAWVGNGWWEGHVSKVL-GDAKYMVCFGSMNELLTFEASDL  1158
              PP+  +     F+  + +DA + +GWW G V KVL G ++YMV F +  +++ FEA DL
Sbjct  99    LPPQYLLKNGGLFQENEAIDASLRDGWWSGVVKKVLDGGSRYMVYFDNPPDVVEFEAKDL  158

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFE  978
             R H +W + NWV                         +  R+A G  FS G  VE    +
Sbjct  159   RLHLDWVDGNWVRP-----------------------QMQRQATGSVFSSGTEVEVNLEK  195

Query  977   EGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDR-F  801
             +     W  AV+        FL++  + R  DE+ P+K   D  +IRP PPL    DR +
Sbjct  196   DNVRDIWLPAVVIKENEDKTFLVKCLSARNSDEAGPMKTIVDFLHIRPPPPLYA--DRNY  253

Query  800   KMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             ++ E VD  Y  GW  G+I+K+L G  Y V+F   NE+ E +H  IRPH EW+D KW
Sbjct  254   ELLERVDTRYGFGWRSGVITKLLAGRRYNVFFKHGNEDKELSHSKIRPHLEWVDGKW  310


 Score =   147 bits (370),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 153/306 (50%), Gaps = 37/306 (12%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK-------------FLLEYQTLRTDDES  876
             F+KG  VE +S EEG+ G+WY A I +   P                +++Y+TL T+D S
Sbjct  25    FNKGEEVEVSSDEEGFRGAWYLATILEFPKPQSQAAVKSASKKKRKAIVQYKTLVTEDGS  84

Query  875   EPLKEKADAFNIRPCPP--LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLN-YVVYF  705
              PL E+ D   IRP PP  L+     F+  E +DA   +GWW G++ KVLDG + Y+VYF
Sbjct  85    APLVEQVDPHLIRPLPPQYLLKNGGLFQENEAIDASLRDGWWSGVVKKVLDGGSRYMVYF  144

Query  704   WTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIG  525
                 + +EF    +R H +W+D  W              +P + R+ +G +     F  G
Sbjct  145   DNPPDVVEFEAKDLRLHLDWVDGNW-------------VRPQMQRQATGSV-----FSSG  186

Query  524   AKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAP  345
              +VEV  +++  +  W PA++++   +  +LV+  + +       +    D L +RP  P
Sbjct  187   TEVEVNLEKDNVRDIWLPAVVIKENEDKTFLVKCLSARNSDEAGPMKTIVDFLHIRPPPP  246

Query  344   ILQRVDR-FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQE  168
             +    DR +  LE VD     GWR G + ++L G +Y V F+  NE  E  H  +R H E
Sbjct  247   LY--ADRNYELLERVDTRYGFGWRSGVITKLLAGRRYNVFFKHGNEDKELSHSKIRPHLE  304

Query  167   WINGAW  150
             W++G W
Sbjct  305   WVDGKW  310


 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 82/279 (29%), Positives = 126/279 (45%), Gaps = 42/279 (15%)
 Frame = -3

Query  1928  VEFETLCSDDD--PMKRRKEYVHLSAVRPAPPG---EPCCYFRVGESADVFYENRGWRRG  1764
             V+++TL ++D   P+    E V    +RP PP    +    F+  E+ D    + GW  G
Sbjct  73    VQYKTLVTEDGSAPLV---EQVDPHLIRPLPPQYLLKNGGLFQENEAIDASLRD-GWWSG  128

Query  1763  TVDEILEN-SMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKK  1587
              V ++L+  S YMV   +   V  V+ E   LR+H DW DG WV P        Q Q++ 
Sbjct  129   VVKKVLDGGSRYMVYFDNPPDV--VEFEAKDLRLHLDWVDGNWVRP--------QMQRQA  178

Query  1586  SEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLL  1407
             +                  GS    FS    VEV  +K+     W  +VV++   +   L
Sbjct  179   T------------------GSV---FSSGTEVEVNLEKDNVRDIWLPAVVIKENEDKTFL  217

Query  1406  VQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVL  1227
             V+    +  D    +   VD   IRP PP ++    ++LL++VD   G GW  G ++K+L
Sbjct  218   VKCLSARNSDEAGPMKTIVDFLHIRP-PPPLYADRNYELLERVDTRYGFGWRSGVITKLL  276

Query  1226  GDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
                +Y V F   NE      S +RPH EW +  W++ +K
Sbjct  277   AGRRYNVFFKHGNEDKELSHSKIRPHLEWVDGKWISKSK  315


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 78/167 (47%), Gaps = 19/167 (11%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEV-LMRDNF-PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             P+    +  + F+ G  VEV L +DN   IW PA V    +++N+    +        SD
Sbjct  172   PQMQRQATGSVFSSGTEVEVNLEKDNVRDIWLPAVV----IKENEDKTFLVKCLSARNSD  227

Query  1901  D-DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMV  1725
             +  PMK   +++H   +RP PP      + + E  D  Y   GWR G + ++L    Y V
Sbjct  228   EAGPMKTIVDFLH---IRPPPPLYADRNYELLERVDTRY-GFGWRSGVITKLLAGRRYNV  283

Query  1724  AL--GDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQV--DQQYQ  1596
                 G+ED     ++   ++R H +W DG W+   +E ++  D Q Q
Sbjct  284   FFKHGNEDK----ELSHSKIRPHLEWVDGKWISKSKEVRIVSDSQGQ  326



>ref|XP_009758789.1| PREDICTED: uncharacterized protein LOC104211439 isoform X1 [Nicotiana 
sylvestris]
Length=912

 Score =   166 bits (421),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/299 (33%), Positives = 159/299 (53%), Gaps = 32/299 (11%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNG----KLLVQYQDL-KTDDGTDYLIEEVD  1347
              +K   VEV  D+EGF+  W+ + V+     G    ++ V+Y+ +   ++G++ L E + 
Sbjct  12    LTKGSTVEVTSDEEGFKGVWFEATVLGASSPGSKSKEVWVEYKSIVAEENGSELLKEVLH  71

Query  1346  ASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEA  1167
              S +RP PP + +I  F+L D VDA+  +GWW G V++VL D++Y V F +  + L F  
Sbjct  72    VSFVRPVPP-VEKIERFELYDDVDAFHKDGWWTGVVTRVLEDSRYQVTFDNPPDELEFGV  130

Query  1166  SDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEAT  987
             S+LR HQ+W    WV   K    + +  +M                    FS G  VE +
Sbjct  131   SELRFHQKWVKGKWVRPGK----QRTGSLM--------------------FSVGENVEVS  166

Query  986   SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFD  807
                E    +W+ + + +  G + FL+E     +D ++   K   D+F+IRP PP I   +
Sbjct  167   FDSEDRRDAWFPSTVLEHCGNSSFLVESYRRASDKKAIVEKVLVDSFHIRPIPPRI--VN  224

Query  806   RFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             +F + E+VDA Y+ GWW G+I++ LD   Y+V+F  TN+E+E     +RPH +W D +W
Sbjct  225   KFSLLEKVDALYDYGWWSGVITRELDDSRYIVFFKHTNKEMELNDSDLRPHMDWKDGQW  283


 Score =   159 bits (401),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 94/294 (32%), Positives = 153/294 (52%), Gaps = 27/294 (9%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGP----NKFLLEYQTLRTDDE-SEPLKEKAD  852
              +KG  VE TS EEG+ G W+ A +  +  P     +  +EY+++  ++  SE LKE   
Sbjct  12    LTKGSTVEVTSDEEGFKGVWFEATVLGASSPGSKSKEVWVEYKSIVAEENGSELLKEVLH  71

Query  851   AFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
                +RP PP + + +RF+++++VDA++ +GWW G++++VL+   Y V F    +E+EF  
Sbjct  72    VSFVRPVPP-VEKIERFELYDDVDAFHKDGWWTGVVTRVLEDSRYQVTFDNPPDELEFGV  130

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
               +R HQ+W+  KW              +PG  R  S        F +G  VEV  D E 
Sbjct  131   SELRFHQKWVKGKW-------------VRPGKQRTGS------LMFSVGENVEVSFDSED  171

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPL  312
              + +W+P+ +L   GN  +LVE      D    +     D+  +RP  P +  V++F  L
Sbjct  172   RRDAWFPSTVLEHCGNSSFLVESYRRASDKKAIVEKVLVDSFHIRPIPPRI--VNKFSLL  229

Query  311   EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             E+VDA  + GW  G +   L+ ++Y V F+ TN+ +E     LR H +W +G W
Sbjct  230   EKVDALYDYGWWSGVITRELDDSRYIVFFKHTNKEMELNDSDLRPHMDWKDGQW  283


 Score =   139 bits (351),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 101/325 (31%), Positives = 160/325 (49%), Gaps = 43/325 (13%)
 Frame = -3

Query  2048  AQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKE  1875
             +   KG  VEV    + F  +WF A VL  S     ++ +++VE++++ ++++  +  KE
Sbjct  10    SHLTKGSTVEVTSDEEGFKGVWFEATVLGAS-SPGSKSKEVWVEYKSIVAEENGSELLKE  68

Query  1874  YVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVES  1695
              +H+S VRP PP E    F + +  D F+++ GW  G V  +LE+S Y V    ++  + 
Sbjct  69    VLHVSFVRPVPPVEKIERFELYDDVDAFHKD-GWWTGVVTRVLEDSRYQVTF--DNPPDE  125

Query  1694  VKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVR  1515
             ++    +LR H+ W  G WV P            K+    LM                  
Sbjct  126   LEFGVSELRFHQKWVKGKWVRP-----------GKQRTGSLM------------------  156

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEE--VDAS  1341
              FS    VEV  D E    +W+ S V+E  GN   LV+     +D     ++E+  VD+ 
Sbjct  157   -FSVGENVEVSFDSEDRRDAWFPSTVLEHCGNSSFLVESYRRASDKKA--IVEKVLVDSF  213

Query  1340  CIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
              IRP PP I  ++ F LL+KVDA    GWW G +++ L D++Y+V F   N+ +    SD
Sbjct  214   HIRPIPPRI--VNKFSLLEKVDALYDYGWWSGVITRELDDSRYIVFFKHTNKEMELNDSD  271

Query  1160  LRPHQEWKNNNWVA-ATKIDLPRSS  1089
             LRPH +WK+  W   A ++ +P  S
Sbjct  272   LRPHMDWKDGQWFTNAREVSIPSDS  296



>ref|XP_007205992.1| hypothetical protein PRUPE_ppa012230mg [Prunus persica]
 gb|EMJ07191.1| hypothetical protein PRUPE_ppa012230mg [Prunus persica]
Length=178

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             F+KG  VE +S EEG++G+W+ A I +++G +KFL+EYQ+LRT+D+S  L+E+ D  +IR
Sbjct  45    FTKGTPVEVSSDEEGFNGAWFAATIVEAVGEDKFLIEYQSLRTEDDSAFLREEIDTLHIR  104

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             PCPP I   D F + +EVD +YN+GWW G+ISKVL G  Y+VYF  T EEIEF H  +R 
Sbjct  105   PCPPEI-VVDHFSLLQEVDGYYNDGWWVGVISKVLRGSRYIVYFRGTYEEIEFQHSELRL  163

Query  656   HQEWIDKKWDIAFR  615
             HQ+WI  KW +A R
Sbjct  164   HQDWIGGKWVMASR  177


 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 90/135 (67%), Gaps = 1/135 (1%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIR  1332
             F+K  PVEV  D+EGF  +W+A+ ++E +G  K L++YQ L+T+D + +L EE+D   IR
Sbjct  45    FTKGTPVEVSSDEEGFNGAWFAATIVEAVGEDKFLIEYQSLRTEDDSAFLREEIDTLHIR  104

Query  1331  PCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRP  1152
             PCPPEI  +  F LL +VD +  +GWW G +SKVL  ++Y+V F    E + F+ S+LR 
Sbjct  105   PCPPEI-VVDHFSLLQEVDGYYNDGWWVGVISKVLRGSRYIVYFRGTYEEIEFQHSELRL  163

Query  1151  HQEWKNNNWVAATKI  1107
             HQ+W    WV A+++
Sbjct  164   HQDWIGGKWVMASRV  178


 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 86/135 (64%), Gaps = 1/135 (1%)
 Frame = -3

Query  554  IASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEA  375
            +++   F  G  VEV  DEEG  G+W+ A I+  +G  K+L+E+++L+ +  +  L +E 
Sbjct  39   VSTHEIFTKGTPVEVSSDEEGFNGAWFAATIVEAVGEDKFLIEYQSLRTEDDSAFLREEI  98

Query  374  DALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFR  195
            D L +RP  P +  VD F  L+EVD + N+GW VG + +VL G++Y V FR T E +EF+
Sbjct  99   DTLHIRPCPPEIV-VDHFSLLQEVDGYYNDGWWVGVISKVLRGSRYIVYFRGTYEEIEFQ  157

Query  194  HHGLRLHQEWINGAW  150
            H  LRLHQ+WI G W
Sbjct  158  HSELRLHQDWIGGKW  172


 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 68/142 (48%), Gaps = 7/142 (5%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRR  1881
             +S    F KG  VEV   +     F  A    ++ +     +  +E+++L ++DD    R
Sbjct  39    VSTHEIFTKGTPVEVSSDEE---GFNGAWFAATIVEAVGEDKFLIEYQSLRTEDDSAFLR  95

Query  1880  KEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAV  1701
             +E   L  +RP PP     +F + +  D +Y N GW  G + ++L  S Y+V        
Sbjct  96    EEIDTLH-IRPCPPEIVVDHFSLLQEVDGYY-NDGWWVGVISKVLRGSRYIVYF--RGTY  151

Query  1700  ESVKVEQWQLRVHRDWKDGCWV  1635
             E ++ +  +LR+H+DW  G WV
Sbjct  152   EEIEFQHSELRLHQDWIGGKWV  173



>ref|XP_011002740.1| PREDICTED: uncharacterized protein LOC105109662 isoform X1 [Populus 
euphratica]
Length=915

 Score =   166 bits (421),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 103/297 (35%), Positives = 149/297 (50%), Gaps = 42/297 (14%)
 Frame = -3

Query  1469  GFERSWYASVVME-------------VLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRP  1329
             GF  +WY + ++E                  K +VQY+ L T+DG+  L+E+VD   IRP
Sbjct  39    GFRGAWYLATILEFPKPQSQAAVKSASKKKRKAIVQYKTLVTEDGSAPLVEQVDPHLIRP  98

Query  1328  CPPE--IHRISPFKLLDKVDAWVGNGWWEGHVSKVL-GDAKYMVCFGSMNELLTFEASDL  1158
              PP+  +     F+  + +DA + +GWW G V KVL G ++YMV F +  +++ FEA DL
Sbjct  99    LPPQYLLKNGGLFQENEAIDASLRDGWWSGVVKKVLDGGSRYMVYFDNPPDVVEFEAKDL  158

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFE  978
             R H +W + NWV                         +  R+A G  FS G  VE    +
Sbjct  159   RLHLDWVDGNWVRP-----------------------QMQRQATGSVFSSGTEVEVNLEK  195

Query  977   EGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDR-F  801
             +     W  AV+        FL++  + R  DE+ P+K   D  +IRP PPL    DR +
Sbjct  196   DNVRDIWLPAVVIKENEDKTFLVKCLSARNSDEAGPMKTIVDFLHIRPPPPLYA--DRNY  253

Query  800   KMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             ++ E VD  Y  GW  G+I+K+L G  Y V+F   NE+ E +H  IRPH EW+D KW
Sbjct  254   ELLERVDTRYGFGWRSGVITKLLAGRRYNVFFKHGNEDKELSHSKIRPHLEWVDGKW  310


 Score =   147 bits (370),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 153/306 (50%), Gaps = 37/306 (12%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK-------------FLLEYQTLRTDDES  876
             F+KG  VE +S EEG+ G+WY A I +   P                +++Y+TL T+D S
Sbjct  25    FNKGEEVEVSSDEEGFRGAWYLATILEFPKPQSQAAVKSASKKKRKAIVQYKTLVTEDGS  84

Query  875   EPLKEKADAFNIRPCPP--LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLN-YVVYF  705
              PL E+ D   IRP PP  L+     F+  E +DA   +GWW G++ KVLDG + Y+VYF
Sbjct  85    APLVEQVDPHLIRPLPPQYLLKNGGLFQENEAIDASLRDGWWSGVVKKVLDGGSRYMVYF  144

Query  704   WTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIG  525
                 + +EF    +R H +W+D  W              +P + R+ +G +     F  G
Sbjct  145   DNPPDVVEFEAKDLRLHLDWVDGNW-------------VRPQMQRQATGSV-----FSSG  186

Query  524   AKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAP  345
              +VEV  +++  +  W PA++++   +  +LV+  + +       +    D L +RP  P
Sbjct  187   TEVEVNLEKDNVRDIWLPAVVIKENEDKTFLVKCLSARNSDEAGPMKTIVDFLHIRPPPP  246

Query  344   ILQRVDR-FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQE  168
             +    DR +  LE VD     GWR G + ++L G +Y V F+  NE  E  H  +R H E
Sbjct  247   LY--ADRNYELLERVDTRYGFGWRSGVITKLLAGRRYNVFFKHGNEDKELSHSKIRPHLE  304

Query  167   WINGAW  150
             W++G W
Sbjct  305   WVDGKW  310


 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 82/279 (29%), Positives = 126/279 (45%), Gaps = 42/279 (15%)
 Frame = -3

Query  1928  VEFETLCSDDD--PMKRRKEYVHLSAVRPAPPG---EPCCYFRVGESADVFYENRGWRRG  1764
             V+++TL ++D   P+    E V    +RP PP    +    F+  E+ D    + GW  G
Sbjct  73    VQYKTLVTEDGSAPLV---EQVDPHLIRPLPPQYLLKNGGLFQENEAIDASLRD-GWWSG  128

Query  1763  TVDEILEN-SMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKK  1587
              V ++L+  S YMV   +   V  V+ E   LR+H DW DG WV P        Q Q++ 
Sbjct  129   VVKKVLDGGSRYMVYFDNPPDV--VEFEAKDLRLHLDWVDGNWVRP--------QMQRQA  178

Query  1586  SEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLL  1407
             +                  GS    FS    VEV  +K+     W  +VV++   +   L
Sbjct  179   T------------------GSV---FSSGTEVEVNLEKDNVRDIWLPAVVIKENEDKTFL  217

Query  1406  VQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVL  1227
             V+    +  D    +   VD   IRP PP ++    ++LL++VD   G GW  G ++K+L
Sbjct  218   VKCLSARNSDEAGPMKTIVDFLHIRP-PPPLYADRNYELLERVDTRYGFGWRSGVITKLL  276

Query  1226  GDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
                +Y V F   NE      S +RPH EW +  W++ +K
Sbjct  277   AGRRYNVFFKHGNEDKELSHSKIRPHLEWVDGKWISKSK  315


 Score = 53.5 bits (127),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 78/167 (47%), Gaps = 19/167 (11%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEV-LMRDNF-PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             P+    +  + F+ G  VEV L +DN   IW PA V    +++N+    +        SD
Sbjct  172   PQMQRQATGSVFSSGTEVEVNLEKDNVRDIWLPAVV----IKENEDKTFLVKCLSARNSD  227

Query  1901  D-DPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMV  1725
             +  PMK   +++H   +RP PP      + + E  D  Y   GWR G + ++L    Y V
Sbjct  228   EAGPMKTIVDFLH---IRPPPPLYADRNYELLERVDTRY-GFGWRSGVITKLLAGRRYNV  283

Query  1724  AL--GDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQV--DQQYQ  1596
                 G+ED     ++   ++R H +W DG W+   +E ++  D Q Q
Sbjct  284   FFKHGNEDK----ELSHSKIRPHLEWVDGKWISKSKEVRIVSDSQGQ  326



>ref|XP_009758790.1| PREDICTED: uncharacterized protein LOC104211439 isoform X2 [Nicotiana 
sylvestris]
Length=905

 Score =   166 bits (421),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/299 (33%), Positives = 159/299 (53%), Gaps = 32/299 (11%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNG----KLLVQYQDL-KTDDGTDYLIEEVD  1347
              +K   VEV  D+EGF+  W+ + V+     G    ++ V+Y+ +   ++G++ L E + 
Sbjct  12    LTKGSTVEVTSDEEGFKGVWFEATVLGASSPGSKSKEVWVEYKSIVAEENGSELLKEVLH  71

Query  1346  ASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEA  1167
              S +RP PP + +I  F+L D VDA+  +GWW G V++VL D++Y V F +  + L F  
Sbjct  72    VSFVRPVPP-VEKIERFELYDDVDAFHKDGWWTGVVTRVLEDSRYQVTFDNPPDELEFGV  130

Query  1166  SDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEAT  987
             S+LR HQ+W    WV   K    + +  +M                    FS G  VE +
Sbjct  131   SELRFHQKWVKGKWVRPGK----QRTGSLM--------------------FSVGENVEVS  166

Query  986   SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFD  807
                E    +W+ + + +  G + FL+E     +D ++   K   D+F+IRP PP I   +
Sbjct  167   FDSEDRRDAWFPSTVLEHCGNSSFLVESYRRASDKKAIVEKVLVDSFHIRPIPPRI--VN  224

Query  806   RFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             +F + E+VDA Y+ GWW G+I++ LD   Y+V+F  TN+E+E     +RPH +W D +W
Sbjct  225   KFSLLEKVDALYDYGWWSGVITRELDDSRYIVFFKHTNKEMELNDSDLRPHMDWKDGQW  283


 Score =   159 bits (401),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 94/294 (32%), Positives = 153/294 (52%), Gaps = 27/294 (9%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGP----NKFLLEYQTLRTDDE-SEPLKEKAD  852
              +KG  VE TS EEG+ G W+ A +  +  P     +  +EY+++  ++  SE LKE   
Sbjct  12    LTKGSTVEVTSDEEGFKGVWFEATVLGASSPGSKSKEVWVEYKSIVAEENGSELLKEVLH  71

Query  851   AFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
                +RP PP + + +RF+++++VDA++ +GWW G++++VL+   Y V F    +E+EF  
Sbjct  72    VSFVRPVPP-VEKIERFELYDDVDAFHKDGWWTGVVTRVLEDSRYQVTFDNPPDELEFGV  130

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
               +R HQ+W+  KW              +PG  R  S        F +G  VEV  D E 
Sbjct  131   SELRFHQKWVKGKW-------------VRPGKQRTGS------LMFSVGENVEVSFDSED  171

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPL  312
              + +W+P+ +L   GN  +LVE      D    +     D+  +RP  P +  V++F  L
Sbjct  172   RRDAWFPSTVLEHCGNSSFLVESYRRASDKKAIVEKVLVDSFHIRPIPPRI--VNKFSLL  229

Query  311   EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             E+VDA  + GW  G +   L+ ++Y V F+ TN+ +E     LR H +W +G W
Sbjct  230   EKVDALYDYGWWSGVITRELDDSRYIVFFKHTNKEMELNDSDLRPHMDWKDGQW  283


 Score =   139 bits (351),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 101/325 (31%), Positives = 160/325 (49%), Gaps = 43/325 (13%)
 Frame = -3

Query  2048  AQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKE  1875
             +   KG  VEV    + F  +WF A VL  S     ++ +++VE++++ ++++  +  KE
Sbjct  10    SHLTKGSTVEVTSDEEGFKGVWFEATVLGAS-SPGSKSKEVWVEYKSIVAEENGSELLKE  68

Query  1874  YVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVES  1695
              +H+S VRP PP E    F + +  D F+++ GW  G V  +LE+S Y V    ++  + 
Sbjct  69    VLHVSFVRPVPPVEKIERFELYDDVDAFHKD-GWWTGVVTRVLEDSRYQVTF--DNPPDE  125

Query  1694  VKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVR  1515
             ++    +LR H+ W  G WV P            K+    LM                  
Sbjct  126   LEFGVSELRFHQKWVKGKWVRP-----------GKQRTGSLM------------------  156

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEE--VDAS  1341
              FS    VEV  D E    +W+ S V+E  GN   LV+     +D     ++E+  VD+ 
Sbjct  157   -FSVGENVEVSFDSEDRRDAWFPSTVLEHCGNSSFLVESYRRASDKKA--IVEKVLVDSF  213

Query  1340  CIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
              IRP PP I  ++ F LL+KVDA    GWW G +++ L D++Y+V F   N+ +    SD
Sbjct  214   HIRPIPPRI--VNKFSLLEKVDALYDYGWWSGVITRELDDSRYIVFFKHTNKEMELNDSD  271

Query  1160  LRPHQEWKNNNWVA-ATKIDLPRSS  1089
             LRPH +WK+  W   A ++ +P  S
Sbjct  272   LRPHMDWKDGQWFTNAREVSIPSDS  296



>gb|KDO86908.1| hypothetical protein CISIN_1g002548mg [Citrus sinensis]
Length=701

 Score =   164 bits (416),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 104/304 (34%), Positives = 152/304 (50%), Gaps = 35/304 (12%)
 Frame = -3

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVME------VLGNGKLLVQYQDLKTDDGTDYLIEE  1353
             +FSK   VEV  D+EGF  +WY + ++E           K L++Y+ L T+DG+  L E 
Sbjct  11    QFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPLTEY  70

Query  1352  VDASCIRPCPPEIHRISP-FKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
             +D + IRP PP+       F+L + V+A   +GWW G V KVL + K+ VCF +  +++ 
Sbjct  71    IDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCFDNPPDVID  130

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
             FEA DLR H +W N  WV   K                         ++ G  FS G  V
Sbjct  131   FEAIDLRVHYQWVNGKWVRPEK------------------------EQSTGSIFSPGTAV  166

Query  995   EAT-SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLI  819
             E     +E     W+ A++        F ++YQ  +  +E+  +K   D+ +IRP PP  
Sbjct  167   EVNLDNKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVKVTLDSQHIRPPPP--  224

Query  818   HRFDR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
                DR +++ E+VD  Y  GW  G+I+KVL G  Y V+F   NE+ E +H  IRPH EW 
Sbjct  225   RYVDRNYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNEDKELSHSEIRPHVEWT  284

Query  641   DKKW  630
                W
Sbjct  285   GGNW  288


 Score =   151 bits (381),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 104/299 (35%), Positives = 150/299 (50%), Gaps = 30/299 (10%)
 Frame = -3

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDS------IGPNKFLLEYQTLRTDDESEPLKEK  858
             +FSKG  VE TS EEG+ G+WY A I +S          K L+EY+ L T+D S PL E 
Sbjct  11    QFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPLTEY  70

Query  857   ADAFNIRPCPPLIHRF-DRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIE  681
              D   IRP PP      D F++ E V+A Y +GWW G + KVLD   + V F    + I+
Sbjct  71    IDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCFDNPPDVID  130

Query  680   FAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVK-D  504
             F    +R H +W++ KW              +P   +  S G    + F  G  VEV  D
Sbjct  131   FEAIDLRVHYQWVNGKW-------------VRP--EKEQSTG----SIFSPGTAVEVNLD  171

Query  503   DEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDR  324
             ++E  +  W+PA++++   +G + V+++  K       +    D+  +RP  P  + VDR
Sbjct  172   NKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVKVTLDSQHIRPPPP--RYVDR  229

Query  323   -FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              +  LE+VD     GWR G + +VL G +Y V F+  NE  E  H  +R H EW  G W
Sbjct  230   NYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNEDKELSHSEIRPHVEWTGGNW  288


 Score =   113 bits (283),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 94/324 (29%), Positives = 150/324 (46%), Gaps = 47/324 (15%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDNF--PIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDD--PM  1890
             ++ QF+KG  VEV   +      W+ A +L  P    +++  +  +E++ L ++D   P+
Sbjct  8     SQIQFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPL  67

Query  1889  KRRKEYVHLSAVRPAPPGEPCC--YFRVGESADVFYENRGWRRGTVDEILENSMYMVALG  1716
                 EY+  + +RP PP +      F + E  +  Y + GW  GTV ++L+N  + V   
Sbjct  68    T---EYIDPAYIRPLPPQQEGGEDVFELNEVVEANYRD-GWWTGTVRKVLDNGKFRVCFD  123

