BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19842_g1_i1 len=176 path=[161:0-21 134:22-64 225:65-110 270:111-139
108:140-175]

Length=176
                                                                      Score     E

ref|XP_010088632.1|  putative LRR receptor-like serine/threonine-...  77.4    9e-15   
ref|XP_010088631.1|  putative leucine-rich repeat receptor-like s...  72.8    4e-13   
ref|XP_010112408.1|  putative leucine-rich repeat receptor-like s...  71.2    2e-12   
emb|CBI30750.3|  unnamed protein product                              70.5    2e-12   
ref|XP_010655585.1|  PREDICTED: probable LRR receptor-like serine...  70.9    2e-12   
ref|XP_010655584.1|  PREDICTED: probable LRR receptor-like serine...  70.9    2e-12   
ref|XP_010655583.1|  PREDICTED: probable LRR receptor-like serine...  70.9    3e-12   
ref|XP_010655564.1|  PREDICTED: probable LRR receptor-like serine...  70.5    4e-12   
ref|XP_010655563.1|  PREDICTED: probable LRR receptor-like serine...  70.5    4e-12   
ref|XP_010655562.1|  PREDICTED: probable LRR receptor-like serine...  70.5    4e-12   
ref|XP_006377456.1|  hypothetical protein POPTR_0011s06100g           69.7    4e-12   
ref|XP_002317379.2|  hypothetical protein POPTR_0011s080203g          67.0    8e-12   Populus trichocarpa [western balsam poplar]
ref|XP_007025270.1|  Leucine-rich repeat transmembrane protein ki...  68.9    1e-11   
ref|XP_008225419.1|  PREDICTED: probable leucine-rich repeat rece...  68.9    1e-11   
ref|XP_007214558.1|  hypothetical protein PRUPE_ppa000742mg           68.9    1e-11   
ref|XP_009600347.1|  PREDICTED: probable LRR receptor-like serine...  68.6    2e-11   
ref|XP_006377518.1|  hypothetical protein POPTR_0011s066201g          68.2    2e-11   
ref|XP_007214549.1|  hypothetical protein PRUPE_ppa001005mg           68.2    2e-11   
ref|XP_007213704.1|  hypothetical protein PRUPE_ppa000741mg           68.2    2e-11   
ref|XP_008245181.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  68.2    2e-11   
ref|XP_011002042.1|  PREDICTED: probable LRR receptor-like serine...  67.8    3e-11   
ref|XP_011002040.1|  PREDICTED: probable LRR receptor-like serine...  67.8    3e-11   
ref|XP_011002039.1|  PREDICTED: probable LRR receptor-like serine...  67.8    3e-11   
ref|XP_011002041.1|  PREDICTED: probable LRR receptor-like serine...  67.8    3e-11   
emb|CDO96888.1|  unnamed protein product                              67.4    3e-11   
emb|CBI30743.3|  unnamed protein product                              67.0    3e-11   
ref|XP_006377525.1|  putative receptor-like protein kinase RLPK1      67.0    4e-11   
ref|XP_006377507.1|  hypothetical protein POPTR_0011s065502g          65.9    5e-11   
ref|XP_006377511.1|  hypothetical protein POPTR_0011s065701g          66.6    5e-11   
ref|XP_006358077.1|  PREDICTED: probable LRR receptor-like serine...  66.2    1e-10   
ref|XP_004233025.1|  PREDICTED: probable LRR receptor-like serine...  66.2    1e-10   
ref|XP_007025267.1|  Leucine-rich repeat transmembrane protein ki...  66.2    1e-10   
ref|XP_004295408.1|  PREDICTED: probable LRR receptor-like serine...  65.5    2e-10   
ref|XP_010247775.1|  PREDICTED: probable leucine-rich repeat rece...  65.5    2e-10   
ref|XP_006371021.1|  hypothetical protein POPTR_0019s027201g          65.1    2e-10   
ref|XP_007025268.1|  Leucine-rich repeat transmembrane protein ki...  65.1    2e-10   
ref|XP_009795508.1|  PREDICTED: probable LRR receptor-like serine...  65.5    2e-10   
ref|XP_010247772.1|  PREDICTED: probable leucine-rich repeat rece...  65.1    2e-10   
emb|CBI30754.3|  unnamed protein product                              64.7    2e-10   
ref|XP_007213678.1|  hypothetical protein PRUPE_ppa000939mg           65.1    3e-10   
ref|XP_010655590.1|  PREDICTED: probable LRR receptor-like serine...  64.7    3e-10   
ref|XP_009795509.1|  PREDICTED: probable LRR receptor-like serine...  64.7    3e-10   
ref|XP_010655588.1|  PREDICTED: probable LRR receptor-like serine...  64.3    5e-10   
ref|XP_010655589.1|  PREDICTED: probable LRR receptor-like serine...  64.3    5e-10   
ref|XP_011045704.1|  PREDICTED: probable LRR receptor-like serine...  64.3    5e-10   
ref|XP_006358076.1|  PREDICTED: probable LRR receptor-like serine...  64.3    5e-10   
ref|XP_002522278.1|  kinase, putative                                 64.3    5e-10   Ricinus communis
ref|XP_006358075.1|  PREDICTED: probable LRR receptor-like serine...  64.3    5e-10   
ref|XP_011045702.1|  PREDICTED: probable LRR receptor-like serine...  64.3    5e-10   
ref|XP_010088635.1|  putative LRR receptor-like serine/threonine-...  63.5    6e-10   
ref|XP_002300205.2|  hypothetical protein POPTR_0001s31610g           63.9    7e-10   Populus trichocarpa [western balsam poplar]
ref|XP_009600351.1|  PREDICTED: probable LRR receptor-like serine...  63.5    8e-10   
ref|XP_008347521.1|  PREDICTED: probable leucine-rich repeat rece...  63.5    8e-10   
ref|XP_008345983.1|  PREDICTED: probable LRR receptor-like serine...  63.2    8e-10   
ref|XP_009600350.1|  PREDICTED: probable LRR receptor-like serine...  63.5    8e-10   
ref|XP_008225418.1|  PREDICTED: probable LRR receptor-like serine...  63.5    9e-10   
ref|XP_008225417.1|  PREDICTED: probable LRR receptor-like serine...  63.5    9e-10   
ref|XP_009600349.1|  PREDICTED: probable LRR receptor-like serine...  63.5    1e-09   
ref|XP_009758721.1|  PREDICTED: probable LRR receptor-like serine...  62.8    1e-09   
ref|XP_009600352.1|  PREDICTED: probable LRR receptor-like serine...  63.2    1e-09   
ref|XP_009600348.1|  PREDICTED: probable LRR receptor-like serine...  63.2    1e-09   
ref|XP_008245184.1|  PREDICTED: probable leucine-rich repeat rece...  63.2    1e-09   
ref|XP_002283596.2|  PREDICTED: probable leucine-rich repeat rece...  63.2    1e-09   Vitis vinifera
ref|XP_006358134.1|  PREDICTED: probable LRR receptor-like serine...  63.2    1e-09   
gb|KDP21156.1|  hypothetical protein JCGZ_21627                       63.2    1e-09   
emb|CBI20124.3|  unnamed protein product                              63.2    1e-09   
ref|XP_008371519.1|  PREDICTED: probable LRR receptor-like serine...  62.8    1e-09   
ref|XP_011046350.1|  PREDICTED: probable LRR receptor-like serine...  62.8    2e-09   
ref|XP_008225260.1|  PREDICTED: probable leucine-rich repeat rece...  62.8    2e-09   
ref|XP_002325753.2|  hypothetical protein POPTR_0019s01950g           62.4    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_008377580.1|  PREDICTED: probable LRR receptor-like serine...  62.4    2e-09   
ref|XP_011098190.1|  PREDICTED: probable LRR receptor-like serine...  62.4    2e-09   
ref|XP_010247776.1|  PREDICTED: probable LRR receptor-like serine...  62.0    3e-09   
ref|XP_010246510.1|  PREDICTED: probable leucine-rich repeat rece...  62.0    3e-09   
ref|XP_006377505.1|  hypothetical protein POPTR_0011s065402g          60.5    5e-09   
emb|CDP06041.1|  unnamed protein product                              61.2    6e-09   
gb|KHN19486.1|  Putative leucine-rich repeat receptor-like serine...  61.2    6e-09   
gb|KHG25892.1|  putative leucine-rich repeat receptor-like serine...  60.8    7e-09   
ref|XP_002283578.2|  PREDICTED: probable leucine-rich repeat rece...  60.8    7e-09   Vitis vinifera
ref|XP_006593302.1|  PREDICTED: probable leucine-rich repeat rece...  60.8    7e-09   
ref|XP_010316867.1|  PREDICTED: probable LRR receptor-like serine...  60.8    7e-09   
ref|XP_011101928.1|  PREDICTED: probable leucine-rich repeat rece...  60.5    8e-09   
ref|XP_011102303.1|  PREDICTED: probable LRR receptor-like serine...  60.1    9e-09   
ref|XP_004295405.1|  PREDICTED: probable leucine-rich repeat rece...  60.8    9e-09   
ref|XP_011046381.1|  PREDICTED: probable leucine-rich repeat rece...  60.5    1e-08   
ref|XP_006377459.1|  hypothetical protein POPTR_0011s06130g           60.1    1e-08   
ref|XP_002317319.2|  hypothetical protein POPTR_0011s032002g          60.1    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_006377501.1|  hypothetical protein POPTR_0011s06490g           60.1    1e-08   
emb|CAN65055.1|  hypothetical protein VITISV_012378                   60.1    1e-08   Vitis vinifera
gb|ABF72021.1|  protein kinase family protein                         60.1    1e-08   Musa acuminata [banana]
ref|XP_004295407.1|  PREDICTED: probable LRR receptor-like serine...  60.5    1e-08   
ref|XP_010655586.1|  PREDICTED: probable LRR receptor-like serine...  60.1    1e-08   
emb|CBI20127.3|  unnamed protein product                              60.1    1e-08   
ref|XP_010246509.1|  PREDICTED: probable leucine-rich repeat rece...  60.1    1e-08   
emb|CBI30748.3|  unnamed protein product                              60.1    1e-08   
ref|XP_011002048.1|  PREDICTED: probable LRR receptor-like serine...  59.7    2e-08   
ref|XP_010655559.1|  PREDICTED: probable LRR receptor-like serine...  59.7    2e-08   
emb|CAN66180.1|  hypothetical protein VITISV_025180                   59.3    2e-08   Vitis vinifera
ref|XP_009351824.1|  PREDICTED: probable LRR receptor-like serine...  59.7    2e-08   
ref|XP_009351815.1|  PREDICTED: probable LRR receptor-like serine...  59.7    2e-08   
ref|XP_010655558.1|  PREDICTED: probable LRR receptor-like serine...  59.7    2e-08   
ref|XP_009351806.1|  PREDICTED: probable LRR receptor-like serine...  59.7    2e-08   
ref|XP_009406150.1|  PREDICTED: probable LRR receptor-like serine...  59.7    2e-08   
emb|CBI30745.3|  unnamed protein product                              59.7    2e-08   
ref|XP_011002046.1|  PREDICTED: probable LRR receptor-like serine...  59.7    2e-08   
ref|XP_011002045.1|  PREDICTED: probable LRR receptor-like serine...  59.7    2e-08   
ref|XP_009351800.1|  PREDICTED: probable LRR receptor-like serine...  59.7    2e-08   
ref|XP_011002049.1|  PREDICTED: probable LRR receptor-like serine...  59.7    2e-08   
ref|XP_011002044.1|  PREDICTED: probable LRR receptor-like serine...  59.7    2e-08   
gb|ABF70094.1|  protein kinase, putative                              59.3    2e-08   Musa balbisiana [starchy banana]
ref|XP_011002050.1|  PREDICTED: probable LRR receptor-like serine...  59.7    2e-08   
ref|XP_011098063.1|  PREDICTED: probable LRR receptor-like serine...  59.7    2e-08   
emb|CDP06039.1|  unnamed protein product                              59.3    2e-08   
ref|XP_010273494.1|  PREDICTED: probable leucine-rich repeat rece...  59.3    2e-08   
emb|CAN74151.1|  hypothetical protein VITISV_028028                   59.3    2e-08   Vitis vinifera
gb|KDO42388.1|  hypothetical protein CISIN_1g001767mg                 59.3    2e-08   
ref|XP_006377483.1|  putative receptor-like protein kinase RLPK1      59.3    2e-08   
ref|XP_006477836.1|  PREDICTED: probable LRR receptor-like serine...  59.3    2e-08   
ref|XP_006442369.1|  hypothetical protein CICLE_v10018721mg           59.3    2e-08   
ref|XP_011002047.1|  PREDICTED: probable LRR receptor-like serine...  59.3    2e-08   
ref|XP_003634703.1|  PREDICTED: probable leucine-rich repeat rece...  59.3    2e-08   
ref|XP_009406149.1|  PREDICTED: probable LRR receptor-like serine...  59.3    2e-08   
gb|KGN53588.1|  hypothetical protein Csa_4G083620                     59.3    3e-08   
ref|XP_004137308.1|  PREDICTED: probable LRR receptor-like serine...  59.3    3e-08   
ref|XP_011082789.1|  PREDICTED: probable leucine-rich repeat rece...  58.9    3e-08   
gb|KDO42390.1|  hypothetical protein CISIN_1g001767mg                 58.9    3e-08   
ref|XP_010655578.1|  PREDICTED: probable LRR receptor-like serine...  58.5    4e-08   
emb|CAN81177.1|  hypothetical protein VITISV_011951                   58.5    4e-08   Vitis vinifera
ref|XP_010655576.1|  PREDICTED: probable LRR receptor-like serine...  58.5    4e-08   
ref|XP_010655575.1|  PREDICTED: probable LRR receptor-like serine...  58.5    4e-08   
ref|XP_010655574.1|  PREDICTED: probable LRR receptor-like serine...  58.5    4e-08   
gb|KDO42386.1|  hypothetical protein CISIN_1g0041552mg                58.2    4e-08   
gb|AES66484.2|  cysteine-rich RLK (receptor-like kinase) protein      58.2    4e-08   
ref|XP_009351856.1|  PREDICTED: probable LRR receptor-like serine...  58.5    5e-08   
ref|XP_010655579.1|  PREDICTED: probable leucine-rich repeat rece...  58.5    5e-08   
ref|XP_010655577.1|  PREDICTED: probable LRR receptor-like serine...  58.2    5e-08   
emb|CBI20121.3|  unnamed protein product                              58.2    5e-08   
ref|XP_006442368.1|  hypothetical protein CICLE_v10018771mg           58.2    6e-08   
gb|KDO52103.1|  hypothetical protein CISIN_1g043333mg                 58.2    6e-08   
ref|XP_010272733.1|  PREDICTED: probable LRR receptor-like serine...  58.2    6e-08   
gb|KDP23043.1|  hypothetical protein JCGZ_00508                       57.8    6e-08   
ref|XP_006442308.1|  hypothetical protein CICLE_v10024314mg           58.2    6e-08   
ref|XP_010272732.1|  PREDICTED: probable LRR receptor-like serine...  58.2    6e-08   
ref|XP_004295664.1|  PREDICTED: probable leucine-rich repeat rece...  58.2    7e-08   
gb|KDP24894.1|  hypothetical protein JCGZ_25156                       57.8    7e-08   
ref|XP_010655560.1|  PREDICTED: probable LRR receptor-like serine...  57.8    7e-08   
ref|XP_008366034.1|  PREDICTED: probable LRR receptor-like serine...  57.8    8e-08   
gb|KDO49310.1|  hypothetical protein CISIN_1g040908mg                 57.8    8e-08   
ref|XP_011046349.1|  PREDICTED: probable LRR receptor-like serine...  57.8    8e-08   
ref|XP_006477833.1|  PREDICTED: probable leucine-rich repeat rece...  57.8    9e-08   
ref|XP_006442357.1|  hypothetical protein CICLE_v10018686mg           57.8    9e-08   
ref|XP_008371728.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  57.8    9e-08   
ref|XP_002317383.2|  hypothetical protein POPTR_0011s06220g           57.4    9e-08   Populus trichocarpa [western balsam poplar]
gb|AES66480.2|  LRR receptor-like kinase                              57.0    9e-08   
ref|XP_010655561.1|  PREDICTED: probable leucine-rich repeat rece...  57.4    1e-07   
emb|CBI30744.3|  unnamed protein product                              57.4    1e-07   
ref|XP_010273522.1|  PREDICTED: probable leucine-rich repeat rece...  56.6    1e-07   
ref|XP_006370933.1|  putative receptor-like protein kinase RLPK1      57.0    1e-07   
ref|XP_004488998.1|  PREDICTED: probable leucine-rich repeat rece...  57.0    1e-07   
ref|XP_007214035.1|  hypothetical protein PRUPE_ppa017351mg           57.0    1e-07   
ref|XP_006377471.1|  hypothetical protein POPTR_0011s06260g           56.6    1e-07   
ref|XP_003596229.1|  Leucine-rich repeat family protein / protein...  56.6    2e-07   
ref|XP_006377472.1|  hypothetical protein POPTR_0011s06260g           56.6    2e-07   
ref|XP_008225432.1|  PREDICTED: probable LRR receptor-like serine...  56.6    2e-07   
ref|XP_008358125.1|  PREDICTED: probable leucine-rich repeat rece...  56.2    2e-07   
gb|KEH38577.1|  LRR receptor-like kinase                              56.6    2e-07   
ref|XP_008225247.1|  PREDICTED: probable LRR receptor-like serine...  56.6    2e-07   
ref|XP_008225246.1|  PREDICTED: probable LRR receptor-like serine...  56.6    2e-07   
gb|KEH38578.1|  LRR receptor-like kinase                              56.2    2e-07   
ref|XP_007048782.1|  Leucine-rich repeat transmembrane protein ki...  56.2    2e-07   
emb|CBI20126.3|  unnamed protein product                              54.3    2e-07   
ref|XP_007048781.1|  Leucine-rich repeat transmembrane protein ki...  56.2    2e-07   
emb|CBI20136.3|  unnamed protein product                              56.2    2e-07   
ref|XP_011009654.1|  PREDICTED: probable LRR receptor-like serine...  56.2    2e-07   
ref|XP_002528777.1|  ATP binding protein, putative                    56.2    3e-07   Ricinus communis
ref|XP_011009653.1|  PREDICTED: probable LRR receptor-like serine...  56.2    3e-07   
ref|XP_011009652.1|  PREDICTED: probable LRR receptor-like serine...  56.2    3e-07   
ref|XP_007048780.1|  Leucine-rich repeat transmembrane protein ki...  56.2    3e-07   
ref|XP_007021938.1|  Leucine-rich repeat transmembrane protein ki...  55.8    3e-07   
emb|CBI20123.3|  unnamed protein product                              53.1    4e-07   
ref|XP_006358135.1|  PREDICTED: probable LRR receptor-like serine...  55.8    4e-07   
gb|KCW74191.1|  hypothetical protein EUGRSUZ_E02839                   55.8    4e-07   
ref|XP_010057167.1|  PREDICTED: probable LRR receptor-like serine...  55.8    4e-07   
ref|XP_010057166.1|  PREDICTED: probable LRR receptor-like serine...  55.8    4e-07   
ref|XP_010316864.1|  PREDICTED: probable LRR receptor-like serine...  55.8    4e-07   
ref|XP_007025275.1|  Receptor-like kinase in flowers 1, putative      55.8    4e-07   
gb|EYU28129.1|  hypothetical protein MIMGU_mgv1a025582mg              55.8    4e-07   
ref|XP_007021935.1|  Leucine-rich repeat transmembrane protein ki...  55.8    4e-07   
ref|XP_010316863.1|  PREDICTED: probable LRR receptor-like serine...  55.8    4e-07   
ref|XP_006477897.1|  PREDICTED: probable leucine-rich repeat rece...  55.5    4e-07   
ref|XP_010316862.1|  PREDICTED: probable LRR receptor-like serine...  55.8    4e-07   
ref|XP_002524511.1|  ATP binding protein, putative                    55.5    4e-07   Ricinus communis
ref|XP_006377463.1|  hypothetical protein POPTR_0011s06170g           54.7    5e-07   
ref|XP_002532988.1|  conserved hypothetical protein                   55.5    5e-07   Ricinus communis
ref|XP_010272742.1|  PREDICTED: probable leucine-rich repeat rece...  55.5    5e-07   
ref|XP_006377260.1|  hypothetical protein POPTR_0011s03210g           55.1    5e-07   
ref|XP_010272741.1|  PREDICTED: probable LRR receptor-like serine...  55.5    5e-07   
ref|XP_006371019.1|  hypothetical protein POPTR_0019s027001g          55.1    5e-07   
ref|XP_004296291.1|  PREDICTED: probable leucine-rich repeat rece...  55.5    5e-07   
gb|KHG01342.1|  hypothetical protein F383_21253                       54.7    6e-07   
ref|XP_007213636.1|  hypothetical protein PRUPE_ppa001834mg           55.1    6e-07   
ref|XP_007025266.1|  Leucine-rich repeat transmembrane protein ki...  55.5    6e-07   
ref|XP_010316866.1|  PREDICTED: probable LRR receptor-like serine...  55.1    6e-07   
ref|XP_006377512.1|  hypothetical protein POPTR_0011s06580g           53.9    6e-07   
ref|XP_006358079.1|  PREDICTED: probable LRR receptor-like serine...  55.1    7e-07   
gb|AES66493.2|  LRR receptor-like kinase                              55.1    7e-07   
ref|XP_011002767.1|  PREDICTED: probable leucine-rich repeat rece...  55.1    7e-07   
ref|XP_002305716.2|  hypothetical protein POPTR_0004s06180g           55.1    8e-07   Populus trichocarpa [western balsam poplar]
emb|CAN76712.1|  hypothetical protein VITISV_022379                   54.3    8e-07   Vitis vinifera
ref|XP_010246513.1|  PREDICTED: probable leucine-rich repeat rece...  54.7    8e-07   
ref|XP_003596244.1|  Receptor-like serine/threonine kinase            54.7    9e-07   
gb|KCW45470.1|  hypothetical protein EUGRSUZ_L008133                  51.6    9e-07   
gb|KHG04296.1|  hypothetical protein F383_04630                       54.7    9e-07   
gb|KHG04295.1|  hypothetical protein F383_04630                       54.7    9e-07   
gb|KHG22690.1|  putative leucine-rich repeat receptor-like serine...  54.3    1e-06   
ref|XP_007025276.1|  Receptor-like kinase in flowers 1, putative      54.7    1e-06   
ref|XP_010273486.1|  PREDICTED: probable leucine-rich repeat rece...  54.7    1e-06   
gb|AES66495.2|  LRR receptor-like kinase                              54.3    1e-06   
dbj|BAJ53166.1|  JHL10I11.12                                          54.3    1e-06   
ref|XP_002306015.2|  hypothetical protein POPTR_0004s14310g           54.3    1e-06   Populus trichocarpa [western balsam poplar]
gb|KDP20042.1|  hypothetical protein JCGZ_05811                       54.3    1e-06   
gb|KDP27082.1|  hypothetical protein JCGZ_20306                       53.9    2e-06   
ref|XP_006371027.1|  hypothetical protein POPTR_0019s02760g           53.9    2e-06   
emb|CAN70381.1|  hypothetical protein VITISV_020134                   53.9    2e-06   Vitis vinifera
ref|XP_004295665.1|  PREDICTED: probable leucine-rich repeat rece...  54.3    2e-06   
ref|XP_008451726.1|  PREDICTED: probable LRR receptor-like serine...  53.9    2e-06   
ref|XP_008451725.1|  PREDICTED: probable LRR receptor-like serine...  53.9    2e-06   
ref|XP_010273497.1|  PREDICTED: probable leucine-rich repeat rece...  53.5    2e-06   
ref|XP_010273495.1|  PREDICTED: probable leucine-rich repeat rece...  53.5    2e-06   
ref|XP_010273493.1|  PREDICTED: probable leucine-rich repeat rece...  53.5    2e-06   
ref|XP_009352711.1|  PREDICTED: probable LRR receptor-like serine...  53.5    2e-06   
ref|XP_009352710.1|  PREDICTED: probable LRR receptor-like serine...  53.5    2e-06   
ref|XP_009352709.1|  PREDICTED: probable LRR receptor-like serine...  53.5    2e-06   
ref|XP_007021941.1|  Leucine-rich repeat transmembrane protein ki...  53.5    2e-06   
ref|XP_009352708.1|  PREDICTED: probable LRR receptor-like serine...  53.5    2e-06   
ref|XP_009352707.1|  PREDICTED: probable LRR receptor-like serine...  53.5    2e-06   
ref|XP_009351793.1|  PREDICTED: probable LRR receptor-like serine...  53.5    2e-06   
ref|XP_002865794.1|  predicted protein                                53.5    2e-06   
ref|XP_009604354.1|  PREDICTED: probable LRR receptor-like serine...  53.5    3e-06   
ref|XP_009351138.1|  PREDICTED: probable LRR receptor-like serine...  53.1    3e-06   
ref|XP_007021942.1|  Leucine-rich repeat transmembrane protein ki...  53.1    3e-06   
