BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19852_g2_i1 len=926 path=[629:0-925]

Length=926
                                                                      Score     E

ref|XP_004240351.1|  PREDICTED: transcription factor MYB48-like       62.4    5e-08   
ref|XP_009770621.1|  PREDICTED: transcription factor MYB48-like       62.0    8e-08   
ref|XP_009597408.1|  PREDICTED: transcription factor MYB48-like       58.9    1e-06   
ref|XP_009792963.1|  PREDICTED: transcription factor MYB48-like       54.3    3e-05   
ref|XP_011089822.1|  PREDICTED: transcription factor MYB48-like i...  53.9    4e-05   
ref|XP_011089823.1|  PREDICTED: transcription factor MYB48-like i...  53.9    4e-05   
ref|XP_011089426.1|  PREDICTED: transcription factor MYB48            52.8    1e-04   
gb|EYU36252.1|  hypothetical protein MIMGU_mgv1a015420mg              48.9    7e-04   
gb|KDP44191.1|  hypothetical protein JCGZ_05658                       50.1    8e-04   



>ref|XP_004240351.1| PREDICTED: transcription factor MYB48-like [Solanum lycopersicum]
Length=235

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 85/171 (50%), Gaps = 31/171 (18%)
 Frame = -2

Query  925  NEIKNYWRTQMRKEAHDkkkkkqqqKgggggassspsslsnssssssgspgeeSTPAVVG  746
            NEIKNYWRT MRK+AHD++K            S+S S  SNS            TP +  
Sbjct  96   NEIKNYWRTHMRKKAHDERKNNASSFSPSSSFSNSSSFSSNSPDVDF-------TP-IKK  147

Query  745  ANERAFYDTGGFVEAPPPPPRADNGEKMGGGVKVYSMDEIWKAIESPEIQESHGGGERSM  566
             NER FYDTGG         + ++G+KM    KVYSMDEIWK IE  +I E+     + +
Sbjct  148  NNERNFYDTGGL-------DKKNDGDKM----KVYSMDEIWKDIELSQISETMDNI-KPI  195

Query  565  IGSAIWDDYSVWTMDYDYQEDERNLVAPVSDQFYSWFDNQLDFAHNTFLTG  413
            + S IW +Y   T+    +E+ +     +  QFY      LD   NTF  G
Sbjct  196  MPSPIW-NYCPNTLWMSNEEETK-----MFPQFYC-----LDNQDNTFFAG  235



>ref|XP_009770621.1| PREDICTED: transcription factor MYB48-like [Nicotiana sylvestris]
Length=252

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 81/180 (45%), Gaps = 32/180 (18%)
 Frame = -2

Query  925  NEIKNYWRTQMRKEAHDkkkkkqqqKgggggassspsslsnssssssgspgeeSTPAVVG  746
            NEIKNYWRT MRK+A D +K K         ++ S    SNS               +  
Sbjct  96   NEIKNYWRTHMRKKAQDDRKNKASISPSSSFSNCSSYFSSNSPDVEFM--------PITE  147

Query  745  ANERAFYDTGGFVEAPPPPPRADNGEKM------GGGVKVYSMDEIWKAIESPEIQESHG  584
             NER FYDTGG +         + G+K       G  +KVYSMDEIWK IE   + E + 
Sbjct  148  NNERNFYDTGGLLGVHEQISLQNAGKKKVGDQEKGKSMKVYSMDEIWKDIEL--LSEEND  205

Query  583  GGERSMIGSAIWD---DYSVWTMDYDYQEDERNLVAPVSDQFYSWFDNQLDFAHNTFLTG  413
               + ++ S +W+   D ++W  D    E+E  +      QFY      LD   NTF  G
Sbjct  206  TKNKPILPSTMWEYCPDSTLWMTD----EEETKMFP----QFYC-----LDNQDNTFFIG  252



>ref|XP_009597408.1| PREDICTED: transcription factor MYB48-like [Nicotiana tomentosiformis]
Length=253

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 81/180 (45%), Gaps = 31/180 (17%)
 Frame = -2