Query  1715  DEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKC  1536
             +   V  +  E   LRVH  W +G WV P +E                            
Sbjct  124   NPPDV--IDFEAIDLRVHYQWVNGKWVRPEKEQ---------------------------  154

Query  1535  TRGSCVRKFSKEMPVEVKGD-KEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLI  1359
             + GS    FS    VEV  D KE     W+ ++V++   +G   V+YQ+ K  +    + 
Sbjct  155   STGSI---FSPGTAVEVNLDNKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVK  211

Query  1358  EEVDASCIRPCPPE-IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
               +D+  IRP PP  + R   ++LL+KVD   G GW  G ++KVL   +Y V F   NE 
Sbjct  212   VTLDSQHIRPPPPRYVDR--NYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNED  269

Query  1181  LTFEASDLRPHQEWKNNNWVAATK  1110
                  S++RPH EW   NW++ +K
Sbjct  270   KELSHSEIRPHVEWTGGNWISKSK  293


 Score = 77.0 bits (188),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 7/145 (5%)
 Frame = -3

Query  563  SGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILR------LIGNGKYLVEFRTLKCDF  402
            S    S+  F  G +VEV  DEEG +G+WY A IL            K L+E++ L  + 
Sbjct  3    SSDTESQIQFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTED  62

Query  401  GTDLLVQEADALSVRPSAPILQ-RVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNF  225
            G+  L +  D   +RP  P  +   D F   E V+A   +GW  G V +VL+  K+RV F
Sbjct  63   GSGPLTEYIDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCF  122

Query  224  RTTNEILEFRHHGLRLHQEWINGAW  150
                ++++F    LR+H +W+NG W
Sbjct  123  DNPPDVIDFEAIDLRVHYQWVNGKW  147



>ref|XP_011079521.1| PREDICTED: uncharacterized protein LOC105163019 isoform X2 [Sesamum 
indicum]
Length=921

 Score =   166 bits (419),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 103/296 (35%), Positives = 155/296 (52%), Gaps = 33/296 (11%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGK------LLVQYQDLKTD-DGTDYLIEEVDASCI  1335
             VEV+ D+E F+  ++++ V+     G       L V+Y DL  D DG+D L E VD S +
Sbjct  45    VEVRTDEEDFKGVFFSATVLPPPKKGSKKKSEKLYVEYIDLLADEDGSDRLREYVDISFV  104

Query  1334  RPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVL-GDAKYMVCFGSMNELLTFEASDL  1158
             RP PP    +  F+  D VDA+  +GWW G VS+V+ G  +++V F    + L F  ++L
Sbjct  105   RPPPPLQEIVKGFEPDDVVDAFYKDGWWTGVVSRVVEGGQRFVVTFQYPPDELEFGLAEL  164

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFE  978
             R H +W N +WV   K ++                         G  F  G  VE +   
Sbjct  165   RVHWDWVNGSWVRPGKQNIA------------------------GSMFDVGRTVEVSFDR  200

Query  977   EGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFK  798
             E    +W+ A I + +G   F++EY +  TD++ E LK   D+ ++RPCPPL+   + F 
Sbjct  201   EDRRDAWFPATIQEDLGKGAFVVEYCSEDTDNKVEALKVTIDSPHLRPCPPLLKEKN-FD  259

Query  797   MFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             + E+VDA++N GWW G+I+K L+   YVV+F     + EF    +RPH EW D KW
Sbjct  260   LLEKVDAFFNFGWWSGVITKELENSRYVVFFKQMKRDKEFYQSELRPHMEWKDGKW  315


 Score =   139 bits (351),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 93/297 (31%), Positives = 145/297 (49%), Gaps = 28/297 (9%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK------FLLEYQTLRTD-DESEPLKEK  858
             F +G LVE  + EE + G +++A +                +EY  L  D D S+ L+E 
Sbjct  39    FPQGSLVEVRTDEEDFKGVFFSATVLPPPKKGSKKKSEKLYVEYIDLLADEDGSDRLREY  98

Query  857   ADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDG-LNYVVYFWTTNEEIE  681
              D   +RP PPL      F+  + VDA+Y +GWW G++S+V++G   +VV F    +E+E
Sbjct  99    VDISFVRPPPPLQEIVKGFEPDDVVDAFYKDGWWTGVVSRVVEGGQRFVVTFQYPPDELE  158

Query  680   FAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDD  501
             F    +R H +W++  W    R    N+                  + F +G  VEV  D
Sbjct  159   FGLAELRVHWDWVNGSW---VRPGKQNIAG----------------SMFDVGRTVEVSFD  199

Query  500   EEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRF  321
              E  + +W+PA I   +G G ++VE+ +   D   + L    D+  +RP  P+L+  + F
Sbjct  200   REDRRDAWFPATIQEDLGKGAFVVEYCSEDTDNKVEALKVTIDSPHLRPCPPLLKEKN-F  258

Query  320   RPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
               LE+VDA+ N GW  G + + LE ++Y V F+      EF    LR H EW +G W
Sbjct  259   DLLEKVDAFFNFGWWSGVITKELENSRYVVFFKQMKRDKEFYQSELRPHMEWKDGKW  315


 Score =   134 bits (337),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 97/315 (31%), Positives = 153/315 (49%), Gaps = 37/315 (12%)
 Frame = -3

Query  2042  FNKGDRVEVLM--RDNFPIWFPAAVLRPSVRKNQRAGQ-IYVEFETLCSDDDPMKRRKEY  1872
             F +G  VEV     D   ++F A VL P  + +++  + +YVE+  L +D+D   R +EY
Sbjct  39    FPQGSLVEVRTDEEDFKGVFFSATVLPPPKKGSKKKSEKLYVEYIDLLADEDGSDRLREY  98

Query  1871  VHLSAVRPAPP-GEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVES  1695
             V +S VRP PP  E    F   +  D FY++ GW  G V  ++E     V        E 
Sbjct  99    VDISFVRPPPPLQEIVKGFEPDDVVDAFYKD-GWWTGVVSRVVEGGQRFVVTFQYPPDE-  156

Query  1694  VKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVR  1515
             ++    +LRVH DW +G WV P +++     +   ++                       
Sbjct  157   LEFGLAELRVHWDWVNGSWVRPGKQNIAGSMFDVGRT-----------------------  193

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCI  1335
                    VEV  D+E    +W+ + + E LG G  +V+Y    TD+  + L   +D+  +
Sbjct  194   -------VEVSFDREDRRDAWFPATIQEDLGKGAFVVEYCSEDTDNKVEALKVTIDSPHL  246

Query  1334  RPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLR  1155
             RPCPP + +   F LL+KVDA+   GWW G ++K L +++Y+V F  M     F  S+LR
Sbjct  247   RPCPP-LLKEKNFDLLEKVDAFFNFGWWSGVITKELENSRYVVFFKQMKRDKEFYQSELR  305

Query  1154  PHQEWKNNNWVAATK  1110
             PH EWK+  W  +++
Sbjct  306   PHMEWKDGKWFTSSQ  320


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 85/188 (45%), Gaps = 25/188 (13%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLM--RDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRR  1881
             A + F+ G  VEV     D    WFPA     +++++   G   VE+   CS+D   K  
Sbjct  184   AGSMFDVGRTVEVSFDREDRRDAWFPA-----TIQEDLGKGAFVVEY---CSEDTDNKVE  235

Query  1880  KEYVHLSA--VRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDED  1707
                V + +  +RP PP      F + E  D F+ N GW  G + + LENS Y+V    + 
Sbjct  236   ALKVTIDSPHLRPCPPLLKEKNFDLLEKVDAFF-NFGWWSGVITKELENSRYVVFF--KQ  292

Query  1706  AVESVKVEQWQLRVHRDWKDGCW------VPPLEESQVDQQYQQ----KKSEDFLMTPSG  1557
                  +  Q +LR H +WKDG W      +  LEE  V    QQ    + +E+  ++ S 
Sbjct  293   MKRDKEFYQSELRPHMEWKDGKWFTSSQPLKKLEEGNVLGSSQQVTHDRSTEEMCVSVSP  352

Query  1556  VKLRIKCT  1533
             V +  K +
Sbjct  353   VSINYKAS  360



>ref|XP_011079520.1| PREDICTED: uncharacterized protein LOC105163019 isoform X1 [Sesamum 
indicum]
Length=1000

 Score =   166 bits (420),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 103/296 (35%), Positives = 155/296 (52%), Gaps = 33/296 (11%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGK------LLVQYQDLKTD-DGTDYLIEEVDASCI  1335
             VEV+ D+E F+  ++++ V+     G       L V+Y DL  D DG+D L E VD S +
Sbjct  45    VEVRTDEEDFKGVFFSATVLPPPKKGSKKKSEKLYVEYIDLLADEDGSDRLREYVDISFV  104

Query  1334  RPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVL-GDAKYMVCFGSMNELLTFEASDL  1158
             RP PP    +  F+  D VDA+  +GWW G VS+V+ G  +++V F    + L F  ++L
Sbjct  105   RPPPPLQEIVKGFEPDDVVDAFYKDGWWTGVVSRVVEGGQRFVVTFQYPPDELEFGLAEL  164

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFE  978
             R H +W N +WV   K ++                         G  F  G  VE +   
Sbjct  165   RVHWDWVNGSWVRPGKQNIA------------------------GSMFDVGRTVEVSFDR  200

Query  977   EGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFK  798
             E    +W+ A I + +G   F++EY +  TD++ E LK   D+ ++RPCPPL+   + F 
Sbjct  201   EDRRDAWFPATIQEDLGKGAFVVEYCSEDTDNKVEALKVTIDSPHLRPCPPLLKEKN-FD  259

Query  797   MFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             + E+VDA++N GWW G+I+K L+   YVV+F     + EF    +RPH EW D KW
Sbjct  260   LLEKVDAFFNFGWWSGVITKELENSRYVVFFKQMKRDKEFYQSELRPHMEWKDGKW  315


 Score =   139 bits (351),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 93/297 (31%), Positives = 145/297 (49%), Gaps = 28/297 (9%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK------FLLEYQTLRTD-DESEPLKEK  858
             F +G LVE  + EE + G +++A +                +EY  L  D D S+ L+E 
Sbjct  39    FPQGSLVEVRTDEEDFKGVFFSATVLPPPKKGSKKKSEKLYVEYIDLLADEDGSDRLREY  98

Query  857   ADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDG-LNYVVYFWTTNEEIE  681
              D   +RP PPL      F+  + VDA+Y +GWW G++S+V++G   +VV F    +E+E
Sbjct  99    VDISFVRPPPPLQEIVKGFEPDDVVDAFYKDGWWTGVVSRVVEGGQRFVVTFQYPPDELE  158

Query  680   FAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDD  501
             F    +R H +W++  W    R    N+                  + F +G  VEV  D
Sbjct  159   FGLAELRVHWDWVNGSW---VRPGKQNIAG----------------SMFDVGRTVEVSFD  199

Query  500   EEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRF  321
              E  + +W+PA I   +G G ++VE+ +   D   + L    D+  +RP  P+L+  + F
Sbjct  200   REDRRDAWFPATIQEDLGKGAFVVEYCSEDTDNKVEALKVTIDSPHLRPCPPLLKEKN-F  258

Query  320   RPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
               LE+VDA+ N GW  G + + LE ++Y V F+      EF    LR H EW +G W
Sbjct  259   DLLEKVDAFFNFGWWSGVITKELENSRYVVFFKQMKRDKEFYQSELRPHMEWKDGKW  315


 Score =   134 bits (338),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 97/316 (31%), Positives = 154/316 (49%), Gaps = 37/316 (12%)
 Frame = -3

Query  2042  FNKGDRVEVLM--RDNFPIWFPAAVLRPSVRKNQRAGQ-IYVEFETLCSDDDPMKRRKEY  1872
             F +G  VEV     D   ++F A VL P  + +++  + +YVE+  L +D+D   R +EY
Sbjct  39    FPQGSLVEVRTDEEDFKGVFFSATVLPPPKKGSKKKSEKLYVEYIDLLADEDGSDRLREY  98

Query  1871  VHLSAVRPAPP-GEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVES  1695
             V +S VRP PP  E    F   +  D FY++ GW  G V  ++E     V        E 
Sbjct  99    VDISFVRPPPPLQEIVKGFEPDDVVDAFYKD-GWWTGVVSRVVEGGQRFVVTFQYPPDE-  156

Query  1694  VKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVR  1515
             ++    +LRVH DW +G WV P +++     +   ++                       
Sbjct  157   LEFGLAELRVHWDWVNGSWVRPGKQNIAGSMFDVGRT-----------------------  193

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCI  1335
                    VEV  D+E    +W+ + + E LG G  +V+Y    TD+  + L   +D+  +
Sbjct  194   -------VEVSFDREDRRDAWFPATIQEDLGKGAFVVEYCSEDTDNKVEALKVTIDSPHL  246

Query  1334  RPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLR  1155
             RPCPP + +   F LL+KVDA+   GWW G ++K L +++Y+V F  M     F  S+LR
Sbjct  247   RPCPP-LLKEKNFDLLEKVDAFFNFGWWSGVITKELENSRYVVFFKQMKRDKEFYQSELR  305

Query  1154  PHQEWKNNNWVAATKI  1107
             PH EWK+  W  ++++
Sbjct  306   PHMEWKDGKWFTSSQM  321



>gb|EMT13245.1| hypothetical protein F775_31527 [Aegilops tauschii]
Length=421

 Score =   159 bits (403),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/294 (32%), Positives = 148/294 (50%), Gaps = 30/294 (10%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIR  1332
             ++K   +EV   +     +W+ ++V + +    LLV+Y   K   G++   E +D   IR
Sbjct  70    YAKGTQIEVARLEADSVVAWFPAIVAKTIWKNNLLVEYPFWK---GSELCNEIIDIKHIR  126

Query  1331  PCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRP  1152
             PCPP    IS F + D V+ +  +GWW G ++++     Y     +  + +    + LR 
Sbjct  127   PCPPRASVIS-FCVNDDVEGFQDDGWWPGKITEIHPKLTYTFKSATSGKKVQLHQNTLRL  185

Query  1151  HQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEG  972
               +W +N W              V  N               G KF+ G  VE +S EEG
Sbjct  186   RYDWTDNQW------------KQVAQNLS-------------GTKFTGGDRVEVSSDEEG  220

Query  971   YHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMF  792
             +HG+W+   +  S+G +KFL+EY  L+ DDE+ PLKE     +IRP PP I   + FK+ 
Sbjct  221   FHGAWFQGTVVKSVG-HKFLVEYDALKDDDETTPLKETIGEEHIRPSPPAIPVTNGFKVL  279

Query  791   EEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             +E+DA+ N+GWW G+IS+VL    Y VYF    E+ EF    +R H +W+  +W
Sbjct  280   DEIDAYTNDGWWVGVISEVLSNQKYKVYFKAYKEQDEFELEQLRRHCDWVGGRW  333


 Score =   149 bits (376),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/289 (31%), Positives = 147/289 (51%), Gaps = 25/289 (9%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             ++KG  +E    E     +W+ A++  +I  N  L+EY   +    SE   E  D  +IR
Sbjct  70    YAKGTQIEVARLEADSVVAWFPAIVAKTIWKNNLLVEYPFWKG---SELCNEIIDIKHIR  126

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             PCPP       F + ++V+ + ++GWW G I+++   L Y     T+ ++++   + +R 
Sbjct  127   PCPPRASVIS-FCVNDDVEGFQDDGWWPGKITEIHPKLTYTFKSATSGKKVQLHQNTLRL  185

Query  656   HQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSW  477
               +W D +W    ++   NL                S T F  G +VEV  DEEG  G+W
Sbjct  186   RYDWTDNQW----KQVAQNL----------------SGTKFTGGDRVEVSSDEEGFHGAW  225

Query  476   YPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDA  297
             +   +++ +G+ K+LVE+  LK D  T  L +      +RPS P +   + F+ L+E+DA
Sbjct  226   FQGTVVKSVGH-KFLVEYDALKDDDETTPLKETIGEEHIRPSPPAIPVTNGFKVLDEIDA  284

Query  296   WSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             ++N+GW VG + EVL   KY+V F+   E  EF    LR H +W+ G W
Sbjct  285   YTNDGWWVGVISEVLSNQKYKVYFKAYKEQDEFELEQLRRHCDWVGGRW  333


 Score =   129 bits (325),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 97/317 (31%), Positives = 142/317 (45%), Gaps = 46/317 (15%)
 Frame = -3

Query  2057  SAEAQFNKGDRVEV--LMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKR  1884
             S    + KG ++EV  L  D+   WFPA V +   + N      + +   LC+       
Sbjct  65    SKRTLYAKGTQIEVARLEADSVVAWFPAIVAKTIWKNNLLVEYPFWKGSELCN-------  117

Query  1883  RKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDA  1704
               E + +  +RP PP      F V +  + F ++ GW  G + EI     Y        +
Sbjct  118   --EIIDIKHIRPCPPRASVISFCVNDDVEGF-QDDGWWPGKITEIHPKLTY--TFKSATS  172

Query  1703  VESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGS  1524
              + V++ Q  LR+  DW D  W       QV Q              SG           
Sbjct  173   GKKVQLHQNTLRLRYDWTDNQW------KQVAQNL------------SGT----------  204

Query  1523  CVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDA  1344
                KF+    VEV  D+EGF  +W+   V++ +G+ K LV+Y  LK DD T  L E +  
Sbjct  205   ---KFTGGDRVEVSSDEEGFHGAWFQGTVVKSVGH-KFLVEYDALKDDDETTPLKETIGE  260

Query  1343  SCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEAS  1164
               IRP PP I   + FK+LD++DA+  +GWW G +S+VL + KY V F +  E   FE  
Sbjct  261   EHIRPSPPAIPVTNGFKVLDEIDAYTNDGWWVGVISEVLSNQKYKVYFKAYKEQDEFELE  320

Query  1163  DLRPHQEWKNNNWVAAT  1113
              LR H +W    W+ A+
Sbjct  321   QLRRHCDWVGGRWIQAS  337


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/134 (25%), Positives = 64/134 (48%), Gaps = 4/134 (3%)
 Frame = -3

Query  551  ASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEAD  372
            +  T +  G ++EV   E  +  +W+PA++ + I     LVE+   K   G++L  +  D
Sbjct  65   SKRTLYAKGTQIEVARLEADSVVAWFPAIVAKTIWKNNLLVEYPFWK---GSELCNEIID  121

Query  371  ALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRH  192
               +RP  P    V  F   ++V+ + ++GW  G++ E+     Y     T+ + ++   
Sbjct  122  IKHIRPCPP-RASVISFCVNDDVEGFQDDGWWPGKITEIHPKLTYTFKSATSGKKVQLHQ  180

Query  191  HGLRLHQEWINGAW  150
            + LRL  +W +  W
Sbjct  181  NTLRLRYDWTDNQW  194



>ref|XP_008381758.1| PREDICTED: uncharacterized protein LOC103444582 [Malus domestica]
Length=306

 Score =   156 bits (395),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 137/254 (54%), Gaps = 17/254 (7%)
 Frame = -3

Query  1376  GTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHV-SKVLGDAK-YMVC  1203
             G   L EEVDA  +RP PP       FKL D VDA+   GWWEG V + VL D   + V 
Sbjct  62    GDAALREEVDAVLLRPPPPRESDYR-FKLGDVVDAFFCGGWWEGVVVTDVLVDNNTFGVY  120

Query  1202  FGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALG  1023
             F    E   FE  +LR H+EW   +W+       P    DV          +K       
Sbjct  121   FRFAKEKFEFEPEELRLHREWVKGSWIP------PLQQGDV--------SDAKEPEIPTK  166

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFN  843
              +  +G  VE  + E+G+ G+W+ A I   +  +KFL+ Y+ ++TDD  E L E+ DA +
Sbjct  167   EELIEGTAVEVCTDEDGFQGAWFAANIVKVMEKDKFLVRYKAIKTDDNRELLTEEVDAKH  226

Query  842   IRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGI  663
             +RP PP +     F + EEVDA+YN+GWWEG+I KVL G  Y VYF  T++E+   H  +
Sbjct  227   VRPRPPKVVVAGSFSLTEEVDAFYNDGWWEGVIRKVLHGRRYKVYFKGTDDELLLQHSDL  286

Query  662   RPHQEWIDKKWDIA  621
             RP Q+WID+ W +A
Sbjct  287   RPRQDWIDRTWVMA  300


 Score =   152 bits (383),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 105/327 (32%), Positives = 169/327 (52%), Gaps = 38/327 (12%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVL--MRDNFPIWFPAAVLRPS-------VRKNQRAGQIYVEFETLCSD  1902
             A+A F  GD VEV   + +     FPA ++  S       V  N+   +I  +       
Sbjct  2     ADAHFEVGDEVEVTSPIHNMRGTTFPAKIVAKSRTKSKFKVEYNRAKARIDRKIGAGHKG  61

Query  1901  DDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTV--DEILENSMYM  1728
              D   R  E V    +RP PP E    F++G+  D F+   GW  G V  D +++N+ + 
Sbjct  62    GDAALR--EEVDAVLLRPPPPRESDYRFKLGDVVDAFFCG-GWWEGVVVTDVLVDNNTFG  118

Query  1727  VALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQV-DQQYQQKKSEDFLMTPSGVK  1551
             V      A E  + E  +LR+HR+W  G W+PPL++  V D +  +  +++ L+  + V+
Sbjct  119   VYF--RFAKEKFEFEPEELRLHREWVKGSWIPPLQQGDVSDAKEPEIPTKEELIEGTAVE  176

Query  1550  LRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGT  1371
             +   CT                  D++GF+ +W+A+ +++V+   K LV+Y+ +KTDD  
Sbjct  177   V---CT------------------DEDGFQGAWFAANIVKVMEKDKFLVRYKAIKTDDNR  215

Query  1370  DYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSM  1191
             + L EEVDA  +RP PP++     F L ++VDA+  +GWWEG + KVL   +Y V F   
Sbjct  216   ELLTEEVDAKHVRPRPPKVVVAGSFSLTEEVDAFYNDGWWEGVIRKVLHGRRYKVYFKGT  275

Query  1190  NELLTFEASDLRPHQEWKNNNWVAATK  1110
             ++ L  + SDLRP Q+W +  WV A++
Sbjct  276   DDELLLQHSDLRPRQDWIDRTWVMASQ  302


 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 97/303 (32%), Positives = 157/303 (52%), Gaps = 25/303 (8%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTA-VIFDSIGPNKFLLEYQTLRTDDESE----------P  870
             F  G  VE TS      G+ + A ++  S   +KF +EY   +   + +           
Sbjct  6     FEVGDEVEVTSPIHNMRGTTFPAKIVAKSRTKSKFKVEYNRAKARIDRKIGAGHKGGDAA  65

Query  869   LKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISK--VLDGLNYVVYFWTT  696
             L+E+ DA  +RP PP    + RFK+ + VDA++  GWWEG++    ++D   + VYF   
Sbjct  66    LREEVDAVLLRPPPPRESDY-RFKLGDVVDAFFCGGWWEGVVVTDVLVDNNTFGVYFRFA  124

Query  695   NEEIEFAHHGIRPHQEWIDKKWDIAFRKSN-NNLPNPKPGIMRRHSGGIASETTFCIGAK  519
              E+ EF    +R H+EW+   W    ++ + ++   P+          I ++     G  
Sbjct  125   KEKFEFEPEELRLHREWVKGSWIPPLQQGDVSDAKEPE----------IPTKEELIEGTA  174

Query  518   VEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPIL  339
             VEV  DE+G QG+W+ A I++++   K+LV ++ +K D   +LL +E DA  VRP  P +
Sbjct  175   VEVCTDEDGFQGAWFAANIVKVMEKDKFLVRYKAIKTDDNRELLTEEVDAKHVRPRPPKV  234

Query  338   QRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWIN  159
                  F   EEVDA+ N+GW  G + +VL G +Y+V F+ T++ L  +H  LR  Q+WI+
Sbjct  235   VVAGSFSLTEEVDAFYNDGWWEGVIRKVLHGRRYKVYFKGTDDELLLQHSDLRPRQDWID  294

Query  158   GAW  150
               W
Sbjct  295   RTW  297



>ref|XP_008246167.1| PREDICTED: uncharacterized protein LOC103344338 [Prunus mume]
Length=179

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             F+KG  VE +S EEG++G+W+ A I +++G +KFL+EYQ+LRT+D+S  L+E+ D  +IR
Sbjct  43    FTKGTPVEVSSDEEGFNGAWFAATIVEAVGEDKFLIEYQSLRTEDDSAFLREEIDTLHIR  102

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             PCPP     D F + +EVD +YN+GWW G+ISKVL G  YVVYF  T EEIEF H  +R 
Sbjct  103   PCPPET-VVDHFSLLQEVDGYYNDGWWVGVISKVLRGSRYVVYFRGTYEEIEFQHSELRL  161

Query  656   HQEWIDKKWDIAFR  615
             HQ+WI  KW +A R
Sbjct  162   HQDWIGGKWVMASR  175


 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 88/134 (66%), Gaps = 1/134 (1%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIR  1332
             F+K  PVEV  D+EGF  +W+A+ ++E +G  K L++YQ L+T+D + +L EE+D   IR
Sbjct  43    FTKGTPVEVSSDEEGFNGAWFAATIVEAVGEDKFLIEYQSLRTEDDSAFLREEIDTLHIR  102

Query  1331  PCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRP  1152
             PCPPE   +  F LL +VD +  +GWW G +SKVL  ++Y+V F    E + F+ S+LR 
Sbjct  103   PCPPET-VVDHFSLLQEVDGYYNDGWWVGVISKVLRGSRYVVYFRGTYEEIEFQHSELRL  161

Query  1151  HQEWKNNNWVAATK  1110
             HQ+W    WV A++
Sbjct  162   HQDWIGGKWVMASR  175


 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 85/135 (63%), Gaps = 1/135 (1%)
 Frame = -3

Query  554  IASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEA  375
            +++   F  G  VEV  DEEG  G+W+ A I+  +G  K+L+E+++L+ +  +  L +E 
Sbjct  37   VSTHEIFTKGTPVEVSSDEEGFNGAWFAATIVEAVGEDKFLIEYQSLRTEDDSAFLREEI  96

Query  374  DALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFR  195
            D L +RP  P    VD F  L+EVD + N+GW VG + +VL G++Y V FR T E +EF+
Sbjct  97   DTLHIRPCPP-ETVVDHFSLLQEVDGYYNDGWWVGVISKVLRGSRYVVYFRGTYEEIEFQ  155

Query  194  HHGLRLHQEWINGAW  150
            H  LRLHQ+WI G W
Sbjct  156  HSELRLHQDWIGGKW  170


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 73/144 (51%), Gaps = 11/144 (8%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             +S    F KG  VEV    + F   WF A ++  +V +++      +E+++L ++DD   
Sbjct  37    VSTHEIFTKGTPVEVSSDEEGFNGAWFAATIVE-AVGEDK----FLIEYQSLRTEDDSAF  91

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDED  1707
              R+E   L  +RP PP     +F + +  D +Y N GW  G + ++L  S Y+V      
Sbjct  92    LREEIDTLH-IRPCPPETVVDHFSLLQEVDGYY-NDGWWVGVISKVLRGSRYVVYF--RG  147

Query  1706  AVESVKVEQWQLRVHRDWKDGCWV  1635
               E ++ +  +LR+H+DW  G WV
Sbjct  148   TYEEIEFQHSELRLHQDWIGGKWV  171



>gb|KDO86904.1| hypothetical protein CISIN_1g002548mg [Citrus sinensis]
Length=909

 Score =   165 bits (417),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 104/304 (34%), Positives = 152/304 (50%), Gaps = 35/304 (12%)
 Frame = -3

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVME------VLGNGKLLVQYQDLKTDDGTDYLIEE  1353
             +FSK   VEV  D+EGF  +WY + ++E           K L++Y+ L T+DG+  L E 
Sbjct  11    QFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPLTEY  70

Query  1352  VDASCIRPCPPEIHRISP-FKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
             +D + IRP PP+       F+L + V+A   +GWW G V KVL + K+ VCF +  +++ 
Sbjct  71    IDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCFDNPPDVID  130

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
             FEA DLR H +W N  WV   K                         ++ G  FS G  V
Sbjct  131   FEAIDLRVHYQWVNGKWVRPEK------------------------EQSTGSIFSPGTAV  166