ref|XP_008226376.1|  PREDICTED: probable leucine-rich repeat rece...  53.5    3e-06   
emb|CBI20129.3|  unnamed protein product                              52.8    3e-06   
ref|XP_007021940.1|  Leucine-rich repeat transmembrane protein ki...  53.1    3e-06   
ref|XP_010057165.1|  PREDICTED: probable LRR receptor-like serine...  53.1    3e-06   
ref|XP_010655557.1|  PREDICTED: probable LRR receptor-like serine...  53.1    3e-06   
ref|XP_010655556.1|  PREDICTED: probable LRR receptor-like serine...  53.1    3e-06   
ref|XP_011010609.1|  PREDICTED: probable LRR receptor-like serine...  53.1    3e-06   
ref|XP_006377497.1|  hypothetical protein POPTR_0011s06460g           52.0    4e-06   
emb|CBI30739.3|  unnamed protein product                              52.8    4e-06   
ref|XP_006370936.1|  hypothetical protein POPTR_0019s01930g           52.8    4e-06   
ref|XP_011010608.1|  PREDICTED: probable LRR receptor-like serine...  53.1    4e-06   
ref|XP_007149541.1|  hypothetical protein PHAVU_005G078900g           53.1    4e-06   
ref|XP_006371024.1|  hypothetical protein POPTR_0019s027404g          52.0    4e-06   
ref|XP_010655572.1|  PREDICTED: probable LRR receptor-like serine...  52.8    4e-06   
ref|XP_011039371.1|  PREDICTED: probable LRR receptor-like serine...  52.8    4e-06   
gb|KDP21155.1|  hypothetical protein JCGZ_21626                       52.4    5e-06   
gb|KHN36922.1|  Putative leucine-rich repeat receptor-like serine...  52.8    5e-06   
ref|NP_001237014.1|  receptor-like protein kinase 2-like precursor    52.8    5e-06   
ref|XP_002892411.1|  hypothetical protein ARALYDRAFT_470791           52.8    5e-06   
ref|XP_010457957.1|  PREDICTED: probable LRR receptor-like serine...  52.8    5e-06   
ref|XP_011014229.1|  PREDICTED: probable leucine-rich repeat rece...  52.4    5e-06   
ref|XP_011046365.1|  PREDICTED: probable leucine-rich repeat rece...  52.4    5e-06   
ref|XP_011046364.1|  PREDICTED: probable leucine-rich repeat rece...  52.4    5e-06   
ref|XP_007213901.1|  hypothetical protein PRUPE_ppa003884mg           52.0    5e-06   
ref|XP_006442359.1|  hypothetical protein CICLE_v100189082mg          52.4    5e-06   
emb|CBI20142.3|  unnamed protein product                              52.4    6e-06   
ref|XP_002283521.1|  PREDICTED: probable LRR receptor-like serine...  52.4    6e-06   Vitis vinifera
emb|CAN73789.1|  hypothetical protein VITISV_025000                   52.0    6e-06   Vitis vinifera
ref|XP_009788430.1|  PREDICTED: probable LRR receptor-like serine...  52.4    6e-06   
ref|XP_009788429.1|  PREDICTED: probable LRR receptor-like serine...  52.4    6e-06   
ref|NP_172244.2|  leucine-rich repeat transmembrane protein kinase    52.4    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001184930.1|  leucine-rich repeat transmembrane protein ki...  52.4    6e-06   
ref|XP_010655570.1|  PREDICTED: probable LRR receptor-like serine...  52.0    7e-06   
ref|XP_008812544.1|  PREDICTED: probable LRR receptor-like serine...  52.0    7e-06   
emb|CAN60698.1|  hypothetical protein VITISV_022626                   52.0    8e-06   Vitis vinifera
ref|XP_010657080.1|  PREDICTED: probable LRR receptor-like serine...  52.0    8e-06   
ref|XP_010655567.1|  PREDICTED: probable LRR receptor-like serine...  52.0    8e-06   
ref|XP_010655566.1|  PREDICTED: probable LRR receptor-like serine...  52.0    8e-06   
emb|CBI30742.3|  unnamed protein product                              52.0    8e-06   
ref|XP_010655565.1|  PREDICTED: probable LRR receptor-like serine...  52.0    8e-06   
ref|XP_009334012.1|  PREDICTED: probable leucine-rich repeat rece...  52.0    8e-06   
ref|XP_010655568.1|  PREDICTED: probable LRR receptor-like serine...  52.0    8e-06   
ref|XP_006477831.1|  PREDICTED: probable leucine-rich repeat rece...  52.0    8e-06   
ref|XP_006477830.1|  PREDICTED: probable leucine-rich repeat rece...  52.0    8e-06   
ref|XP_006477832.1|  PREDICTED: probable leucine-rich repeat rece...  52.0    9e-06   
ref|XP_011046351.1|  PREDICTED: probable LRR receptor-like serine...  51.6    9e-06   
ref|XP_009334010.1|  PREDICTED: probable leucine-rich repeat rece...  51.6    1e-05   
ref|XP_009334011.1|  PREDICTED: probable leucine-rich repeat rece...  51.6    1e-05   
ref|XP_004146079.1|  PREDICTED: probable leucine-rich repeat rece...  51.6    1e-05   
ref|XP_011085314.1|  PREDICTED: probable LRR receptor-like serine...  51.6    1e-05   
ref|XP_011085313.1|  PREDICTED: probable LRR receptor-like serine...  51.6    1e-05   
ref|XP_007149538.1|  hypothetical protein PHAVU_005G078600g           51.2    1e-05   
ref|XP_010112411.1|  putative LRR receptor-like serine/threonine-...  51.2    1e-05   
ref|XP_004294067.1|  PREDICTED: probable LRR receptor-like serine...  51.2    2e-05   
ref|XP_008371518.1|  PREDICTED: probable LRR receptor-like serine...  50.8    2e-05   
ref|XP_008371517.1|  PREDICTED: probable LRR receptor-like serine...  50.8    2e-05   
ref|XP_002524510.1|  kinase, putative                                 50.8    2e-05   
emb|CDP06038.1|  unnamed protein product                              50.8    2e-05   
gb|KCW74192.1|  hypothetical protein EUGRSUZ_E02840                   50.8    2e-05   
ref|XP_010093467.1|  hypothetical protein L484_017528                 50.8    2e-05   
ref|XP_010431372.1|  PREDICTED: probable LRR receptor-like serine...  50.4    2e-05   
ref|XP_010059064.1|  PREDICTED: probable LRR receptor-like serine...  50.8    2e-05   
ref|XP_004168262.1|  PREDICTED: probable LRR receptor-like serine...  50.8    2e-05   
gb|KCW76049.1|  hypothetical protein EUGRSUZ_D00417                   50.4    2e-05   
gb|KCW76050.1|  hypothetical protein EUGRSUZ_D00417                   50.4    2e-05   
ref|XP_007213739.1|  hypothetical protein PRUPE_ppa000808mg           50.8    2e-05   
ref|XP_002522279.1|  ATP binding protein, putative                    50.4    2e-05   
ref|XP_010500991.1|  PREDICTED: probable LRR receptor-like serine...  50.1    3e-05   
ref|XP_010462235.1|  PREDICTED: probable LRR receptor-like serine...  50.1    3e-05   
ref|XP_010500994.1|  PREDICTED: probable LRR receptor-like serine...  50.1    3e-05   
ref|XP_006306823.1|  hypothetical protein CARUB_v10008366mg           50.1    3e-05   
gb|KHG23496.1|  putative LRR receptor-like serine/threonine-prote...  50.1    3e-05   
gb|KCW67601.1|  hypothetical protein EUGRSUZ_F01359                   50.1    3e-05   
ref|XP_002317385.1|  hypothetical protein POPTR_0011s06740g           50.1    4e-05   
ref|XP_006449566.1|  hypothetical protein CICLE_v10014125mg           50.1    4e-05   
emb|CDP06042.1|  unnamed protein product                              50.1    4e-05   
ref|XP_002891752.1|  leucine-rich repeat family protein               50.1    4e-05   
ref|XP_006417782.1|  hypothetical protein EUTSA_v10006761mg           49.7    4e-05   
ref|XP_006377482.1|  hypothetical protein POPTR_0011s06335g           49.7    4e-05   
ref|XP_007214614.1|  hypothetical protein PRUPE_ppa001161mg           50.1    4e-05   
ref|XP_007211339.1|  hypothetical protein PRUPE_ppa001122mg           50.1    4e-05   
gb|KFK43087.1|  hypothetical protein AALP_AA1G077600                  49.7    4e-05   
gb|KEH38567.1|  LRR receptor-like kinase                              49.7    4e-05   
ref|XP_010060735.1|  PREDICTED: probable leucine-rich repeat rece...  49.7    4e-05   
ref|XP_008443633.1|  PREDICTED: probable LRR receptor-like serine...  49.7    4e-05   
ref|XP_006417781.1|  hypothetical protein EUTSA_v10006761mg           49.7    4e-05   
gb|KCW48051.1|  hypothetical protein EUGRSUZ_K01793                   49.7    5e-05   
gb|KCW67560.1|  hypothetical protein EUGRSUZ_F013102                  49.7    5e-05   
ref|XP_010060737.1|  PREDICTED: probable leucine-rich repeat rece...  49.7    5e-05   
gb|KCW67565.1|  hypothetical protein EUGRSUZ_F01314                   49.7    5e-05   
ref|XP_008443628.1|  PREDICTED: probable LRR receptor-like serine...  49.7    5e-05   
ref|XP_010060736.1|  PREDICTED: probable leucine-rich repeat rece...  49.3    5e-05   
ref|XP_008226375.1|  PREDICTED: probable leucine-rich repeat rece...  49.7    5e-05   
ref|XP_010052146.1|  PREDICTED: probable LRR receptor-like serine...  49.7    5e-05   
ref|XP_010665668.1|  PREDICTED: probable LRR receptor-like serine...  49.7    5e-05   
ref|XP_010038894.1|  PREDICTED: probable leucine-rich repeat rece...  49.7    5e-05   
ref|XP_010052145.1|  PREDICTED: probable LRR receptor-like serine...  49.7    5e-05   
ref|XP_006448021.1|  hypothetical protein CICLE_v10014129mg           49.3    5e-05   
ref|XP_010052144.1|  PREDICTED: probable LRR receptor-like serine...  49.7    5e-05   
gb|KCW76047.1|  hypothetical protein EUGRSUZ_D00415                   49.7    5e-05   
ref|XP_006448022.1|  hypothetical protein CICLE_v10014129mg           49.3    5e-05   
gb|KDO58606.1|  hypothetical protein CISIN_1g002566mg                 49.3    6e-05   
ref|XP_006448019.1|  hypothetical protein CICLE_v10014129mg           49.3    6e-05   
ref|XP_006448018.1|  hypothetical protein CICLE_v10014129mg           49.3    6e-05   
ref|XP_010059621.1|  PREDICTED: probable leucine-rich repeat rece...  49.3    6e-05   
ref|XP_006467585.1|  PREDICTED: probable LRR receptor-like serine...  49.3    6e-05   
ref|XP_002522276.1|  kinase, putative                                 49.7    6e-05   
gb|KEH38566.1|  LRR receptor-like kinase                              49.3    6e-05   
gb|KCW75321.1|  hypothetical protein EUGRSUZ_E04067                   49.3    6e-05   
ref|XP_010665666.1|  PREDICTED: probable LRR receptor-like serine...  49.3    6e-05   
ref|XP_010665665.1|  PREDICTED: probable LRR receptor-like serine...  49.3    6e-05   
ref|XP_010665667.1|  PREDICTED: probable LRR receptor-like serine...  49.3    7e-05   
ref|XP_008463779.1|  PREDICTED: probable leucine-rich repeat rece...  49.3    7e-05   
ref|XP_008443626.1|  PREDICTED: probable LRR receptor-like serine...  49.3    7e-05   
ref|XP_010052142.1|  PREDICTED: probable LRR receptor-like serine...  49.3    7e-05   
ref|XP_008463778.1|  PREDICTED: probable leucine-rich repeat rece...  49.3    7e-05   
gb|KDO58605.1|  hypothetical protein CISIN_1g002566mg                 48.9    7e-05   
ref|XP_010057163.1|  PREDICTED: probable LRR receptor-like serine...  48.9    7e-05   
ref|XP_010665669.1|  PREDICTED: probable LRR receptor-like serine...  48.9    8e-05   
ref|XP_010057162.1|  PREDICTED: probable LRR receptor-like serine...  48.9    8e-05   
ref|XP_010052141.1|  PREDICTED: probable LRR receptor-like serine...  48.9    8e-05   
emb|CDP18745.1|  unnamed protein product                              48.9    8e-05   
ref|XP_003596240.1|  Receptor-like protein kinase                     48.5    8e-05   
ref|XP_006442361.1|  hypothetical protein CICLE_v10019246mg           48.9    8e-05   
gb|KDO58607.1|  hypothetical protein CISIN_1g002566mg                 48.9    8e-05   
ref|XP_006492254.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  48.9    8e-05   
gb|KDO58609.1|  hypothetical protein CISIN_1g002566mg                 48.9    8e-05   
gb|KEH38570.1|  cysteine-rich RLK (receptor-like kinase) protein      48.9    8e-05   
gb|KEH38568.1|  LRR receptor-like kinase                              48.9    8e-05   
gb|KDO58604.1|  hypothetical protein CISIN_1g002566mg                 48.9    9e-05   
ref|XP_006448020.1|  hypothetical protein CICLE_v10014129mg           48.9    9e-05   
ref|XP_008463772.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  48.9    9e-05   
gb|KFK35729.1|  hypothetical protein AALP_AA4G029100                  48.9    9e-05   
ref|XP_006448023.1|  hypothetical protein CICLE_v10014129mg           48.9    9e-05   
ref|XP_010273492.1|  PREDICTED: probable leucine-rich repeat rece...  48.9    1e-04   
gb|KDO58608.1|  hypothetical protein CISIN_1g002566mg                 48.5    1e-04   
ref|XP_010273491.1|  PREDICTED: probable leucine-rich repeat rece...  48.9    1e-04   
emb|CDX98501.1|  BnaC05g38740D                                        48.9    1e-04   
ref|XP_010273487.1|  PREDICTED: probable leucine-rich repeat rece...  48.9    1e-04   
ref|XP_010273485.1|  PREDICTED: probable leucine-rich repeat rece...  48.9    1e-04   
ref|XP_004488997.1|  PREDICTED: probable leucine-rich repeat rece...  48.5    1e-04   
ref|XP_007149537.1|  hypothetical protein PHAVU_005G078500g           48.5    1e-04   
gb|KCW76052.1|  hypothetical protein EUGRSUZ_D00419                   48.5    1e-04   
ref|XP_004488996.1|  PREDICTED: probable leucine-rich repeat rece...  48.5    1e-04   
gb|AES66492.2|  LRR receptor-like kinase                              48.5    1e-04   
gb|AAF75093.1|AC007583_29  Contains similarity to a receptor-like...  48.1    1e-04   
gb|KCW63414.1|  hypothetical protein EUGRSUZ_G01055                   48.5    1e-04   
ref|XP_010036641.1|  PREDICTED: probable leucine-rich repeat rece...  48.1    1e-04   
ref|XP_004488995.1|  PREDICTED: probable leucine-rich repeat rece...  48.5    1e-04   
ref|XP_010665673.1|  PREDICTED: probable LRR receptor-like serine...  48.1    1e-04   
gb|KCW89681.1|  hypothetical protein EUGRSUZ_A01951                   48.1    1e-04   
ref|XP_010036639.1|  PREDICTED: probable leucine-rich repeat rece...  48.1    2e-04   
ref|XP_010665671.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
ref|XP_010053001.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
ref|XP_010665670.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
ref|XP_010040667.1|  PREDICTED: probable leucine-rich repeat rece...  48.1    2e-04   
gb|KCW48258.1|  hypothetical protein EUGRSUZ_K01987                   48.1    2e-04   
ref|XP_010242178.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
ref|XP_010242177.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
gb|KCW89682.1|  hypothetical protein EUGRSUZ_A01951                   48.1    2e-04   
ref|XP_009359382.1|  PREDICTED: probable leucine-rich repeat rece...  48.1    2e-04   
ref|XP_008463773.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
ref|XP_004146083.1|  PREDICTED: probable LRR receptor-like serine...  47.8    2e-04   
ref|XP_006346646.1|  PREDICTED: probable LRR receptor-like serine...  47.8    2e-04   
ref|XP_010040114.1|  PREDICTED: probable LRR receptor-like serine...  47.8    2e-04   
ref|XP_008225244.1|  PREDICTED: probable LRR receptor-like serine...  47.8    2e-04   
ref|XP_006392789.1|  hypothetical protein EUTSA_v10011204mg           47.8    2e-04   
ref|XP_009359381.1|  PREDICTED: probable leucine-rich repeat rece...  47.8    2e-04   
ref|XP_010036644.1|  PREDICTED: probable leucine-rich repeat rece...  47.4    2e-04   
ref|XP_010418194.1|  PREDICTED: probable leucine-rich repeat rece...  47.8    2e-04   
ref|XP_002522277.1|  ATP binding protein, putative                    47.8    2e-04   
ref|XP_011014228.1|  PREDICTED: probable leucine-rich repeat rece...  47.8    2e-04   
ref|XP_010475531.1|  PREDICTED: probable LRR receptor-like serine...  47.8    2e-04   
ref|XP_006377528.1|  hypothetical protein POPTR_0011s067101g          46.2    2e-04   
ref|XP_010272760.1|  PREDICTED: probable leucine-rich repeat rece...  47.8    2e-04   
ref|XP_010475530.1|  PREDICTED: probable LRR receptor-like serine...  47.8    2e-04   
gb|ACN59254.1|  leucine-rich repeat receptor-like protein kinase      47.4    2e-04   
ref|XP_011046363.1|  PREDICTED: probable leucine-rich repeat rece...  47.4    2e-04   
gb|EYU43301.1|  hypothetical protein MIMGU_mgv1a000913mg              47.4    3e-04   
ref|XP_010431689.1|  PREDICTED: probable leucine-rich repeat rece...  47.4    3e-04   
ref|XP_011014230.1|  PREDICTED: probable leucine-rich repeat rece...  47.4    3e-04   
ref|XP_009359377.1|  PREDICTED: probable leucine-rich repeat rece...  47.4    3e-04   
ref|XP_011014227.1|  PREDICTED: probable leucine-rich repeat rece...  47.4    3e-04   
ref|XP_011046362.1|  PREDICTED: probable leucine-rich repeat rece...  47.4    3e-04   
ref|XP_011046360.1|  PREDICTED: probable leucine-rich repeat rece...  47.4    3e-04   
ref|XP_011046359.1|  PREDICTED: probable leucine-rich repeat rece...  47.4    3e-04   
ref|XP_010924705.1|  PREDICTED: probable LRR receptor-like serine...  47.4    3e-04   
gb|AAF78445.1|AC018748_24  Contains a weak similarity to disease ...  47.4    3e-04   
ref|XP_010924703.1|  PREDICTED: probable LRR receptor-like serine...  47.4    3e-04   
ref|XP_008792302.1|  PREDICTED: probable LRR receptor-like serine...  47.4    3e-04   
emb|CDY32337.1|  BnaC01g36560D                                        45.8    3e-04   
gb|KCW48256.1|  hypothetical protein EUGRSUZ_K01985                   47.4    3e-04   
ref|NP_175749.1|  putative LRR receptor-like serine/threonine-pro...  47.4    3e-04   
ref|XP_010038955.1|  PREDICTED: probable leucine-rich repeat rece...  47.4    3e-04   
ref|XP_010479904.1|  PREDICTED: probable LRR receptor-like serine...  47.4    3e-04   
ref|NP_001117479.1|  Leucine-rich repeat transmembrane protein ki...  47.0    3e-04   
ref|NP_175748.1|  Leucine-rich repeat transmembrane protein kinase    47.0    3e-04   
ref|XP_006388682.1|  hypothetical protein POPTR_0122s00210g           47.0    4e-04   
ref|XP_004162117.1|  PREDICTED: probable leucine-rich repeat rece...  47.0    4e-04   
ref|XP_004146082.1|  PREDICTED: probable leucine-rich repeat rece...  47.0    4e-04   
ref|XP_007142243.1|  hypothetical protein PHAVU_008G264400g           47.0    4e-04   
sp|C0LGG8.1|Y5343_ARATH  RecName: Full=Probable LRR receptor-like...  47.0    4e-04   
emb|CDX97606.1|  BnaA05g24730D                                        47.0    4e-04   
ref|XP_009146321.1|  PREDICTED: probable leucine-rich repeat rece...  47.0    4e-04   
gb|AAF78446.1|AC018748_25  Contains similarity to receptor-like s...  47.0    4e-04   
ref|XP_009351836.1|  PREDICTED: probable LRR receptor-like serine...  47.0    4e-04   
ref|XP_008463771.1|  PREDICTED: probable leucine-rich repeat rece...  47.0    4e-04   
ref|XP_006370080.1|  hypothetical protein POPTR_0001s39360g           47.0    4e-04   
gb|EPS72702.1|  hypothetical protein M569_02055                       47.0    4e-04   
gb|KEH28296.1|  LRR receptor-like kinase                              47.0    4e-04   
ref|XP_007021933.1|  Leucine-rich repeat transmembrane protein ki...  47.0    4e-04   
ref|XP_010462234.1|  PREDICTED: probable LRR receptor-like serine...  47.0    4e-04   
ref|XP_007021934.1|  Leucine-rich repeat transmembrane protein ki...  47.0    4e-04   
ref|XP_006377458.1|  hypothetical protein POPTR_0011s06120g           45.8    5e-04   
ref|XP_006301399.1|  hypothetical protein CARUB_v10021813mg           46.6    5e-04   
ref|XP_006847775.1|  hypothetical protein AMTR_s00162p00056910        46.6    5e-04   
ref|XP_004172595.1|  PREDICTED: probable leucine-rich repeat rece...  46.6    5e-04   
ref|XP_010501267.1|  PREDICTED: probable LRR receptor-like serine...  46.6    5e-04   
ref|XP_009376743.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  46.6    5e-04   
ref|XP_003616753.1|  Cysteine-rich receptor-like protein kinase       46.6    5e-04   
ref|XP_009359378.1|  PREDICTED: probable leucine-rich repeat rece...  46.6    5e-04   
ref|XP_004146081.1|  PREDICTED: probable leucine-rich repeat rece...  46.6    5e-04   
gb|KCW74195.1|  hypothetical protein EUGRSUZ_E02843                   46.6    6e-04   
ref|XP_010038884.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  46.6    6e-04   
ref|XP_004146084.1|  PREDICTED: probable LRR receptor-like serine...  46.6    6e-04   
gb|KCW48041.1|  hypothetical protein EUGRSUZ_K01781                   46.2    6e-04   
gb|KGN55037.1|  hypothetical protein Csa_4G624430                     46.2    6e-04   
ref|XP_010057164.1|  PREDICTED: probable LRR receptor-like serine...  46.2    6e-04   
gb|KEH38575.1|  cysteine-rich RLK (receptor-like kinase) protein      46.2    6e-04   
ref|XP_004167668.1|  PREDICTED: probable LRR receptor-like serine...  46.2    7e-04   
ref|XP_009396547.1|  PREDICTED: probable LRR receptor-like serine...  46.2    7e-04   
ref|XP_010246507.1|  PREDICTED: probable LRR receptor-like serine...  46.2    7e-04   
gb|AGW52154.1|  RKF                                                   46.2    7e-04   
ref|XP_002524514.1|  ATP binding protein, putative                    46.2    7e-04   
ref|XP_010246506.1|  PREDICTED: probable LRR receptor-like serine...  46.2    7e-04   
ref|XP_011002052.1|  PREDICTED: probable LRR receptor-like serine...  46.2    7e-04   
ref|XP_011002053.1|  PREDICTED: probable LRR receptor-like serine...  46.2    7e-04   
emb|CDX98497.1|  BnaC05g38780D                                        46.2    8e-04   
ref|XP_004305822.1|  PREDICTED: probable LRR receptor-like serine...  46.2    8e-04   
ref|XP_006592942.1|  PREDICTED: probable leucine-rich repeat rece...  46.2    8e-04   
ref|XP_006574177.1|  PREDICTED: probable leucine-rich repeat rece...  46.2    8e-04   
ref|XP_009144771.1|  PREDICTED: probable LRR receptor-like serine...  46.2    8e-04   
emb|CDY25853.1|  BnaA05g14440D                                        46.2    8e-04   
gb|KCW74196.1|  hypothetical protein EUGRSUZ_E02844                   45.8    9e-04   
gb|KCW67558.1|  hypothetical protein EUGRSUZ_F01308                   45.8    9e-04   
ref|XP_006573361.1|  PREDICTED: probable leucine-rich repeat rece...  45.8    9e-04   
ref|XP_006573364.1|  PREDICTED: probable leucine-rich repeat rece...  45.8    0.001   
gb|ABF72026.1|  leucine-rich repeat-containing protein kinase fam...  45.8    0.001   
ref|XP_010064487.1|  PREDICTED: probable leucine-rich repeat rece...  45.8    0.001   