Query  925  NEIKNYWRTQMRKEAHDkkkkkqqqKgggggassspsslsnssssssgspgeeSTPAVVG  746
            NEIKNYWRT MRK+A D +K K         ++ S    SNS               +  
Sbjct  96   NEIKNYWRTHMRKKAQDDRKNKASISPSSSFSNCSSYFSSNSPDVDFM--------PITE  147

Query  745  ANERAFYDTGGFVEAPPPPPRADNGEKM------GGGVKVYSMDEIWKAIESPEIQESHG  584
             NER FYDTGG +         + G+K       G  +KVYSMDEIWK IE    +E+  
Sbjct  148  NNERNFYDTGGLLGVHEQSSLQNAGKKKVGDQEKGKSMKVYSMDEIWKDIELLS-EENEK  206

Query  583  GGERSMIGSAIWD---DYSVWTMDYDYQEDERNLVAPVSDQFYSWFDNQLDFAHNTFLTG  413
              +  +  S +W+   D ++W  D    E+E  +      QFY      LD   N+F TG
Sbjct  207  KNKPILPISTMWEYCPDSTLWMTD----EEETKMFP----QFYC-----LDNQDNSFFTG  253



>ref|XP_009792963.1| PREDICTED: transcription factor MYB48-like [Nicotiana sylvestris]
Length=220

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 67/130 (52%), Gaps = 24/130 (18%)
 Frame = -2

Query  925  NEIKNYWRTQMRKEAHDkkkkkqqqKgggggassspsslsnssssssgspgeeSTPAVVG  746
            NEIKNYWRT MRK+A +++KK          ++ S SS+++                   
Sbjct  96   NEIKNYWRTHMRKKAQEQRKKATSISPSSSFSNCSSSSITHE------------------  137

Query  745  ANERAFYDTGGFVEAP-PPPPRADNGEKMGGGVKVYSMDEIWKAIESPEIQESHGGGERS  569
             NER FYDTGG  +       + ++ E+ G  +KVYSMDEIWK IE  E  E+     + 
Sbjct  138  ENERNFYDTGGIEQLQVEEQKKVNDQEQAGESMKVYSMDEIWKDIELLEENETIN---KP  194

Query  568  MIGSA--IWD  545
            ++GS   +WD
Sbjct  195  IMGSISPLWD  204



>ref|XP_011089822.1| PREDICTED: transcription factor MYB48-like isoform X1 [Sesamum 
indicum]
Length=238

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 83/164 (51%), Gaps = 15/164 (9%)
 Frame = -2

Query  925  NEIKNYWRTQMRKEAHDkkkkkqqqKgggggassspsslsnssssssgspgeeSTPAVVG  746
            NEIKNYWRT MRK A ++KK            SS+ SS S S+S ++       TPA+  
Sbjct  77   NEIKNYWRTHMRKMAQERKKGAASPSVSASSLSSNSSSSSISNSPTAELIS---TPAL-Q  132

Query  745  ANERAFYDTGGF-VEAPPPPPRADNGEKMGGGVKVYSMDEIWKAIESPEIQESHGGGERS  569
            A E +FYDTGG  + A  P  +     K     KVYSM++IW+  E  + +  +      
Sbjct  133  AKEHSFYDTGGMELMAAAPGEKKITSSKAEESPKVYSMEDIWEDFEFSQ-ENCNQLMTCQ  191

Query  568  MIGSAIWD----DYS--VWTMDYDYQEDERNLVAPVSDQFYSWF  455
             + S IWD    D+S  +W+MD   +E+ R  + P+ D  +  F
Sbjct  192  AVASPIWDYCPTDHSLQLWSMD---EEESRLPMQPIGDDHFHSF  232



>ref|XP_011089823.1| PREDICTED: transcription factor MYB48-like isoform X2 [Sesamum 
indicum]
Length=258

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 83/164 (51%), Gaps = 15/164 (9%)
 Frame = -2

Query  925  NEIKNYWRTQMRKEAHDkkkkkqqqKgggggassspsslsnssssssgspgeeSTPAVVG  746
            NEIKNYWRT MRK A ++KK            SS+ SS S S+S ++       TPA+  
Sbjct  97   NEIKNYWRTHMRKMAQERKKGAASPSVSASSLSSNSSSSSISNSPTAELIS---TPAL-Q  152