Query  995   EAT-SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLI  819
             E     +E     W+ A++        F ++YQ  +  +E+  +K   D+ +IRP PP  
Sbjct  167   EVNLDNKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVKVTLDSQHIRPPPP--  224

Query  818   HRFDR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
                DR +++ E+VD  Y  GW  G+I+KVL G  Y V+F   NE+ E +H  IRPH EW 
Sbjct  225   RYVDRNYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNEDKELSHSEIRPHVEWT  284

Query  641   DKKW  630
                W
Sbjct  285   GGNW  288


 Score =   150 bits (380),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 104/299 (35%), Positives = 150/299 (50%), Gaps = 30/299 (10%)
 Frame = -3

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDS------IGPNKFLLEYQTLRTDDESEPLKEK  858
             +FSKG  VE TS EEG+ G+WY A I +S          K L+EY+ L T+D S PL E 
Sbjct  11    QFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPLTEY  70

Query  857   ADAFNIRPCPPLIHRF-DRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIE  681
              D   IRP PP      D F++ E V+A Y +GWW G + KVLD   + V F    + I+
Sbjct  71    IDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCFDNPPDVID  130

Query  680   FAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVK-D  504
             F    +R H +W++ KW              +P   +  S G    + F  G  VEV  D
Sbjct  131   FEAIDLRVHYQWVNGKW-------------VRP--EKEQSTG----SIFSPGTAVEVNLD  171

Query  503   DEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDR  324
             ++E  +  W+PA++++   +G + V+++  K       +    D+  +RP  P  + VDR
Sbjct  172   NKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVKVTLDSQHIRPPPP--RYVDR  229

Query  323   -FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              +  LE+VD     GWR G + +VL G +Y V F+  NE  E  H  +R H EW  G W
Sbjct  230   NYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNEDKELSHSEIRPHVEWTGGNW  288


 Score =   113 bits (283),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 94/324 (29%), Positives = 150/324 (46%), Gaps = 47/324 (15%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDNF--PIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDD--PM  1890
             ++ QF+KG  VEV   +      W+ A +L  P    +++  +  +E++ L ++D   P+
Sbjct  8     SQIQFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPL  67

Query  1889  KRRKEYVHLSAVRPAPPGEPCC--YFRVGESADVFYENRGWRRGTVDEILENSMYMVALG  1716
                 EY+  + +RP PP +      F + E  +  Y + GW  GTV ++L+N  + V   
Sbjct  68    T---EYIDPAYIRPLPPQQEGGEDVFELNEVVEANYRD-GWWTGTVRKVLDNGKFRVCFD  123

Query  1715  DEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKC  1536
             +   V  +  E   LRVH  W +G WV P +E                            
Sbjct  124   NPPDV--IDFEAIDLRVHYQWVNGKWVRPEKEQ---------------------------  154

Query  1535  TRGSCVRKFSKEMPVEVKGD-KEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLI  1359
             + GS    FS    VEV  D KE     W+ ++V++   +G   V+YQ+ K  +    + 
Sbjct  155   STGSI---FSPGTAVEVNLDNKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVK  211

Query  1358  EEVDASCIRPCPPE-IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
               +D+  IRP PP  + R   ++LL+KVD   G GW  G ++KVL   +Y V F   NE 
Sbjct  212   VTLDSQHIRPPPPRYVDR--NYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNED  269

Query  1181  LTFEASDLRPHQEWKNNNWVAATK  1110
                  S++RPH EW   NW++ +K
Sbjct  270   KELSHSEIRPHVEWTGGNWISKSK  293


 Score = 77.0 bits (188),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 7/145 (5%)
 Frame = -3

Query  563  SGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILR------LIGNGKYLVEFRTLKCDF  402
            S    S+  F  G +VEV  DEEG +G+WY A IL            K L+E++ L  + 
Sbjct  3    SSDTESQIQFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTED  62

Query  401  GTDLLVQEADALSVRPSAPILQ-RVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNF  225
            G+  L +  D   +RP  P  +   D F   E V+A   +GW  G V +VL+  K+RV F
Sbjct  63   GSGPLTEYIDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCF  122

Query  224  RTTNEILEFRHHGLRLHQEWINGAW  150
                ++++F    LR+H +W+NG W
Sbjct  123  DNPPDVIDFEAIDLRVHYQWVNGKW  147



>gb|KDO86906.1| hypothetical protein CISIN_1g002548mg [Citrus sinensis]
Length=907

 Score =   165 bits (417),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 104/304 (34%), Positives = 152/304 (50%), Gaps = 35/304 (12%)
 Frame = -3

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVME------VLGNGKLLVQYQDLKTDDGTDYLIEE  1353
             +FSK   VEV  D+EGF  +WY + ++E           K L++Y+ L T+DG+  L E 
Sbjct  11    QFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPLTEY  70

Query  1352  VDASCIRPCPPEIHRISP-FKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
             +D + IRP PP+       F+L + V+A   +GWW G V KVL + K+ VCF +  +++ 
Sbjct  71    IDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCFDNPPDVID  130

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
             FEA DLR H +W N  WV   K                         ++ G  FS G  V
Sbjct  131   FEAIDLRVHYQWVNGKWVRPEK------------------------EQSTGSIFSPGTAV  166

Query  995   EAT-SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLI  819
             E     +E     W+ A++        F ++YQ  +  +E+  +K   D+ +IRP PP  
Sbjct  167   EVNLDNKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVKVTLDSQHIRPPPP--  224

Query  818   HRFDR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
                DR +++ E+VD  Y  GW  G+I+KVL G  Y V+F   NE+ E +H  IRPH EW 
Sbjct  225   RYVDRNYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNEDKELSHSEIRPHVEWT  284

Query  641   DKKW  630
                W
Sbjct  285   GGNW  288


 Score =   150 bits (380),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 104/299 (35%), Positives = 150/299 (50%), Gaps = 30/299 (10%)
 Frame = -3

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDS------IGPNKFLLEYQTLRTDDESEPLKEK  858
             +FSKG  VE TS EEG+ G+WY A I +S          K L+EY+ L T+D S PL E 
Sbjct  11    QFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPLTEY  70

Query  857   ADAFNIRPCPPLIHRF-DRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIE  681
              D   IRP PP      D F++ E V+A Y +GWW G + KVLD   + V F    + I+
Sbjct  71    IDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCFDNPPDVID  130

Query  680   FAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVK-D  504
             F    +R H +W++ KW              +P   +  S G    + F  G  VEV  D
Sbjct  131   FEAIDLRVHYQWVNGKW-------------VRP--EKEQSTG----SIFSPGTAVEVNLD  171

Query  503   DEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDR  324
             ++E  +  W+PA++++   +G + V+++  K       +    D+  +RP  P  + VDR
Sbjct  172   NKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVKVTLDSQHIRPPPP--RYVDR  229

Query  323   -FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              +  LE+VD     GWR G + +VL G +Y V F+  NE  E  H  +R H EW  G W
Sbjct  230   NYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNEDKELSHSEIRPHVEWTGGNW  288


 Score =   113 bits (283),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 94/324 (29%), Positives = 150/324 (46%), Gaps = 47/324 (15%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDN--FPIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDD--PM  1890
             ++ QF+KG  VEV   +      W+ A +L  P    +++  +  +E++ L ++D   P+
Sbjct  8     SQIQFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPL  67

Query  1889  KRRKEYVHLSAVRPAPPGEPCC--YFRVGESADVFYENRGWRRGTVDEILENSMYMVALG  1716
                 EY+  + +RP PP +      F + E  +  Y + GW  GTV ++L+N  + V   
Sbjct  68    T---EYIDPAYIRPLPPQQEGGEDVFELNEVVEANYRD-GWWTGTVRKVLDNGKFRVCFD  123

Query  1715  DEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKC  1536
             +   V  +  E   LRVH  W +G WV P +E                            
Sbjct  124   NPPDV--IDFEAIDLRVHYQWVNGKWVRPEKEQ---------------------------  154

Query  1535  TRGSCVRKFSKEMPVEVKGD-KEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLI  1359
             + GS    FS    VEV  D KE     W+ ++V++   +G   V+YQ+ K  +    + 
Sbjct  155   STGSI---FSPGTAVEVNLDNKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVK  211

Query  1358  EEVDASCIRPCPPE-IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
               +D+  IRP PP  + R   ++LL+KVD   G GW  G ++KVL   +Y V F   NE 
Sbjct  212   VTLDSQHIRPPPPRYVDR--NYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNED  269

Query  1181  LTFEASDLRPHQEWKNNNWVAATK  1110
                  S++RPH EW   NW++ +K
Sbjct  270   KELSHSEIRPHVEWTGGNWISKSK  293


 Score = 77.0 bits (188),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 7/145 (5%)
 Frame = -3

Query  563  SGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILR------LIGNGKYLVEFRTLKCDF  402
            S    S+  F  G +VEV  DEEG +G+WY A IL            K L+E++ L  + 
Sbjct  3    SSDTESQIQFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTED  62

Query  401  GTDLLVQEADALSVRPSAPILQ-RVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNF  225
            G+  L +  D   +RP  P  +   D F   E V+A   +GW  G V +VL+  K+RV F
Sbjct  63   GSGPLTEYIDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCF  122

Query  224  RTTNEILEFRHHGLRLHQEWINGAW  150
                ++++F    LR+H +W+NG W
Sbjct  123  DNPPDVIDFEAIDLRVHYQWVNGKW  147



>ref|XP_006444549.1| hypothetical protein CICLE_v10018775mg [Citrus clementina]
 ref|XP_006492370.1| PREDICTED: uncharacterized protein LOC102615295 [Citrus sinensis]
 gb|ESR57789.1| hypothetical protein CICLE_v10018775mg [Citrus clementina]
 gb|KDO86905.1| hypothetical protein CISIN_1g002548mg [Citrus sinensis]
Length=908

 Score =   165 bits (417),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 104/304 (34%), Positives = 152/304 (50%), Gaps = 35/304 (12%)
 Frame = -3

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVME------VLGNGKLLVQYQDLKTDDGTDYLIEE  1353
             +FSK   VEV  D+EGF  +WY + ++E           K L++Y+ L T+DG+  L E 
Sbjct  11    QFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPLTEY  70

Query  1352  VDASCIRPCPPEIHRISP-FKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLT  1176
             +D + IRP PP+       F+L + V+A   +GWW G V KVL + K+ VCF +  +++ 
Sbjct  71    IDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCFDNPPDVID  130

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLV  996
             FEA DLR H +W N  WV   K                         ++ G  FS G  V
Sbjct  131   FEAIDLRVHYQWVNGKWVRPEK------------------------EQSTGSIFSPGTAV  166

Query  995   EAT-SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLI  819
             E     +E     W+ A++        F ++YQ  +  +E+  +K   D+ +IRP PP  
Sbjct  167   EVNLDNKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVKVTLDSQHIRPPPP--  224

Query  818   HRFDR-FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWI  642
                DR +++ E+VD  Y  GW  G+I+KVL G  Y V+F   NE+ E +H  IRPH EW 
Sbjct  225   RYVDRNYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNEDKELSHSEIRPHVEWT  284

Query  641   DKKW  630
                W
Sbjct  285   GGNW  288


 Score =   150 bits (380),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 104/299 (35%), Positives = 150/299 (50%), Gaps = 30/299 (10%)
 Frame = -3

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDS------IGPNKFLLEYQTLRTDDESEPLKEK  858
             +FSKG  VE TS EEG+ G+WY A I +S          K L+EY+ L T+D S PL E 
Sbjct  11    QFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPLTEY  70

Query  857   ADAFNIRPCPPLIHRF-DRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIE  681
              D   IRP PP      D F++ E V+A Y +GWW G + KVLD   + V F    + I+
Sbjct  71    IDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCFDNPPDVID  130

Query  680   FAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVK-D  504
             F    +R H +W++ KW              +P   +  S G    + F  G  VEV  D
Sbjct  131   FEAIDLRVHYQWVNGKW-------------VRP--EKEQSTG----SIFSPGTAVEVNLD  171

Query  503   DEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDR  324
             ++E  +  W+PA++++   +G + V+++  K       +    D+  +RP  P  + VDR
Sbjct  172   NKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVKVTLDSQHIRPPPP--RYVDR  229

Query  323   -FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              +  LE+VD     GWR G + +VL G +Y V F+  NE  E  H  +R H EW  G W
Sbjct  230   NYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNEDKELSHSEIRPHVEWTGGNW  288


 Score =   113 bits (283),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 94/324 (29%), Positives = 150/324 (46%), Gaps = 47/324 (15%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDNF--PIWFPAAVLR-PSVRKNQRAGQIYVEFETLCSDDD--PM  1890
             ++ QF+KG  VEV   +      W+ A +L  P    +++  +  +E++ L ++D   P+
Sbjct  8     SQIQFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTEDGSGPL  67

Query  1889  KRRKEYVHLSAVRPAPPGEPCC--YFRVGESADVFYENRGWRRGTVDEILENSMYMVALG  1716
                 EY+  + +RP PP +      F + E  +  Y + GW  GTV ++L+N  + V   
Sbjct  68    T---EYIDPAYIRPLPPQQEGGEDVFELNEVVEANYRD-GWWTGTVRKVLDNGKFRVCFD  123

Query  1715  DEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKC  1536
             +   V  +  E   LRVH  W +G WV P +E                            
Sbjct  124   NPPDV--IDFEAIDLRVHYQWVNGKWVRPEKEQ---------------------------  154

Query  1535  TRGSCVRKFSKEMPVEVKGD-KEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLI  1359
             + GS    FS    VEV  D KE     W+ ++V++   +G   V+YQ+ K  +    + 
Sbjct  155   STGSI---FSPGTAVEVNLDNKESLRDVWFPAIVIKENVDGTFFVKYQNSKNSEEAATVK  211

Query  1358  EEVDASCIRPCPPE-IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
               +D+  IRP PP  + R   ++LL+KVD   G GW  G ++KVL   +Y V F   NE 
Sbjct  212   VTLDSQHIRPPPPRYVDR--NYELLEKVDTSYGFGWRAGVITKVLAGRRYNVFFKHGNED  269

Query  1181  LTFEASDLRPHQEWKNNNWVAATK  1110
                  S++RPH EW   NW++ +K
Sbjct  270   KELSHSEIRPHVEWTGGNWISKSK  293


 Score = 76.6 bits (187),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 7/145 (5%)
 Frame = -3

Query  563  SGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILR------LIGNGKYLVEFRTLKCDF  402
            S    S+  F  G +VEV  DEEG +G+WY A IL            K L+E++ L  + 
Sbjct  3    SSDTESQIQFSKGTEVEVTSDEEGFRGAWYLATILESPPKSASKKRKKALIEYKYLVTED  62

Query  401  GTDLLVQEADALSVRPSAPILQ-RVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNF  225
            G+  L +  D   +RP  P  +   D F   E V+A   +GW  G V +VL+  K+RV F
Sbjct  63   GSGPLTEYIDPAYIRPLPPQQEGGEDVFELNEVVEANYRDGWWTGTVRKVLDNGKFRVCF  122

Query  224  RTTNEILEFRHHGLRLHQEWINGAW  150
                ++++F    LR+H +W+NG W
Sbjct  123  DNPPDVIDFEAIDLRVHYQWVNGKW  147



>ref|XP_006349168.1| PREDICTED: uncharacterized protein LOC102593578 isoform X2 [Solanum 
tuberosum]
Length=891

 Score =   164 bits (414),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 102/306 (33%), Positives = 161/306 (53%), Gaps = 33/306 (11%)
 Frame = -3

Query  1535  TRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK-LLVQYQDLKTDD-GTDYL  1362
             TR       +K   VEV  D+EGF+  W+   ++    N K +LV+Y+ +  D+ G+  L
Sbjct  7     TRQQQQEYLTKGSTVEVTSDEEGFKGVWFDGTILNYGSNKKKVLVEYRSILADEIGSKPL  66

Query  1361  IEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
              E V+ S +RP PP +  +  F+L D VDA   +GWW G ++KVL D +Y V F +  ++
Sbjct  67    RELVNVSFVRPVPP-LEIVESFELHDVVDASYKDGWWTGVITKVLDDFRYQVTFSNPPDV  125

Query  1181  LTFEASDLRPHQEWKNNNWVAATKIDLP-RSSSDVMLNskvvkvkskSDRKALGPKFSKG  1005
             L F  S+LR H++W   NWV      LP +  +D ++                   FS G
Sbjct  126   LEFGVSELRLHKQWVKGNWV------LPGKQRTDSLM-------------------FSVG  160

Query  1004  MLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLE-YQTLRTDDESEPLKEKADAFNIRPCP  828
               VE +   +    +W+ + + + +    FL+E Y+T+  D ++   K   D+F+IRP P
Sbjct  161   KNVEVSFDRDDRRDAWFPSKVLEHLENGSFLVERYRTI--DKKASIDKVTVDSFHIRPLP  218

Query  827   PLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQE  648
             P I R  +F + E+VDA+Y+  WW G+I++ L    Y+V+F  TN E E     +RPH +
Sbjct  219   PHIKR-KKFNLLEKVDAFYDLAWWSGVITRELADSRYIVFFKHTNMEKELNDSDLRPHMD  277

Query  647   WIDKKW  630
             W D +W
Sbjct  278   WKDGQW  283


 Score =   155 bits (392),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 151/293 (52%), Gaps = 28/293 (10%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK--FLLEYQTLRTDD-ESEPLKEKADAF  846
              +KG  VE TS EEG+ G W+   I +  G NK   L+EY+++  D+  S+PL+E  +  
Sbjct  15    LTKGSTVEVTSDEEGFKGVWFDGTILN-YGSNKKKVLVEYRSILADEIGSKPLRELVNVS  73

Query  845   NIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHG  666
              +RP PPL    + F++ + VDA Y +GWW G+I+KVLD   Y V F    + +EF    
Sbjct  74    FVRPVPPL-EIVESFELHDVVDASYKDGWWTGVITKVLDDFRYQVTFSNPPDVLEFGVSE  132

Query  665   IRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQ  486
             +R H++W+   W +             PG  R  S        F +G  VEV  D +  +
Sbjct  133   LRLHKQWVKGNWVL-------------PGKQRTDS------LMFSVGKNVEVSFDRDDRR  173

Query  485   GSWYPALILRLIGNGKYLVE-FRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLE  309
              +W+P+ +L  + NG +LVE +RT+      D +    D+  +RP  P ++R  +F  LE
Sbjct  174   DAWFPSKVLEHLENGSFLVERYRTIDKKASIDKVT--VDSFHIRPLPPHIKR-KKFNLLE  230

Query  308   EVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +VDA+ +  W  G +   L  ++Y V F+ TN   E     LR H +W +G W
Sbjct  231   KVDAFYDLAWWSGVITRELADSRYIVFFKHTNMEKELNDSDLRPHMDWKDGQW  283


 Score =   132 bits (331),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 99/318 (31%), Positives = 149/318 (47%), Gaps = 44/318 (14%)
 Frame = -3

Query  2042  FNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYV  1869
               KG  VEV    + F  +WF   +L     K +    + VE+ ++ +D+   K  +E V
Sbjct  15    LTKGSTVEVTSDEEGFKGVWFDGTILNYGSNKKK----VLVEYRSILADEIGSKPLRELV  70

Query  1868  HLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVK  1689
             ++S VRP PP E    F + +  D  Y++ GW  G + ++L++  Y V   +   V    
Sbjct  71    NVSFVRPVPPLEIVESFELHDVVDASYKD-GWWTGVITKVLDDFRYQVTFSNPPDVLEFG  129

Query  1688  VEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKF  1509
             V +  LR+H+ W  G WV P            K+  D LM                   F
Sbjct  130   VSE--LRLHKQWVKGNWVLP-----------GKQRTDSLM-------------------F  157

Query  1508  SKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQ-YQDLKTDDGTDYLIEEVDASCIR  1332
             S    VEV  D++    +W+ S V+E L NG  LV+ Y+ +      D +   VD+  IR
Sbjct  158   SVGKNVEVSFDRDDRRDAWFPSKVLEHLENGSFLVERYRTIDKKASIDKVT--VDSFHIR  215

Query  1331  PCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRP  1152
             P PP I R   F LL+KVDA+    WW G +++ L D++Y+V F   N       SDLRP
Sbjct  216   PLPPHIKR-KKFNLLEKVDAFYDLAWWSGVITRELADSRYIVFFKHTNMEKELNDSDLRP  274

Query  1151  HQEWKNNNWVAATKIDLP  1098
             H +WK+  W   ++ D+P
Sbjct  275   HMDWKDGQWFTTSR-DIP  291



>ref|XP_006349167.1| PREDICTED: uncharacterized protein LOC102593578 isoform X1 [Solanum 
tuberosum]
Length=920

 Score =   164 bits (414),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 102/306 (33%), Positives = 161/306 (53%), Gaps = 33/306 (11%)
 Frame = -3

Query  1535  TRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK-LLVQYQDLKTDD-GTDYL  1362
             TR       +K   VEV  D+EGF+  W+   ++    N K +LV+Y+ +  D+ G+  L
Sbjct  7     TRQQQQEYLTKGSTVEVTSDEEGFKGVWFDGTILNYGSNKKKVLVEYRSILADEIGSKPL  66

Query  1361  IEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
              E V+ S +RP PP +  +  F+L D VDA   +GWW G ++KVL D +Y V F +  ++
Sbjct  67    RELVNVSFVRPVPP-LEIVESFELHDVVDASYKDGWWTGVITKVLDDFRYQVTFSNPPDV  125

Query  1181  LTFEASDLRPHQEWKNNNWVAATKIDLP-RSSSDVMLNskvvkvkskSDRKALGPKFSKG  1005
             L F  S+LR H++W   NWV      LP +  +D ++                   FS G
Sbjct  126   LEFGVSELRLHKQWVKGNWV------LPGKQRTDSLM-------------------FSVG  160

Query  1004  MLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLE-YQTLRTDDESEPLKEKADAFNIRPCP  828
               VE +   +    +W+ + + + +    FL+E Y+T+  D ++   K   D+F+IRP P
Sbjct  161   KNVEVSFDRDDRRDAWFPSKVLEHLENGSFLVERYRTI--DKKASIDKVTVDSFHIRPLP  218

Query  827   PLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQE  648
             P I R  +F + E+VDA+Y+  WW G+I++ L    Y+V+F  TN E E     +RPH +
Sbjct  219   PHIKR-KKFNLLEKVDAFYDLAWWSGVITRELADSRYIVFFKHTNMEKELNDSDLRPHMD  277

Query  647   WIDKKW  630
             W D +W
Sbjct  278   WKDGQW  283


 Score =   155 bits (392),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 151/293 (52%), Gaps = 28/293 (10%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK--FLLEYQTLRTDD-ESEPLKEKADAF  846
              +KG  VE TS EEG+ G W+   I +  G NK   L+EY+++  D+  S+PL+E  +  
Sbjct  15    LTKGSTVEVTSDEEGFKGVWFDGTILN-YGSNKKKVLVEYRSILADEIGSKPLRELVNVS  73

Query  845   NIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHG  666
              +RP PPL    + F++ + VDA Y +GWW G+I+KVLD   Y V F    + +EF    
Sbjct  74    FVRPVPPL-EIVESFELHDVVDASYKDGWWTGVITKVLDDFRYQVTFSNPPDVLEFGVSE  132

Query  665   IRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQ  486
             +R H++W+   W +             PG  R  S        F +G  VEV  D +  +
Sbjct  133   LRLHKQWVKGNWVL-------------PGKQRTDS------LMFSVGKNVEVSFDRDDRR  173

Query  485   GSWYPALILRLIGNGKYLVE-FRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLE  309
              +W+P+ +L  + NG +LVE +RT+      D +    D+  +RP  P ++R  +F  LE
Sbjct  174   DAWFPSKVLEHLENGSFLVERYRTIDKKASIDKVT--VDSFHIRPLPPHIKR-KKFNLLE  230

Query  308   EVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +VDA+ +  W  G +   L  ++Y V F+ TN   E     LR H +W +G W
Sbjct  231   KVDAFYDLAWWSGVITRELADSRYIVFFKHTNMEKELNDSDLRPHMDWKDGQW  283


 Score =   132 bits (331),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 99/318 (31%), Positives = 149/318 (47%), Gaps = 44/318 (14%)
 Frame = -3

Query  2042  FNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYV  1869
               KG  VEV    + F  +WF   +L     K +    + VE+ ++ +D+   K  +E V
Sbjct  15    LTKGSTVEVTSDEEGFKGVWFDGTILNYGSNKKK----VLVEYRSILADEIGSKPLRELV  70

Query  1868  HLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVK  1689
             ++S VRP PP E    F + +  D  Y++ GW  G + ++L++  Y V   +   V    
Sbjct  71    NVSFVRPVPPLEIVESFELHDVVDASYKD-GWWTGVITKVLDDFRYQVTFSNPPDVLEFG  129

Query  1688  VEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKF  1509
             V +  LR+H+ W  G WV P            K+  D LM                   F
Sbjct  130   VSE--LRLHKQWVKGNWVLP-----------GKQRTDSLM-------------------F  157

Query  1508  SKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQ-YQDLKTDDGTDYLIEEVDASCIR  1332
             S    VEV  D++    +W+ S V+E L NG  LV+ Y+ +      D +   VD+  IR
Sbjct  158   SVGKNVEVSFDRDDRRDAWFPSKVLEHLENGSFLVERYRTIDKKASIDKVT--VDSFHIR  215

Query  1331  PCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRP  1152
             P PP I R   F LL+KVDA+    WW G +++ L D++Y+V F   N       SDLRP
Sbjct  216   PLPPHIKR-KKFNLLEKVDAFYDLAWWSGVITRELADSRYIVFFKHTNMEKELNDSDLRP  274

Query  1151  HQEWKNNNWVAATKIDLP  1098
             H +WK+  W   ++ D+P
Sbjct  275   HMDWKDGQWFTTSR-DIP  291



>gb|KCW84862.1| hypothetical protein EUGRSUZ_B01689 [Eucalyptus grandis]
Length=154

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 96/146 (66%), Gaps = 0/146 (0%)
 Frame = -3

Query  1037  RKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEK  858
             +K    +F+KG  VE +S E+GY G+W+ AV+ + +   K+L+E++  RT+D +E LKE+
Sbjct  5     KKMKSNEFTKGTPVEVSSDEDGYRGAWFAAVVVEEVSKGKYLVEFKNFRTEDGAELLKEE  64

Query  857   ADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEF  678
             ADA +IRPCPP I   D F +F+EVDA +N+ WW G++SKVL    Y VYF  T EE+ F
Sbjct  65    ADALHIRPCPPEIIVADHFNLFDEVDALHNDSWWVGVVSKVLSRSRYTVYFRDTKEELVF  124

Query  677   AHHGIRPHQEWIDKKWDIAFRKSNNN  600
              H  +RPHQEWI  +W  A     NN
Sbjct  125   QHSNLRPHQEWIGGRWMTASLDPKNN  150


 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 91/144 (63%), Gaps = 0/144 (0%)
 Frame = -3

Query  1544  IKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDY  1365
             +K  +     +F+K  PVEV  D++G+  +W+A+VV+E +  GK LV++++ +T+DG + 
Sbjct  1     MKVAKKMKSNEFTKGTPVEVSSDEDGYRGAWFAAVVVEEVSKGKYLVEFKNFRTEDGAEL  60

Query  1364  LIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNE  1185
             L EE DA  IRPCPPEI     F L D+VDA   + WW G VSKVL  ++Y V F    E
Sbjct  61    LKEEADALHIRPCPPEIIVADHFNLFDEVDALHNDSWWVGVVSKVLSRSRYTVYFRDTKE  120

Query  1184  LLTFEASDLRPHQEWKNNNWVAAT  1113
              L F+ S+LRPHQEW    W+ A+
Sbjct  121   ELVFQHSNLRPHQEWIGGRWMTAS  144


 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 81/129 (63%), Gaps = 0/129 (0%)
 Frame = -3

Query  536  FCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVR  357
            F  G  VEV  DE+G +G+W+ A+++  +  GKYLVEF+  + + G +LL +EADAL +R
Sbjct  12   FTKGTPVEVSSDEDGYRGAWFAAVVVEEVSKGKYLVEFKNFRTEDGAELLKEEADALHIR  71