>ref|XP_010088632.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB36794.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=617

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IIV  V S+LCLIF IL   WWK Y+  + S+E  L+G+DLQTG FTFRQIKAATN
Sbjct  233  IIVAGVLSALCLIFMILGVLWWKGYLGGRPSREQVLKGLDLQTGFFTFRQIKAATN  288



>ref|XP_010088631.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXB36793.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=924

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++ V S++CL+F +L   WWK     KTS+E  +RG+DLQTG FTFRQIKAATN
Sbjct  535  IIIGVVSAVCLLFIVLGILWWKGCFGGKTSREQVMRGLDLQTGFFTFRQIKAATN  589



>ref|XP_010112408.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXC33466.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=941

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I + AV S L LIF I+   WWK +     S+E ELRG+DLQTG FTFRQIKAATN
Sbjct  526  IAIGAVISGLGLIFAIISLLWWKGFFGGSISREKELRGLDLQTGFFTFRQIKAATN  581



>emb|CBI30750.3| unnamed protein product [Vitis vinifera]
Length=522

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +IV AVTS LCLI  +L    W+ Y+ +K ++E ELRG+DLQ G FT RQIKAATN
Sbjct  141  VIVGAVTSLLCLILFVLGVLCWRHYLGDKNTRERELRGLDLQIGSFTLRQIKAATN  196



>ref|XP_010655585.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Vitis vinifera]
Length=861

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +IV AVTS LCLI  +L    W+ Y+ +K ++E ELRG+DLQ G FT RQIKAATN
Sbjct  480  VIVGAVTSLLCLILFVLGVLCWRHYLGDKNTRERELRGLDLQIGSFTLRQIKAATN  535



>ref|XP_010655584.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Vitis vinifera]
Length=975

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +IV AVTS LCLI  +L    W+ Y+ +K ++E ELRG+DLQ G FT RQIKAATN
Sbjct  594  VIVGAVTSLLCLILFVLGVLCWRHYLGDKNTRERELRGLDLQIGSFTLRQIKAATN  649



>ref|XP_010655583.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Vitis vinifera]
Length=988

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +IV AVTS LCLI  +L    W+ Y+ +K ++E ELRG+DLQ G FT RQIKAATN
Sbjct  607  VIVGAVTSLLCLILFVLGVLCWRHYLGDKNTRERELRGLDLQIGSFTLRQIKAATN  662



>ref|XP_010655564.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=972

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  + S L  IFTIL    WK Y   +TS+E ELRG+DLQTG FT RQIKAATN
Sbjct  582  ILIAVLVSVLVFIFTILGLICWKCYFGQRTSREQELRGLDLQTGLFTLRQIKAATN  637