Query  745  ANERAFYDTGGF-VEAPPPPPRADNGEKMGGGVKVYSMDEIWKAIESPEIQESHGGGERS  569
            A E +FYDTGG  + A  P  +     K     KVYSM++IW+  E  + +  +      
Sbjct  153  AKEHSFYDTGGMELMAAAPGEKKITSSKAEESPKVYSMEDIWEDFEFSQ-ENCNQLMTCQ  211

Query  568  MIGSAIWD----DYS--VWTMDYDYQEDERNLVAPVSDQFYSWF  455
             + S IWD    D+S  +W+MD   +E+ R  + P+ D  +  F
Sbjct  212  AVASPIWDYCPTDHSLQLWSMD---EEESRLPMQPIGDDHFHSF  252



>ref|XP_011089426.1| PREDICTED: transcription factor MYB48 [Sesamum indicum]
Length=241

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 71/144 (49%), Gaps = 28/144 (19%)
 Frame = -2

Query  925  NEIKNYWRTQMRKEAHDkkkkkqqqKgggggassspsslsnssssssgspgeeSTPAV--  752
            NEIKNYWRT MRK+A ++KK           +SSS S+                +PAV  
Sbjct  97   NEIKNYWRTHMRKKAQERKKTSIISPTSPSSSSSSNSN----------------SPAVGF  140

Query  751  ---VGANERAFYDTGGFVEAPPPPPRADNGEKMGGGVKVYSMDEIWKAIE-SPEIQESHG  584
               +    R+FYDTGG   A     + ++G ++ G  +VYSMDEIWK IE S E      
Sbjct  141  EPMIETEGRSFYDTGGVDIATG---QNNSGVEIEGSAEVYSMDEIWKDIELSEESSNLRS  197

Query  583  GGERSMIGSAIWDDY---SVWTMD  521
             G  S     IWD +   S+W+MD
Sbjct  198  QGVMSSSTPPIWDFWAADSLWSMD  221



>gb|EYU36252.1| hypothetical protein MIMGU_mgv1a015420mg [Erythranthe guttata]
Length=158

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 57/121 (47%), Gaps = 36/121 (30%)
 Frame = -2

Query  745  ANERAFYDTGGF----VEAPPPPPRADNGEKMGGGVK--------VYSMDEIWKAIESPE  602
            A E +FYDTGG     +  P      + GE    GV+        VYSMD++WK  E   
Sbjct  42   AKETSFYDTGGVEIKDLMIPAAAAAVEPGESKKNGVELAKSGTKEVYSMDDLWKEFE---  98

Query  601  IQESHGGGERS-----MIGSAIW------DDYSVWTMDYDYQEDERN--LVAPVSDQFYS  461
                   GER       + S IW      DD  +W+MD   +EDE++  L+ P+ DQFYS
Sbjct  99   -----FSGERCELTWQTVVSPIWDYCPSNDDSFLWSMD---EEDEKSKMLMQPMGDQFYS  150

Query  460  W  458
            +
Sbjct  151  F  151



>gb|KDP44191.1| hypothetical protein JCGZ_05658 [Jatropha curcas]
 gb|AIT52231.1| MYB family protein [Jatropha curcas]
Length=242

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 54/106 (51%), Gaps = 16/106 (15%)
 Frame = -2

Query  925  NEIKNYWRTQMRKEAHDkkkkkqqqKgggggassspsslsnssssssgspgeeSTPAVVG  746
            NEIKNYWRT MRK+A                  +   S S+S+SS + +    ++P    
Sbjct  98   NEIKNYWRTHMRKKAQ-------------ARKRAMSPSQSSSNSSPTSNITTVNSPPFPE  144

Query  745  ANERAFYDTGGFVEAPPPPPRADNGEKMGGGVKVYSMDEIWKAIES  608
              E +FYDTGG   A   P    N E + GG K YSMD+IWK IE+
Sbjct  145  TGEASFYDTGG---ADSSPSGEKNSEAVQGGEKGYSMDDIWKDIEN  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1948488333440