Query  356  PSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRL  177
            P  P +   D F   +EVDA  N+ W VG V +VL  ++Y V FR T E L F+H  LR 
Sbjct  72   PCPPEIIVADHFNLFDEVDALHNDSWWVGVVSKVLSRSRYTVYFRDTKEELVFQHSNLRP  131

Query  176  HQEWINGAW  150
            HQEWI G W
Sbjct  132  HQEWIGGRW  140



>gb|AAU44232.1| hypothetical protein [Oryza sativa Japonica Group]
Length=448

 Score =   157 bits (397),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 124/453 (27%), Positives = 192/453 (42%), Gaps = 49/453 (11%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEI  1314
             VEV  D+ G+  + + + V     N +       +  D     L E V AS +RP PP+ 
Sbjct  31    VEVLPDEPGYRGAHFPASVTASHANPRGYT----VAYDGSGCPLGEVVAASQLRPRPPDA  86

Query  1313  HRISPFKLLDKVDAWVGNGWW---EGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQE  1143
              R  P      VDA+ G  WW        +     +  VCF    E++ F+A+D+RPH E
Sbjct  87    PRGVPPAEHAVVDAFKGGAWWVGVALGGGRAAAGGRVAVCFPETREVVEFDAADVRPHLE  146

Query  1142  WKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHG  963
             W    W++   + + ++                         + KG  VE    E     
Sbjct  147   WVAGEWLSPENMGISKTMP-----------------------YKKGTQVEVAKLEGNSVV  183

Query  962   SWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEV  783
             +W++A +  +I  N  L++Y   + D    P KE  D  +IRP P        F + +EV
Sbjct  184   AWFSAAVEKAIWKNSLLVDYNCSKNDGSVLP-KEIVDLKHIRPHPQHASAI-IFCINDEV  241

Query  782   DAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNN  603
             + +   GWW G+I+ V     Y      + +EI+     +R   +W   +W         
Sbjct  242   EGFQGNGWWLGVITDVHPEFRYTFKAAHSGKEIQLDQKALRLRYDWTHDQW--------Q  293

Query  602   NLPNPKPGIMRRHSGGIASETT--FCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLV  429
              +    PG+         +  T  F  G+KVEV  +++G  G+W+    L+ + N K LV
Sbjct  294   QVTQMIPGLFYMLLPTFHNNVTKKFAKGSKVEVTSNDDGFHGAWFQGTALKYVNN-KILV  352

Query  428   EFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLE  249
             E+  LK D     L +  +   VRP  P +     F  L+EVDA  N+GW VG + +V  
Sbjct  353   EYDALKADDEITPLTEAIEVQHVRPCPPDIPVTSGFNLLDEVDACWNDGWWVGVISKVNS  412

Query  248   GAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             G       R++ E  EF H  LRLH +W+ G W
Sbjct  413   GD------RSSTEETEFGHEQLRLHCDWVGGRW  439


 Score =   124 bits (312),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 95/323 (29%), Positives = 145/323 (45%), Gaps = 36/323 (11%)
 Frame = -3

Query  2075  PETHAMSAEAQFNKGDRVEV--LMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSD  1902
             PE   +S    + KG +VEV  L  ++   WF AAV + ++ KN     + V++   CS 
Sbjct  155   PENMGISKTMPYKKGTQVEVAKLEGNSVVAWFSAAVEK-AIWKNS----LLVDYN--CSK  207

Query  1901  DDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVA  1722
             +D     KE V L  +RP P       F + +  + F  N GW  G + ++     Y   
Sbjct  208   NDGSVLPKEIVDLKHIRPHPQHASAIIFCINDEVEGFQGN-GWWLGVITDVHPEFRYTFK  266

Query  1721  LGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRI  1542
                    + ++++Q  LR+  DW    W          QQ  Q       M P    + +
Sbjct  267   AAHSG--KEIQLDQKALRLRYDWTHDQW----------QQVTQ-------MIPGLFYMLL  307

Query  1541  KCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYL  1362
                  +  +KF+K   VEV  + +GF  +W+    ++ + N K+LV+Y  LK DD    L
Sbjct  308   PTFHNNVTKKFAKGSKVEVTSNDDGFHGAWFQGTALKYVNN-KILVEYDALKADDEITPL  366

Query  1361  IEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNEL  1182
              E ++   +RPCPP+I   S F LLD+VDA   +GWW G +SKV    +      S  E 
Sbjct  367   TEAIEVQHVRPCPPDIPVTSGFNLLDEVDACWNDGWWVGVISKVNSGDR------SSTEE  420

Query  1181  LTFEASDLRPHQEWKNNNWVAAT  1113
               F    LR H +W    W+ A+
Sbjct  421   TEFGHEQLRLHCDWVGGRWMRAS  443


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 75/294 (26%), Positives = 116/294 (39%), Gaps = 29/294 (10%)
 Frame = -3

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDS-IGPNKFLLEYQTLRTDDESEPLKEKADAFN  843
             +F  G LVE    E GY G+ + A +  S   P  + + Y     D    PL E   A  
Sbjct  24    QFRPGDLVEVLPDEPGYRGAHFPASVTASHANPRGYTVAY-----DGSGCPLGEVVAASQ  78

Query  842   IRPCPPLIHRFDRFKMFEEVDAWYNEGWW---EGLISKVLDGLNYVVYFWTTNEEIEFAH  672
             +RP PP   R         VDA+    WW        +   G    V F  T E +EF  
Sbjct  79    LRPRPPDAPRGVPPAEHAVVDAFKGGAWWVGVALGGGRAAAGGRVAVCFPETREVVEFDA  138

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
               +RPH EW+  +W                  +   + GI+    +  G +VEV   E  
Sbjct  139   ADVRPHLEWVAGEW------------------LSPENMGISKTMPYKKGTQVEVAKLEGN  180

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPL  312
             +  +W+ A + + I     LV++   K D G+ L  +  D   +RP  P       F   
Sbjct  181   SVVAWFSAAVEKAIWKNSLLVDYNCSKND-GSVLPKEIVDLKHIRPH-PQHASAIIFCIN  238

Query  311   EEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +EV+ +  NGW +G + +V    +Y      + + ++     LRL  +W +  W
Sbjct  239   DEVEGFQGNGWWLGVITDVHPEFRYTFKAAHSGKEIQLDQKALRLRYDWTHDQW  292



>ref|XP_008388457.1| PREDICTED: uncharacterized protein LOC103450836 [Malus domestica]
 ref|XP_008350590.1| PREDICTED: uncharacterized protein LOC103413939 [Malus domestica]
Length=180

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 97/140 (69%), Gaps = 1/140 (1%)
 Frame = -3

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNI  840
             KF+KGMLVE  S E+G+ G+W+ A I +++G +KFL+EYQ+LRT+D S  L+E+ D  +I
Sbjct  41    KFTKGMLVEVCSDEDGFLGAWFAATIVEAVGNDKFLIEYQSLRTEDNSAFLREEIDTLHI  100

Query  839   RPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIR  660
             RP PP    F+ F + +EVDA YN+GWW G+ISKVL G  Y+VYF +T EEIEF    +R
Sbjct  101   RPNPPET-AFEHFSLLQEVDALYNDGWWVGVISKVLSGSRYIVYFRSTYEEIEFQQSELR  159

Query  659   PHQEWIDKKWDIAFRKSNNN  600
              HQ+WI  KW +  R    N
Sbjct  160   LHQDWIGGKWVMPSRALKTN  179


 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 88/135 (65%), Gaps = 1/135 (1%)
 Frame = -3

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCI  1335
             KF+K M VEV  D++GF  +W+A+ ++E +GN K L++YQ L+T+D + +L EE+D   I
Sbjct  41    KFTKGMLVEVCSDEDGFLGAWFAATIVEAVGNDKFLIEYQSLRTEDNSAFLREEIDTLHI  100

Query  1334  RPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLR  1155
             RP PPE      F LL +VDA   +GWW G +SKVL  ++Y+V F S  E + F+ S+LR
Sbjct  101   RPNPPET-AFEHFSLLQEVDALYNDGWWVGVISKVLSGSRYIVYFRSTYEEIEFQQSELR  159

Query  1154  PHQEWKNNNWVAATK  1110
              HQ+W    WV  ++
Sbjct  160   LHQDWIGGKWVMPSR  174


 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 91/153 (59%), Gaps = 5/153 (3%)
 Frame = -3

Query  596  PNPKPGIMRRHSGG----IASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLV  429
            P  K  +    +GG    I +   F  G  VEV  DE+G  G+W+ A I+  +GN K+L+
Sbjct  18   PGKKRAVPLEENGGEKVPIVTHEKFTKGMLVEVCSDEDGFLGAWFAATIVEAVGNDKFLI  77

Query  428  EFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLE  249
            E+++L+ +  +  L +E D L +RP+ P     + F  L+EVDA  N+GW VG + +VL 
Sbjct  78   EYQSLRTEDNSAFLREEIDTLHIRPNPPETA-FEHFSLLQEVDALYNDGWWVGVISKVLS  136

Query  248  GAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
            G++Y V FR+T E +EF+   LRLHQ+WI G W
Sbjct  137  GSRYIVYFRSTYEEIEFQQSELRLHQDWIGGKW  169


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 69/141 (49%), Gaps = 11/141 (8%)
 Frame = -3

Query  2045  QFNKGDRVEVLMRDN--FPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEY  1872
             +F KG  VEV   ++     WF A ++           +  +E+++L ++D+    R+E 
Sbjct  41    KFTKGMLVEVCSDEDGFLGAWFAATIVEAVGND-----KFLIEYQSLRTEDNSAFLREEI  95

Query  1871  VHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESV  1692
               L  +RP PP     +F + +  D  Y N GW  G + ++L  S Y+V        E +
Sbjct  96    DTLH-IRPNPPETAFEHFSLLQEVDALY-NDGWWVGVISKVLSGSRYIVYF--RSTYEEI  151

Query  1691  KVEQWQLRVHRDWKDGCWVPP  1629
             + +Q +LR+H+DW  G WV P
Sbjct  152   EFQQSELRLHQDWIGGKWVMP  172



>ref|XP_009373309.1| PREDICTED: uncharacterized protein LOC103962335 [Pyrus x bretschneideri]
Length=178

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = -3

Query  1019  KFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNI  840
             KF+KGM VE  S E+G+HG+W+ A I +++G  KFL+EYQ+LRT+D S  L+E+ D  +I
Sbjct  41    KFTKGMPVEVCSDEDGFHGAWFAATIVEAVGNEKFLIEYQSLRTEDNSAFLREEIDTLHI  100

Query  839   RPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIR  660
             RP PP I   + F + +EVDA YN+GWW G+ISKVL G  Y+VYF +T EEIEF    +R
Sbjct  101   RPNPPEI-AVEHFSLLQEVDALYNDGWWVGVISKVLSGSRYIVYFRSTYEEIEFQQSELR  159

Query  659   PHQEWIDKKWDIAFR  615
              HQ+WI  KW ++ R
Sbjct  160   LHQDWIGGKWVMSSR  174


 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = -3

Query  1517  RKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASC  1338
             +KF+K MPVEV  D++GF  +W+A+ ++E +GN K L++YQ L+T+D + +L EE+D   
Sbjct  40    KKFTKGMPVEVCSDEDGFHGAWFAATIVEAVGNEKFLIEYQSLRTEDNSAFLREEIDTLH  99

Query  1337  IRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDL  1158
             IRP PPEI  +  F LL +VDA   +GWW G +SKVL  ++Y+V F S  E + F+ S+L
Sbjct  100   IRPNPPEI-AVEHFSLLQEVDALYNDGWWVGVISKVLSGSRYIVYFRSTYEEIEFQQSEL  158

Query  1157  RPHQEWKNNNWVAATK  1110
             R HQ+W    WV +++
Sbjct  159   RLHQDWIGGKWVMSSR  174


 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 87/135 (64%), Gaps = 1/135 (1%)
 Frame = -3

Query  554  IASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEA  375
            I +   F  G  VEV  DE+G  G+W+ A I+  +GN K+L+E+++L+ +  +  L +E 
Sbjct  36   IVTHKKFTKGMPVEVCSDEDGFHGAWFAATIVEAVGNEKFLIEYQSLRTEDNSAFLREEI  95

Query  374  DALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFR  195
            D L +RP+ P +  V+ F  L+EVDA  N+GW VG + +VL G++Y V FR+T E +EF+
Sbjct  96   DTLHIRPNPPEIA-VEHFSLLQEVDALYNDGWWVGVISKVLSGSRYIVYFRSTYEEIEFQ  154

Query  194  HHGLRLHQEWINGAW  150
               LRLHQ+WI G W
Sbjct  155  QSELRLHQDWIGGKW  169


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 69/139 (50%), Gaps = 11/139 (8%)
 Frame = -3

Query  2045  QFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEY  1872
             +F KG  VEV    D F   WF A ++     +     +  +E+++L ++D+    R+E 
Sbjct  41    KFTKGMPVEVCSDEDGFHGAWFAATIVEAVGNE-----KFLIEYQSLRTEDNSAFLREEI  95

Query  1871  VHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESV  1692
               L  +RP PP     +F + +  D  Y N GW  G + ++L  S Y+V        E +
Sbjct  96    DTLH-IRPNPPEIAVEHFSLLQEVDALY-NDGWWVGVISKVLSGSRYIVYF--RSTYEEI  151

Query  1691  KVEQWQLRVHRDWKDGCWV  1635
             + +Q +LR+H+DW  G WV
Sbjct  152   EFQQSELRLHQDWIGGKWV  170



>ref|XP_004505515.1| PREDICTED: uncharacterized protein LOC101489110 [Cicer arietinum]
Length=285

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 100/298 (34%), Positives = 148/298 (50%), Gaps = 27/298 (9%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             +  G  VE  S EEG+ GS++ A +   I   ++ + Y  L +DDES PL E   A  +R
Sbjct  4     YDIGDKVEVCSEEEGFEGSYFEATVVACIENGEYAVRYTNLLSDDESAPLIEIVKANEVR  63

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISK----VLDGLNYVVYFWTTNEEIEFAHH  669
             P PP ++  D F  +++VDA+ N+GWW GLI        +G  Y VYF  TNE I F   
Sbjct  64    PLPPCVNPQD-FNFYQKVDAFDNDGWWIGLIISEKIATQNGYYYGVYFQNTNETIHFRFD  122

Query  668   GIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGN  489
              IR H EW+D +W                 I+         +  +  G KVEV   EEG 
Sbjct  123   QIRVHHEWVDGEW-----------------ILEESMRPPMKKVDYKEGDKVEVCSKEEGF  165

Query  488   QGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEA-DALSVRPSAPILQRVDRFRPL  312
              GS+Y   I+  + NGKY+V ++ L  D  +   ++E      +RP  P ++    F+  
Sbjct  166   IGSYYEGTIVSCLENGKYVVCYKNLIEDDNSGRYLKETLYPKELRPLPPRVRNPTNFKRN  225

Query  311   EEVDAWSNNGWRVGQVC-EVLEGAK---YRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             ++VDA+ N+GW +G +  E +   K   Y+V F   NE + +  H +RLH +W  G W
Sbjct  226   QKVDAFDNDGWWLGVIASEKMVQQKIDYYKVYFPNCNESIYYPSHRIRLHHQWFAGHW  283


 Score =   142 bits (359),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 97/297 (33%), Positives = 144/297 (48%), Gaps = 32/297 (11%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEI  1314
             VEV  ++EGFE S++ + V+  + NG+  V+Y +L +DD +  LIE V A+ +RP PP +
Sbjct  10    VEVCSEEEGFEGSYFEATVVACIENGEYAVRYTNLLSDDESAPLIEIVKANEVRPLPPCV  69

Query  1313  HRISPFKLLDKVDAWVGNGWWEGHV--SKVLGDAKYM--VCFGSMNELLTFEASDLRPHQ  1146
             +    F    KVDA+  +GWW G +   K+     Y   V F + NE + F    +R H 
Sbjct  70    NP-QDFNFYQKVDAFDNDGWWIGLIISEKIATQNGYYYGVYFQNTNETIHFRFDQIRVHH  128

Query  1145  EWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYH  966
             EW +  W+    +  P    D                      + +G  VE  S EEG+ 
Sbjct  129   EWVDGEWILEESMRPPMKKVD----------------------YKEGDKVEVCSKEEGFI  166

Query  965   GSWYTAVIFDSIGPNKFLLEYQTLRTDDES-EPLKEKADAFNIRPCPPLIHRFDRFKMFE  789
             GS+Y   I   +   K+++ Y+ L  DD S   LKE      +RP PP +     FK  +
Sbjct  167   GSYYEGTIVSCLENGKYVVCYKNLIEDDNSGRYLKETLYPKELRPLPPRVRNPTNFKRNQ  226

Query  788   EVDAWYNEGWWEGLISK---VLDGLNYV-VYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             +VDA+ N+GWW G+I+    V   ++Y  VYF   NE I +  H IR H +W    W
Sbjct  227   KVDAFDNDGWWLGVIASEKMVQQKIDYYKVYFPNCNESIYYPSHRIRLHHQWFAGHW  283


 Score =   104 bits (260),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 93/314 (30%), Positives = 142/314 (45%), Gaps = 40/314 (13%)
 Frame = -3

Query  2042  FNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHL  1863
             ++ GD+VEV   +     F  +    +V      G+  V +  L SDD+      E V  
Sbjct  4     YDIGDKVEVCSEEE---GFEGSYFEATVVACIENGEYAVRYTNLLSDDESAPL-IEIVKA  59

Query  1862  SAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTV--DEILENSMYMVALGDEDAVESVK  1689
             + VRP PP      F   +  D F +N GW  G +  ++I   + Y   +  ++  E++ 
Sbjct  60    NEVRPLPPCVNPQDFNFYQKVDAF-DNDGWWIGLIISEKIATQNGYYYGVYFQNTNETIH  118

Query  1688  VEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKF  1509
                 Q+RVH +W DG W+  LEES               M P   K+  K   G  V   
Sbjct  119   FRFDQIRVHHEWVDGEWI--LEES---------------MRPPMKKVDYK--EGDKVEVC  159

Query  1508  SKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTD-YLIEEVDASCIR  1332
             SKE         EGF  S+Y   ++  L NGK +V Y++L  DD +  YL E +    +R
Sbjct  160   SKE---------EGFIGSYYEGTIVSCLENGKYVVCYKNLIEDDNSGRYLKETLYPKELR  210

Query  1331  PCPPEIHRISPFKLLDKVDAWVGNGWWEGHV-SKVLGDAK---YMVCFGSMNELLTFEAS  1164
             P PP +   + FK   KVDA+  +GWW G + S+ +   K   Y V F + NE + + + 
Sbjct  211   PLPPRVRNPTNFKRNQKVDAFDNDGWWLGVIASEKMVQQKIDYYKVYFPNCNESIYYPSH  270

Query  1163  DLRPHQEWKNNNWV  1122
              +R H +W   +W+
Sbjct  271   RIRLHHQWFAGHWI  284



>ref|XP_010679472.1| PREDICTED: uncharacterized protein LOC104894831 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1038

 Score =   161 bits (407),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 156/296 (53%), Gaps = 37/296 (13%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVME-----VLGNGKLLVQYQDLKTDDGTDYLIEE-VDASCIR  1332
             VEV  D+EGF  +WY + V++          K+LV+Y++L +D+    L++E VD   +R
Sbjct  57    VEVTSDEEGFTGAWYLATVLQPPSLSSSSARKVLVEYKNLLSDENGSALLQEFVDIEFVR  116

Query  1331  PCPP--EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDL  1158
             P PP  E  ++S F++ D VDA+  +GWW G V++++ D K+ V F +  + + F++SDL
Sbjct  117   PKPPIDENDKVS-FQINDVVDAFYQDGWWSGVVTQLVSDTKFRVFFSNPPDEMEFDSSDL  175

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFE  978
             R H++W +  WV      LP +     LN                  FS G  VE     
Sbjct  176   RIHKDWVHGKWV------LPPNQRMRDLN------------------FSPGTAVEVNIDP  211

Query  977   EGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFK  798
             +     W+ A I   +  N FL+EYQ+ +   E+   K   D+F+I+P PP       F 
Sbjct  212   DNSSDVWFPATIIKQVANNSFLVEYQSSK---EAGLQKVSVDSFHIKPSPPSSSN-KTFN  267

Query  797   MFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             + E+VDA+Y+  W  G+++K+L    Y+VYF  T +E E +H  +R H EW + KW
Sbjct  268   LLEKVDAFYDCRWLSGVVTKILADGRYIVYFKRTKKEKELSHADLRLHMEWNNGKW  323


 Score =   152 bits (385),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 99/299 (33%), Positives = 152/299 (51%), Gaps = 32/299 (11%)
 Frame = -3

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTAVIFD-----SIGPNKFLLEYQTLRTDDE-SEPLKE  861
             P F  G  VE TS EEG+ G+WY A +       S    K L+EY+ L +D+  S  L+E
Sbjct  49    PLFPFGSEVEVTSDEEGFTGAWYLATVLQPPSLSSSSARKVLVEYKNLLSDENGSALLQE  108

Query  860   KADAFNIRPCPPLIHRFDR--FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEE  687
               D   +RP PP I   D+  F++ + VDA+Y +GWW G++++++    + V+F    +E
Sbjct  109   FVDIEFVRPKPP-IDENDKVSFQINDVVDAFYQDGWWSGVVTQLVSDTKFRVFFSNPPDE  167

Query  686   IEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVK  507
             +EF    +R H++W+  KW +         PN +   MR        +  F  G  VEV 
Sbjct  168   MEFDSSDLRIHKDWVHGKWVLP--------PNQR---MR--------DLNFSPGTAVEVN  208

Query  506   DDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVD  327
              D + +   W+PA I++ + N  +LVE+++ K      L     D+  ++PS P      
Sbjct  209   IDPDNSSDVWFPATIIKQVANNSFLVEYQSSK---EAGLQKVSVDSFHIKPSPPSSSN-K  264

Query  326   RFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              F  LE+VDA+ +  W  G V ++L   +Y V F+ T +  E  H  LRLH EW NG W
Sbjct  265   TFNLLEKVDAFYDCRWLSGVVTKILADGRYIVYFKRTKKEKELSHADLRLHMEWNNGKW  323


 Score =   120 bits (302),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 138/296 (47%), Gaps = 39/296 (13%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPC--CYF  1818
             W+ A VL+P    +  A ++ VE++ L SD++     +E+V +  VRP PP +      F
Sbjct  70    WYLATVLQPPSLSSSSARKVLVEYKNLLSDENGSALLQEFVDIEFVRPKPPIDENDKVSF  129

Query  1817  RVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCW  1638
             ++ +  D FY++ GW  G V +++ ++ + V   +    + ++ +   LR+H+DW  G W
Sbjct  130   QINDVVDAFYQD-GWWSGVVTQLVSDTKFRVFFSN--PPDEMEFDSSDLRIHKDWVHGKW  186

Query  1637  VPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFER  1458
             V P  +   D                                FS    VEV  D +    
Sbjct  187   VLPPNQRMRDLN------------------------------FSPGTAVEVNIDPDNSSD  216

Query  1457  SWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKV  1278
              W+ + +++ + N   LV+YQ  K + G   +   VD+  I+P PP     + F LL+KV
Sbjct  217   VWFPATIIKQVANNSFLVEYQSSK-EAGLQKV--SVDSFHIKPSPPSSSNKT-FNLLEKV  272

Query  1277  DAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             DA+    W  G V+K+L D +Y+V F    +      +DLR H EW N  W+ +++
Sbjct  273   DAFYDCRWLSGVVTKILADGRYIVYFKRTKKEKELSHADLRLHMEWNNGKWILSSQ  328



>ref|XP_010679471.1| PREDICTED: uncharacterized protein LOC104894831 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1041

 Score =   161 bits (407),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 156/296 (53%), Gaps = 37/296 (13%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVME-----VLGNGKLLVQYQDLKTDDGTDYLIEE-VDASCIR  1332
             VEV  D+EGF  +WY + V++          K+LV+Y++L +D+    L++E VD   +R
Sbjct  57    VEVTSDEEGFTGAWYLATVLQPPSLSSSSARKVLVEYKNLLSDENGSALLQEFVDIEFVR  116

Query  1331  PCPP--EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDL  1158
             P PP  E  ++S F++ D VDA+  +GWW G V++++ D K+ V F +  + + F++SDL
Sbjct  117   PKPPIDENDKVS-FQINDVVDAFYQDGWWSGVVTQLVSDTKFRVFFSNPPDEMEFDSSDL  175

Query  1157  RPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFE  978
             R H++W +  WV      LP +     LN                  FS G  VE     
Sbjct  176   RIHKDWVHGKWV------LPPNQRMRDLN------------------FSPGTAVEVNIDP  211

Query  977   EGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFK  798
             +     W+ A I   +  N FL+EYQ+ +   E+   K   D+F+I+P PP       F 
Sbjct  212   DNSSDVWFPATIIKQVANNSFLVEYQSSK---EAGLQKVSVDSFHIKPSPPSSSN-KTFN  267

Query  797   MFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             + E+VDA+Y+  W  G+++K+L    Y+VYF  T +E E +H  +R H EW + KW
Sbjct  268   LLEKVDAFYDCRWLSGVVTKILADGRYIVYFKRTKKEKELSHADLRLHMEWNNGKW  323


 Score =   152 bits (385),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 99/299 (33%), Positives = 152/299 (51%), Gaps = 32/299 (11%)
 Frame = -3

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTAVIFD-----SIGPNKFLLEYQTLRTDDE-SEPLKE  861
             P F  G  VE TS EEG+ G+WY A +       S    K L+EY+ L +D+  S  L+E
Sbjct  49    PLFPFGSEVEVTSDEEGFTGAWYLATVLQPPSLSSSSARKVLVEYKNLLSDENGSALLQE  108

Query  860   KADAFNIRPCPPLIHRFDR--FKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEE  687
               D   +RP PP I   D+  F++ + VDA+Y +GWW G++++++    + V+F    +E
Sbjct  109   FVDIEFVRPKPP-IDENDKVSFQINDVVDAFYQDGWWSGVVTQLVSDTKFRVFFSNPPDE  167

Query  686   IEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVK  507
             +EF    +R H++W+  KW +         PN +   MR        +  F  G  VEV 
Sbjct  168   MEFDSSDLRIHKDWVHGKWVLP--------PNQR---MR--------DLNFSPGTAVEVN  208

Query  506   DDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVD  327
              D + +   W+PA I++ + N  +LVE+++ K      L     D+  ++PS P      
Sbjct  209   IDPDNSSDVWFPATIIKQVANNSFLVEYQSSK---EAGLQKVSVDSFHIKPSPPSSSN-K  264

Query  326   RFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              F  LE+VDA+ +  W  G V ++L   +Y V F+ T +  E  H  LRLH EW NG W
Sbjct  265   TFNLLEKVDAFYDCRWLSGVVTKILADGRYIVYFKRTKKEKELSHADLRLHMEWNNGKW  323


 Score =   120 bits (302),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 138/296 (47%), Gaps = 39/296 (13%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPC--CYF  1818
             W+ A VL+P    +  A ++ VE++ L SD++     +E+V +  VRP PP +      F
Sbjct  70    WYLATVLQPPSLSSSSARKVLVEYKNLLSDENGSALLQEFVDIEFVRPKPPIDENDKVSF  129

Query  1817  RVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCW  1638
             ++ +  D FY++ GW  G V +++ ++ + V   +    + ++ +   LR+H+DW  G W
Sbjct  130   QINDVVDAFYQD-GWWSGVVTQLVSDTKFRVFFSN--PPDEMEFDSSDLRIHKDWVHGKW  186

Query  1637  VPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFER  1458
             V P  +   D                                FS    VEV  D +    
Sbjct  187   VLPPNQRMRDLN------------------------------FSPGTAVEVNIDPDNSSD  216

Query  1457  SWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKV  1278
              W+ + +++ + N   LV+YQ  K + G   +   VD+  I+P PP     + F LL+KV
Sbjct  217   VWFPATIIKQVANNSFLVEYQSSK-EAGLQKV--SVDSFHIKPSPPSSSNKT-FNLLEKV  272