>ref|XP_010655563.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=972

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  + S L  IFTIL    WK Y   +TS+E ELRG+DLQTG FT RQIKAATN
Sbjct  582  ILIAVLVSVLVFIFTILGLICWKCYFGQRTSREQELRGLDLQTGLFTLRQIKAATN  637



>ref|XP_010655562.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=994

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  + S L  IFTIL    WK Y   +TS+E ELRG+DLQTG FT RQIKAATN
Sbjct  604  ILIAVLVSVLVFIFTILGLICWKCYFGQRTSREQELRGLDLQTGLFTLRQIKAATN  659



>ref|XP_006377456.1| hypothetical protein POPTR_0011s06100g [Populus trichocarpa]
 gb|ERP55253.1| hypothetical protein POPTR_0011s06100g [Populus trichocarpa]
Length=555

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T I++ AVTS+L L+F ++    WKFY R+K  +E +L+G+DL+TG FT RQ++AATN
Sbjct  142  TPIVIGAVTSALLLVFLVMGVICWKFYFRDKFMRERDLKGLDLKTGSFTLRQLRAATN  199



>ref|XP_002317379.2| hypothetical protein POPTR_0011s080203g, partial [Populus trichocarpa]
 gb|EEE97991.2| hypothetical protein POPTR_0011s080203g, partial [Populus trichocarpa]
Length=264

 Score = 67.0 bits (162),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+V  VTS+L L+F ++    WKFY R+K  +E +L+G+DL+TG FT RQ++AATN
Sbjct  197  IVVGVVTSALLLVFLVMGVICWKFYFRDKFMRERDLKGLDLKTGSFTLRQLRAATN  252



>ref|XP_007025270.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY27892.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=941

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  13   VVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            V AV S  CLIF IL   WWK Y  ++T +E +L+G DLQ+G FTFRQ+KAATN
Sbjct  568  VGAVVSVSCLIFIILSILWWKGYFWHRTLREQDLKGFDLQSGFFTFRQMKAATN  621



>ref|XP_008225419.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1017

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  28   SSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            S LCLIF IL   WWK  + +KTS+E  LR +DLQTG FTFRQIKAATN
Sbjct  626  SVLCLIFLILGILWWKGSLDSKTSREKALRELDLQTGFFTFRQIKAATN  674



>ref|XP_007214558.1| hypothetical protein PRUPE_ppa000742mg [Prunus persica]
 gb|EMJ15757.1| hypothetical protein PRUPE_ppa000742mg [Prunus persica]
Length=1017

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  28   SSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            S LCLIF IL   WWK  + +KTS+E  LR +DLQTG FTFRQIKAATN
Sbjct  626  SVLCLIFLILGILWWKGSLDSKTSREKALRELDLQTGFFTFRQIKAATN  674



>ref|XP_009600347.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana tomentosiformis]
Length=1003

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LI+V AV SSL LI  IL  AW K   RN T  E ELRG+DLQTG FTFRQIKAAT+
Sbjct  610  LIVVGAVMSSLALILMILFVAWRKR--RNGTLMEQELRGLDLQTGIFTFRQIKAATS  664



>ref|XP_006377518.1| hypothetical protein POPTR_0011s066201g, partial [Populus trichocarpa]
 gb|ERP55315.1| hypothetical protein POPTR_0011s066201g, partial [Populus trichocarpa]
Length=662

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+V  VTS+L L+F ++    WKFY R+K  +E +L+G+DL+TG FT RQ++AATN
Sbjct  301  IVVGVVTSALLLVFLVMGVICWKFYFRDKFMRERDLKGLDLKTGSFTLRQLRAATN  356



>ref|XP_007214549.1| hypothetical protein PRUPE_ppa001005mg [Prunus persica]
 gb|EMJ15748.1| hypothetical protein PRUPE_ppa001005mg [Prunus persica]
Length=935

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  28   SSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            S LCLIF IL   WWK  + +KTS+E  LR +DLQTG FTF+QIKAATN
Sbjct  552  SVLCLIFLILGILWWKGSLDSKTSREKALRELDLQTGFFTFKQIKAATN  600



>ref|XP_007213704.1| hypothetical protein PRUPE_ppa000741mg [Prunus persica]
 gb|EMJ14903.1| hypothetical protein PRUPE_ppa000741mg [Prunus persica]
Length=1017

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  28   SSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            S LCLIF IL   WW+  + +KTS+E  LR +DLQTG FTFRQIKAATN
Sbjct  626  SVLCLIFLILGILWWRGSLDSKTSREKALRELDLQTGFFTFRQIKAATN  674



>ref|XP_008245181.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like serine/threonine-protein kinase At3g14840 [Prunus 
mume]
Length=1017

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  34   LCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LCLIF IL   WWK  + +KTS+E  LR +DLQTG FTFRQIKAATN
Sbjct  628  LCLIFLILGILWWKGSLDSKTSREKALRELDLQTGFFTFRQIKAATN  674



>ref|XP_011002042.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X4 [Populus euphratica]
Length=1002

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+V  VTS+L L+F ++    WKFY R+K  +E +L+G+DL+TG FT RQ++AATN
Sbjct  590  IVVGVVTSALLLVFLVMGVICWKFYFRDKFMRERDLKGLDLKTGSFTLRQLRAATN  645



>ref|XP_011002040.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Populus euphratica]
Length=1024

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+V  VTS+L L+F ++    WKFY R+K  +E +L+G+DL+TG FT RQ++AATN
Sbjct  614  IVVGVVTSALLLVFLVMGVICWKFYFRDKFMRERDLKGLDLKTGSFTLRQLRAATN  669



>ref|XP_011002039.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Populus euphratica]
Length=1026

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+V  VTS+L L+F ++    WKFY R+K  +E +L+G+DL+TG FT RQ++AATN
Sbjct  614  IVVGVVTSALLLVFLVMGVICWKFYFRDKFMRERDLKGLDLKTGSFTLRQLRAATN  669



>ref|XP_011002041.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Populus euphratica]
Length=1009

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+V  VTS+L L+F ++    WKFY R+K  +E +L+G+DL+TG FT RQ++AATN
Sbjct  614  IVVGVVTSALLLVFLVMGVICWKFYFRDKFMRERDLKGLDLKTGSFTLRQLRAATN  669



>emb|CDO96888.1| unnamed protein product [Coffea canephora]
Length=1019

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
             I V  V S+L ++ +IL FAW +++ R K S+E ELRG+DL+TG FT+RQIKAAT+
Sbjct  630  FIAVGTVASTLLIVLSILGFAWRRWHSRQKISREEELRGLDLRTGLFTYRQIKAATD  686



>emb|CBI30743.3| unnamed protein product [Vitis vinifera]
Length=526

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  + S L  IFTIL    WK Y   +TS+E ELRG+DLQTG FT RQIKAATN
Sbjct  136  ILIAVLVSVLVFIFTILGLICWKCYFGQRTSREQELRGLDLQTGLFTLRQIKAATN  191



>ref|XP_006377525.1| putative receptor-like protein kinase RLPK1, partial [Populus 
trichocarpa]
 gb|ERP55322.1| putative receptor-like protein kinase RLPK1, partial [Populus 
trichocarpa]
Length=607

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T I+V  VTS+L L+F ++    WKFY R+K  +E +L G+DL+TG FT RQ++AATN
Sbjct  195  TPIVVGLVTSALLLVFLVMGIICWKFYFRDKFMRERDLMGLDLKTGSFTLRQLRAATN  252



>ref|XP_006377507.1| hypothetical protein POPTR_0011s065502g, partial [Populus trichocarpa]
 gb|ERP55304.1| hypothetical protein POPTR_0011s065502g, partial [Populus trichocarpa]
Length=387

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+V   TS+L L+F ++    WKFY R+K  +E +L+G+DL+TG FT RQ++AATN
Sbjct  9    IVVGVFTSALLLVFLVMGVICWKFYFRDKFMRERDLKGLDLKTGTFTLRQLRAATN  64



>ref|XP_006377511.1| hypothetical protein POPTR_0011s065701g, partial [Populus trichocarpa]
 gb|ERP55308.1| hypothetical protein POPTR_0011s065701g, partial [Populus trichocarpa]
Length=580

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+V  VTS+L L+F ++    WKFY R+K  ++ +L+G+DL+TG FT RQ++AATN
Sbjct  188  IVVGVVTSALLLVFLVMGVICWKFYFRDKFMRDRDLKGLDLKTGSFTLRQLRAATN  243



>ref|XP_006358077.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=932

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LI+  AVTSSL L+  I   AW K   RN+   E ELRG+DLQTG FTFRQIKAAT+
Sbjct  540  LIVAGAVTSSLALVLMIFFVAWKKR--RNRKLMEQELRGLDLQTGIFTFRQIKAATS  594



>ref|XP_004233025.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=1002

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LI+  AVTSSL L+  I   AW K   RN+   E ELRG+DLQTG FTFRQIKAAT+
Sbjct  610  LIVAGAVTSSLALVLMIFFVAWKKR--RNRKLMEQELRGLDLQTGIFTFRQIKAATS  664



>ref|XP_007025267.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
 gb|EOY27889.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
Length=1007

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +V A  S  CL+  IL   WWK     K S+E  LRG+DLQTG FTFRQ+KAATN
Sbjct  620  VVAAAVSVPCLLLVILGILWWKGCFEAKVSREQVLRGLDLQTGFFTFRQMKAATN  674



>ref|XP_004295408.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=1071

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            + IVV V S+LCLIF I+   W++    +KT++E ELRG+DL TG F F+QIKAAT+
Sbjct  617  IYIVVGVVSALCLIFLIIGILWFRGCFGHKTTREEELRGMDLHTGFFRFKQIKAATD  673



>ref|XP_010247775.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=938

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T ++   V S L  IF +L   WWK Y+  K + + +LRG+DLQTG FT RQIKAATN
Sbjct  533  TGVVAGIVVSVLAFIFLVLGILWWKGYLGCKNTMDKDLRGLDLQTGSFTLRQIKAATN  590



>ref|XP_006371021.1| hypothetical protein POPTR_0019s027201g, partial [Populus trichocarpa]
 gb|ERP48818.1| hypothetical protein POPTR_0019s027201g, partial [Populus trichocarpa]
Length=620

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
             I+  AV  SL L+F +L   WWK Y+  + S++ EL G+DL TG FTFRQIKAATN
Sbjct  203  FIVAGAVVLSLFLVFILLSSLWWKGYLGGRKSRDRELVGLDLLTGIFTFRQIKAATN  259



>ref|XP_007025268.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
2, partial [Theobroma cacao]
 gb|EOY27890.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
2, partial [Theobroma cacao]
Length=692

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +V A  S  CL+  IL   WWK     K S+E  LRG+DLQTG FTFRQ+KAATN
Sbjct  620  VVAAAVSVPCLLLVILGILWWKGCFEAKVSREQVLRGLDLQTGFFTFRQMKAATN  674



>ref|XP_009795508.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana sylvestris]
Length=1003

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LI+V AV  SL LI  IL  AW K   RN+   E ELRG+DLQTG FTFRQIKAAT+
Sbjct  610  LIVVGAVMFSLALILMILFVAWRKR--RNRNLMEQELRGLDLQTGIFTFRQIKAATS  664



>ref|XP_010247772.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1001

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  22   VTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            V + L  IF +L   WWK  + NKT+ + +L+G+DLQTG FT RQIKAATN
Sbjct  603  VVTVLVFIFLVLVLLWWKGCLGNKTTMDQDLKGVDLQTGTFTLRQIKAATN  653



>emb|CBI30754.3| unnamed protein product [Vitis vinifera]
Length=540

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            + IV   TS  CLI  +L    WK+Y   K   E ELRG+DLQTG FT RQIKAATN
Sbjct  152  VTIVGVATSVSCLILFVLGVLCWKYYFGGKNMMEKELRGLDLQTGSFTLRQIKAATN  208



>ref|XP_007213678.1| hypothetical protein PRUPE_ppa000939mg [Prunus persica]
 gb|EMJ14877.1| hypothetical protein PRUPE_ppa000939mg [Prunus persica]
Length=955

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            + IV+ V S+LCLIF      W K     KTS+E  LRG DLQTG F F+QIKAATN
Sbjct  568  IFIVIGVVSALCLIFATFGILWLKGCFGGKTSREEVLRGFDLQTGFFRFKQIKAATN  624



>ref|XP_010655590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Vitis vinifera]
Length=865

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            + IV   TS  CLI  +L    WK+Y   K   E ELRG+DLQTG FT RQIKAATN
Sbjct  480  VTIVGVATSVSCLILFVLGVLCWKYYFGGKNMMEKELRGLDLQTGSFTLRQIKAATN  536



>ref|XP_009795509.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Nicotiana sylvestris]
Length=757

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LI+V AV  SL LI  IL  AW K   RN+   E ELRG+DLQTG FTFRQIKAAT+
Sbjct  610  LIVVGAVMFSLALILMILFVAWRKR--RNRNLMEQELRGLDLQTGIFTFRQIKAATS  664



>ref|XP_010655588.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Vitis vinifera]
Length=1006

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            + IV   TS  CLI  +L    WK+Y   K   E ELRG+DLQTG FT RQIKAATN
Sbjct  621  VTIVGVATSVSCLILFVLGVLCWKYYFGGKNMMEKELRGLDLQTGSFTLRQIKAATN  677



>ref|XP_010655589.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Vitis vinifera]
Length=999

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            + IV   TS  CLI  +L    WK+Y   K   E ELRG+DLQTG FT RQIKAATN
Sbjct  621  VTIVGVATSVSCLILFVLGVLCWKYYFGGKNMMEKELRGLDLQTGSFTLRQIKAATN  677



>ref|XP_011045704.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=829

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LI+  AV   L  IF +L   WWK Y+  K S++ EL G+DL TG FTFRQIKAATN
Sbjct  435  LIVAGAVVVPLFFIFVLLFTLWWKGYLGGKKSRDPELVGLDLVTGIFTFRQIKAATN  491



>ref|XP_006358076.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X2 [Solanum tuberosum]
Length=883

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LI+  AV SSL L+  I   AW K   RN+   E ELRG+DLQTG FTFRQIKAAT+
Sbjct  491  LIVAGAVVSSLALVLMIFFVAWKKR--RNRKLMEQELRGLDLQTGIFTFRQIKAATS  545



>ref|XP_002522278.1| kinase, putative [Ricinus communis]
 gb|EEF40136.1| kinase, putative [Ricinus communis]
Length=965

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +II VA + SL L+F ++C   WKF  + K  ++ +LRG+DLQTG FT RQ++AATN
Sbjct  592  IIIAVATSVSL-LVFLVICALCWKFCFQKKYKRDKDLRGVDLQTGSFTLRQLRAATN  647



>ref|XP_006358075.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X1 [Solanum tuberosum]
Length=1002

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LI+  AV SSL L+  I   AW K   RN+   E ELRG+DLQTG FTFRQIKAAT+
Sbjct  610  LIVAGAVVSSLALVLMIFFVAWKKR--RNRKLMEQELRGLDLQTGIFTFRQIKAATS  664



>ref|XP_011045702.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
 ref|XP_011045703.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1006

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LI+  AV   L  IF +L   WWK Y+  K S++ EL G+DL TG FTFRQIKAATN
Sbjct  612  LIVAGAVVVPLFFIFVLLFTLWWKGYLGGKKSRDPELVGLDLVTGIFTFRQIKAATN  668



>ref|XP_010088635.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB36797.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=550

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  43   IFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +FT LC  WWK       ++E ELRG+DLQTG FTFRQIKAATN
Sbjct  236  MFTTLCILWWKGCFDGTATRERELRGLDLQTGIFTFRQIKAATN  279



>ref|XP_002300205.2| hypothetical protein POPTR_0001s31610g [Populus trichocarpa]
 gb|EEE85010.2| hypothetical protein POPTR_0001s31610g [Populus trichocarpa]
Length=1003

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LI+  AV   L  IF +L   WWK Y+  K S++ EL G+DL TG FTFRQIKAATN
Sbjct  609  LIVAGAVVLPLFFIFVLLFTLWWKGYLGGKKSRDPELVGLDLVTGIFTFRQIKAATN  665



>ref|XP_009600351.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Nicotiana tomentosiformis]
Length=856

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 41/56 (73%), Gaps = 2/56 (4%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            II  AVT+SL LIF IL  +W +   RN+ S+E ELRG+DL TG FT RQIKAAT+
Sbjct  469  IIAGAVTASLILIFAILFVSWRRS--RNRISKEAELRGLDLLTGVFTIRQIKAATD  522



>ref|XP_008347521.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Malus domestica]
Length=783

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  28   SSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            S L LIF +L   WW     ++TS+E  LRG+DLQTG FTFRQIKAATN
Sbjct  391  SVLGLIFLVLGILWWNDCFDSRTSREKALRGLDLQTGFFTFRQIKAATN  439



>ref|XP_008345983.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=674

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  19   AVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +V +S+  +F  L   WW+  + +KTS+E  LRG+DLQTG FTFRQIKAATN
Sbjct  276  SVGASVXCLFLTLGILWWRGCLESKTSREKALRGLDLQTGFFTFRQIKAATN  327



>ref|XP_009600350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Nicotiana tomentosiformis]
Length=911

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 41/56 (73%), Gaps = 2/56 (4%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            II  AVT+SL LIF IL  +W +   RN+ S+E ELRG+DL TG FT RQIKAAT+
Sbjct  524  IIAGAVTASLILIFAILFVSWRRS--RNRISKEAELRGLDLLTGVFTIRQIKAATD  577