Query  1277  DAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATK  1110
             DA+    W  G V+K+L D +Y+V F    +      +DLR H EW N  W+ +++
Sbjct  273   DAFYDCRWLSGVVTKILADGRYIVYFKRTKKEKELSHADLRLHMEWNNGKWILSSQ  328



>ref|XP_002320282.2| hypothetical protein POPTR_0014s11310g [Populus trichocarpa]
 gb|EEE98597.2| hypothetical protein POPTR_0014s11310g [Populus trichocarpa]
Length=915

 Score =   158 bits (400),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 106/334 (32%), Positives = 155/334 (46%), Gaps = 53/334 (16%)
 Frame = -3

Query  1469  GFERSWYASVVMEVLGNG----------KLLVQYQDLKTDDGTDYLIEEVDASCIRPCPP  1320
             GF  +WY + +++               K +VQY+ L T+DG   L+E+VD   IRP PP
Sbjct  39    GFRGAWYLATILDFPTPSQPQSASEKKRKAIVQYKTLVTEDGPAPLLEQVDPQLIRPLPP  98

Query  1319  E--IHRISPFKLLDKVDAWVGNGWWEGHVSKVLG-DAKYMVCFGSMNELLTFEASDLRPH  1149
             +  +     F+  + +DA +  GWW G V KVL   A+YMV F +  ++L F+A DLR H
Sbjct  99    QDSLKNGGVFQENEAIDASLRYGWWSGVVKKVLDRGARYMVYFDNPPDVLDFDAKDLRIH  158

Query  1148  QEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGY  969
              +W +  WV                       + +  ++A G  FS G  VE    ++  
Sbjct  159   LDWVDGKWV-----------------------RPEMQQQATGSVFSSGTEVEVNLEKDNV  195

Query  968   HGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFE  789
                W  AV+        FL++ Q+    DE+  +K   D+ +IRP PP  H    +++ E
Sbjct  196   RDIWLPAVVVKENEDRTFLVKCQSSWNSDEAGTMKTIVDSLHIRPTPP--HADRNYELLE  253

Query  788   EVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA----  621
              VDA Y  GW  G+I+K+L G  Y V+F   NE+ E +   IRPH EW+D KW       
Sbjct  254   RVDAHYGSGWRSGVITKLLAGRRYNVFFKQGNEDRELSQSKIRPHMEWVDGKWISKKEVR  313

Query  620   --------FRKSNNNLPNPKPGIMRRHSGGIASE  543
                     F  +NN   N  P +   H    ASE
Sbjct  314   ILSDSRGQFGSTNN---NKNPDVAELHKSSSASE  344


 Score =   145 bits (366),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 95/302 (31%), Positives = 153/302 (51%), Gaps = 33/302 (11%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPN----------KFLLEYQTLRTDDESEPL  867
             F+KG  VE +S +EG+ G+WY A I D   P+          K +++Y+TL T+D   PL
Sbjct  25    FNKGEEVEVSSEQEGFRGAWYLATILDFPTPSQPQSASEKKRKAIVQYKTLVTEDGPAPL  84

Query  866   KEKADAFNIRPCPPL--IHRFDRFKMFEEVDAWYNEGWWEGLISKVLD-GLNYVVYFWTT  696
              E+ D   IRP PP   +     F+  E +DA    GWW G++ KVLD G  Y+VYF   
Sbjct  85    LEQVDPQLIRPLPPQDSLKNGGVFQENEAIDASLRYGWWSGVVKKVLDRGARYMVYFDNP  144

Query  695   NEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKV  516
              + ++F    +R H +W+D KW              +P + ++ +G +     F  G +V
Sbjct  145   PDVLDFDAKDLRIHLDWVDGKW-------------VRPEMQQQATGSV-----FSSGTEV  186

Query  515   EVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQ  336
             EV  +++  +  W PA++++   +  +LV+ ++         +    D+L +RP+ P   
Sbjct  187   EVNLEKDNVRDIWLPAVVVKENEDRTFLVKCQSSWNSDEAGTMKTIVDSLHIRPTPPHAD  246

Query  335   RVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWING  156
             R   +  LE VDA   +GWR G + ++L G +Y V F+  NE  E     +R H EW++G
Sbjct  247   R--NYELLERVDAHYGSGWRSGVITKLLAGRRYNVFFKQGNEDRELSQSKIRPHMEWVDG  304

Query  155   AW  150
              W
Sbjct  305   KW  306


 Score =   100 bits (250),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 88/309 (28%), Positives = 137/309 (44%), Gaps = 54/309 (17%)
 Frame = -3

Query  1991  WFPAAVLR-PSVRKNQRAGQ----IYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPC  1827
             W+ A +L  P+  + Q A +      V+++TL ++D P     E V    +RP PP +  
Sbjct  44    WYLATILDFPTPSQPQSASEKKRKAIVQYKTLVTEDGPAPLL-EQVDPQLIRPLPPQDSL  102

Query  1826  CYFRVGESADVFYENR--------GWRRGTVDEILE-NSMYMVALGDEDAVESVKVEQWQ  1674
                   ++  VF EN         GW  G V ++L+  + YMV   +   V  +  +   
Sbjct  103   ------KNGGVFQENEAIDASLRYGWWSGVVKKVLDRGARYMVYFDNPPDV--LDFDAKD  154

Query  1673  LRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMP  1494
             LR+H DW DG WV P        + QQ+ +                  GS    FS    
Sbjct  155   LRIHLDWVDGKWVRP--------EMQQQAT------------------GSV---FSSGTE  185

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEI  1314
             VEV  +K+     W  +VV++   +   LV+ Q     D    +   VD+  IRP PP  
Sbjct  186   VEVNLEKDNVRDIWLPAVVVKENEDRTFLVKCQSSWNSDEAGTMKTIVDSLHIRPTPPHA  245

Query  1313  HRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKN  1134
              R   ++LL++VDA  G+GW  G ++K+L   +Y V F   NE      S +RPH EW +
Sbjct  246   DR--NYELLERVDAHYGSGWRSGVITKLLAGRRYNVFFKQGNEDRELSQSKIRPHMEWVD  303

Query  1133  NNWVAATKI  1107
               W++  ++
Sbjct  304   GKWISKKEV  312



>ref|XP_011040897.1| PREDICTED: uncharacterized protein LOC105137022 isoform X2 [Populus 
euphratica]
Length=910

 Score =   157 bits (396),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 106/336 (32%), Positives = 156/336 (46%), Gaps = 53/336 (16%)
 Frame = -3

Query  1469  GFERSWYASVVMEVLGNG----------KLLVQYQDLKTDDGTDYLIEEVDASCIRPCPP  1320
             GF  +WY + +++               K +VQY+ L T+DG   L+E+VD   IRP PP
Sbjct  39    GFRGAWYLATILDFPTPSQTQSASEKKRKAIVQYKTLVTEDGPAPLLEQVDPQLIRPLPP  98

Query  1319  E--IHRISPFKLLDKVDAWVGNGWWEGHVSKVLG-DAKYMVCFGSMNELLTFEASDLRPH  1149
             +  +     F+  + +DA +  GWW G V KVL   A+Y+V F +  ++L F+A DLR H
Sbjct  99    QDSLKNGGVFQENEAIDASLRYGWWSGVVKKVLDRGARYVVFFDNPPDVLDFDAKDLRIH  158

Query  1148  QEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGY  969
              +W + +WV                         +  ++A G  FS G  VE    ++  
Sbjct  159   LDWVDGSWVRP-----------------------EMQQQATGSVFSSGTEVEVNLEKDNV  195

Query  968   HGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFE  789
                W  AV+        FL++ Q+    DE+  +K   D+ +IRP PP  H    +++ E
Sbjct  196   RDIWLPAVVIKENEDRTFLVKCQSSWNSDEAGTMKTIVDSLHIRPSPP--HADRNYELLE  253

Query  788   EVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA----  621
              VDA Y  GW  G+I+K+L G  Y V+F   NE+ E +   IRPH EW+D KW       
Sbjct  254   RVDAHYGIGWRSGVITKLLAGRRYNVFFKQGNEDRELSQSKIRPHMEWVDGKWISKKEVR  313

Query  620   --------FRKSNNNLPNPKPGIMRRHSGGIASETT  537
                     F  +NN   N  P +   H    ASE T
Sbjct  314   ILSDSRGQFGSTNN---NKNPDVAELHKSSSASEDT  346


 Score =   143 bits (360),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 95/302 (31%), Positives = 151/302 (50%), Gaps = 33/302 (11%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPN----------KFLLEYQTLRTDDESEPL  867
             F+KG  VE +S +EG+ G+WY A I D   P+          K +++Y+TL T+D   PL
Sbjct  25    FNKGEEVEVSSEQEGFRGAWYLATILDFPTPSQTQSASEKKRKAIVQYKTLVTEDGPAPL  84

Query  866   KEKADAFNIRPCPPL--IHRFDRFKMFEEVDAWYNEGWWEGLISKVLD-GLNYVVYFWTT  696
              E+ D   IRP PP   +     F+  E +DA    GWW G++ KVLD G  YVV+F   
Sbjct  85    LEQVDPQLIRPLPPQDSLKNGGVFQENEAIDASLRYGWWSGVVKKVLDRGARYVVFFDNP  144

Query  695   NEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKV  516
              + ++F    +R H +W+D  W              +P + ++ +G +     F  G +V
Sbjct  145   PDVLDFDAKDLRIHLDWVDGSW-------------VRPEMQQQATGSV-----FSSGTEV  186

Query  515   EVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQ  336
             EV  +++  +  W PA++++   +  +LV+ ++         +    D+L +RPS P   
Sbjct  187   EVNLEKDNVRDIWLPAVVIKENEDRTFLVKCQSSWNSDEAGTMKTIVDSLHIRPSPPHAD  246

Query  335   RVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWING  156
             R   +  LE VDA    GWR G + ++L G +Y V F+  NE  E     +R H EW++G
Sbjct  247   R--NYELLERVDAHYGIGWRSGVITKLLAGRRYNVFFKQGNEDRELSQSKIRPHMEWVDG  304

Query  155   AW  150
              W
Sbjct  305   KW  306


 Score =   101 bits (251),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 86/308 (28%), Positives = 134/308 (44%), Gaps = 52/308 (17%)
 Frame = -3

Query  1991  WFPAAVLR-PSVRKNQRAGQ----IYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPC  1827
             W+ A +L  P+  + Q A +      V+++TL ++D P     E V    +RP PP +  
Sbjct  44    WYLATILDFPTPSQTQSASEKKRKAIVQYKTLVTEDGPAPLL-EQVDPQLIRPLPPQDSL  102

Query  1826  CYFRVGESADVFYENR--------GWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQL  1671
                   ++  VF EN         GW  G V ++L+     V   D +  + +  +   L
Sbjct  103   ------KNGGVFQENEAIDASLRYGWWSGVVKKVLDRGARYVVFFD-NPPDVLDFDAKDL  155

Query  1670  RVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPV  1491
             R+H DW DG WV P        + QQ+ +                  GS    FS    V
Sbjct  156   RIHLDWVDGSWVRP--------EMQQQAT------------------GSV---FSSGTEV  186

Query  1490  EVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIH  1311
             EV  +K+     W  +VV++   +   LV+ Q     D    +   VD+  IRP PP   
Sbjct  187   EVNLEKDNVRDIWLPAVVIKENEDRTFLVKCQSSWNSDEAGTMKTIVDSLHIRPSPPHAD  246

Query  1310  RISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNN  1131
             R   ++LL++VDA  G GW  G ++K+L   +Y V F   NE      S +RPH EW + 
Sbjct  247   R--NYELLERVDAHYGIGWRSGVITKLLAGRRYNVFFKQGNEDRELSQSKIRPHMEWVDG  304

Query  1130  NWVAATKI  1107
              W++  ++
Sbjct  305   KWISKKEV  312


 Score = 61.2 bits (147),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 82/162 (51%), Gaps = 16/162 (10%)
 Frame = -3

Query  596  PNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNG--------  441
            P P+    R++     S   F  G +VEV  ++EG +G+WY A IL              
Sbjct  8    PQPQQNPQRKNQ---TSTVFFNKGEEVEVSSEQEGFRGAWYLATILDFPTPSQTQSASEK  64

Query  440  --KYLVEFRTLKCDFGTDLLVQEADALSVRPSAP--ILQRVDRFRPLEEVDAWSNNGWRV  273
              K +V+++TL  + G   L+++ D   +RP  P   L+    F+  E +DA    GW  
Sbjct  65   KRKAIVQYKTLVTEDGPAPLLEQVDPQLIRPLPPQDSLKNGGVFQENEAIDASLRYGWWS  124

Query  272  GQVCEVLE-GAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
            G V +VL+ GA+Y V F    ++L+F    LR+H +W++G+W
Sbjct  125  GVVKKVLDRGARYVVFFDNPPDVLDFDAKDLRIHLDWVDGSW  166



>ref|XP_011040888.1| PREDICTED: uncharacterized protein LOC105137022 isoform X1 [Populus 
euphratica]
Length=912

 Score =   157 bits (396),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 106/336 (32%), Positives = 156/336 (46%), Gaps = 53/336 (16%)
 Frame = -3

Query  1469  GFERSWYASVVMEVLGNG----------KLLVQYQDLKTDDGTDYLIEEVDASCIRPCPP  1320
             GF  +WY + +++               K +VQY+ L T+DG   L+E+VD   IRP PP
Sbjct  39    GFRGAWYLATILDFPTPSQTQSASEKKRKAIVQYKTLVTEDGPAPLLEQVDPQLIRPLPP  98

Query  1319  E--IHRISPFKLLDKVDAWVGNGWWEGHVSKVLG-DAKYMVCFGSMNELLTFEASDLRPH  1149
             +  +     F+  + +DA +  GWW G V KVL   A+Y+V F +  ++L F+A DLR H
Sbjct  99    QDSLKNGGVFQENEAIDASLRYGWWSGVVKKVLDRGARYVVFFDNPPDVLDFDAKDLRIH  158

Query  1148  QEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGY  969
              +W + +WV                         +  ++A G  FS G  VE    ++  
Sbjct  159   LDWVDGSWVRP-----------------------EMQQQATGSVFSSGTEVEVNLEKDNV  195

Query  968   HGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFE  789
                W  AV+        FL++ Q+    DE+  +K   D+ +IRP PP  H    +++ E
Sbjct  196   RDIWLPAVVIKENEDRTFLVKCQSSWNSDEAGTMKTIVDSLHIRPSPP--HADRNYELLE  253

Query  788   EVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIA----  621
              VDA Y  GW  G+I+K+L G  Y V+F   NE+ E +   IRPH EW+D KW       
Sbjct  254   RVDAHYGIGWRSGVITKLLAGRRYNVFFKQGNEDRELSQSKIRPHMEWVDGKWISKKEVR  313

Query  620   --------FRKSNNNLPNPKPGIMRRHSGGIASETT  537
                     F  +NN   N  P +   H    ASE T
Sbjct  314   ILSDSRGQFGSTNN---NKNPDVAELHKSSSASEDT  346


 Score =   143 bits (360),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 95/302 (31%), Positives = 151/302 (50%), Gaps = 33/302 (11%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPN----------KFLLEYQTLRTDDESEPL  867
             F+KG  VE +S +EG+ G+WY A I D   P+          K +++Y+TL T+D   PL
Sbjct  25    FNKGEEVEVSSEQEGFRGAWYLATILDFPTPSQTQSASEKKRKAIVQYKTLVTEDGPAPL  84

Query  866   KEKADAFNIRPCPPL--IHRFDRFKMFEEVDAWYNEGWWEGLISKVLD-GLNYVVYFWTT  696
              E+ D   IRP PP   +     F+  E +DA    GWW G++ KVLD G  YVV+F   
Sbjct  85    LEQVDPQLIRPLPPQDSLKNGGVFQENEAIDASLRYGWWSGVVKKVLDRGARYVVFFDNP  144

Query  695   NEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKV  516
              + ++F    +R H +W+D  W              +P + ++ +G +     F  G +V
Sbjct  145   PDVLDFDAKDLRIHLDWVDGSW-------------VRPEMQQQATGSV-----FSSGTEV  186

Query  515   EVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQ  336
             EV  +++  +  W PA++++   +  +LV+ ++         +    D+L +RPS P   
Sbjct  187   EVNLEKDNVRDIWLPAVVIKENEDRTFLVKCQSSWNSDEAGTMKTIVDSLHIRPSPPHAD  246

Query  335   RVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWING  156
             R   +  LE VDA    GWR G + ++L G +Y V F+  NE  E     +R H EW++G
Sbjct  247   R--NYELLERVDAHYGIGWRSGVITKLLAGRRYNVFFKQGNEDRELSQSKIRPHMEWVDG  304

Query  155   AW  150
              W
Sbjct  305   KW  306


 Score =   100 bits (250),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 86/308 (28%), Positives = 134/308 (44%), Gaps = 52/308 (17%)
 Frame = -3

Query  1991  WFPAAVLR-PSVRKNQRAGQ----IYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPC  1827
             W+ A +L  P+  + Q A +      V+++TL ++D P     E V    +RP PP +  
Sbjct  44    WYLATILDFPTPSQTQSASEKKRKAIVQYKTLVTEDGPAPLL-EQVDPQLIRPLPPQDSL  102

Query  1826  CYFRVGESADVFYENR--------GWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQL  1671
                   ++  VF EN         GW  G V ++L+     V   D +  + +  +   L
Sbjct  103   ------KNGGVFQENEAIDASLRYGWWSGVVKKVLDRGARYVVFFD-NPPDVLDFDAKDL  155

Query  1670  RVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVRKFSKEMPV  1491
             R+H DW DG WV P        + QQ+ +                  GS    FS    V
Sbjct  156   RIHLDWVDGSWVRP--------EMQQQAT------------------GSV---FSSGTEV  186

Query  1490  EVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIH  1311
             EV  +K+     W  +VV++   +   LV+ Q     D    +   VD+  IRP PP   
Sbjct  187   EVNLEKDNVRDIWLPAVVIKENEDRTFLVKCQSSWNSDEAGTMKTIVDSLHIRPSPPHAD  246

Query  1310  RISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNN  1131
             R   ++LL++VDA  G GW  G ++K+L   +Y V F   NE      S +RPH EW + 
Sbjct  247   R--NYELLERVDAHYGIGWRSGVITKLLAGRRYNVFFKQGNEDRELSQSKIRPHMEWVDG  304

Query  1130  NWVAATKI  1107
              W++  ++
Sbjct  305   KWISKKEV  312


 Score = 61.2 bits (147),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 82/162 (51%), Gaps = 16/162 (10%)
 Frame = -3

Query  596  PNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNG--------  441
            P P+    R++     S   F  G +VEV  ++EG +G+WY A IL              
Sbjct  8    PQPQQNPQRKNQ---TSTVFFNKGEEVEVSSEQEGFRGAWYLATILDFPTPSQTQSASEK  64

Query  440  --KYLVEFRTLKCDFGTDLLVQEADALSVRPSAP--ILQRVDRFRPLEEVDAWSNNGWRV  273
              K +V+++TL  + G   L+++ D   +RP  P   L+    F+  E +DA    GW  
Sbjct  65   KRKAIVQYKTLVTEDGPAPLLEQVDPQLIRPLPPQDSLKNGGVFQENEAIDASLRYGWWS  124

Query  272  GQVCEVLE-GAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
            G V +VL+ GA+Y V F    ++L+F    LR+H +W++G+W
Sbjct  125  GVVKKVLDRGARYVVFFDNPPDVLDFDAKDLRIHLDWVDGSW  166



>ref|XP_009337627.1| PREDICTED: uncharacterized protein LOC103930067 [Pyrus x bretschneideri]
Length=178

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             F+KG  VE  S E+G+HG+W+ A I +++G +KFL+EYQ+LRT+D+S  L+E+ D  +IR
Sbjct  42    FTKGTPVEVCSDEDGFHGAWFAATIVEAVGGDKFLIEYQSLRTEDDSAFLREEIDTLHIR  101

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             P PP  +  + F + +EVDA YN+GWW G+ISKVL G +Y+VYF +T EEIEF    +R 
Sbjct  102   PNPPE-NAVEHFSLLQEVDALYNDGWWVGVISKVLSGSSYIVYFRSTYEEIEFQQSELRL  160

Query  656   HQEWIDKKWDIAFR  615
             HQ+WI  KW +  R
Sbjct  161   HQDWIGGKWVMPSR  174


 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIR  1332
             F+K  PVEV  D++GF  +W+A+ ++E +G  K L++YQ L+T+D + +L EE+D   IR
Sbjct  42    FTKGTPVEVCSDEDGFHGAWFAATIVEAVGGDKFLIEYQSLRTEDDSAFLREEIDTLHIR  101

Query  1331  PCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRP  1152
             P PPE + +  F LL +VDA   +GWW G +SKVL  + Y+V F S  E + F+ S+LR 
Sbjct  102   PNPPE-NAVEHFSLLQEVDALYNDGWWVGVISKVLSGSSYIVYFRSTYEEIEFQQSELRL  160

Query  1151  HQEWKNNNWVAATK  1110
             HQ+W    WV  ++
Sbjct  161   HQDWIGGKWVMPSR  174


 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 85/135 (63%), Gaps = 1/135 (1%)
 Frame = -3

Query  554  IASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEA  375
            I ++  F  G  VEV  DE+G  G+W+ A I+  +G  K+L+E+++L+ +  +  L +E 
Sbjct  36   IVTQENFTKGTPVEVCSDEDGFHGAWFAATIVEAVGGDKFLIEYQSLRTEDDSAFLREEI  95

Query  374  DALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFR  195
            D L +RP+ P    V+ F  L+EVDA  N+GW VG + +VL G+ Y V FR+T E +EF+
Sbjct  96   DTLHIRPNPP-ENAVEHFSLLQEVDALYNDGWWVGVISKVLSGSSYIVYFRSTYEEIEFQ  154

Query  194  HHGLRLHQEWINGAW  150
               LRLHQ+WI G W
Sbjct  155  QSELRLHQDWIGGKW  169


 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 71/146 (49%), Gaps = 11/146 (8%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEVLM-RDNF-PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             +  +  F KG  VEV    D F   WF A ++     +     +  +E+++L ++DD   
Sbjct  36    IVTQENFTKGTPVEVCSDEDGFHGAWFAATIV-----EAVGGDKFLIEYQSLRTEDDSAF  90

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDED  1707
              R+E   L  +RP PP     +F + +  D  Y N GW  G + ++L  S Y+V      
Sbjct  91    LREEIDTLH-IRPNPPENAVEHFSLLQEVDALY-NDGWWVGVISKVLSGSSYIVYF--RS  146

Query  1706  AVESVKVEQWQLRVHRDWKDGCWVPP  1629
               E ++ +Q +LR+H+DW  G WV P
Sbjct  147   TYEEIEFQQSELRLHQDWIGGKWVMP  172



>emb|CAN64022.1| hypothetical protein VITISV_005264 [Vitis vinifera]
Length=1348

 Score =   155 bits (392),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 106/325 (33%), Positives = 158/325 (49%), Gaps = 43/325 (13%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDL-KTDDGTDYLIEEVDASCIRPCPPE  1317
             VEV+ + +G   SWY + ++ +    + LV+YQDL    DG+  L E VD   +RP PP 
Sbjct  14    VEVRINNDGCRGSWYVAKII-MAEKSRALVEYQDLLDGKDGSRRLREVVDTLFLRPLPP-  71

Query  1316  IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWK  1137
             +   + F   D VD +  +GW  G V   + D+KY V F   N  +  + SDLR H+EW 
Sbjct  72    LETNASFGEYDIVDTFYHDGWCTG-VIICIKDSKYTVFFS--NNEIQVDRSDLRLHKEWV  128

Query  1136  N---NNWVAATKID-------------------------LPRSSSD--------VMLNsk  1065
             N   NN V   ++                           P   SD        + L   
Sbjct  129   NGKFNNLVKDMRLTWLNLVMDYLDLILFPYELCSLMLFFFPGGMSDPFFSESFALKLERL  188

Query  1064  vvkvkskSDRKALGPKFSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTD  885
             +   + +   +  G  FS G  VE T  E+    +W+ A++   IG   ++++ Q+L+  
Sbjct  189   LCXEEKEKGVRTTGLIFSPGAAVEVTLNEQSSRDAWFPAIVRREIGLGSYVVQCQSLKNS  248

Query  884   DESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYF  705
              E+  L    D  +IRP PP +    +F + E+VDA+Y+ GWW G+++KVL G  YVV+F
Sbjct  249   GEAGVLDVTVDNLHIRPSPPRLEG-RKFGLLEKVDAFYDYGWWNGIVTKVLTGRRYVVFF  307

Query  704   WTTNEEIEFAHHGIRPHQEWIDKKW  630
               TN E EF H  +RPH EW+D KW
Sbjct  308   KHTNMEKEFIHSDLRPHMEWVDGKW  332


 Score =   139 bits (349),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 107/331 (32%), Positives = 157/331 (47%), Gaps = 48/331 (15%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQ-TLRTDDESEPLKEKADAFNI  840
             F +G LVE     +G  GSWY A I  +   ++ L+EYQ  L   D S  L+E  D   +
Sbjct  8     FRQGSLVEVRINNDGCRGSWYVAKIIMA-EKSRALVEYQDLLDGKDGSRRLREVVDTLFL  66

Query  839   RPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIR  660
             RP PPL      F  ++ VD +Y++GW  G+I  + D   Y V+F  +N EI+     +R
Sbjct  67    RPLPPL-ETNASFGEYDIVDTFYHDGWCTGVIICIKDS-KYTVFF--SNNEIQVDRSDLR  122

Query  659   PHQEWIDKKWDIAFRKSNNNLPNPK---------------------PGIMR----RHSGG  555
              H+EW++ K++   +       N                       PG M       S  
Sbjct  123   LHKEWVNGKFNNLVKDMRLTWLNLVMDYLDLILFPYELCSLMLFFFPGGMSDPFFSESFA  182

Query  554   IASETTFCI----------------GAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEF  423
             +  E   C                 GA VEV  +E+ ++ +W+PA++ R IG G Y+V+ 
Sbjct  183   LKLERLLCXEEKEKGVRTTGLIFSPGAAVEVTLNEQSSRDAWFPAIVRREIGLGSYVVQC  242

Query  422   RTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGA  243
             ++LK      +L    D L +RPS P L+   +F  LE+VDA+ + GW  G V +VL G 
Sbjct  243   QSLKNSGEAGVLDVTVDNLHIRPSPPRLEG-RKFGLLEKVDAFYDYGWWNGIVTKVLTGR  301

Query  242   KYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             +Y V F+ TN   EF H  LR H EW++G W
Sbjct  302   RYVVFFKHTNMEKEFIHSDLRPHMEWVDGKW  332


 Score =   116 bits (291),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 100/355 (28%), Positives = 159/355 (45%), Gaps = 45/355 (13%)
 Frame = -3

Query  2042  FNKGDRVEVLMRDN--FPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYV  1869
             F +G  VEV + ++     W+ A ++   + +  RA    VE++ L    D  +R +E V
Sbjct  8     FRQGSLVEVRINNDGCRGSWYVAKII---MAEKSRA---LVEYQDLLDGKDGSRRLREVV  61

Query  1868  HLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVK  1689
                 +RP PP E    F   +  D FY + GW  G +   +++S Y V   + +    ++
Sbjct  62    DTLFLRPLPPLETNASFGEYDIVDTFYHD-GWCTGVII-CIKDSKYTVFFSNNE----IQ  115

Query  1688  VEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGV---------------  1554
             V++  LR+H++W +G +   +++ ++          D ++ P  +               
Sbjct  116   VDRSDLRLHKEWVNGKFNNLVKDMRLTWLNLVMDYLDLILFPYELCSLMLFFFPGGMSDP  175

Query  1553  ----KLRIKCTRGSCVRK-----------FSKEMPVEVKGDKEGFERSWYASVVMEVLGN  1419
                    +K  R  C  +           FS    VEV  +++    +W+ ++V   +G 
Sbjct  176   FFSESFALKLERLLCXEEKEKGVRTTGLIFSPGAAVEVTLNEQSSRDAWFPAIVRREIGL  235

Query  1418  GKLLVQYQDLKTDDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHV  1239
             G  +VQ Q LK       L   VD   IRP PP +     F LL+KVDA+   GWW G V
Sbjct  236   GSYVVQCQSLKNSGEAGVLDVTVDNLHIRPSPPRLEG-RKFGLLEKVDAFYDYGWWNGIV  294

Query  1238  SKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVML  1074
             +KVL   +Y+V F   N    F  SDLRPH EW +  WV AT+  L  + SD  L
Sbjct  295   TKVLTGRRYVVFFKHTNMEKEFIHSDLRPHMEWVDGKWVGATQEVLGTTYSDEQL  349


 Score =   108 bits (270),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 86/133 (65%), Gaps = 6/133 (5%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIG--PNKFLLEYQTLRTD-DESEPLKEKADAF  846
               KG  VE +S EEG  GSWYTA +   +     K  +EY TL ++ D+S+PL+E  DA 
Sbjct  1209  LKKGEKVEVSSEEEGLRGSWYTATVLRPVTKKTKKIYVEYHTLMSEEDDSKPLRESVDAI  1268

Query  845   NIRPCPPL-IHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHH  669
              +RP PP  + R  RFK+ EEVDA+Y++GWWEG++++VL+   Y V+F T+ E+I+F   
Sbjct  1269  LVRPYPPREVGR--RFKLMEEVDAFYSDGWWEGVVTQVLENSRYSVFFRTSREQIDFHQV  1326

Query  668   GIRPHQEWIDKKW  630
              +R H+EW+   W
Sbjct  1327  DLRLHREWVRGNW  1339


 Score =   100 bits (248),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 73/126 (58%), Gaps = 6/126 (5%)
 Frame = -3

Query  1991  WFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHLSAVRPAPPGEPCCYFRV  1812
             W+ A VLRP  +K ++   IYVE+ TL S++D  K  +E V    VRP PP E    F++
Sbjct  1228  WYTATVLRPVTKKTKK---IYVEYHTLMSEEDDSKPLRESVDAILVRPYPPREVGRRFKL  1284

Query  1811  GESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVP  1632
              E  D FY + GW  G V ++LENS Y V      + E +   Q  LR+HR+W  G WVP
Sbjct  1285  MEEVDAFYSD-GWWEGVVTQVLENSRYSVFF--RTSREQIDFHQVDLRLHREWVRGNWVP  1341

Query  1631  PLEESQ  1614
             PLEESQ
Sbjct  1342  PLEESQ  1347


 Score = 87.8 bits (216),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 72/120 (60%), Gaps = 6/120 (5%)
 Frame = -3

Query  1469  GFERSWYASVVMEVLG--NGKLLVQYQDLKTD-DGTDYLIEEVDASCIRPCPP-EIHRIS  1302
             G   SWY + V+  +     K+ V+Y  L ++ D +  L E VDA  +RP PP E+ R  
Sbjct  1223  GLRGSWYTATVLRPVTKKTKKIYVEYHTLMSEEDDSKPLRESVDAILVRPYPPREVGR--  1280

Query  1301  PFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRPHQEWKNNNWV  1122
              FKL+++VDA+  +GWWEG V++VL +++Y V F +  E + F   DLR H+EW   NWV
Sbjct  1281  RFKLMEEVDAFYSDGWWEGVVTQVLENSRYSVFFRTSREQIDFHQVDLRLHREWVRGNWV  1340


 Score = 84.0 bits (206),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 72/118 (61%), Gaps = 4/118 (3%)
 Frame = -3

Query  494   GNQGSWYPALILRLIG--NGKYLVEFRTLKCDFGTDLLVQEA-DALSVRPSAPILQRVDR  324
             G +GSWY A +LR +     K  VE+ TL  +      ++E+ DA+ VRP  P  +   R
Sbjct  1223  GLRGSWYTATVLRPVTKKTKKIYVEYHTLMSEEDDSKPLRESVDAILVRPYPP-REVGRR  1281

Query  323   FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             F+ +EEVDA+ ++GW  G V +VLE ++Y V FRT+ E ++F    LRLH+EW+ G W
Sbjct  1282  FKLMEEVDAFYSDGWWEGVVTQVLENSRYSVFFRTSREQIDFHQVDLRLHREWVRGNW  1339



>ref|XP_004302288.1| PREDICTED: uncharacterized protein LOC101303819 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=166

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             F+KG LVE +S EEG+HGSW+ A +  S+G + FL+EY+ LRT+D+S  L+E+ D  +IR
Sbjct  30    FTKGALVEVSSDEEGFHGSWFAATVVKSMGKDGFLVEYKCLRTEDDSAFLREEVDNMHIR  89

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             P PP  +  D FK  +EVDA +N+GWW G++SKVL G  Y+VYF  T EE+E+ H  +R 
Sbjct  90    PHPPE-NVVDCFKKLDEVDALHNDGWWVGVVSKVLRGSRYIVYFRETCEELEYHHSELRL  148

Query  656   HQEWIDKKWDI  624
             HQ+WID KW I
Sbjct  149   HQDWIDGKWVI  159


 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 86/135 (64%), Gaps = 1/135 (1%)
 Frame = -3

Query  554  IASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEA  375
            I S+  F  GA VEV  DEEG  GSW+ A +++ +G   +LVE++ L+ +  +  L +E 
Sbjct  24   IVSDGYFTKGALVEVSSDEEGFHGSWFAATVVKSMGKDGFLVEYKCLRTEDDSAFLREEV  83

Query  374  DALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFR  195
            D + +RP  P    VD F+ L+EVDA  N+GW VG V +VL G++Y V FR T E LE+ 
Sbjct  84   DNMHIRPHPP-ENVVDCFKKLDEVDALHNDGWWVGVVSKVLRGSRYIVYFRETCEELEYH  142

Query  194  HHGLRLHQEWINGAW  150
            H  LRLHQ+WI+G W
Sbjct  143  HSELRLHQDWIDGKW  157


 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIR  1332
             F+K   VEV  D+EGF  SW+A+ V++ +G    LV+Y+ L+T+D + +L EEVD   IR
Sbjct  30    FTKGALVEVSSDEEGFHGSWFAATVVKSMGKDGFLVEYKCLRTEDDSAFLREEVDNMHIR  89

Query  1331  PCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRP  1152
             P PPE + +  FK LD+VDA   +GWW G VSKVL  ++Y+V F    E L +  S+LR 
Sbjct  90    PHPPE-NVVDCFKKLDEVDALHNDGWWVGVVSKVLRGSRYIVYFRETCEELEYHHSELRL  148

Query  1151  HQEWKNNNWVAATK  1110
             HQ+W +  WV  ++
Sbjct  149   HQDWIDGKWVIPSQ  162


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 77/159 (48%), Gaps = 11/159 (7%)
 Frame = -3

Query  2081  DVPETHAMSAEAQFNKGDRVEVLMRDN--FPIWFPAAVLRPSVRKNQRAGQIYVEFETLC  1908
             DV E   + ++  F KG  VEV   +      WF A V+     K+       VE++ L 
Sbjct  17    DVGENDPIVSDGYFTKGALVEVSSDEEGFHGSWFAATVV-----KSMGKDGFLVEYKCLR  71

Query  1907  SDDDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYM  1728
             ++DD    R+E  ++  +RP PP      F+  +  D  + N GW  G V ++L  S Y+
Sbjct  72    TEDDSAFLREEVDNMH-IRPHPPENVVDCFKKLDEVDALH-NDGWWVGVVSKVLRGSRYI  129

Query  1727  VALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQV  1611
             V     +  E ++    +LR+H+DW DG WV P +E ++
Sbjct  130   VYF--RETCEELEYHHSELRLHQDWIDGKWVIPSQELKL  166



>ref|XP_010544951.1| PREDICTED: uncharacterized protein LOC104817448 isoform X1 [Tarenaya 
hassleriana]
Length=827

 Score =   154 bits (388),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 147/295 (50%), Gaps = 26/295 (9%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK---FLLEYQTLRTDDESEPLKEKADAF  846
              +KG  VE +S E+G+ GS Y AV+ ++   +K     + Y TL  DD+  PL+E  D  
Sbjct  12    IAKGSTVEVSSDEDGFKGSLYVAVLEETPSKSKRKKLSVRYSTLLADDDFTPLRETVDPR  71

Query  845   NIRPCPP--LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
              IRP PP  ++   ++F+  + VDA Y +GWW G++ K+L+G  YV+YF    + IEF  
Sbjct  72    FIRPVPPADIVAAVEKFEEGDVVDASYRDGWWTGVVMKILEGGRYVIYFDNPPDVIEFEG  131

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
               +R H +WI   W                    R       ++ F  G  VE++ D E 
Sbjct  132   KDLRAHFDWIHGNWT-------------------RIEKQQLKKSAFSCGTTVEMRPDSED  172

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTD-LLVQEADALSVRPSAPILQRVDRFRP  315
                 W PA+I++    G + V+ ++L      + +++   D+  +RP+ P+  +   +  
Sbjct  173   LCDFWIPAVIIKENEGGTFHVKHKSLTKGVDAESMILSVVDSRCIRPT-PMPCKDREYAL  231

Query  314   LEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             LE VD     GWR G +  VL G  Y V F++TNE  +F H  LR   EW +G+W
Sbjct  232   LELVDVCHVRGWREGVITRVLAGKTYTVFFKSTNESFDFNHSDLRPSLEWKDGSW  286


 Score =   142 bits (358),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 98/303 (32%), Positives = 141/303 (47%), Gaps = 33/303 (11%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK---LLVQYQDLKTDDGTDYLIEEVDAS  1341
              +K   VEV  D++GF+ S Y +V+ E     K   L V+Y  L  DD    L E VD  
Sbjct  12    IAKGSTVEVSSDEDGFKGSLYVAVLEETPSKSKRKKLSVRYSTLLADDDFTPLRETVDPR  71

Query  1340  CIRPCPPE--IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEA  1167
              IRP PP   +  +  F+  D VDA   +GWW G V K+L   +Y++ F +  +++ FE 
Sbjct  72    FIRPVPPADIVAAVEKFEEGDVVDASYRDGWWTGVVMKILEGGRYVIYFDNPPDVIEFEG  131

Query  1166  SDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEAT  987
              DLR H +W + NW    K  L +S+                        FS G  VE  
Sbjct  132   KDLRAHFDWIHGNWTRIEKQQLKKSA------------------------FSCGTTVEMR  167

Query  986   SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPL-KEKADAFNIRPCP-PLIHR  813
                E     W  AVI        F +++++L    ++E +     D+  IRP P P   R
Sbjct  168   PDSEDLCDFWIPAVIIKENEGGTFHVKHKSLTKGVDAESMILSVVDSRCIRPTPMPCKDR  227

Query  812   FDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKK  633
                + + E VD  +  GW EG+I++VL G  Y V+F +TNE  +F H  +RP  EW D  
Sbjct  228   --EYALLELVDVCHVRGWREGVITRVLAGKTYTVFFKSTNESFDFNHSDLRPSLEWKDGS  285

Query  632   WDI  624
             W +
Sbjct  286   WQM  288


 Score =   113 bits (282),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 101/321 (31%), Positives = 146/321 (45%), Gaps = 47/321 (15%)
 Frame = -3

Query  2036  KGDRVEVLM-RDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDD--PMKRRKEYVH  1866
             KG  VEV    D F      AVL  +  K++R  ++ V + TL +DDD  P++   E V 
Sbjct  14    KGSTVEVSSDEDGFKGSLYVAVLEETPSKSKRK-KLSVRYSTLLADDDFTPLR---ETVD  69

Query  1865  LSAVRPAPPGEPCCY---FRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVES  1695
                +RP PP +       F  G+  D  Y + GW  G V +ILE   Y++   +   V  
Sbjct  70    PRFIRPVPPADIVAAVEKFEEGDVVDASYRD-GWWTGVVMKILEGGRYVIYFDNPPDV--  126

Query  1694  VKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVR  1515
             ++ E   LR H DW  G W      +++++Q Q KKS                       
Sbjct  127   IEFEGKDLRAHFDWIHGNW------TRIEKQ-QLKKS-----------------------  156

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDL-KTDDGTDYLIEEVDASC  1338
              FS    VE++ D E     W  +V+++    G   V+++ L K  D    ++  VD+ C
Sbjct  157   AFSCGTTVEMRPDSEDLCDFWIPAVIIKENEGGTFHVKHKSLTKGVDAESMILSVVDSRC  216

Query  1337  IRPCP-PEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
             IRP P P   R   + LL+ VD     GW EG +++VL    Y V F S NE   F  SD
Sbjct  217   IRPTPMPCKDR--EYALLELVDVCHVRGWREGVITRVLAGKTYTVFFKSTNESFDFNHSD  274

Query  1160  LRPHQEWKNNNWVAATKIDLP  1098
             LRP  EWK+ +W    K+ +P
Sbjct  275   LRPSLEWKDGSWQMEPKLSIP  295



>ref|XP_010544954.1| PREDICTED: uncharacterized protein LOC104817448 isoform X2 [Tarenaya 
hassleriana]
Length=826

 Score =   154 bits (388),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 147/295 (50%), Gaps = 26/295 (9%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK---FLLEYQTLRTDDESEPLKEKADAF  846
              +KG  VE +S E+G+ GS Y AV+ ++   +K     + Y TL  DD+  PL+E  D  
Sbjct  12    IAKGSTVEVSSDEDGFKGSLYVAVLEETPSKSKRKKLSVRYSTLLADDDFTPLRETVDPR  71

Query  845   NIRPCPP--LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
              IRP PP  ++   ++F+  + VDA Y +GWW G++ K+L+G  YV+YF    + IEF  
Sbjct  72    FIRPVPPADIVAAVEKFEEGDVVDASYRDGWWTGVVMKILEGGRYVIYFDNPPDVIEFEG  131

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
               +R H +WI   W                    R       ++ F  G  VE++ D E 
Sbjct  132   KDLRAHFDWIHGNWT-------------------RIEKQQLKKSAFSCGTTVEMRPDSED  172

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTD-LLVQEADALSVRPSAPILQRVDRFRP  315
                 W PA+I++    G + V+ ++L      + +++   D+  +RP+ P+  +   +  
Sbjct  173   LCDFWIPAVIIKENEGGTFHVKHKSLTKGVDAESMILSVVDSRCIRPT-PMPCKDREYAL  231

Query  314   LEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             LE VD     GWR G +  VL G  Y V F++TNE  +F H  LR   EW +G+W
Sbjct  232   LELVDVCHVRGWREGVITRVLAGKTYTVFFKSTNESFDFNHSDLRPSLEWKDGSW  286


 Score =   142 bits (358),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 98/303 (32%), Positives = 141/303 (47%), Gaps = 33/303 (11%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK---LLVQYQDLKTDDGTDYLIEEVDAS  1341
              +K   VEV  D++GF+ S Y +V+ E     K   L V+Y  L  DD    L E VD  
Sbjct  12    IAKGSTVEVSSDEDGFKGSLYVAVLEETPSKSKRKKLSVRYSTLLADDDFTPLRETVDPR  71

Query  1340  CIRPCPPE--IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEA  1167
              IRP PP   +  +  F+  D VDA   +GWW G V K+L   +Y++ F +  +++ FE 
Sbjct  72    FIRPVPPADIVAAVEKFEEGDVVDASYRDGWWTGVVMKILEGGRYVIYFDNPPDVIEFEG  131

Query  1166  SDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEAT  987
              DLR H +W + NW    K  L +S+                        FS G  VE  
Sbjct  132   KDLRAHFDWIHGNWTRIEKQQLKKSA------------------------FSCGTTVEMR  167

Query  986   SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPL-KEKADAFNIRPCP-PLIHR  813
                E     W  AVI        F +++++L    ++E +     D+  IRP P P   R
Sbjct  168   PDSEDLCDFWIPAVIIKENEGGTFHVKHKSLTKGVDAESMILSVVDSRCIRPTPMPCKDR  227

Query  812   FDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKK  633
                + + E VD  +  GW EG+I++VL G  Y V+F +TNE  +F H  +RP  EW D  
Sbjct  228   --EYALLELVDVCHVRGWREGVITRVLAGKTYTVFFKSTNESFDFNHSDLRPSLEWKDGS  285

Query  632   WDI  624
             W +
Sbjct  286   WQM  288


 Score =   113 bits (282),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 101/321 (31%), Positives = 146/321 (45%), Gaps = 47/321 (15%)
 Frame = -3

Query  2036  KGDRVEVLM-RDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDD--PMKRRKEYVH  1866
             KG  VEV    D F      AVL  +  K++R  ++ V + TL +DDD  P++   E V 
Sbjct  14    KGSTVEVSSDEDGFKGSLYVAVLEETPSKSKRK-KLSVRYSTLLADDDFTPLR---ETVD  69

Query  1865  LSAVRPAPPGEPCCY---FRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVES  1695
                +RP PP +       F  G+  D  Y + GW  G V +ILE   Y++   +   V  
Sbjct  70    PRFIRPVPPADIVAAVEKFEEGDVVDASYRD-GWWTGVVMKILEGGRYVIYFDNPPDV--  126

Query  1694  VKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVR  1515
             ++ E   LR H DW  G W      +++++Q Q KKS                       
Sbjct  127   IEFEGKDLRAHFDWIHGNW------TRIEKQ-QLKKS-----------------------  156

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDL-KTDDGTDYLIEEVDASC  1338
              FS    VE++ D E     W  +V+++    G   V+++ L K  D    ++  VD+ C
Sbjct  157   AFSCGTTVEMRPDSEDLCDFWIPAVIIKENEGGTFHVKHKSLTKGVDAESMILSVVDSRC  216

Query  1337  IRPCP-PEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
             IRP P P   R   + LL+ VD     GW EG +++VL    Y V F S NE   F  SD
Sbjct  217   IRPTPMPCKDR--EYALLELVDVCHVRGWREGVITRVLAGKTYTVFFKSTNESFDFNHSD  274

Query  1160  LRPHQEWKNNNWVAATKIDLP  1098
             LRP  EWK+ +W    K+ +P
Sbjct  275   LRPSLEWKDGSWQMEPKLSIP  295



>ref|XP_010544955.1| PREDICTED: uncharacterized protein LOC104817448 isoform X3 [Tarenaya 
hassleriana]
Length=813

 Score =   153 bits (387),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 147/295 (50%), Gaps = 26/295 (9%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNK---FLLEYQTLRTDDESEPLKEKADAF  846
              +KG  VE +S E+G+ GS Y AV+ ++   +K     + Y TL  DD+  PL+E  D  
Sbjct  12    IAKGSTVEVSSDEDGFKGSLYVAVLEETPSKSKRKKLSVRYSTLLADDDFTPLRETVDPR  71

Query  845   NIRPCPP--LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
              IRP PP  ++   ++F+  + VDA Y +GWW G++ K+L+G  YV+YF    + IEF  
Sbjct  72    FIRPVPPADIVAAVEKFEEGDVVDASYRDGWWTGVVMKILEGGRYVIYFDNPPDVIEFEG  131

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
               +R H +WI   W                    R       ++ F  G  VE++ D E 
Sbjct  132   KDLRAHFDWIHGNWT-------------------RIEKQQLKKSAFSCGTTVEMRPDSED  172

Query  491   NQGSWYPALILRLIGNGKYLVEFRTL-KCDFGTDLLVQEADALSVRPSAPILQRVDRFRP  315
                 W PA+I++    G + V+ ++L K      +++   D+  +RP+ P+  +   +  
Sbjct  173   LCDFWIPAVIIKENEGGTFHVKHKSLTKGVDAESMILSVVDSRCIRPT-PMPCKDREYAL  231

Query  314   LEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
             LE VD     GWR G +  VL G  Y V F++TNE  +F H  LR   EW +G+W
Sbjct  232   LELVDVCHVRGWREGVITRVLAGKTYTVFFKSTNESFDFNHSDLRPSLEWKDGSW  286


 Score =   142 bits (357),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 98/303 (32%), Positives = 141/303 (47%), Gaps = 33/303 (11%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGK---LLVQYQDLKTDDGTDYLIEEVDAS  1341
              +K   VEV  D++GF+ S Y +V+ E     K   L V+Y  L  DD    L E VD  
Sbjct  12    IAKGSTVEVSSDEDGFKGSLYVAVLEETPSKSKRKKLSVRYSTLLADDDFTPLRETVDPR  71

Query  1340  CIRPCPPE--IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEA  1167
              IRP PP   +  +  F+  D VDA   +GWW G V K+L   +Y++ F +  +++ FE 
Sbjct  72    FIRPVPPADIVAAVEKFEEGDVVDASYRDGWWTGVVMKILEGGRYVIYFDNPPDVIEFEG  131

Query  1166  SDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEAT  987
              DLR H +W + NW    K  L +S+                        FS G  VE  
Sbjct  132   KDLRAHFDWIHGNWTRIEKQQLKKSA------------------------FSCGTTVEMR  167

Query  986   SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPL-KEKADAFNIRPCP-PLIHR  813
                E     W  AVI        F +++++L    ++E +     D+  IRP P P   R
Sbjct  168   PDSEDLCDFWIPAVIIKENEGGTFHVKHKSLTKGVDAESMILSVVDSRCIRPTPMPCKDR  227

Query  812   FDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKK  633
                + + E VD  +  GW EG+I++VL G  Y V+F +TNE  +F H  +RP  EW D  
Sbjct  228   --EYALLELVDVCHVRGWREGVITRVLAGKTYTVFFKSTNESFDFNHSDLRPSLEWKDGS  285

Query  632   WDI  624
             W +
Sbjct  286   WQM  288


 Score =   113 bits (282),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 101/321 (31%), Positives = 146/321 (45%), Gaps = 47/321 (15%)
 Frame = -3

Query  2036  KGDRVEVLM-RDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDD--PMKRRKEYVH  1866
             KG  VEV    D F      AVL  +  K++R  ++ V + TL +DDD  P++   E V 
Sbjct  14    KGSTVEVSSDEDGFKGSLYVAVLEETPSKSKRK-KLSVRYSTLLADDDFTPLR---ETVD  69

Query  1865  LSAVRPAPPGEPCCY---FRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVES  1695
                +RP PP +       F  G+  D  Y + GW  G V +ILE   Y++   +   V  
Sbjct  70    PRFIRPVPPADIVAAVEKFEEGDVVDASYRD-GWWTGVVMKILEGGRYVIYFDNPPDV--  126

Query  1694  VKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRGSCVR  1515
             ++ E   LR H DW  G W      +++++Q Q KKS                       
Sbjct  127   IEFEGKDLRAHFDWIHGNW------TRIEKQ-QLKKS-----------------------  156

Query  1514  KFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDL-KTDDGTDYLIEEVDASC  1338
              FS    VE++ D E     W  +V+++    G   V+++ L K  D    ++  VD+ C
Sbjct  157   AFSCGTTVEMRPDSEDLCDFWIPAVIIKENEGGTFHVKHKSLTKGVDAESMILSVVDSRC  216

Query  1337  IRPCP-PEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
             IRP P P   R   + LL+ VD     GW EG +++VL    Y V F S NE   F  SD
Sbjct  217   IRPTPMPCKDR--EYALLELVDVCHVRGWREGVITRVLAGKTYTVFFKSTNESFDFNHSD  274

Query  1160  LRPHQEWKNNNWVAATKIDLP  1098
             LRP  EWK+ +W    K+ +P
Sbjct  275   LRPSLEWKDGSWQMEPKLSIP  295



>ref|XP_010523907.1| PREDICTED: uncharacterized protein LOC104802141 isoform X2 [Tarenaya 
hassleriana]
Length=770

 Score =   152 bits (385),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 98/301 (33%), Positives = 145/301 (48%), Gaps = 30/301 (10%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEV---LGNGKLLVQYQDLKTDDGTDYLIEEVDAS  1341
              +K   VEV  D+EGF+ +WY +++ E        KLLV+Y  L  DDG   L E VD  
Sbjct  54    ITKGSVVEVSSDEEGFKGAWYRALLEETPLKSRRKKLLVRYLTLLKDDGLTPLHEAVDLG  113

Query  1340  CIRPCPPEIHRIS--PFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEA  1167
              IRP PPE   +S   F   D VDA   +GWW G V KVL D +Y+V F +  +++ F+ 
Sbjct  114   FIRPLPPEDVVVSGESFDEGDVVDASYRDGWWTGVVRKVLEDGRYIVYFDNPPDVIEFDG  173

Query  1166  SDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEAT  987
             + LR H +W N  W  A K  L +S+                        F  G  VE  
Sbjct  174   THLRAHFDWINGKWARAAKQQLEKSA------------------------FCSGTAVELR  209

Query  986   SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFD  807
             +  E     W  AV+          ++Y+TLR  D++E  +   ++  IRP  PL  +  
Sbjct  210   TETEHLRDVWVGAVVIKENEVGTVYVKYRTLRNGDDAESRRADVESSKIRPT-PLPCKDR  268

Query  806   RFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWD  627
              + + E+VD  +  GW EG+I++++ G  Y V+F  T E  +F    +RP  +W   KW+
Sbjct  269   EYMILEKVDVRHESGWREGVITRIMAGNIYKVFFRRTKESFDFTESDLRPSMKWNGGKWE  328

Query  626   I  624
             +
Sbjct  329   M  329


 Score =   147 bits (371),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 149/296 (50%), Gaps = 29/296 (10%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPN---KFLLEYQTLRTDDESEPLKEKADAF  846
              +KG +VE +S EEG+ G+WY A++ ++   +   K L+ Y TL  DD   PL E  D  
Sbjct  54    ITKGSVVEVSSDEEGFKGAWYRALLEETPLKSRRKKLLVRYLTLLKDDGLTPLHEAVDLG  113

Query  845   NIRPCPP--LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
              IRP PP  ++   + F   + VDA Y +GWW G++ KVL+   Y+VYF    + IEF  
Sbjct  114   FIRPLPPEDVVVSGESFDEGDVVDASYRDGWWTGVVRKVLEDGRYIVYFDNPPDVIEFDG  173

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
               +R H +WI+ KW  A ++                      ++ FC G  VE++ + E 
Sbjct  174   THLRAHFDWINGKWARAAKQQ-------------------LEKSAFCSGTAVELRTETEH  214

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALS--VRPSAPILQRVDRFR  318
              +  W  A++++    G   V++RTL+   G D   + AD  S  +RP+ P+  +   + 
Sbjct  215   LRDVWVGAVVIKENEVGTVYVKYRTLRN--GDDAESRRADVESSKIRPT-PLPCKDREYM  271

Query  317   PLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              LE+VD    +GWR G +  ++ G  Y+V FR T E  +F    LR   +W  G W
Sbjct  272   ILEKVDVRHESGWREGVITRIMAGNIYKVFFRRTKESFDFTESDLRPSMKWNGGKW  327


 Score = 94.7 bits (234),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 88/327 (27%), Positives = 143/327 (44%), Gaps = 42/327 (13%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLM-RDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRK  1878
             A+    KG  VEV    + F   +  A+L  +  K++R  ++ V + TL  DD  +    
Sbjct  50    AKCGITKGSVVEVSSDEEGFKGAWYRALLEETPLKSRRK-KLLVRYLTLLKDDG-LTPLH  107

Query  1877  EYVHLSAVRPAPPGEPCCY---FRVGESADVFYENRGWRRGTVDEILENSMYMVALGDED  1707
             E V L  +RP PP +       F  G+  D  Y + GW  G V ++LE+  Y+V   +  
Sbjct  108   EAVDLGFIRPLPPEDVVVSGESFDEGDVVDASYRD-GWWTGVVRKVLEDGRYIVYFDNPP  166

Query  1706  AVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRG  1527
              V  ++ +   LR H DW +G W      ++  +Q  +K +                   
Sbjct  167   DV--IEFDGTHLRAHFDWINGKW------ARAAKQQLEKSA-------------------  199

Query  1526  SCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVD  1347
                  F     VE++ + E     W  +VV++    G + V+Y+ L+  D  +    +V+
Sbjct  200   -----FCSGTAVELRTETEHLRDVWVGAVVIKENEVGTVYVKYRTLRNGDDAESRRADVE  254

Query  1346  ASCIRPCP-PEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFE  1170
             +S IRP P P   R   + +L+KVD    +GW EG +++++    Y V F    E   F 
Sbjct  255   SSKIRPTPLPCKDR--EYMILEKVDVRHESGWREGVITRIMAGNIYKVFFRRTKESFDFT  312