>ref|XP_008225418.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Prunus mume]
Length=989

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            + IV+ V S+LCLIF      W K     KTS+E  LRG DLQTG + F+QIKAATN
Sbjct  602  IFIVIGVVSALCLIFATFGILWLKGCFGGKTSREEVLRGFDLQTGFYRFKQIKAATN  658



>ref|XP_008225417.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Prunus mume]
Length=992

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            + IV+ V S+LCLIF      W K     KTS+E  LRG DLQTG + F+QIKAATN
Sbjct  605  IFIVIGVVSALCLIFATFGILWLKGCFGGKTSREEVLRGFDLQTGFYRFKQIKAATN  661



>ref|XP_009600349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Nicotiana tomentosiformis]
Length=993

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 41/56 (73%), Gaps = 2/56 (4%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            II  AVT+SL LIF IL  +W +   RN+ S+E ELRG+DL TG FT RQIKAAT+
Sbjct  606  IIAGAVTASLILIFAILFVSWRR--SRNRISKEAELRGLDLLTGVFTIRQIKAATD  659



>ref|XP_009758721.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650, partial [Nicotiana sylvestris]
Length=422

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            II  AVT+SL LIF IL  +W +   RN+ S+E ELRG+DL TG FT RQIK AT+
Sbjct  35   IIAGAVTASLILIFAILFVSWRR--SRNRISKEEELRGLDLLTGVFTIRQIKVATD  88



>ref|XP_009600352.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X6 [Nicotiana tomentosiformis]
Length=812

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 41/56 (73%), Gaps = 2/56 (4%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            II  AVT+SL LIF IL  +W +   RN+ S+E ELRG+DL TG FT RQIKAAT+
Sbjct  425  IIAGAVTASLILIFAILFVSWRR--SRNRISKEAELRGLDLLTGVFTIRQIKAATD  478



>ref|XP_009600348.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Nicotiana tomentosiformis]
Length=993

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 41/56 (73%), Gaps = 2/56 (4%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            II  AVT+SL LIF IL  +W +   RN+ S+E ELRG+DL TG FT RQIKAAT+
Sbjct  606  IIAGAVTASLILIFAILFVSWRR--SRNRISKEAELRGLDLLTGVFTIRQIKAATD  659



>ref|XP_008245184.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1005

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +1

Query  28   SSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            S L LIF IL   WWK  + +K S+E  LRG+DLQTG FTF+QIKAATN
Sbjct  610  SVLFLIFLILGILWWKGCLDSKISREKALRGLDLQTGFFTFKQIKAATN  658



>ref|XP_002283596.2| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Vitis vinifera]
Length=1007

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+V  V   + L+F ++   WW+  +R K + E EL+G+DLQTG FT RQIKAATN
Sbjct  604  IVVGHVAGVILLVFLVIGILWWRGCLRRKDTLEQELKGLDLQTGLFTLRQIKAATN  659



>ref|XP_006358134.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=1028

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            II   V SSL L+FTI   AW +   RN  S+E ELRG+DL TG FT RQIKAATN
Sbjct  639  IIAGVVASSLVLLFTIFFVAWRR--SRNSMSKEEELRGLDLLTGVFTIRQIKAATN  692



>gb|KDP21156.1| hypothetical protein JCGZ_21627 [Jatropha curcas]
Length=962

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LI+  AV   L LIF I    WWK Y+  +  +E EL G+DL TG FT+RQIKAATN
Sbjct  562  LIVAGAVVLPLFLIFIITGSLWWKGYLGGRAVKEQELLGLDLHTGVFTYRQIKAATN  618



>emb|CBI20124.3| unnamed protein product [Vitis vinifera]
Length=1036

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+V  V   + L+F ++   WW+  +R K + E EL+G+DLQTG FT RQIKAATN
Sbjct  633  IVVGHVAGVILLVFLVIGILWWRGCLRRKDTLEQELKGLDLQTGLFTLRQIKAATN  688



>ref|XP_008371519.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=1011

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  19   AVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +V +S+  +F  L   WW+  + +KTS+E  LRG+DLQTG FTFRQIKAATN
Sbjct  613  SVGASVXCLFLTLGILWWRGCLESKTSREKALRGLDLQTGFFTFRQIKAATN  664



>ref|XP_011046350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=1003

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
             I+  AV  SL L+F +L   WWK Y+  + S++ EL G+DL TG FTF QIKAATN
Sbjct  603  FIVAGAVVLSLFLVFILLSSPWWKGYLGGRKSRDRELVGLDLLTGIFTFSQIKAATN  659



>ref|XP_008225260.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=983

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  28   SSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            S L LIF I    WWK  + +K S+E  LRG+DLQTG FTF+QIKAATN
Sbjct  589  SVLFLIFLIFSVLWWKGCLDSKISREKALRGLDLQTGFFTFKQIKAATN  637



>ref|XP_002325753.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
 gb|EEF00135.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
Length=972

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
             I+  AV  SL L+F +L   WWK Y+  + S++ EL G+DL TG FTF QIKAATN
Sbjct  572  FIVAGAVVLSLFLVFILLSSLWWKGYLGGRKSRDRELVGLDLLTGIFTFSQIKAATN  628



>ref|XP_008377580.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=987

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IV+ V S+L LIF IL   WWK    ++T++E +L G+DL TG F F+Q+KAATN
Sbjct  605  IVIGVVSALFLIFLILGILWWKGCFGSRTTREQDLMGLDLHTGFFKFKQLKAATN  659



>ref|XP_011098190.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Sesamum indicum]
Length=1024

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+  V SS   +F IL   W K   R    ++NELRG+DLQTG FT RQIKAATN
Sbjct  609  IIGIVVSSCVFMFFILALLWMKVCRRGNAGEDNELRGLDLQTGYFTLRQIKAATN  663



>ref|XP_010247776.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Nelumbo nucifera]
Length=978

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            ++   V S L  IF +L   WW  Y+  K + + +LRG+DLQTG FT RQIKAATN
Sbjct  575  VVAGIVISVLAFIFLVLGILWWTGYLGCKNTIDKDLRGLDLQTGSFTLRQIKAATN  630



>ref|XP_010246510.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1011

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +I   + S + L+F +L   WW+   R+K++ + +LRG+D+QTG FT RQIKAATN
Sbjct  606  VIAGIIVSVVALVFMVLGTIWWRGCQRHKSTMDQDLRGLDMQTGSFTLRQIKAATN  661



>ref|XP_006377505.1| hypothetical protein POPTR_0011s065402g, partial [Populus trichocarpa]
 gb|ERP55302.1| hypothetical protein POPTR_0011s065402g, partial [Populus trichocarpa]
Length=413

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  VTS++ LIF ++   +WK    +K ++E EL+G+DL+TG FT RQ+KAAT+
Sbjct  57   IVIGVVTSAVFLIFLVMGVIYWKLCYGDKYTRERELKGLDLKTGSFTLRQLKAATD  112



>emb|CDP06041.1| unnamed protein product [Coffea canephora]
Length=1026

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IV+AV  S+ ++  IL   WWK  ++ + S EN+L+G+DL TG FT RQIKAATN
Sbjct  629  IVLAVLFSITMVLVIL---WWKGCLQCRDSMENDLKGLDLHTGSFTLRQIKAATN  680



>gb|KHN19486.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Glycine soja]
Length=1004

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
             I+ + VT +L +I  I   AWWK  +  K S E ELRG+DLQTG F+ RQ+KAATN
Sbjct  603  FIVAIVVTGALVIII-IFGIAWWKGCLGRKGSLERELRGVDLQTGLFSLRQMKAATN  658



>gb|KHG25892.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Gossypium arboreum]
Length=619

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            ++  V  S+  IF I+   WWK  +R K+  E EL+G+DLQT  F+ RQIKAATN
Sbjct  214  VIGIVAGSVFAIFLIVLLLWWKGCLRQKSQLERELKGLDLQTSSFSLRQIKAATN  268



>ref|XP_002283578.2| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Vitis vinifera]
Length=1011

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  40   LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            L+F ++   WW+  +R K + E EL+G+DLQTG FT RQIKAATN
Sbjct  619  LVFLVIGILWWRVCLRRKDTLEQELKGLDLQTGLFTLRQIKAATN  663



>ref|XP_006593302.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Glycine max]
Length=858

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
             I+ + VT +L +I  I   AWWK  +  K S E ELRG+DLQTG F+ RQ+KAATN
Sbjct  457  FIVAIVVTGALVIII-IFGIAWWKGCLGRKGSLERELRGVDLQTGLFSLRQMKAATN  512



>ref|XP_010316867.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=998

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            II  AV SSL L+ TI   AW +    N+ S+E ELRG+DL TG FT RQIKAATN
Sbjct  612  IIAGAVASSLVLLLTIFIVAWRRSI--NRISKEEELRGLDLLTGVFTIRQIKAATN  665



>ref|XP_011101928.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Sesamum indicum]
Length=815

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  31   SLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +L LI  ++ +AWW  YI  + S+E  LRG+DL  G FT+RQIKAATN
Sbjct  429  ALFLILAVIFYAWWNQYIGERISREQVLRGLDLHAGFFTYRQIKAATN  476



>ref|XP_011102303.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650, partial [Sesamum indicum]
Length=486

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  31   SLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +L LI  ++ +AWW  YI  + S+E  LRG+DL  G FT+RQIKAATN
Sbjct  262  ALFLILAVIFYAWWNQYIGERISREQVLRGLDLHAGFFTYRQIKAATN  309



>ref|XP_004295405.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Fragaria vesca subsp. 
vesca]
Length=1351

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +1

Query  34   LCLIFTILCFAWWK-FYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LCL+F I    WW+   + ++TS+E  LRG+DLQTG FT RQIKAATN
Sbjct  585  LCLVFLIFGILWWRGCLVDSQTSREKVLRGMDLQTGFFTLRQIKAATN  632



>ref|XP_011046381.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
Length=992

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
             I+  AV   L LI   L   WWK Y+  + S++ EL G+DL TG FTFRQIKAATN
Sbjct  592  FIVAGAVVLPLFLILVFLSTLWWKGYLGERKSRDPELVGLDLLTGIFTFRQIKAATN  648



>ref|XP_006377459.1| hypothetical protein POPTR_0011s06130g [Populus trichocarpa]
 gb|ERP55256.1| hypothetical protein POPTR_0011s06130g [Populus trichocarpa]
Length=585

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  VTS++ LIF ++   +WK    +K ++E EL+G+DL+TG FT RQ+KAAT+
Sbjct  154  IVIGVVTSAVFLIFLVMGVIYWKLCYGDKYTRERELKGLDLKTGSFTLRQLKAATD  209



>ref|XP_002317319.2| hypothetical protein POPTR_0011s032002g, partial [Populus trichocarpa]
 gb|EEE97931.2| hypothetical protein POPTR_0011s032002g, partial [Populus trichocarpa]
Length=668

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  VTS++ LIF ++   +WK    +K ++E EL+G+DL+TG FT RQ+KAAT+
Sbjct  258  IVIGVVTSAVFLIFLVMGVIYWKLCYGDKYTRERELKGLDLKTGSFTLRQLKAATD  313



>ref|XP_006377501.1| hypothetical protein POPTR_0011s06490g [Populus trichocarpa]
 gb|ERP55298.1| hypothetical protein POPTR_0011s06490g [Populus trichocarpa]
Length=573

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  VTS++ LIF ++   +WK    +K ++E EL+G+DL+TG FT RQ+KAAT+
Sbjct  161  IVIGVVTSAVFLIFLVMGVIYWKLCYGDKYTRERELQGLDLKTGSFTLRQLKAATD  216



>emb|CAN65055.1| hypothetical protein VITISV_012378 [Vitis vinifera]
Length=575

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +1

Query  46   FTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            FT+L   WWK Y + K+  E ELRG+DLQTG FT RQIKAATN
Sbjct  181  FTVLGIIWWKCYFKGKSPIE-ELRGLDLQTGFFTLRQIKAATN  222



>gb|ABF72021.1| protein kinase family protein [Musa acuminata]
Length=589

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            T IIV  + S  CLIF +L   W K ++  +T+++ ELR +DL+TG+FT RQIK AT
Sbjct  188  TKIIVGIIVSVSCLIFLLLSILWKKGWLGGQTAKDRELRALDLRTGRFTLRQIKMAT  244



>ref|XP_004295407.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=1681

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +1

Query  34    LCLIFTILCFAWWK-FYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
             LCL   I C  WWK   + ++TS+E  LRG+DL+TG FT RQIKAATN
Sbjct  1286  LCLFIFIFCILWWKGCLVDSETSREEALRGLDLKTGFFTLRQIKAATN  1333


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +1

Query  34   LCLIFTILCFAWWK-FYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LCL+F I    WW+   + ++TS+E  LRG+DLQTG FT RQIKAATN
Sbjct  258  LCLVFLIFGILWWRGCLVDSQTSREKVLRGMDLQTGFFTLRQIKAATN  305



>ref|XP_010655586.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
 ref|XP_010655587.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
Length=1006

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +1

Query  46   FTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            FT+L   WWK Y + K+  E ELRG+DLQTG FT RQIKAATN
Sbjct  625  FTVLGIIWWKCYFKGKSPIE-ELRGLDLQTGFFTLRQIKAATN  666



>emb|CBI20127.3| unnamed protein product [Vitis vinifera]
Length=906

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  40   LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            L+F ++   WW+  +R K + E EL+G+DLQTG FT RQIKAATN
Sbjct  619  LVFLVIGILWWRVCLRRKDTLEQELKGLDLQTGLFTLRQIKAATN  663



>ref|XP_010246509.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1013

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  22   VTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            V S + +IF +L   WWK  + +K + + +LRG+DLQTG FT RQIKAATN
Sbjct  615  VVSIVGVIFLVLGILWWKGCLGHKNTMDQDLRGLDLQTGSFTLRQIKAATN  665



>emb|CBI30748.3| unnamed protein product [Vitis vinifera]
Length=1017

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +1

Query  46   FTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            FT+L   WWK Y + K+  E ELRG+DLQTG FT RQIKAATN
Sbjct  636  FTVLGIIWWKCYFKGKSPIE-ELRGLDLQTGFFTLRQIKAATN  677



>ref|XP_011002048.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X5 [Populus euphratica]
Length=963

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  VTS++ L+F ++   +WK    +K ++E EL+G+DL+TG FT RQ+KAAT+
Sbjct  568  IVIGVVTSAVFLVFLVMGVLYWKLCYGDKYTRERELKGLDLKTGSFTLRQLKAATD  623



>ref|XP_010655559.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=997

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  46   FTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            F IL   WWK     + S+E ELRG+DLQTG FT RQIKAATN
Sbjct  620  FLILGILWWKVCFGGRISREQELRGLDLQTGLFTLRQIKAATN  662



>emb|CAN66180.1| hypothetical protein VITISV_025180 [Vitis vinifera]
Length=561

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  34   LCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            + L+F ++   WW+  +R K + E EL+G+DLQTG FT RQIKAATN
Sbjct  167  ILLVFLVIGILWWRGCLRRKDTLEQELKGLDLQTGLFTVRQIKAATN  213



>ref|XP_009351824.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X4 [Pyrus x bretschneideri]
Length=978

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T+ I+  V   +CL   IL   WWK  +R K  ++ +L G D+Q G FT +QIKAATN
Sbjct  593  TIYIIAGVVGGICLTLFILAILWWKGCLRGKRGRQKDLLGQDMQMGTFTLKQIKAATN  650



>ref|XP_009351815.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X3 [Pyrus x bretschneideri]
Length=1002

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T+ I+  V   +CL   IL   WWK  +R K  ++ +L G D+Q G FT +QIKAATN
Sbjct  617  TIYIIAGVVGGICLTLFILAILWWKGCLRGKRGRQKDLLGQDMQMGTFTLKQIKAATN  674



>ref|XP_010655558.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=1003

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  46   FTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            F IL   WWK     + S+E ELRG+DLQTG FT RQIKAATN
Sbjct  626  FLILGILWWKVCFGGRISREQELRGLDLQTGLFTLRQIKAATN  668



>ref|XP_009351806.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Pyrus x bretschneideri]
Length=1011

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T+ I+  V   +CL   IL   WWK  +R K  ++ +L G D+Q G FT +QIKAATN
Sbjct  626  TIYIIAGVVGGICLTLFILAILWWKGCLRGKRGRQKDLLGQDMQMGTFTLKQIKAATN  683



>ref|XP_009406150.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009406151.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Musa acuminata subsp. malaccensis]
Length=896

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            T IIV  + S  CLIF +L   W K ++  +T+++ ELR +DL+TG+FT RQIK AT
Sbjct  498  TKIIVGIIVSVSCLIFLLLSILWKKGWLGGQTAKDRELRALDLRTGRFTLRQIKMAT  554



>emb|CBI30745.3| unnamed protein product [Vitis vinifera]
Length=1901

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  46    FTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
             F IL   WWK     + S+E ELRG+DLQTG FT RQIKAATN
Sbjct  1524  FLILGILWWKVCFGGRISREQELRGLDLQTGLFTLRQIKAATN  1566



>ref|XP_011002046.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Populus euphratica]
Length=983

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  VTS++ L+F ++   +WK    +K ++E EL+G+DL+TG FT RQ+KAAT+
Sbjct  588  IVIGVVTSAVFLVFLVMGVLYWKLCYGDKYTRERELKGLDLKTGSFTLRQLKAATD  643



>ref|XP_011002045.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Populus euphratica]
Length=985

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  VTS++ L+F ++   +WK    +K ++E EL+G+DL+TG FT RQ+KAAT+
Sbjct  590  IVIGVVTSAVFLVFLVMGVLYWKLCYGDKYTRERELKGLDLKTGSFTLRQLKAATD  645



>ref|XP_009351800.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Pyrus x bretschneideri]
Length=1016

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T+ I+  V   +CL   IL   WWK  +R K  ++ +L G D+Q G FT +QIKAATN
Sbjct  631  TIYIIAGVVGGICLTLFILAILWWKGCLRGKRGRQKDLLGQDMQMGTFTLKQIKAATN  688



>ref|XP_011002049.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X6 [Populus euphratica]
Length=959

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  VTS++ L+F ++   +WK    +K ++E EL+G+DL+TG FT RQ+KAAT+
Sbjct  564  IVIGVVTSAVFLVFLVMGVLYWKLCYGDKYTRERELKGLDLKTGSFTLRQLKAATD  619



>ref|XP_011002044.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Populus euphratica]
Length=1007

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  VTS++ L+F ++   +WK    +K ++E EL+G+DL+TG FT RQ+KAAT+
Sbjct  612  IVIGVVTSAVFLVFLVMGVLYWKLCYGDKYTRERELKGLDLKTGSFTLRQLKAATD  667



>gb|ABF70094.1| protein kinase, putative [Musa balbisiana]
Length=549

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            T IIV  + S  CLIF +L   W K ++  +T+++ E+R +DL+TG+FT RQIK AT
Sbjct  152  TKIIVGIIVSVSCLIFLLLSILWKKGWLGGQTAKDREMRALDLRTGRFTLRQIKMAT  208



>ref|XP_011002050.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X7 [Populus euphratica]
Length=1002

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  VTS++ L+F ++   +WK    +K ++E EL+G+DL+TG FT RQ+KAAT+
Sbjct  612  IVIGVVTSAVFLVFLVMGVLYWKLCYGDKYTRERELKGLDLKTGSFTLRQLKAATD  667



>ref|XP_011098063.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Sesamum indicum]
Length=1020

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            T ++   +  ++C +  ILCF   K Y+  K S + +LRG+DLQTG FT RQIKAAT
Sbjct  617  TAVVAGTIAGAVCFLTLILCFMHEKGYLGGKISADKDLRGLDLQTGLFTLRQIKAAT  673



>emb|CDP06039.1| unnamed protein product [Coffea canephora]
Length=998

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  55   LCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +C  WWK  +R + + EN+L+G+DLQTG FT RQIKAATN
Sbjct  613  ICVLWWKGCLRCRDTVENDLKGLDLQTGSFTLRQIKAATN  652



>ref|XP_010273494.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Nelumbo nucifera]
Length=1021

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IVV++     LIF +L F WW+ Y+ +K + + ++ G+DL TG FT RQIKAATN
Sbjct  620  IVVSIAG---LIFFVLGFLWWRGYLGHKNTMDQDMTGLDLHTGFFTLRQIKAATN  671



>emb|CAN74151.1| hypothetical protein VITISV_028028 [Vitis vinifera]
Length=882

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  40   LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            L+F ++   WW+  +R K + E EL+G+DLQTG FT RQIKAATN
Sbjct  490  LVFLLIGILWWRDCLRRKDTLEQELKGLDLQTGLFTLRQIKAATN  534



>gb|KDO42388.1| hypothetical protein CISIN_1g001767mg [Citrus sinensis]
 gb|KDO42389.1| hypothetical protein CISIN_1g001767mg [Citrus sinensis]
Length=1016

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  13   VVAVTSSLCLIFTILCFAWWKF-YIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +V + +  C +  IL F  W+  Y+  K  ++ ELRG+DLQTG FT RQIKAATN
Sbjct  605  IVGIVAGSCAVVIILLFILWRLGYLGGKNVEDKELRGLDLQTGYFTLRQIKAATN  659



>ref|XP_006377483.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
 gb|ERP55280.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
Length=642

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  +TS+  LIF ++   +WK    +K ++E EL+G+DL+TG FT RQ+KAAT+
Sbjct  228  IVIGVITSAAFLIFMVMGVIYWKLCYGDKYTRERELKGLDLKTGSFTLRQLKAATD  283



>ref|XP_006477836.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X1 [Citrus sinensis]
 ref|XP_006477837.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X2 [Citrus sinensis]
 ref|XP_006477838.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X3 [Citrus sinensis]
Length=1016

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  13   VVAVTSSLCLIFTILCFAWWKF-YIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +V + +  C +  IL F  W+  Y+  K  ++ ELRG+DLQTG FT RQIKAATN
Sbjct  605  IVGIVAGSCAVVIILLFILWRLGYLGGKNVEDKELRGLDLQTGYFTLRQIKAATN  659



>ref|XP_006442369.1| hypothetical protein CICLE_v10018721mg [Citrus clementina]
 gb|ESR55609.1| hypothetical protein CICLE_v10018721mg [Citrus clementina]
Length=966

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  13   VVAVTSSLCLIFTILCFAWWKF-YIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +V + +  C +  IL F  W+  Y+  K  ++ ELRG+DLQTG FT RQIKAATN
Sbjct  555  IVGIIAGSCAVVIILLFILWRLGYLGGKNVEDKELRGLDLQTGYFTLRQIKAATN  609



>ref|XP_011002047.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X4 [Populus euphratica]
Length=983

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  VTS++ L+F ++   +WK    +K ++E EL+G+DL+TG FT RQ+KAAT+
Sbjct  588  IVIGVVTSAVFLVFLVMGVLYWKLCYGDKYTRERELKGLDLKTGSFTLRQLKAATD  643



>ref|XP_003634703.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Vitis vinifera]
Length=1007

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  40   LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            L+F ++   WW+  +R K + E EL+G+DLQTG FT RQIKAATN
Sbjct  615  LVFLLIGILWWRDCLRRKDTLEQELKGLDLQTGLFTLRQIKAATN  659



>ref|XP_009406149.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Musa acuminata subsp. malaccensis]
Length=995

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            T IIV  + S  CLIF +L   W K ++  +T+++ ELR +DL+TG+FT RQIK AT
Sbjct  597  TKIIVGIIVSVSCLIFLLLSILWKKGWLGGQTAKDRELRALDLRTGRFTLRQIKMAT  653



>gb|KGN53588.1| hypothetical protein Csa_4G083620 [Cucumis sativus]
Length=991

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  16   VAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            + V+S L +I  +L F W   YI  K    NEL GIDLQTG FT +QIKAATN
Sbjct  611  IIVSSFLVVIILVLVFLWMTGYICKKEDLANELSGIDLQTGHFTLKQIKAATN  663



>ref|XP_004137308.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like [Cucumis sativus]
Length=1030

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  16   VAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            + V+S L +I  +L F W   YI  K    NEL GIDLQTG FT +QIKAATN
Sbjct  611  IIVSSFLVVIILVLVFLWMTGYICKKEDLANELSGIDLQTGHFTLKQIKAATN  663



>ref|XP_011082789.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Sesamum indicum]
Length=992

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +IV    + L  +  +L   WWK  +R K + +N+L+G+DL TG FT RQI+AATN
Sbjct  599  VIVGIAVAGLFTVLLVLGILWWKGCLRRKDTMQNDLKGLDLHTGSFTLRQIRAATN  654



>gb|KDO42390.1| hypothetical protein CISIN_1g001767mg [Citrus sinensis]
Length=764

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  13   VVAVTSSLCLIFTILCFAWWKF-YIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +V + +  C +  IL F  W+  Y+  K  ++ ELRG+DLQTG FT RQIKAATN
Sbjct  605  IVGIVAGSCAVVIILLFILWRLGYLGGKNVEDKELRGLDLQTGYFTLRQIKAATN  659



>ref|XP_010655578.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Vitis vinifera]
Length=864

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 3/45 (7%)
 Frame = +1

Query  40   LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            L+F IL   WWK     + S+E ELRG+DLQTG FT RQIKAATN
Sbjct  479  LVFGIL---WWKVCFGGRISREQELRGLDLQTGLFTLRQIKAATN  520



>emb|CAN81177.1| hypothetical protein VITISV_011951 [Vitis vinifera]
Length=868

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 3/45 (7%)
 Frame = +1

Query  40   LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            L+F IL   WWK     + S+E ELRG+DLQTG FT RQIKAATN
Sbjct  470  LVFGIL---WWKVCFGGRISREQELRGLDLQTGLFTLRQIKAATN  511



>ref|XP_010655576.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=985

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 3/45 (7%)
 Frame = +1

Query  40   LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            L+F IL   WWK     + S+E ELRG+DLQTG FT RQIKAATN
Sbjct  600  LVFGIL---WWKVCFGGRISREQELRGLDLQTGLFTLRQIKAATN  641



>ref|XP_010655575.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=986

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 3/45 (7%)
 Frame = +1

Query  40   LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            L+F IL   WWK     + S+E ELRG+DLQTG FT RQIKAATN
Sbjct  601  LVFGIL---WWKVCFGGRISREQELRGLDLQTGLFTLRQIKAATN  642



>ref|XP_010655574.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
 emb|CBI30746.3| unnamed protein product [Vitis vinifera]
Length=1008

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 3/45 (7%)
 Frame = +1

Query  40   LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            L+F IL   WWK     + S+E ELRG+DLQTG FT RQIKAATN
Sbjct  623  LVFGIL---WWKVCFGGRISREQELRGLDLQTGLFTLRQIKAATN  664



>gb|KDO42386.1| hypothetical protein CISIN_1g0041552mg, partial [Citrus sinensis]
Length=500

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IV A T  + L+  IL   WWK   R + + E ELRG+DL TG FT RQIKAATN
Sbjct  99   IVAATTFVIILLVGIL---WWKGCFRPEHTLEQELRGVDLHTGSFTLRQIKAATN  150



>gb|AES66484.2| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=577

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            ++VA T  + LIF IL   WWK     K S E EL+ +DLQTG FT RQIKAATN
Sbjct  197  LLVAATIVIILIFGIL---WWKECFGKKNSLERELKSLDLQTGLFTLRQIKAATN  248



>ref|XP_009351856.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Pyrus x bretschneideri]
Length=988

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IV+ V S+L L+F IL   W K     +T++E +L G DLQTG F F+Q+KAATN
Sbjct  605  IVIGVVSALFLVFVILGILWLKGCFGGRTTREQDLMGFDLQTGFFKFKQLKAATN  659



>ref|XP_010655579.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X6 [Vitis vinifera]
Length=844

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 3/45 (7%)
 Frame = +1

Query  40   LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            L+F IL   WWK     + S+E ELRG+DLQTG FT RQIKAATN
Sbjct  623  LVFGIL---WWKVCFGGRISREQELRGLDLQTGLFTLRQIKAATN  664



>ref|XP_010655577.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Vitis vinifera]
Length=891

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 3/45 (7%)
 Frame = +1

Query  40   LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            L+F IL   WWK     + S+E ELRG+DLQTG FT RQIKAATN
Sbjct  623  LVFGIL---WWKVCFGGRISREQELRGLDLQTGLFTLRQIKAATN  664



>emb|CBI20121.3| unnamed protein product [Vitis vinifera]
Length=869

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  40   LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            L+F ++   WW+  +R K + E EL+G+DLQTG FT RQIKAATN
Sbjct  615  LVFLLIGILWWRDCLRRKDTLEQELKGLDLQTGLFTLRQIKAATN  659



>ref|XP_006442368.1| hypothetical protein CICLE_v10018771mg [Citrus clementina]
 gb|ESR55608.1| hypothetical protein CICLE_v10018771mg [Citrus clementina]
Length=910

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IV A T  + L+  IL   WWK   R + + E ELRG+DL TG FT RQIKAATN
Sbjct  509  IVAATTFVIILLVGIL---WWKGCFRPEHTLEQELRGVDLHTGSFTLRQIKAATN  560



>gb|KDO52103.1| hypothetical protein CISIN_1g043333mg, partial [Citrus sinensis]
Length=809

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IV A    L LI +IL   WWK   + K + E EL+G+DL TG FT RQIKAATN
Sbjct  524  IVAAAAFILILIVSIL---WWKGCFKRKHTLEQELKGLDLHTGSFTLRQIKAATN  575



>ref|XP_010272733.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Nelumbo nucifera]
Length=882

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +1

Query  1    TLIIVVAVTSSLC-LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            ++I+V +V +S   LIF +L   W K ++  K S + EL+GIDLQTG FT RQIKAAT
Sbjct  480  SVIVVASVLASAAFLIFLVLGILWRKGWLGGKASMDRELKGIDLQTGIFTLRQIKAAT  537



>gb|KDP23043.1| hypothetical protein JCGZ_00508 [Jatropha curcas]
Length=560

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  46   FTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            F +LC  WWK  +  K   + +LRG+DLQTG FT RQIKAATN
Sbjct  164  FLVLCVLWWKGCLWRKDIIDQDLRGLDLQTGSFTLRQIKAATN  206



>ref|XP_006442308.1| hypothetical protein CICLE_v10024314mg, partial [Citrus clementina]
 gb|ESR55548.1| hypothetical protein CICLE_v10024314mg, partial [Citrus clementina]
Length=925

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IV A    L LI +IL   WWK   + K + E EL+G+DL TG FT RQIKAATN
Sbjct  523  IVAAAAFILILIVSIL---WWKGCFKRKHTLEQELKGLDLHTGSFTLRQIKAATN  574



>ref|XP_010272732.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nelumbo nucifera]
Length=1024

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +1

Query  1    TLIIVVAVTSSLC-LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            ++I+V +V +S   LIF +L   W K ++  K S + EL+GIDLQTG FT RQIKAAT
Sbjct  622  SVIVVASVLASAAFLIFLVLGILWRKGWLGGKASMDRELKGIDLQTGIFTLRQIKAAT  679



>ref|XP_004295664.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Fragaria vesca subsp. 
vesca]
Length=1023

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            ++ +    ++ L+  +  + WW+ Y+R + + E +L+G+DLQTGKF+ RQIK AT
Sbjct  624  VVGIMAAGAVFLVLLVFAYLWWRGYLRRERTLEQDLKGVDLQTGKFSLRQIKDAT  678



>gb|KDP24894.1| hypothetical protein JCGZ_25156 [Jatropha curcas]
Length=544

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  46   FTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            F +LC  WWK  +  K   + +LRG+DLQTG FT RQIKAATN
Sbjct  148  FLVLCVLWWKGCLWRKDIIDQDLRGLDLQTGSFTLRQIKAATN  190



>ref|XP_010655560.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=970

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            I +AV +   +IF IL   WWK     + S+E +L G+D+QTG FT +QIKAAT
Sbjct  612  IFIAVGAVAFMIFLILGILWWKVCFGGRISREQDLEGLDMQTGSFTLKQIKAAT  665



>ref|XP_008366034.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=980

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTS-QENELRGIDLQTGKFTFRQIKAATN  174
            + IVV V S+LCL F      W +     +TS +E +L+G+DLQTG F F+QIKAATN
Sbjct  584  IYIVVVVVSALCLFFVTAAILWLRCCKERRTSTREQDLKGLDLQTGFFGFKQIKAATN  641



>gb|KDO49310.1| hypothetical protein CISIN_1g040908mg [Citrus sinensis]
Length=790

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  67   WWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            WWK   R K + E ELRG+DLQTG FT RQIKAATN
Sbjct  411  WWKGCFRPKYTSERELRGLDLQTGSFTLRQIKAATN  446



>ref|XP_011046349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1005

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQEN--ELRGIDLQTGKFTFRQIKAATN  174
             I+  AV  SL L+F +L   WWK Y+  + S++   EL G+DL TG FTF QIKAATN
Sbjct  603  FIVAGAVVLSLFLVFILLSSPWWKGYLGGRKSRDRGAELVGLDLLTGIFTFSQIKAATN  661



>ref|XP_006477833.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Citrus sinensis]
Length=996

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  67   WWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            WWK   R K + E ELRG+DLQTG FT RQIKAATN
Sbjct  617  WWKGCFRPKYTSERELRGLDLQTGSFTLRQIKAATN  652



>ref|XP_006442357.1| hypothetical protein CICLE_v10018686mg [Citrus clementina]
 gb|ESR55597.1| hypothetical protein CICLE_v10018686mg [Citrus clementina]
Length=996

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  67   WWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            WWK   R K + E ELRG+DLQTG FT RQIKAATN
Sbjct  617  WWKGCFRPKYTSERELRGLDLQTGSFTLRQIKAATN  652



>ref|XP_008371728.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103435116 
[Malus domestica]
Length=2029

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  1     TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
             T+ I+  V   +CL   I+   WWK  +R K  ++ +L G D+Q   FTF+QIKAATN
Sbjct  1631  TIYIIAGVVGGICLTLFIVAILWWKRCLRGKXGRQKDLLGRDMQMRTFTFKQIKAATN  1688



>ref|XP_002317383.2| hypothetical protein POPTR_0011s06220g [Populus trichocarpa]
 gb|EEE97995.2| hypothetical protein POPTR_0011s06220g [Populus trichocarpa]
Length=591

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  VTS+  LI  ++   +WK    +K ++E EL+G+DL+TG FT RQ+KAAT+
Sbjct  179  IVIGVVTSASFLILLVMGVIYWKLCYGDKNTRERELKGLDLKTGSFTLRQLKAATD  234



>gb|AES66480.2| LRR receptor-like kinase [Medicago truncatula]
Length=448

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 34/55 (62%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IVVA  + + L+F IL   WWK     K S   EL  +DLQTG FT RQIKAATN
Sbjct  103  IVVAAITVIILVFVIL---WWKGCFGKKNSLARELNSLDLQTGLFTLRQIKAATN  154



>ref|XP_010655561.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Vitis vinifera]
Length=783