Query  1169  ASDLRPHQEWKNNNWVAATKIDLPRSS  1089
              SDLRP  +W    W    K+D   S+
Sbjct  313   ESDLRPSMKWNGGKWEMEPKLDTAMSN  339


 Score = 73.2 bits (178),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 75/153 (49%), Gaps = 10/153 (7%)
 Frame = -3

Query  578  IMRRHSGGIASETTFCI-----GAKVEVKDDEEGNQGSWYPALILRL---IGNGKYLVEF  423
            +  R +G + SET         G+ VEV  DEEG +G+WY AL+          K LV +
Sbjct  35   VRERTAGEMLSETELAKCGITKGSVVEVSSDEEGFKGAWYRALLEETPLKSRRKKLLVRY  94

Query  422  RTLKCDFGTDLLVQEADALSVRPSAP--ILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLE  249
             TL  D G   L +  D   +RP  P  ++   + F   + VDA   +GW  G V +VLE
Sbjct  95   LTLLKDDGLTPLHEAVDLGFIRPLPPEDVVVSGESFDEGDVVDASYRDGWWTGVVRKVLE  154

Query  248  GAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              +Y V F    +++EF    LR H +WING W
Sbjct  155  DGRYIVYFDNPPDVIEFDGTHLRAHFDWINGKW  187



>ref|XP_010523906.1| PREDICTED: uncharacterized protein LOC104802141 isoform X1 [Tarenaya 
hassleriana]
Length=762

 Score =   152 bits (384),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 98/301 (33%), Positives = 145/301 (48%), Gaps = 30/301 (10%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEV---LGNGKLLVQYQDLKTDDGTDYLIEEVDAS  1341
              +K   VEV  D+EGF+ +WY +++ E        KLLV+Y  L  DDG   L E VD  
Sbjct  12    ITKGSVVEVSSDEEGFKGAWYRALLEETPLKSRRKKLLVRYLTLLKDDGLTPLHEAVDLG  71

Query  1340  CIRPCPPEIHRIS--PFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEA  1167
              IRP PPE   +S   F   D VDA   +GWW G V KVL D +Y+V F +  +++ F+ 
Sbjct  72    FIRPLPPEDVVVSGESFDEGDVVDASYRDGWWTGVVRKVLEDGRYIVYFDNPPDVIEFDG  131

Query  1166  SDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEAT  987
             + LR H +W N  W  A K  L +S+                        F  G  VE  
Sbjct  132   THLRAHFDWINGKWARAAKQQLEKSA------------------------FCSGTAVELR  167

Query  986   SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFD  807
             +  E     W  AV+          ++Y+TLR  D++E  +   ++  IRP  PL  +  
Sbjct  168   TETEHLRDVWVGAVVIKENEVGTVYVKYRTLRNGDDAESRRADVESSKIRPT-PLPCKDR  226

Query  806   RFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWD  627
              + + E+VD  +  GW EG+I++++ G  Y V+F  T E  +F    +RP  +W   KW+
Sbjct  227   EYMILEKVDVRHESGWREGVITRIMAGNIYKVFFRRTKESFDFTESDLRPSMKWNGGKWE  286

Query  626   I  624
             +
Sbjct  287   M  287


 Score =   147 bits (370),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 149/296 (50%), Gaps = 29/296 (10%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPN---KFLLEYQTLRTDDESEPLKEKADAF  846
              +KG +VE +S EEG+ G+WY A++ ++   +   K L+ Y TL  DD   PL E  D  
Sbjct  12    ITKGSVVEVSSDEEGFKGAWYRALLEETPLKSRRKKLLVRYLTLLKDDGLTPLHEAVDLG  71

Query  845   NIRPCPP--LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
              IRP PP  ++   + F   + VDA Y +GWW G++ KVL+   Y+VYF    + IEF  
Sbjct  72    FIRPLPPEDVVVSGESFDEGDVVDASYRDGWWTGVVRKVLEDGRYIVYFDNPPDVIEFDG  131

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
               +R H +WI+ KW  A ++                      ++ FC G  VE++ + E 
Sbjct  132   THLRAHFDWINGKWARAAKQQ-------------------LEKSAFCSGTAVELRTETEH  172

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALS--VRPSAPILQRVDRFR  318
              +  W  A++++    G   V++RTL+   G D   + AD  S  +RP+ P+  +   + 
Sbjct  173   LRDVWVGAVVIKENEVGTVYVKYRTLRN--GDDAESRRADVESSKIRPT-PLPCKDREYM  229

Query  317   PLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              LE+VD    +GWR G +  ++ G  Y+V FR T E  +F    LR   +W  G W
Sbjct  230   ILEKVDVRHESGWREGVITRIMAGNIYKVFFRRTKESFDFTESDLRPSMKWNGGKW  285


 Score = 94.0 bits (232),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 88/327 (27%), Positives = 143/327 (44%), Gaps = 42/327 (13%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLM-RDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRK  1878
             A+    KG  VEV    + F   +  A+L  +  K++R  ++ V + TL  DD  +    
Sbjct  8     AKCGITKGSVVEVSSDEEGFKGAWYRALLEETPLKSRRK-KLLVRYLTLLKDDG-LTPLH  65

Query  1877  EYVHLSAVRPAPPGEPCCY---FRVGESADVFYENRGWRRGTVDEILENSMYMVALGDED  1707
             E V L  +RP PP +       F  G+  D  Y + GW  G V ++LE+  Y+V   +  
Sbjct  66    EAVDLGFIRPLPPEDVVVSGESFDEGDVVDASYRD-GWWTGVVRKVLEDGRYIVYFDNPP  124

Query  1706  AVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRG  1527
              V  ++ +   LR H DW +G W      ++  +Q  +K +                   
Sbjct  125   DV--IEFDGTHLRAHFDWINGKW------ARAAKQQLEKSA-------------------  157

Query  1526  SCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVD  1347
                  F     VE++ + E     W  +VV++    G + V+Y+ L+  D  +    +V+
Sbjct  158   -----FCSGTAVELRTETEHLRDVWVGAVVIKENEVGTVYVKYRTLRNGDDAESRRADVE  212

Query  1346  ASCIRPCP-PEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFE  1170
             +S IRP P P   R   + +L+KVD    +GW EG +++++    Y V F    E   F 
Sbjct  213   SSKIRPTPLPCKDR--EYMILEKVDVRHESGWREGVITRIMAGNIYKVFFRRTKESFDFT  270

Query  1169  ASDLRPHQEWKNNNWVAATKIDLPRSS  1089
              SDLRP  +W    W    K+D   S+
Sbjct  271   ESDLRPSMKWNGGKWEMEPKLDTAMSN  297



>ref|XP_010523908.1| PREDICTED: uncharacterized protein LOC104802141 isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010523909.1| PREDICTED: uncharacterized protein LOC104802141 isoform X3 [Tarenaya 
hassleriana]
Length=763

 Score =   152 bits (384),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 98/301 (33%), Positives = 145/301 (48%), Gaps = 30/301 (10%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEV---LGNGKLLVQYQDLKTDDGTDYLIEEVDAS  1341
              +K   VEV  D+EGF+ +WY +++ E        KLLV+Y  L  DDG   L E VD  
Sbjct  12    ITKGSVVEVSSDEEGFKGAWYRALLEETPLKSRRKKLLVRYLTLLKDDGLTPLHEAVDLG  71

Query  1340  CIRPCPPEIHRIS--PFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEA  1167
              IRP PPE   +S   F   D VDA   +GWW G V KVL D +Y+V F +  +++ F+ 
Sbjct  72    FIRPLPPEDVVVSGESFDEGDVVDASYRDGWWTGVVRKVLEDGRYIVYFDNPPDVIEFDG  131

Query  1166  SDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEAT  987
             + LR H +W N  W  A K  L +S+                        F  G  VE  
Sbjct  132   THLRAHFDWINGKWARAAKQQLEKSA------------------------FCSGTAVELR  167

Query  986   SFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFD  807
             +  E     W  AV+          ++Y+TLR  D++E  +   ++  IRP  PL  +  
Sbjct  168   TETEHLRDVWVGAVVIKENEVGTVYVKYRTLRNGDDAESRRADVESSKIRPT-PLPCKDR  226

Query  806   RFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWD  627
              + + E+VD  +  GW EG+I++++ G  Y V+F  T E  +F    +RP  +W   KW+
Sbjct  227   EYMILEKVDVRHESGWREGVITRIMAGNIYKVFFRRTKESFDFTESDLRPSMKWNGGKWE  286

Query  626   I  624
             +
Sbjct  287   M  287


 Score =   147 bits (370),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 149/296 (50%), Gaps = 29/296 (10%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPN---KFLLEYQTLRTDDESEPLKEKADAF  846
              +KG +VE +S EEG+ G+WY A++ ++   +   K L+ Y TL  DD   PL E  D  
Sbjct  12    ITKGSVVEVSSDEEGFKGAWYRALLEETPLKSRRKKLLVRYLTLLKDDGLTPLHEAVDLG  71

Query  845   NIRPCPP--LIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAH  672
              IRP PP  ++   + F   + VDA Y +GWW G++ KVL+   Y+VYF    + IEF  
Sbjct  72    FIRPLPPEDVVVSGESFDEGDVVDASYRDGWWTGVVRKVLEDGRYIVYFDNPPDVIEFDG  131

Query  671   HGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
               +R H +WI+ KW  A ++                      ++ FC G  VE++ + E 
Sbjct  132   THLRAHFDWINGKWARAAKQQ-------------------LEKSAFCSGTAVELRTETEH  172

Query  491   NQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALS--VRPSAPILQRVDRFR  318
              +  W  A++++    G   V++RTL+   G D   + AD  S  +RP+ P+  +   + 
Sbjct  173   LRDVWVGAVVIKENEVGTVYVKYRTLRN--GDDAESRRADVESSKIRPT-PLPCKDREYM  229

Query  317   PLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
              LE+VD    +GWR G +  ++ G  Y+V FR T E  +F    LR   +W  G W
Sbjct  230   ILEKVDVRHESGWREGVITRIMAGNIYKVFFRRTKESFDFTESDLRPSMKWNGGKW  285


 Score = 94.0 bits (232),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 88/327 (27%), Positives = 143/327 (44%), Gaps = 42/327 (13%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLM-RDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRK  1878
             A+    KG  VEV    + F   +  A+L  +  K++R  ++ V + TL  DD  +    
Sbjct  8     AKCGITKGSVVEVSSDEEGFKGAWYRALLEETPLKSRRK-KLLVRYLTLLKDDG-LTPLH  65

Query  1877  EYVHLSAVRPAPPGEPCCY---FRVGESADVFYENRGWRRGTVDEILENSMYMVALGDED  1707
             E V L  +RP PP +       F  G+  D  Y + GW  G V ++LE+  Y+V   +  
Sbjct  66    EAVDLGFIRPLPPEDVVVSGESFDEGDVVDASYRD-GWWTGVVRKVLEDGRYIVYFDNPP  124

Query  1706  AVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTRG  1527
              V  ++ +   LR H DW +G W      ++  +Q  +K +                   
Sbjct  125   DV--IEFDGTHLRAHFDWINGKW------ARAAKQQLEKSA-------------------  157

Query  1526  SCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVD  1347
                  F     VE++ + E     W  +VV++    G + V+Y+ L+  D  +    +V+
Sbjct  158   -----FCSGTAVELRTETEHLRDVWVGAVVIKENEVGTVYVKYRTLRNGDDAESRRADVE  212

Query  1346  ASCIRPCP-PEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFE  1170
             +S IRP P P   R   + +L+KVD    +GW EG +++++    Y V F    E   F 
Sbjct  213   SSKIRPTPLPCKDR--EYMILEKVDVRHESGWREGVITRIMAGNIYKVFFRRTKESFDFT  270

Query  1169  ASDLRPHQEWKNNNWVAATKIDLPRSS  1089
              SDLRP  +W    W    K+D   S+
Sbjct  271   ESDLRPSMKWNGGKWEMEPKLDTAMSN  297



>ref|XP_006344851.1| PREDICTED: uncharacterized protein LOC102580710 [Solanum tuberosum]
Length=156

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             FS+G LVE +S EEG+ G+W+ A I   +    +L+EYQTLR +D++  L+E+ D  +IR
Sbjct  19    FSEGSLVEVSSDEEGFEGAWFVATIVKFLDNGNYLIEYQTLRNNDDTAFLQEETDRLHIR  78

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             P PP I  F+ FK+ EEVDA +N+GWW G+ISKVL G  Y VYF  +NEE+EF H  IR 
Sbjct  79    PRPPDIGSFESFKVLEEVDALHNDGWWVGVISKVLKGQRYKVYFKASNEELEFKHADIRL  138

Query  656   HQEWIDKKW  630
             H +W + KW
Sbjct  139   HLDWTNGKW  147


 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = -3

Query  536  FCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVR  357
            F  G+ VEV  DEEG +G+W+ A I++ + NG YL+E++TL+ +  T  L +E D L +R
Sbjct  19   FSEGSLVEVSSDEEGFEGAWFVATIVKFLDNGNYLIEYQTLRNNDDTAFLQEETDRLHIR  78

Query  356  PSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRL  177
            P  P +   + F+ LEEVDA  N+GW VG + +VL+G +Y+V F+ +NE LEF+H  +RL
Sbjct  79   PRPPDIGSFESFKVLEEVDALHNDGWWVGVISKVLKGQRYKVYFKASNEELEFKHADIRL  138

Query  176  HQEWINGAW  150
            H +W NG W
Sbjct  139  HLDWTNGKW  147


 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 86/134 (64%), Gaps = 0/134 (0%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIR  1332
             FS+   VEV  D+EGFE +W+ + +++ L NG  L++YQ L+ +D T +L EE D   IR
Sbjct  19    FSEGSLVEVSSDEEGFEGAWFVATIVKFLDNGNYLIEYQTLRNNDDTAFLQEETDRLHIR  78

Query  1331  PCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRP  1152
             P PP+I     FK+L++VDA   +GWW G +SKVL   +Y V F + NE L F+ +D+R 
Sbjct  79    PRPPDIGSFESFKVLEEVDALHNDGWWVGVISKVLKGQRYKVYFKASNEELEFKHADIRL  138

Query  1151  HQEWKNNNWVAATK  1110
             H +W N  WV A++
Sbjct  139   HLDWTNGKWVRASQ  152


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 65/137 (47%), Gaps = 8/137 (6%)
 Frame = -3

Query  2042  FNKGDRVEVLMRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRRKEYVHL  1863
             F++G  VEV   +     F  A    ++ K    G   +E++TL ++DD    ++E   L
Sbjct  19    FSEGSLVEVSSDEE---GFEGAWFVATIVKFLDNGNYLIEYQTLRNNDDTAFLQEETDRL  75

Query  1862  SAVRPAPPGEPCC-YFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDEDAVESVKV  1686
               +RP PP       F+V E  D  + N GW  G + ++L+   Y V     +  E ++ 
Sbjct  76    H-IRPRPPDIGSFESFKVLEEVDALH-NDGWWVGVISKVLKGQRYKVYFKASN--EELEF  131

Query  1685  EQWQLRVHRDWKDGCWV  1635
             +   +R+H DW +G WV
Sbjct  132   KHADIRLHLDWTNGKWV  148



>ref|XP_004295045.1| PREDICTED: uncharacterized protein LOC101297044 [Fragaria vesca 
subsp. vesca]
Length=374

 Score =   147 bits (370),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 105/297 (35%), Positives = 161/297 (54%), Gaps = 20/297 (7%)
 Frame = -3

Query  1496  PVEVKGDKEGFE-RSWYASVVMEVLGNGKLLVQYQDLKTD-----DGTDYLIEEV--DAS  1341
             P +V  D + F  + WY   V ++L N K LV   D + D     D  D  +     D S
Sbjct  79    PFKVGDDVDAFRAKGWYRGTVRDILENSKYLVVV-DGQADQEFECDHFDLRVHREWDDGS  137

Query  1340  CIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASD  1161
              + P  PE  +        K+   + +        K    A +       ++ L  E  +
Sbjct  138   WVPPLLPEEKKSPEVVKSRKITIKIRD-------KKETMGASFKSGTLEDDQELESEQLN  190

Query  1160  LRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSF  981
             LR H+EW + + +     +L  S    ++NS+ ++   ++ ++++  KF  G  VE +S 
Sbjct  191   LRCHREWDDRSSIPPLPKELKSSG---VVNSRKIRFNLRAKKESMRKKFENGTRVEVSSD  247

Query  980   EEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRF  801
             EEGY G+WYTA I D IG +KFL+EY +L T+D ++ L+E+A A  IRPCPP +    ++
Sbjct  248   EEGYKGAWYTATIVDYIGKDKFLVEYVSLVTEDRTQLLREEALASYIRPCPPPLPPVVQY  307

Query  800   KMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKW  630
             K+ ++VDAWYNEGWWEG I+KVL G  YVVYF ++NE +EF H  +R HQ+W++  W
Sbjct  308   KLLQKVDAWYNEGWWEGSITKVLTGSKYVVYF-SSNETLEFKHSDLRLHQDWLNGHW  363


 Score =   147 bits (370),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 115/376 (31%), Positives = 178/376 (47%), Gaps = 78/376 (21%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMR---DNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKR  1884
             ++ +F+KGD+VEV       +   ++PA VLRP ++       I+VE++T  +     K 
Sbjct  2     SQTRFHKGDQVEVTTSVHGGSTGPYYPATVLRPVIKDK---SHIFVEYQTQTAPGRAPKP  58

Query  1883  RKEYVHLSAV---------RPAPPGEPCCYFR---------------------VGESADV  1794
              KE V L+ V         RP   G+    FR                     V   AD 
Sbjct  59    LKEIVLLTNVRPTPPRELHRPFKVGDDVDAFRAKGWYRGTVRDILENSKYLVVVDGQADQ  118

Query  1793  FYE--------NRGWRRGT-----------VDEILENSMYMVALGDEDAV----------  1701
              +E        +R W  G+             E++++    + + D+             
Sbjct  119   EFECDHFDLRVHREWDDGSWVPPLLPEEKKSPEVVKSRKITIKIRDKKETMGASFKSGTL  178

Query  1700  ---ESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVKLRIKCTR  1530
                + ++ EQ  LR HR+W D   +PPL         ++ KS   ++    ++  ++  +
Sbjct  179   EDDQELESEQLNLRCHREWDDRSSIPPLP--------KELKSSG-VVNSRKIRFNLRAKK  229

Query  1529  GSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEV  1350
              S  +KF     VEV  D+EG++ +WY + +++ +G  K LV+Y  L T+D T  L EE 
Sbjct  230   ESMRKKFENGTRVEVSSDEEGYKGAWYTATIVDYIGKDKFLVEYVSLVTEDRTQLLREEA  289

Query  1349  DASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFE  1170
              AS IRPCPP +  +  +KLL KVDAW   GWWEG ++KVL  +KY+V F S NE L F+
Sbjct  290   LASYIRPCPPPLPPVVQYKLLQKVDAWYNEGWWEGSITKVLTGSKYVVYFSS-NETLEFK  348

Query  1169  ASDLRPHQEWKNNNWV  1122
              SDLR HQ+W N +W+
Sbjct  349   HSDLRLHQDWLNGHWI  364


 Score =   120 bits (302),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 107/184 (58%), Gaps = 3/184 (2%)
 Frame = -3

Query  695  NEEIEFAHHGIRPHQEWIDKKWDIAFRK--SNNNLPNPKPGIMRRHSGGIASETTFCIGA  522
            ++E+E     +R H+EW D+       K   ++ + N +       +   +    F  G 
Sbjct  181  DQELESEQLNLRCHREWDDRSSIPPLPKELKSSGVVNSRKIRFNLRAKKESMRKKFENGT  240

Query  521  KVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPI  342
            +VEV  DEEG +G+WY A I+  IG  K+LVE+ +L  +  T LL +EA A  +RP  P 
Sbjct  241  RVEVSSDEEGYKGAWYTATIVDYIGKDKFLVEYVSLVTEDRTQLLREEALASYIRPCPPP  300

Query  341  LQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWI  162
            L  V +++ L++VDAW N GW  G + +VL G+KY V F ++NE LEF+H  LRLHQ+W+
Sbjct  301  LPPVVQYKLLQKVDAWYNEGWWEGSITKVLTGSKYVVYF-SSNETLEFKHSDLRLHQDWL  359

Query  161  NGAW  150
            NG W
Sbjct  360  NGHW  363


 Score = 69.7 bits (169),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 71/136 (52%), Gaps = 8/136 (6%)
 Frame = -3

Query  1019  KFSKGMLVE-ATSFEEGYHGSWYTAVIFDSIGPNK--FLLEYQTLRTDDES-EPLKEKAD  852
             +F KG  VE  TS   G  G +Y A +   +  +K    +EYQT      + +PLKE   
Sbjct  5     RFHKGDQVEVTTSVHGGSTGPYYPATVLRPVIKDKSHIFVEYQTQTAPGRAPKPLKEIVL  64

Query  851   AFNIRPCPPL-IHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYF-WTTNEEIEF  678
               N+RP PP  +HR   FK+ ++VDA+  +GW+ G +  +L+   Y+V      ++E E 
Sbjct  65    LTNVRPTPPRELHR--PFKVGDDVDAFRAKGWYRGTVRDILENSKYLVVVDGQADQEFEC  122

Query  677   AHHGIRPHQEWIDKKW  630
              H  +R H+EW D  W
Sbjct  123   DHFDLRVHREWDDGSW  138


 Score = 65.5 bits (158),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 86/187 (46%), Gaps = 14/187 (7%)
 Frame = -3

Query  1514  KFSKEMPVEVKGDKEGFERSWY--ASVVMEVLGN-GKLLVQYQDLKTDDGT--DYLIEEV  1350
             +F K   VEV     G     Y  A+V+  V+ +   + V+YQ  +T  G     L E V
Sbjct  5     RFHKGDQVEVTTSVHGGSTGPYYPATVLRPVIKDKSHIFVEYQ-TQTAPGRAPKPLKEIV  63

Query  1349  DASCIRPCPP-EIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCF-GSMNELLT  1176
               + +RP PP E+HR  PFK+ D VDA+   GW+ G V  +L ++KY+V   G  ++   
Sbjct  64    LLTNVRPTPPRELHR--PFKVGDDVDAFRAKGWYRGTVRDILENSKYLVVVDGQADQEFE  121

Query  1175  FEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRK-ALGPKFSKGML  999
              +  DLR H+EW + +WV      LP       +           D+K  +G  F  G L
Sbjct  122   CDHFDLRVHREWDDGSWVPPL---LPEEKKSPEVVKSRKITIKIRDKKETMGASFKSGTL  178

Query  998   VEATSFE  978
              +    E
Sbjct  179   EDDQELE  185


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 74/139 (53%), Gaps = 8/139 (6%)
 Frame = -3

Query  548  SETTFCIGAKVEVKDD-EEGNQGSWYPALILRLIGNGK--YLVEFRTLKCDFGTDLLVQE  378
            S+T F  G +VEV      G+ G +YPA +LR +   K    VE++T          ++E
Sbjct  2    SQTRFHKGDQVEVTTSVHGGSTGPYYPATVLRPVIKDKSHIFVEYQTQTAPGRAPKPLKE  61

Query  377  ADALS-VRPSAPILQRVDR-FRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFR-TTNEI  207
               L+ VRP+ P  + + R F+  ++VDA+   GW  G V ++LE +KY V      ++ 
Sbjct  62   IVLLTNVRPTPP--RELHRPFKVGDDVDAFRAKGWYRGTVRDILENSKYLVVVDGQADQE  119

Query  206  LEFRHHGLRLHQEWINGAW  150
             E  H  LR+H+EW +G+W
Sbjct  120  FECDHFDLRVHREWDDGSW  138



>ref|XP_008370599.1| PREDICTED: uncharacterized protein LOC103434067 [Malus domestica]
Length=190

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             F+KG  VE  S E+G+HG+W+ A I  ++G  KFL+EYQ+LRT+D+S  L+E+ D  + R
Sbjct  54    FTKGXPVEVCSDEDGFHGAWFAATIVXAVGXXKFLIEYQSLRTEDDSAFLREEIDTLHJR  113

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             P PP  +  + F + +EVDA YN+GWW G+ISKVL G  Y+VYF +T EEIEF    +R 
Sbjct  114   PNPPE-NAVEHFSLLQEVDALYNDGWWVGMISKVLSGSRYIVYFRSTYEEIEFQQSELRL  172

Query  656   HQEWIDKKWDIAFR  615
             HQ+WI  KW +  R
Sbjct  173   HQDWIGGKWVMPSR  186


 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIR  1332
             F+K  PVEV  D++GF  +W+A+ ++  +G  K L++YQ L+T+D + +L EE+D    R
Sbjct  54    FTKGXPVEVCSDEDGFHGAWFAATIVXAVGXXKFLIEYQSLRTEDDSAFLREEIDTLHJR  113

Query  1331  PCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRP  1152
             P PPE + +  F LL +VDA   +GWW G +SKVL  ++Y+V F S  E + F+ S+LR 
Sbjct  114   PNPPE-NAVEHFSLLQEVDALYNDGWWVGMISKVLSGSRYIVYFRSTYEEIEFQQSELRL  172

Query  1151  HQEWKNNNWVAATK  1110
             HQ+W    WV  ++
Sbjct  173   HQDWIGGKWVMPSR  186


 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 88/146 (60%), Gaps = 1/146 (1%)
 Frame = -3

Query  587  KPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKC  408
            KP   +     I ++  F  G  VEV  DE+G  G+W+ A I+  +G  K+L+E+++L+ 
Sbjct  37   KPIFSKFQKVPIVTQENFTKGXPVEVCSDEDGFHGAWFAATIVXAVGXXKFLIEYQSLRT  96

Query  407  DFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVN  228
            +  +  L +E D L  RP+ P    V+ F  L+EVDA  N+GW VG + +VL G++Y V 
Sbjct  97   EDDSAFLREEIDTLHJRPNPP-ENAVEHFSLLQEVDALYNDGWWVGMISKVLSGSRYIVY  155

Query  227  FRTTNEILEFRHHGLRLHQEWINGAW  150
            FR+T E +EF+   LRLHQ+WI G W
Sbjct  156  FRSTYEEIEFQQSELRLHQDWIGGKW  181


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 69/146 (47%), Gaps = 11/146 (8%)
 Frame = -3

Query  2060  MSAEAQFNKGDRVEVLM-RDNFP-IWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMK  1887
             +  +  F KG  VEV    D F   WF A ++           +  +E+++L ++DD   
Sbjct  48    IVTQENFTKGXPVEVCSDEDGFHGAWFAATIVXAV-----GXXKFLIEYQSLRTEDDSAF  102

Query  1886  RRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYMVALGDED  1707
              R+E   L   RP PP     +F + +  D  Y N GW  G + ++L  S Y+V      
Sbjct  103   LREEIDTLH-JRPNPPENAVEHFSLLQEVDALY-NDGWWVGMISKVLSGSRYIVYF--RS  158

Query  1706  AVESVKVEQWQLRVHRDWKDGCWVPP  1629
               E ++ +Q +LR+H+DW  G WV P
Sbjct  159   TYEEIEFQQSELRLHQDWIGGKWVMP  184



>ref|XP_004302287.1| PREDICTED: uncharacterized protein LOC101303819 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=187

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             F+KG LVE +S EEG+HGSW+ A +  S+G + FL+EY+ LRT+D+S  L+E+ D  +IR
Sbjct  30    FTKGALVEVSSDEEGFHGSWFAATVVKSMGKDGFLVEYKCLRTEDDSAFLREEVDNMHIR  89

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             P PP  +  D FK  +EVDA +N+GWW G++SKVL G  Y+VYF  T EE+E+ H  +R 
Sbjct  90    PHPPE-NVVDCFKKLDEVDALHNDGWWVGVVSKVLRGSRYIVYFRETCEELEYHHSELRL  148

Query  656   HQEWIDKKWDI  624
             HQ+WID KW I
Sbjct  149   HQDWIDGKWVI  159


 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 86/135 (64%), Gaps = 1/135 (1%)
 Frame = -3