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            I +AV +   +IF IL   WWK     + S+E +L G+D+QTG FT +QIKAAT
Sbjct  612  IFIAVGAVAFMIFLILGILWWKVCFGGRISREQDLEGLDMQTGSFTLKQIKAAT  665



>emb|CBI30744.3| unnamed protein product [Vitis vinifera]
Length=1144

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            I +AV +   +IF IL   WWK     + S+E +L G+D+QTG FT +QIKAAT
Sbjct  654  IFIAVGAVAFMIFLILGILWWKVCFGGRISREQDLEGLDMQTGSFTLKQIKAAT  707



>ref|XP_010273522.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Nelumbo nucifera]
Length=436

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            ++   V S +  IF +L F WW+  + NK++   +L G+D+QTG FT RQIK ATN
Sbjct  15   VVAGVVISIVGFIFLVLGFLWWRGCLCNKSTMNKDLIGLDVQTGSFTLRQIKDATN  70



>ref|XP_006370933.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
 gb|ERP48730.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
Length=540

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  67   WWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            WWK Y+R + S++ EL G+DL TG FTFRQIKAATN
Sbjct  265  WWKGYLRGRKSRDRELVGLDLLTGIFTFRQIKAATN  300



>ref|XP_004488998.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Cicer arietinum]
Length=1007

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IVVA  S + ++F IL   WWK   R K S   E+  +DLQTG FT RQIKAATN
Sbjct  606  IVVAAISIMIIVFGIL---WWKGCFRKKNSLAREVMSLDLQTGLFTLRQIKAATN  657



>ref|XP_007214035.1| hypothetical protein PRUPE_ppa017351mg [Prunus persica]
 gb|EMJ15234.1| hypothetical protein PRUPE_ppa017351mg [Prunus persica]
Length=876

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTS-QENELRGIDLQTGKFTFRQIKAATN  174
            + IVV   S LCLIF  +   W +     + S +E +LRG+DLQTG F F+QIKAATN
Sbjct  531  IFIVVGAVSVLCLIFMTIGILWLRCCFGGRASTREQDLRGLDLQTGFFRFKQIKAATN  588



>ref|XP_006377471.1| hypothetical protein POPTR_0011s06260g [Populus trichocarpa]
 gb|ERP55268.1| hypothetical protein POPTR_0011s06260g [Populus trichocarpa]
Length=576

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  VTS+  LI  ++   +WK    +K ++E EL+G+DL+TG FT RQ+KAAT+
Sbjct  216  IVIGVVTSAAFLILLVMGVIYWKLCYGDKYTRERELKGLDLKTGSFTLRQLKAATD  271



>ref|XP_003596229.1| Leucine-rich repeat family protein / protein kinase family protein 
[Medicago truncatula]
Length=466

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 34/55 (62%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IVVA  + + L+F IL   WWK     K S   EL  +DLQTG FT RQIKAATN
Sbjct  103  IVVAAITVIILVFVIL---WWKGCFGKKNSLARELNSLDLQTGLFTLRQIKAATN  154



>ref|XP_006377472.1| hypothetical protein POPTR_0011s06260g [Populus trichocarpa]
 gb|ERP55269.1| hypothetical protein POPTR_0011s06260g [Populus trichocarpa]
Length=582

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  VTS+  LI  ++   +WK    +K ++E EL+G+DL+TG FT RQ+KAAT+
Sbjct  216  IVIGVVTSAAFLILLVMGVIYWKLCYGDKYTRERELKGLDLKTGSFTLRQLKAATD  271



>ref|XP_008225432.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Prunus mume]
Length=657

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTS-QENELRGIDLQTGKFTFRQIKAATN  174
            + IVV   S LCLIF  +   W +     + S +E +LRG+DLQTG F F+QIKAATN
Sbjct  270  IFIVVGAVSVLCLIFMTIGILWLRCCFGGRASTREQDLRGLDLQTGFFRFKQIKAATN  327



>ref|XP_008358125.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Malus domestica]
Length=430

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            +V  V   + +I  ILC  W +  +  + + E++L+G+DLQTGKFTF+Q+KAAT
Sbjct  29   VVGIVAGGIFIILVILCILWRRGSLGQQKTLEDDLKGVDLQTGKFTFKQLKAAT  82



>gb|KEH38577.1| LRR receptor-like kinase [Medicago truncatula]
Length=1010

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IVVA T ++ L+F IL   WWK     K S   EL  +D+QTG FT RQIKAATN
Sbjct  609  IVVAATIAIILVFVIL---WWKGCFGKKNSLARELNSLDVQTGIFTLRQIKAATN  660



>ref|XP_008225247.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Prunus mume]
Length=938

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+  AV  +  L+F IL   WWK Y+  K  ++ +  G+D QTG FT +Q+KAATN
Sbjct  540  IVAGAVVGAFGLVFVILGILWWKGYMPGKRGRKKDREGLDGQTGTFTLKQLKAATN  595



>ref|XP_008225246.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Prunus mume]
Length=1010

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+  AV  +  L+F IL   WWK Y+  K  ++ +  G+D QTG FT +Q+KAATN
Sbjct  612  IVAGAVVGAFGLVFVILGILWWKGYMPGKRGRKKDREGLDGQTGTFTLKQLKAATN  667



>gb|KEH38578.1| LRR receptor-like kinase [Medicago truncatula]
Length=827

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IVVA T ++ L+F IL   WWK     K S   EL  +D+QTG FT RQIKAATN
Sbjct  609  IVVAATIAIILVFVIL---WWKGCFGKKNSLARELNSLDVQTGIFTLRQIKAATN  660



>ref|XP_007048782.1| Leucine-rich repeat transmembrane protein kinase isoform 3 [Theobroma 
cacao]
 gb|EOX92939.1| Leucine-rich repeat transmembrane protein kinase isoform 3 [Theobroma 
cacao]
Length=773

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            +++V AV++++ ++  +L   W K ++  K S E ELR +DLQTG F+ RQIKAAT
Sbjct  484  IVVVGAVSAAILIVLMVLSVMWRKGWLGGKISAEKELRCLDLQTGIFSLRQIKAAT  539



>emb|CBI20126.3| unnamed protein product [Vitis vinifera]
Length=225

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  40   LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            L+F ++   WW+  +R K + E +L+G+D QTG FT RQIKAATN
Sbjct  105  LVFLVIGILWWRGCLRRKDTLEQDLKGLDQQTGLFTLRQIKAATN  149



>ref|XP_007048781.1| Leucine-rich repeat transmembrane protein kinase isoform 2 [Theobroma 
cacao]
 gb|EOX92938.1| Leucine-rich repeat transmembrane protein kinase isoform 2 [Theobroma 
cacao]
Length=873

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            +++V AV++++ ++  +L   W K ++  K S E ELR +DLQTG F+ RQIKAAT
Sbjct  471  IVVVGAVSAAILIVLMVLSVMWRKGWLGGKISAEKELRCLDLQTGIFSLRQIKAAT  526



>emb|CBI20136.3| unnamed protein product [Vitis vinifera]
Length=710

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  67   WWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            WWK  +R+K + E +LRG++LQTG FT RQIKAATN
Sbjct  326  WWKGCLRHKNTMEQDLRGLNLQTGTFTLRQIKAATN  361



>ref|XP_011009654.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X3 [Populus euphratica]
Length=871

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            T+ I++ V    CL+F+ L   WWK Y R K  ++  L GI++QT  FT +QIKAAT
Sbjct  431  TVPIILGVVG-FCLVFSALAIFWWKCYFRVKKRRQKGLEGIEIQTVSFTLKQIKAAT  486



>ref|XP_002528777.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33599.1| ATP binding protein, putative [Ricinus communis]
Length=1007

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 2/57 (4%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LI+  AV   L +I  I+   WWK  + ++  +E EL G+D QTG FTFRQIKAATN
Sbjct  588  LIVAGAVVLPLFVILVIVGTIWWK--VHSRAVKEQELLGLDQQTGVFTFRQIKAATN  642



>ref|XP_011009653.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Populus euphratica]
Length=996

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            T+ I++ V    CL+F+ L   WWK Y R K  ++  L GI++QT  FT +QIKAAT
Sbjct  556  TVPIILGVVG-FCLVFSALAIFWWKCYFRVKKRRQKGLEGIEIQTVSFTLKQIKAAT  611



>ref|XP_011009652.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Populus euphratica]
Length=1039

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            T+ I++ V    CL+F+ L   WWK Y R K  ++  L GI++QT  FT +QIKAAT
Sbjct  599  TVPIILGVVG-FCLVFSALAIFWWKCYFRVKKRRQKGLEGIEIQTVSFTLKQIKAAT  654



>ref|XP_007048780.1| Leucine-rich repeat transmembrane protein kinase isoform 1 [Theobroma 
cacao]
 gb|EOX92937.1| Leucine-rich repeat transmembrane protein kinase isoform 1 [Theobroma 
cacao]
Length=1029

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            +++V AV++++ ++  +L   W K ++  K S E ELR +DLQTG F+ RQIKAAT
Sbjct  627  IVVVGAVSAAILIVLMVLSVMWRKGWLGGKISAEKELRCLDLQTGIFSLRQIKAAT  682



>ref|XP_007021938.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY13463.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=825

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+V +V  +   +F I    WW  ++R K++ E +L+G++LQT  FT RQIKAATN
Sbjct  420  IVVGSVAGAAFAVFLIGGILWWYGFLRPKSTLERDLKGLELQTNSFTLRQIKAATN  475



>emb|CBI20123.3| unnamed protein product [Vitis vinifera]
Length=157

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +1

Query  40   LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LIF ++   WW+  +R K + E +L+G+D  TG FT RQIKAATN
Sbjct  37   LIFLVIGILWWRGCLRRKDTLEQDLKGLDQHTGLFTLRQIKAATN  81



>ref|XP_006358135.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=779

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            II  AV S L LIF I+ F  WK + +NK ++E E RG+D  TG FT RQIKAATN
Sbjct  392  IIAGAVVSLLILIF-IISFVAWKRH-KNKIAKEEESRGLDSMTGVFTIRQIKAATN  445



>gb|KCW74191.1| hypothetical protein EUGRSUZ_E02839 [Eucalyptus grandis]
Length=927

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +IV     + C+    LC   WK Y R +T +   + G+DLQTG F+ +QIKAATN
Sbjct  567  VIVGVGAGAFCIFLLSLCILKWKGYFRGRTKRRQGMDGLDLQTGTFSLKQIKAATN  622



>ref|XP_010057167.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Eucalyptus grandis]
Length=973

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +IV     + C+    LC   WK Y R +T +   + G+DLQTG F+ +QIKAATN
Sbjct  613  VIVGVGAGAFCIFLLSLCILKWKGYFRGRTKRRQGMDGLDLQTGTFSLKQIKAATN  668



>ref|XP_010057166.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Eucalyptus grandis]
Length=975

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +IV     + C+    LC   WK Y R +T +   + G+DLQTG F+ +QIKAATN
Sbjct  615  VIVGVGAGAFCIFLLSLCILKWKGYFRGRTKRRQGMDGLDLQTGTFSLKQIKAATN  670



>ref|XP_010316864.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X3 [Solanum lycopersicum]
Length=975

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T+ ++V V ++ C+   ++   WWK Y++ K  Q  +L G++LQT  FT +QIKAATN
Sbjct  582  TVFVIVGVVTT-CIFLLLISTLWWKGYLQCKKKQRTDLEGMELQTISFTLKQIKAATN  638



>ref|XP_007025275.1| Receptor-like kinase in flowers 1, putative [Theobroma cacao]
 gb|EOY27897.1| Receptor-like kinase in flowers 1, putative [Theobroma cacao]
Length=995

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            TL IVV V  S  LIF +     W++Y + K+ +E +L+G+D QT  FT +QIKAATN
Sbjct  597  TLPIVVGVLGSF-LIFLVSGVLCWRYYFKTKSRREKDLKGLDPQTVSFTLKQIKAATN  653



>gb|EYU28129.1| hypothetical protein MIMGU_mgv1a025582mg, partial [Erythranthe 
guttata]
Length=940

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  13   VVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +V    ++C+IF +L   WWK Y++ K  +  E  G++ QT  FT +QI+AATN
Sbjct  567  IVGPVVAVCVIFLMLSILWWKGYLKGKKRRGKEFEGLEFQTVAFTLKQIRAATN  620



>ref|XP_007021935.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY13460.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=1016

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  43   IFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I  I+   WW  Y+R K++ E +L+G+DL+ G F+ RQIKAATN
Sbjct  620  ILLIVVLLWWSGYLRQKSTLEQDLKGLDLKIGSFSLRQIKAATN  663



>ref|XP_010316863.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Solanum lycopersicum]
Length=994

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T+ ++V V ++ C+   ++   WWK Y++ K  Q  +L G++LQT  FT +QIKAATN
Sbjct  601  TVFVIVGVVTT-CIFLLLISTLWWKGYLQCKKKQRTDLEGMELQTISFTLKQIKAATN  657



>ref|XP_006477897.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like, partial [Citrus sinensis]
Length=932

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IV A T  + L+  IL   WWK   R + + E EL+G+DL TG FT RQIKAATN
Sbjct  530  IVAATTFVIILLVGIL---WWKGCFRPEHTLEQELKGVDLLTGSFTLRQIKAATN  581



>ref|XP_010316862.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Solanum lycopersicum]
Length=995

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T+ ++V V ++ C+   ++   WWK Y++ K  Q  +L G++LQT  FT +QIKAATN
Sbjct  602  TVFVIVGVVTT-CIFLLLISTLWWKGYLQCKKKQRTDLEGMELQTISFTLKQIKAATN  658



>ref|XP_002524511.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF37838.1| ATP binding protein, putative [Ricinus communis]
Length=985

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            ++  V +++ +IF IL   WWK  +  K   + +LRG++LQTG FT +QIKAATN
Sbjct  580  VIGIVATAIAVIFFILGVLWWKGCLGRKDILDQDLRGLELQTGSFTLKQIKAATN  634



>ref|XP_006377463.1| hypothetical protein POPTR_0011s06170g [Populus trichocarpa]
 gb|ERP55260.1| hypothetical protein POPTR_0011s06170g [Populus trichocarpa]
Length=363

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  70   WKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            WKFY R+K  +E +L+G+DL+TG FT RQ++AATN
Sbjct  6    WKFYFRDKFMRERDLKGLDLKTGSFTLRQLRAATN  40



>ref|XP_002532988.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29396.1| conserved hypothetical protein [Ricinus communis]
Length=941

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            +I+   V++++ L+  IL   W K  + +  S + ELRG+DLQTG FT RQIKAAT
Sbjct  526  IIVATTVSAAVFLVLLILGIMWRKGCLGDNVSADKELRGLDLQTGIFTLRQIKAAT  581



>ref|XP_010272742.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Nelumbo nucifera]
Length=954

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  67   WWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            WWK Y+  K  +  +LRG+DLQTG FT RQIKAATN
Sbjct  576  WWKGYLGGKNRRYKDLRGLDLQTGSFTLRQIKAATN  611



>ref|XP_006377260.1| hypothetical protein POPTR_0011s03210g, partial [Populus trichocarpa]
 gb|ERP55057.1| hypothetical protein POPTR_0011s03210g, partial [Populus trichocarpa]
Length=484

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = +1

Query  4    LIIVVAVTSSLC--LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LI  + V S +   ++F ++    WKFY R+K  +E +L+G+DL+TG  T RQ++AATN
Sbjct  183  LISAITVCSGILTQIVFLVMGVICWKFYFRDKFMRERDLKGLDLKTGSCTLRQLRAATN  241



>ref|XP_010272741.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nelumbo nucifera]
Length=1008

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  67   WWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            WWK Y+  K  +  +LRG+DLQTG FT RQIKAATN
Sbjct  630  WWKGYLGGKNRRYKDLRGLDLQTGSFTLRQIKAATN  665



>ref|XP_006371019.1| hypothetical protein POPTR_0019s027001g, partial [Populus trichocarpa]
 gb|ERP48816.1| hypothetical protein POPTR_0019s027001g, partial [Populus trichocarpa]
Length=599

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  67   WWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            WWK ++R + S++ EL G+DL TG FTFRQIKAATN
Sbjct  220  WWKGHLRGRKSRDRELVGLDLLTGIFTFRQIKAATN  255



>ref|XP_004296291.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Fragaria vesca subsp. 
vesca]
Length=978

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  67   WWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            WW+  +  KTS+E  LRG+DLQTG FTF+QIKAATN
Sbjct  601  WWRGCLDKKTSREEVLRGLDLQTGFFTFKQIKAATN  636



>gb|KHG01342.1| hypothetical protein F383_21253 [Gossypium arboreum]
Length=376

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  67   WWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            WWK Y + K S+E  LRG+DLQTG FTF Q+KAATN
Sbjct  95   WWKGYFQPKPSREQVLRGLDLQTGFFTFIQMKAATN  130



>ref|XP_007213636.1| hypothetical protein PRUPE_ppa001834mg [Prunus persica]
 gb|EMJ14835.1| hypothetical protein PRUPE_ppa001834mg [Prunus persica]
Length=759

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+  AV  +  L+F IL   WWK Y+  K  ++ + RG+D QTG FT +Q+KAATN
Sbjct  612  IVAGAVVGAFGLVFVILGILWWKGYMPGKRGRKKD-RGLDGQTGTFTLKQLKAATN  666



>ref|XP_007025266.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY27888.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=988

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  52   ILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IL   WWK  + ++ S+E ELRG+DL+TG FT RQIKAATN
Sbjct  616  ILGALWWKGCLWDRISREEELRGLDLKTGIFTLRQIKAATN  656