Query  554  IASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEA  375
            I S+  F  GA VEV  DEEG  GSW+ A +++ +G   +LVE++ L+ +  +  L +E 
Sbjct  24   IVSDGYFTKGALVEVSSDEEGFHGSWFAATVVKSMGKDGFLVEYKCLRTEDDSAFLREEV  83

Query  374  DALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFR  195
            D + +RP  P    VD F+ L+EVDA  N+GW VG V +VL G++Y V FR T E LE+ 
Sbjct  84   DNMHIRPHPP-ENVVDCFKKLDEVDALHNDGWWVGVVSKVLRGSRYIVYFRETCEELEYH  142

Query  194  HHGLRLHQEWINGAW  150
            H  LRLHQ+WI+G W
Sbjct  143  HSELRLHQDWIDGKW  157


 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 87/135 (64%), Gaps = 1/135 (1%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGTDYLIEEVDASCIR  1332
             F+K   VEV  D+EGF  SW+A+ V++ +G    LV+Y+ L+T+D + +L EEVD   IR
Sbjct  30    FTKGALVEVSSDEEGFHGSWFAATVVKSMGKDGFLVEYKCLRTEDDSAFLREEVDNMHIR  89

Query  1331  PCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSMNELLTFEASDLRP  1152
             P PPE + +  FK LD+VDA   +GWW G VSKVL  ++Y+V F    E L +  S+LR 
Sbjct  90    PHPPE-NVVDCFKKLDEVDALHNDGWWVGVVSKVLRGSRYIVYFRETCEELEYHHSELRL  148

Query  1151  HQEWKNNNWVAATKI  1107
             HQ+W +  WV  +++
Sbjct  149   HQDWIDGKWVIPSQV  163


 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 73/153 (48%), Gaps = 11/153 (7%)
 Frame = -3

Query  2081  DVPETHAMSAEAQFNKGDRVEVLMRDN--FPIWFPAAVLRPSVRKNQRAGQIYVEFETLC  1908
             DV E   + ++  F KG  VEV   +      WF A V+     K+       VE++ L 
Sbjct  17    DVGENDPIVSDGYFTKGALVEVSSDEEGFHGSWFAATVV-----KSMGKDGFLVEYKCLR  71

Query  1907  SDDDPMKRRKEYVHLSAVRPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEILENSMYM  1728
             ++DD    R+E  ++  +RP PP      F+  +  D  + N GW  G V ++L  S Y+
Sbjct  72    TEDDSAFLREEVDNMH-IRPHPPENVVDCFKKLDEVDALH-NDGWWVGVVSKVLRGSRYI  129

Query  1727  VALGDEDAVESVKVEQWQLRVHRDWKDGCWVPP  1629
             V     +  E ++    +LR+H+DW DG WV P
Sbjct  130   VYF--RETCEELEYHHSELRLHQDWIDGKWVIP  160



>ref|XP_010918488.1| PREDICTED: uncharacterized protein LOC105042847 isoform X1 [Elaeis 
guineensis]
Length=942

 Score =   150 bits (380),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 99/311 (32%), Positives = 155/311 (50%), Gaps = 28/311 (9%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTD-DGTDYLIEEVDASCIRPCPPE  1317
             VEV+ D EGF  +WY + V+  L      V+Y  L +D D ++ L E V  S +RP PP 
Sbjct  27    VEVRSDDEGFRGAWYEATVVRSLPRRHYSVEYVSLVSDADPSEPLHEIVCRSHVRPPPPP  86

Query  1316  IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGD--AKYMVCFGSMNELLTFEASDLRPHQE  1143
                 + +++L +V+ +  +GWW G VSK+ G+   ++ V F +  E++ F  S++RP  E
Sbjct  87    ALSPTRYQVLQRVEVFHNDGWWAGVVSKLHGEDSGRFTVSFPNTREVMDFRPSEIRPLLE  146

Query  1142  WKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHG  963
             W    W+ A                         D++   P FS G  VE +   E Y  
Sbjct  147   WVRGRWIVA------------------------RDQEVAEPLFSVGEQVEVSQERENYGA  182

Query  962   SWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEV  783
             +W+ A+I   I  + FL++Y+TLR   + E L E  DA  IRP PP     + F + + V
Sbjct  183   AWFAAMIGSVISKSIFLVDYKTLRAVTDRESLTEIVDAQYIRPAPPPASEDENFGLHDVV  242

Query  782   DAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNN  603
             +  Y+ GW  G++S++L+G  Y+V      EE+EF H  +R  Q   D +W I++   + 
Sbjct  243   EVLYHGGWSLGVVSQILNGSKYIVKLKHHEEEMEFNHSEMRSCQVLEDGQW-ISYSSQDK  301

Query  602   NLPNPKPGIMR  570
             N  +P  G  R
Sbjct  302   NRKSPMLGGAR  312


 Score =   139 bits (350),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/289 (30%), Positives = 145/289 (50%), Gaps = 22/289 (8%)
 Frame = -3

Query  1007  GMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTD-DESEPLKEKADAFNIRPC  831
             G  VE  S +EG+ G+WY A +  S+    + +EY +L +D D SEPL E     ++RP 
Sbjct  24    GAKVEVRSDDEGFRGAWYEATVVRSLPRRHYSVEYVSLVSDADPSEPLHEIVCRSHVRPP  83

Query  830   PPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVL--DGLNYVVYFWTTNEEIEFAHHGIRP  657
             PP      R+++ + V+ ++N+GWW G++SK+   D   + V F  T E ++F    IRP
Sbjct  84    PPPALSPTRYQVLQRVEVFHNDGWWAGVVSKLHGEDSGRFTVSFPNTREVMDFRPSEIRP  143

Query  656   HQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSW  477
               EW+  +W +A  +                     +E  F +G +VEV  + E    +W
Sbjct  144   LLEWVRGRWIVARDQE-------------------VAEPLFSVGEQVEVSQERENYGAAW  184

Query  476   YPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDA  297
             + A+I  +I    +LV+++TL+     + L +  DA  +RP+ P     + F   + V+ 
Sbjct  185   FAAMIGSVISKSIFLVDYKTLRAVTDRESLTEIVDAQYIRPAPPPASEDENFGLHDVVEV  244

Query  296   WSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
               + GW +G V ++L G+KY V  +   E +EF H  +R  Q   +G W
Sbjct  245   LYHGGWSLGVVSQILNGSKYIVKLKHHEEEMEFNHSEMRSCQVLEDGQW  293



>ref|XP_010918489.1| PREDICTED: uncharacterized protein LOC105042847 isoform X2 [Elaeis 
guineensis]
Length=914

 Score =   150 bits (380),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 99/311 (32%), Positives = 155/311 (50%), Gaps = 28/311 (9%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTD-DGTDYLIEEVDASCIRPCPPE  1317
             VEV+ D EGF  +WY + V+  L      V+Y  L +D D ++ L E V  S +RP PP 
Sbjct  27    VEVRSDDEGFRGAWYEATVVRSLPRRHYSVEYVSLVSDADPSEPLHEIVCRSHVRPPPPP  86

Query  1316  IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGD--AKYMVCFGSMNELLTFEASDLRPHQE  1143
                 + +++L +V+ +  +GWW G VSK+ G+   ++ V F +  E++ F  S++RP  E
Sbjct  87    ALSPTRYQVLQRVEVFHNDGWWAGVVSKLHGEDSGRFTVSFPNTREVMDFRPSEIRPLLE  146

Query  1142  WKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHG  963
             W    W+ A                         D++   P FS G  VE +   E Y  
Sbjct  147   WVRGRWIVA------------------------RDQEVAEPLFSVGEQVEVSQERENYGA  182

Query  962   SWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEV  783
             +W+ A+I   I  + FL++Y+TLR   + E L E  DA  IRP PP     + F + + V
Sbjct  183   AWFAAMIGSVISKSIFLVDYKTLRAVTDRESLTEIVDAQYIRPAPPPASEDENFGLHDVV  242

Query  782   DAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNN  603
             +  Y+ GW  G++S++L+G  Y+V      EE+EF H  +R  Q   D +W I++   + 
Sbjct  243   EVLYHGGWSLGVVSQILNGSKYIVKLKHHEEEMEFNHSEMRSCQVLEDGQW-ISYSSQDK  301

Query  602   NLPNPKPGIMR  570
             N  +P  G  R
Sbjct  302   NRKSPMLGGAR  312


 Score =   139 bits (350),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/289 (30%), Positives = 145/289 (50%), Gaps = 22/289 (8%)
 Frame = -3

Query  1007  GMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTD-DESEPLKEKADAFNIRPC  831
             G  VE  S +EG+ G+WY A +  S+    + +EY +L +D D SEPL E     ++RP 
Sbjct  24    GAKVEVRSDDEGFRGAWYEATVVRSLPRRHYSVEYVSLVSDADPSEPLHEIVCRSHVRPP  83

Query  830   PPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVL--DGLNYVVYFWTTNEEIEFAHHGIRP  657
             PP      R+++ + V+ ++N+GWW G++SK+   D   + V F  T E ++F    IRP
Sbjct  84    PPPALSPTRYQVLQRVEVFHNDGWWAGVVSKLHGEDSGRFTVSFPNTREVMDFRPSEIRP  143

Query  656   HQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSW  477
               EW+  +W +A  +                     +E  F +G +VEV  + E    +W
Sbjct  144   LLEWVRGRWIVARDQE-------------------VAEPLFSVGEQVEVSQERENYGAAW  184

Query  476   YPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDA  297
             + A+I  +I    +LV+++TL+     + L +  DA  +RP+ P     + F   + V+ 
Sbjct  185   FAAMIGSVISKSIFLVDYKTLRAVTDRESLTEIVDAQYIRPAPPPASEDENFGLHDVVEV  244

Query  296   WSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
               + GW +G V ++L G+KY V  +   E +EF H  +R  Q   +G W
Sbjct  245   LYHGGWSLGVVSQILNGSKYIVKLKHHEEEMEFNHSEMRSCQVLEDGQW  293



>ref|XP_007220929.1| hypothetical protein PRUPE_ppa024896mg [Prunus persica]
 gb|EMJ22128.1| hypothetical protein PRUPE_ppa024896mg [Prunus persica]
Length=422

 Score =   145 bits (367),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 99/315 (31%), Positives = 151/315 (48%), Gaps = 45/315 (14%)
 Frame = -3

Query  1511  FSKEMPVEVKGDKEGFERSWYASVVME-------------VLGNG-KLLVQYQDLKTDDG  1374
              SK+  VEV  +++G++ +W+ ++ ++              LGN  K LVQY+ L +DD 
Sbjct  10    LSKDSKVEVCSNEDGYQGAWFPAIFLDPQPSDGTPKKKRKSLGNSSKALVQYETLVSDDD  69

Query  1373  TDY-LIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFG  1197
              +  L E VD   IRP PP  +   PF+  + VDA+    WW G V +   D KY V F 
Sbjct  70    PNKPLTELVDVCSIRPVPPPDNPDQPFEPANVVDAFYQEAWWVGVVIR-FEDDKYTVGFK  128

Query  1196  SMNELLTFEASDLRPHQEWKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPK  1017
             +  +LL    S+LRPH ++ +  WV A K                         + +G  
Sbjct  129   NPPDLLELRRSELRPHWDFLDGVWVRARK------------------------ERMVGSF  164

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIR  837
             FS G  VE   ++E    +W+ A+    +G N FLL+Y++    D    +K       IR
Sbjct  165   FSPGTAVEVNLYKEHLFCAWFPAIYLGELGANNFLLQYKSSNNCD----VKAVVGGKQIR  220

Query  836   PCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRP  657
             P PP +   D F + E+VDA+++ GWW G I KVL G  Y+V    T E  +++   +R 
Sbjct  221   PQPPKLAERD-FNLMEKVDAFFDMGWWVGEIIKVLTGKKYMVCLKLTEEVKQYSQSELRR  279

Query  656   HQEWIDKKWDIAFRK  612
             H  W D +W+  F +
Sbjct  280   HMYWTDGRWEGHFSR  294


 Score =   132 bits (333),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 95/305 (31%), Positives = 149/305 (49%), Gaps = 42/305 (14%)
 Frame = -3

Query  1016  FSKGMLVEATSFEEGYHGSWYTAVIFD-------------SIG-PNKFLLEYQTLRTDDE  879
              SK   VE  S E+GY G+W+ A+  D             S+G  +K L++Y+TL +DD+
Sbjct  10    LSKDSKVEVCSNEDGYQGAWFPAIFLDPQPSDGTPKKKRKSLGNSSKALVQYETLVSDDD  69

Query  878   -SEPLKEKADAFNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYFW  702
              ++PL E  D  +IRP PP  +    F+    VDA+Y E WW G++ +  D   Y V F 
Sbjct  70    PNKPLTELVDVCSIRPVPPPDNPDQPFEPANVVDAFYQEAWWVGVVIRFEDD-KYTVGFK  128

Query  701   TTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGA  522
                + +E     +RPH +++D  W +  RK              R  G       F  G 
Sbjct  129   NPPDLLELRRSELRPHWDFLDGVW-VRARK-------------ERMVGSF-----FSPGT  169

Query  521   KVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLK-CDFGTDLLVQEADALSVRPSAP  345
              VEV   +E    +W+PA+ L  +G   +L+++++   CD    +  ++     +RP  P
Sbjct  170   AVEVNLYKEHLFCAWFPAIYLGELGANNFLLQYKSSNNCDVKAVVGGKQ-----IRPQPP  224

Query  344   ILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEW  165
              L   D F  +E+VDA+ + GW VG++ +VL G KY V  + T E+ ++    LR H  W
Sbjct  225   KLAERD-FNLMEKVDAFFDMGWWVGEIIKVLTGKKYMVCLKLTEEVKQYSQSELRRHMYW  283

Query  164   INGAW  150
              +G W
Sbjct  284   TDGRW  288


 Score =   115 bits (289),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 99/322 (31%), Positives = 145/322 (45%), Gaps = 51/322 (16%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDNF--PIWFPAAVLRPS----VRKNQR-----AGQIYVEFETLC  1908
             ++A  +K  +VEV   ++     WFPA  L P       K +R     + +  V++ETL 
Sbjct  6     SQAHLSKDSKVEVCSNEDGYQGAWFPAIFLDPQPSDGTPKKKRKSLGNSSKALVQYETLV  65

Query  1907  SDDDPMKRRKEYVHLSAVRPAPPGE-PCCYFRVGESADVFYENRGWRRGTVDEILENSMY  1731
             SDDDP K   E V + ++RP PP + P   F      D FY+   W  G V    E+  Y
Sbjct  66    SDDDPNKPLTELVDVCSIRPVPPPDNPDQPFEPANVVDAFYQ-EAWWVGVVIR-FEDDKY  123

Query  1730  MVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMTPSGVK  1551
              V  G ++  + +++ + +LR H D+ DG WV   +E  V                    
Sbjct  124   TV--GFKNPPDLLELRRSELRPHWDFLDGVWVRARKERMV--------------------  161

Query  1550  LRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTDDGT  1371
                    GS    FS    VEV   KE    +W+ ++ +  LG    L+QY   K+ +  
Sbjct  162   -------GSF---FSPGTAVEVNLYKEHLFCAWFPAIYLGELGANNFLLQY---KSSNNC  208

Query  1370  DYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDAKYMVCFGSM  1191
             D +   V    IRP PP++     F L++KVDA+   GWW G + KVL   KYMVC    
Sbjct  209   D-VKAVVGGKQIRPQPPKLAE-RDFNLMEKVDAFFDMGWWVGEIIKVLTGKKYMVCLKLT  266

Query  1190  NELLTFEASDLRPHQEWKNNNW  1125
              E+  +  S+LR H  W +  W
Sbjct  267   EEVKQYSQSELRRHMYWTDGRW  288



>ref|XP_010918487.1| PREDICTED: uncharacterized protein LOC105042846 [Elaeis guineensis]
Length=942

 Score =   150 bits (379),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 103/343 (30%), Positives = 165/343 (48%), Gaps = 38/343 (11%)
 Frame = -3

Query  1493  VEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQDLKTD-DGTDYLIEEVDASCIRPCPPE  1317
             VEV+ D EGF  +WY + ++  L   +  V+Y  L +D D ++ L E V  S +RP PP 
Sbjct  28    VEVRSDDEGFRGAWYEATIVRSLKRRRYSVEYVSLVSDADPSEPLHEIVRRSHVRPPPPP  87

Query  1316  IHRISPFKLLDKVDAWVGNGWWEGHVSKVLGD--AKYMVCFGSMNELLTFEASDLRPHQE  1143
                 + +++  +V+A+  +GWW G VS++ G+   ++ V F +  E++ F  SD+RP  E
Sbjct  88    PPSPADYQVYQRVEAFHNDGWWAGVVSRLHGEDSGRFTVSFPNTREVMDFPPSDIRPLLE  147

Query  1142  WKNNNWVAATKIDLPRSSSDVMLNskvvkvkskSDRKALGPKFSKGMLVEATSFEEGYHG  963
             W    W+ A                         D+    P FS G  VE +   E Y G
Sbjct  148   WVRGRWIVA------------------------RDQDVAEPLFSVGAQVEVSRERENY-G  182

Query  962   SWYTAVIFDSIGPNKFLLEYQTLRTDDESEPLKEKADAFNIRPCPPLIHRFDRFKMFEEV  783
             +W+ A I   +  + FL++Y+TLR   + E   E  DA  IRP PPL    + F + + V
Sbjct  183   TWFAATIGRVVSKSIFLVDYKTLRDVTDRELSMEIVDAQYIRPAPPLASEDENFSLHDVV  242

Query  782   DAWYNEGWWEGLISKVLDGLNYVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNN  603
             +  Y+ GW  G++S++ +G  Y+V     +EE+EF H  +R  Q W D +W I++   + 
Sbjct  243   EVLYHGGWLLGVVSQIPNGSKYIVRLRHYDEEMEFNHSEMRSCQVWEDGQW-ISYSSQDK  301

Query  602   NLPNP------KPGIMRRHSGGIASETTFCIGAKVEVKDDEEG  492
             N  +P        G  R+   G  S     +       DD++G
Sbjct  302   NRKSPMLSGARSAGPRRQSHAGKRSSLPISVTTS---SDDDDG  341


 Score =   149 bits (376),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 91/289 (31%), Positives = 153/289 (53%), Gaps = 23/289 (8%)
 Frame = -3

Query  1007  GMLVEATSFEEGYHGSWYTAVIFDSIGPNKFLLEYQTLRTD-DESEPLKEKADAFNIRPC  831
             G  VE  S +EG+ G+WY A I  S+   ++ +EY +L +D D SEPL E     ++RP 
Sbjct  25    GAKVEVRSDDEGFRGAWYEATIVRSLKRRRYSVEYVSLVSDADPSEPLHEIVRRSHVRPP  84

Query  830   PPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVL--DGLNYVVYFWTTNEEIEFAHHGIRP  657
             PP       +++++ V+A++N+GWW G++S++   D   + V F  T E ++F    IRP
Sbjct  85    PPPPPSPADYQVYQRVEAFHNDGWWAGVVSRLHGEDSGRFTVSFPNTREVMDFPPSDIRP  144

Query  656   HQEWIDKKWDIAFRKSNNNLPNPKPGIMRRHSGGIASETTFCIGAKVEVKDDEEGNQGSW  477
               EW+  +W +A  +                     +E  F +GA+VEV  + E N G+W
Sbjct  145   LLEWVRGRWIVARDQD-------------------VAEPLFSVGAQVEVSRERE-NYGTW  184

Query  476   YPALILRLIGNGKYLVEFRTLKCDFGTDLLVQEADALSVRPSAPILQRVDRFRPLEEVDA  297
             + A I R++    +LV+++TL+     +L ++  DA  +RP+ P+    + F   + V+ 
Sbjct  185   FAATIGRVVSKSIFLVDYKTLRDVTDRELSMEIVDAQYIRPAPPLASEDENFSLHDVVEV  244

Query  296   WSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRHHGLRLHQEWINGAW  150
               + GW +G V ++  G+KY V  R  +E +EF H  +R  Q W +G W
Sbjct  245   LYHGGWLLGVVSQIPNGSKYIVRLRHYDEEMEFNHSEMRSCQVWEDGQW  293



>gb|KCW73282.1| hypothetical protein EUGRSUZ_E01742 [Eucalyptus grandis]
Length=341

 Score =   143 bits (361),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 98/319 (31%), Positives = 148/319 (46%), Gaps = 23/319 (7%)
 Frame = -3

Query  1037  RKALGPKFSKGMLVEATSFEEGYHGSWYTAVIF--DSIGPNKFLLEYQTLRTDDE----S  876
             R    P+F  G  VE TS      G+ +   I       PN FL+EY+TL    +    S
Sbjct  19    RSMAHPRFRAGAEVEITSPIHRLRGTLFPGRIVAPSRRKPNSFLVEYRTLVAPSDACRPS  78

Query  875   EPLKEKADA--------FNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLN  720
              P +E+                 P        F++ + VDA+ N GWWEG I+K L    
Sbjct  79    RPYREEVPVGLLRPAPPAEAEAGPGPGPGGRGFRLGDAVDAFLNGGWWEGAITKELKNAR  138

Query  719   YVVYFWTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPK------PGIMRRHSG  558
             ++VYF     E  F    +R H+EW++  W   F     +  +           M   SG
Sbjct  139   FMVYFRCVKREYRFDAAELRLHREWVNGNWAPPFEDEGEDGDDDDGDGEEVTSTMGEKSG  198

Query  557   GI--ASETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKC-DFGTDLL  387
              +   ++  F  GA VEV+ DE+G QG+W+ A I+  +   ++ +E++TL+  D  ++ L
Sbjct  199   DVFRIAKGVFTKGALVEVRSDEDGLQGAWFAATIINKVAKNRFFIEYQTLRAEDNSSEYL  258

Query  386   VQEADALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEI  207
              ++  A  +RP  P    +D +     VDA  N GW  G V  VL+  +YRV F+ T + 
Sbjct  259   REQVAASHMRPYPPETFVIDPYERNASVDALYNEGWWEGTVERVLDRMQYRVYFKGTEDR  318

Query  206   LEFRHHGLRLHQEWINGAW  150
             +   H  LRLHQ+W+NG W
Sbjct  319   MVCHHSELRLHQDWVNGKW  337


 Score =   135 bits (341),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 101/332 (30%), Positives = 155/332 (47%), Gaps = 36/332 (11%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVL-----MRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPM  1890
             A  +F  G  VE+      +R      FP  ++ PS RK        VE+ TL +  D  
Sbjct  22    AHPRFRAGAEVEITSPIHRLRGTL---FPGRIVAPSRRK---PNSFLVEYRTLVAPSDAC  75

Query  1889  KRRKEYVHLSAV------------RPAPPGEPCCYFRVGESADVFYENRGWRRGTVDEIL  1746
             +  + Y     V                PG     FR+G++ D F  N GW  G + + L
Sbjct  76    RPSRPYREEVPVGLLRPAPPAEAEAGPGPGPGGRGFRLGDAVDAFL-NGGWWEGAITKEL  134

Query  1745  ENSMYMVALGDEDAVESVKVEQWQLRVHRDWKDGCWVPPLEESQVDQQYQQKKSEDFLMT  1566
             +N+ +MV           + +  +LR+HR+W +G W PP E+   D        E+   T
Sbjct  135   KNARFMVYF--RCVKREYRFDAAELRLHREWVNGNWAPPFEDEGEDGDDDDGDGEEVTST  192

Query  1565  ---PSGVKLRIKCTRGSCVRKFSKEMPVEVKGDKEGFERSWYASVVMEVLGNGKLLVQYQ  1395
                 SG   RI   +G     F+K   VEV+ D++G + +W+A+ ++  +   +  ++YQ
Sbjct  193   MGEKSGDVFRI--AKGV----FTKGALVEVRSDEDGLQGAWFAATIINKVAKNRFFIEYQ  246

Query  1394  DLKT-DDGTDYLIEEVDASCIRPCPPEIHRISPFKLLDKVDAWVGNGWWEGHVSKVLGDA  1218
              L+  D+ ++YL E+V AS +RP PPE   I P++    VDA    GWWEG V +VL   
Sbjct  247   TLRAEDNSSEYLREQVAASHMRPYPPETFVIDPYERNASVDALYNEGWWEGTVERVLDRM  306

Query  1217  KYMVCFGSMNELLTFEASDLRPHQEWKNNNWV  1122
             +Y V F    + +    S+LR HQ+W N  WV
Sbjct  307   QYRVYFKGTEDRMVCHHSELRLHQDWVNGKWV  338


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 73/146 (50%), Gaps = 13/146 (9%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVLMRDNF--PIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPMKRR  1881
             A+  F KG  VEV   ++     WF A ++   V KN+     ++E++TL ++D+  +  
Sbjct  204   AKGVFTKGALVEVRSDEDGLQGAWFAATIIN-KVAKNR----FFIEYQTLRAEDNSSEYL  258

Query  1880  KEYVHLSAVRPAPPGEPCC-YFRVGESADVFYENRGWRRGTVDEILENSMYMVAL-GDED  1707
             +E V  S +RP PP       +    S D  Y N GW  GTV+ +L+   Y V   G ED
Sbjct  259   REQVAASHMRPYPPETFVIDPYERNASVDALY-NEGWWEGTVERVLDRMQYRVYFKGTED  317

Query  1706  AVESVKVEQWQLRVHRDWKDGCWVPP  1629
                 +     +LR+H+DW +G WV P
Sbjct  318   ---RMVCHHSELRLHQDWVNGKWVMP  340



>ref|XP_010058576.1| PREDICTED: uncharacterized protein LOC104446420 [Eucalyptus grandis]
Length=321

 Score =   142 bits (358),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 97/314 (31%), Positives = 147/314 (47%), Gaps = 23/314 (7%)
 Frame = -3

Query  1022  PKFSKGMLVEATSFEEGYHGSWYTAVIF--DSIGPNKFLLEYQTLRTDDE----SEPLKE  861
             P+F  G  VE TS      G+ +   I       PN FL+EY+TL    +    S P +E
Sbjct  4     PRFRAGAEVEITSPIHRLRGTLFPGRIVAPSRRKPNSFLVEYRTLVAPSDACRPSRPYRE  63

Query  860   KADA--------FNIRPCPPLIHRFDRFKMFEEVDAWYNEGWWEGLISKVLDGLNYVVYF  705
             +                 P        F++ + VDA+ N GWWEG I+K L    ++VYF
Sbjct  64    EVPVGLLRPAPPAEAEAGPGPGPGGRGFRLGDAVDAFLNGGWWEGAITKELKNARFMVYF  123

Query  704   WTTNEEIEFAHHGIRPHQEWIDKKWDIAFRKSNNNLPNPK------PGIMRRHSGGI--A  549
                  E  F    +R H+EW++  W   F     +  +           M   SG +   
Sbjct  124   RCVKREYRFDAAELRLHREWVNGNWAPPFEDEGEDGDDDDGDGEEVTSTMGEKSGDVFRI  183

Query  548   SETTFCIGAKVEVKDDEEGNQGSWYPALILRLIGNGKYLVEFRTLKC-DFGTDLLVQEAD  372
             ++  F  GA VEV+ DE+G QG+W+ A I+  +   ++ +E++TL+  D  ++ L ++  
Sbjct  184   AKGVFTKGALVEVRSDEDGLQGAWFAATIINKVAKNRFFIEYQTLRAEDNSSEYLREQVA  243

Query  371   ALSVRPSAPILQRVDRFRPLEEVDAWSNNGWRVGQVCEVLEGAKYRVNFRTTNEILEFRH  192
             A  +RP  P    +D +     VDA  N GW  G V  VL+  +YRV F+ T + +   H
Sbjct  244   ASHMRPYPPETFVIDPYERNASVDALYNEGWWEGTVERVLDRMQYRVYFKGTEDRMVCHH  303

Query  191   HGLRLHQEWINGAW  150
               LRLHQ+W+NG W
Sbjct  304   SELRLHQDWVNGKW  317


 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 101/332 (30%), Positives = 155/332 (47%), Gaps = 36/332 (11%)
 Frame = -3

Query  2054  AEAQFNKGDRVEVL-----MRDNFPIWFPAAVLRPSVRKNQRAGQIYVEFETLCSDDDPM  1890
             A  +F  G  VE+      +R      FP  ++ PS RK        VE+ TL