>ref|XP_010316866.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=993

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            II  +V S L LI TI   AW +   RNK ++E E RG+D  TG FT RQIKAATN
Sbjct  606  IIAGSVVSLLILILTISFVAWKRH--RNKIAKEEESRGLDSMTGVFTIRQIKAATN  659



>ref|XP_006377512.1| hypothetical protein POPTR_0011s06580g, partial [Populus trichocarpa]
 gb|ERP55309.1| hypothetical protein POPTR_0011s06580g, partial [Populus trichocarpa]
Length=293

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  VTS+  LI  ++   +WKF   +K ++E EL+G+DL+TG FT RQ+KA  +
Sbjct  204  IVIGVVTSAAFLILLVMGVIYWKFCYGDKYTRERELKGLDLKTGSFTLRQLKATPD  259



>ref|XP_006358079.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1-like [Solanum tuberosum]
Length=997

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T+ ++V V ++ C+   ++   WWK Y++ K  Q  +L G++LQT  FT +QIKAATN
Sbjct  605  TVYVIVGVVAT-CIFLLLISTLWWKGYLQCKKKQRKDLEGMELQTISFTLKQIKAATN  661



>gb|AES66493.2| LRR receptor-like kinase [Medicago truncatula]
Length=973

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 34/55 (62%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IVVA T+ + L+F IL   WWK     K S   EL  +DLQT  FT RQIKAATN
Sbjct  599  IVVAATTVIILVFGIL---WWKGCFGKKNSLTRELNSLDLQTSLFTLRQIKAATN  650



>ref|XP_011002767.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
 ref|XP_011002768.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
 ref|XP_011002769.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
Length=1007

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  46   FTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            F IL   WWK  +  K S  N+L+G++L+TG FT RQIKAATN
Sbjct  618  FLILGILWWKGCLGQKISMRNDLKGLELKTGSFTLRQIKAATN  660



>ref|XP_002305716.2| hypothetical protein POPTR_0004s06180g [Populus trichocarpa]
 gb|EEE86227.2| hypothetical protein POPTR_0004s06180g [Populus trichocarpa]
Length=1092

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            T+ I++ V    CL+F+ L   WWK Y R +  ++  L GI++QT  FT +QIKAAT
Sbjct  652  TVPIILGVVG-FCLVFSALAIFWWKCYFRVQKKRQKGLEGIEIQTVSFTLKQIKAAT  707



>emb|CAN76712.1| hypothetical protein VITISV_022379 [Vitis vinifera]
Length=410

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +1

Query  40   LIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            LIF ++   WW+  +R K + E +L+G+D  TG FT RQIKAATN
Sbjct  104  LIFLVIGILWWRGCLRRKDTLEQDLKGLDQHTGLFTLRQIKAATN  148



>ref|XP_010246513.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=953

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +1

Query  34   LCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            + L+  +LC  WWK  I   T  + +L+G+DLQTG FT RQIKAATN
Sbjct  562  ISLVLGVLCVLWWKGCIGYDT-MDQDLKGLDLQTGSFTLRQIKAATN  607



>ref|XP_003596244.1| Receptor-like serine/threonine kinase [Medicago truncatula]
Length=1208

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 34/55 (62%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IVVA T+ + L+F IL   WW      K S   E+  +DLQTG FT RQIKAATN
Sbjct  815  IVVAATTVIILVFGIL---WWNGCFGKKNSLTREINSLDLQTGLFTLRQIKAATN  866



>gb|KCW45470.1| hypothetical protein EUGRSUZ_L008133, partial [Eucalyptus grandis]
Length=108

 Score = 51.6 bits (122),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTI-LCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T  +VV V +    I  + LC   WK Y R +T +   + G+DLQTG F+ +QIKAATN
Sbjct  32   TAYVVVGVGAGAFFIVLLSLCILKWKGYFRGRTKRRQGMDGLDLQTGTFSLKQIKAATN  90



>gb|KHG04296.1| hypothetical protein F383_04630 [Gossypium arboreum]
Length=885

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            +++V A+++++ +   +L   W K  +  K S E ELRG+DLQTG F+ RQIKAAT
Sbjct  494  VVVVGAISAAIVIALMVLGIFWRKGRLGGKNSVEKELRGLDLQTGIFSLRQIKAAT  549



>gb|KHG04295.1| hypothetical protein F383_04630 [Gossypium arboreum]
Length=899

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            +++V A+++++ +   +L   W K  +  K S E ELRG+DLQTG F+ RQIKAAT
Sbjct  494  VVVVGAISAAIVIALMVLGIFWRKGRLGGKNSVEKELRGLDLQTGIFSLRQIKAAT  549



>gb|KHG22690.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Gossypium arboreum]
Length=453

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  67   WWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            WWK Y + K S+E  LRG+DLQTG FTF Q+KAATN
Sbjct  172  WWKGYFQPKPSREQVLRGLDLQTGFFTFIQMKAATN  207



>ref|XP_007025276.1| Receptor-like kinase in flowers 1, putative [Theobroma cacao]
 gb|EOY27898.1| Receptor-like kinase in flowers 1, putative [Theobroma cacao]
Length=951

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IVV V  +   IF      WW++Y + K+ +E +L G+D+QT  FT +QIKAATN
Sbjct  523  IVVGVLGAFT-IFLASGILWWRYYFKAKSRREKDLEGLDVQTVSFTLKQIKAATN  576



>ref|XP_010273486.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Nelumbo nucifera]
Length=1014

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IVV++     LIF +L F WW+ Y+ +K + + +L G+DL T  FT  QIK ATN
Sbjct  614  IVVSIAG---LIFFVLGFLWWRGYLGHKNTMDQDLTGLDLHTSSFTLTQIKVATN  665



>gb|AES66495.2| LRR receptor-like kinase [Medicago truncatula]
Length=994

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 34/55 (62%), Gaps = 3/55 (5%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IVVA T+ + L+F IL   WW      K S   E+  +DLQTG FT RQIKAATN
Sbjct  601  IVVAATTVIILVFGIL---WWNGCFGKKNSLTREINSLDLQTGLFTLRQIKAATN  652



>dbj|BAJ53166.1| JHL10I11.12 [Jatropha curcas]
Length=927

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            +I+   V  ++ L+  +LC  W K  +  K   + ELRG+DLQTG FT +QIKAAT
Sbjct  505  IIVSSTVAGAVFLVLLVLCIMWRKGCLGGKVYADKELRGLDLQTGIFTLKQIKAAT  560



>ref|XP_002306015.2| hypothetical protein POPTR_0004s14310g [Populus trichocarpa]
 gb|EEE86526.2| hypothetical protein POPTR_0004s14310g [Populus trichocarpa]
Length=1028

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +I+  AV  ++ L F +L   W   ++  K + + EL+G+DLQTG FT RQ+KAATN
Sbjct  626  IIVTGAVAGAIFLAFLVLGVMWRNGWLCGKAAADKELKGLDLQTGLFTLRQMKAATN  682



>gb|KDP20042.1| hypothetical protein JCGZ_05811 [Jatropha curcas]
Length=1041

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAAT  171
            +I+   V  ++ L+  +LC  W K  +  K   + ELRG+DLQTG FT +QIKAAT
Sbjct  619  IIVSSTVAGAVFLVLLVLCIMWRKGCLGGKVYADKELRGLDLQTGIFTLKQIKAAT  674



>gb|KDP27082.1| hypothetical protein JCGZ_20306 [Jatropha curcas]
Length=1030

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IV  V +SL LI  IL     K Y+  K   + ELRG+DLQTG FT RQIK ATN
Sbjct  617  IVGIVAASLVLIMLILIVLRLKGYLGGKEPVDKELRGLDLQTGYFTLRQIKHATN  671



>ref|XP_006371027.1| hypothetical protein POPTR_0019s02760g [Populus trichocarpa]
 gb|ERP48824.1| hypothetical protein POPTR_0019s02760g [Populus trichocarpa]
Length=781

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  67   WWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            WWK Y+  + S++ EL G+DL TG FTFRQIKAATN
Sbjct  440  WWKGYLGGRKSRDRELVGLDLLTGIFTFRQIKAATN  475



>emb|CAN70381.1| hypothetical protein VITISV_020134 [Vitis vinifera]
Length=833

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  34   LCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            + LIF ++   WW+  +R K + E +L+G+D QT  FT RQIKAATN
Sbjct  247  ILLIFLVISILWWRGCLRRKYTLEQDLKGLDQQTDLFTLRQIKAATN  293



>ref|XP_004295665.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Fragaria vesca subsp. 
vesca]
Length=1979

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  67    WWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
             WWK +I    + E +L+G+DLQTGKFT RQIK ATN
Sbjct  1597  WWKGFIGPANTLEQDLKGVDLQTGKFTLRQIKTATN  1632


 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +V  V   + +I  +L   WWK +I    + E +L+G+DLQT +F+ RQIK ATN
Sbjct  621  VVGIVAGGVFIILLVLGILWWKGFIGPANTLEQDLKGVDLQTSRFSLRQIKTATN  675



>ref|XP_008451726.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X2 [Cucumis melo]
Length=927

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  61   FAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            F W K YI  K + +NEL GIDLQTG FT +QIKAATN
Sbjct  524  FLWVKGYIFKKENLDNELSGIDLQTGHFTLKQIKAATN  561



>ref|XP_008451725.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Cucumis melo]
Length=1029

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  61   FAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            F W K YI  K + +NEL GIDLQTG FT +QIKAATN
Sbjct  626  FLWVKGYIFKKENLDNELSGIDLQTGHFTLKQIKAATN  663



>ref|XP_010273497.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X5 [Nelumbo nucifera]
Length=979

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 7/59 (12%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQEN----ELRGIDLQTGKFTFRQIKAATN  174
            IVV++     LIF +L F WW+ Y+ +K + +     ++ G+DL TG FT RQIKAATN
Sbjct  574  IVVSIAG---LIFFVLGFLWWRGYLGHKNTMDQAPWTDMTGLDLHTGFFTLRQIKAATN  629



>ref|XP_010273495.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Nelumbo nucifera]
Length=991

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 7/59 (12%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQEN----ELRGIDLQTGKFTFRQIKAATN  174
            IVV++     LIF +L F WW+ Y+ +K + +     ++ G+DL TG FT RQIKAATN
Sbjct  586  IVVSIAG---LIFFVLGFLWWRGYLGHKNTMDQAPWTDMTGLDLHTGFFTLRQIKAATN  641



>ref|XP_010273493.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Nelumbo nucifera]
Length=1025

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 7/59 (12%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQEN----ELRGIDLQTGKFTFRQIKAATN  174
            IVV++     LIF +L F WW+ Y+ +K + +     ++ G+DL TG FT RQIKAATN
Sbjct  620  IVVSIAG---LIFFVLGFLWWRGYLGHKNTMDQAPWTDMTGLDLHTGFFTLRQIKAATN  675



>ref|XP_009352711.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X5 [Pyrus x bretschneideri]
Length=912

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T I+   V  +  L+F +L   WWK Y+  K  ++ +  G+D QTG FT +Q+KAATN
Sbjct  512  THIVTGVVVGAFLLVFVLLGILWWKGYLACKRGRKKDRDGLDGQTGGFTLKQLKAATN  569



>ref|XP_009352710.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X4 [Pyrus x bretschneideri]
Length=938

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T I+   V  +  L+F +L   WWK Y+  K  ++ +  G+D QTG FT +Q+KAATN
Sbjct  538  THIVTGVVVGAFLLVFVLLGILWWKGYLACKRGRKKDRDGLDGQTGGFTLKQLKAATN  595



>ref|XP_009352709.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X3 [Pyrus x bretschneideri]
Length=987

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T I+   V  +  L+F +L   WWK Y+  K  ++ +  G+D QTG FT +Q+KAATN
Sbjct  587  THIVTGVVVGAFLLVFVLLGILWWKGYLACKRGRKKDRDGLDGQTGGFTLKQLKAATN  644



>ref|XP_007021941.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
2 [Theobroma cacao]
 gb|EOY13466.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
2 [Theobroma cacao]
Length=881

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            ++V  V  +   IF I    WW   +R K++ E +L+G++LQT  FT RQIKAATN
Sbjct  476  MVVGIVAGTAFAIFLIGGILWWNGCLRQKSTLEQDLKGLELQTNSFTLRQIKAATN  531



>ref|XP_009352708.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Pyrus x bretschneideri]
Length=1010

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T I+   V  +  L+F +L   WWK Y+  K  ++ +  G+D QTG FT +Q+KAATN
Sbjct  610  THIVTGVVVGAFLLVFVLLGILWWKGYLACKRGRKKDRDGLDGQTGGFTLKQLKAATN  667



>ref|XP_009352707.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Pyrus x bretschneideri]
Length=1011

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T I+   V  +  L+F +L   WWK Y+  K  ++ +  G+D QTG FT +Q+KAATN
Sbjct  611  THIVTGVVVGAFLLVFVLLGILWWKGYLACKRGRKKDRDGLDGQTGGFTLKQLKAATN  668



>ref|XP_009351793.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 [Pyrus x bretschneideri]
Length=1011

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+   V  +  L+F IL   WWK Y+  K  ++ +  G+D QTG FT +Q+KAATN
Sbjct  613  IVTGVVVGAFLLVFVILGILWWKGYLPCKRGRKKDRDGLDGQTGGFTLKQLKAATN  668



>ref|XP_002865794.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42053.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=951

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IIV AV   L +I  I+C    + Y   K + + ELRG+DLQTG FT R IKAATN
Sbjct  564  IIVAAVILILAIITVIICLWRRRCY---KNAMDKELRGLDLQTGTFTLRHIKAATN  616



>ref|XP_009604354.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 [Nicotiana tomentosiformis]
Length=1004

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/58 (40%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T+ ++V V ++ C+   ++   WWK Y++ K  Q  +L G++LQT  F  +QIKAATN
Sbjct  612  TVYVIVGVGAT-CIFLLVMSTLWWKGYLQCKKRQRKDLEGMELQTVSFALKQIKAATN  668



>ref|XP_009351138.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 [Pyrus x bretschneideri]
Length=841

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I+   V  +  L+F IL   WWK Y+  K  ++ +  G+D QTG FT +Q+KAATN
Sbjct  549  IVTGVVVGAFLLVFVILGILWWKGYLPCKRGRKKDRDGLDGQTGGFTLKQLKAATN  604



>ref|XP_007021942.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
3 [Theobroma cacao]
 gb|EOY13467.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
3 [Theobroma cacao]
Length=887

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            ++V  V  +   IF I    WW   +R K++ E +L+G++LQT  FT RQIKAATN
Sbjct  482  MVVGIVAGTAFAIFLIGGILWWNGCLRQKSTLEQDLKGLELQTNSFTLRQIKAATN  537



>ref|XP_008226376.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1003

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  10   IVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            IV  V   + +I  I    W + ++  + + E++L+G+DLQTGKF+FRQ+KAATN
Sbjct  603  IVGIVAGGVFIILLIFGVLWRRGHLGQENTLEDDLKGVDLQTGKFSFRQLKAATN  657



>emb|CBI20129.3| unnamed protein product [Vitis vinifera]
Length=382

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  34   LCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            + LIF ++   WW+  +R K + E +L+G+D QT  FT RQIKAATN
Sbjct  295  ILLIFLVISILWWRGCLRRKYTLEQDLKGLDQQTDLFTLRQIKAATN  341



>ref|XP_007021940.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
 gb|EOY13465.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
Length=1020

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            ++V  V  +   IF I    WW   +R K++ E +L+G++LQT  FT RQIKAATN
Sbjct  615  MVVGIVAGTAFAIFLIGGILWWNGCLRQKSTLEQDLKGLELQTNSFTLRQIKAATN  670



>ref|XP_010057165.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 [Eucalyptus grandis]
 gb|KCW74194.1| hypothetical protein EUGRSUZ_E02842 [Eucalyptus grandis]
Length=1014

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +1

Query  31   SLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            + C++   LC   WK Y R +T +   + G+DLQTG  + +QIKAATN
Sbjct  621  AFCIVLLSLCILKWKGYFRGRTKRRQGMDGLDLQTGTLSLKQIKAATN  668



>ref|XP_010655557.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Vitis vinifera]
Length=1060

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T  I++ V ++ CLI   L   WW+  +R K  +E +  G+D+  G FT +QIKAATN
Sbjct  609  TAPIIIGVVAA-CLICLALGIFWWRVNLRTKNGREKDFGGLDVHIGSFTLKQIKAATN  665



>ref|XP_010655556.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Vitis vinifera]
Length=1067

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T  I++ V ++ CLI   L   WW+  +R K  +E +  G+D+  G FT +QIKAATN
Sbjct  616  TAPIIIGVVAA-CLICLALGIFWWRVNLRTKNGREKDFGGLDVHIGSFTLKQIKAATN  672



>ref|XP_011010609.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=879

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    LIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            +I+  AV  ++ L F +L   W   ++  + + + EL+G+DLQTG FT RQ+KAATN
Sbjct  477  IIVTGAVAGAIFLAFLVLGVMWRNGWLCGQAAADKELKGLDLQTGLFTLRQMKAATN  533



>ref|XP_006377497.1| hypothetical protein POPTR_0011s06460g, partial [Populus trichocarpa]
 gb|ERP55294.1| hypothetical protein POPTR_0011s06460g, partial [Populus trichocarpa]
Length=302

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    IIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            I++  VTS+  LI  ++   +WK    +K ++E EL+G+DL+TG FT RQ+KA  +
Sbjct  225  IVIGVVTSAAFLILLVMGVIYWKLCYGDKYTRERELKGLDLKTGSFTLRQLKATPD  280



>emb|CBI30739.3| unnamed protein product [Vitis vinifera]
Length=839

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = +1

Query  1    TLIIVVAVTSSLCLIFTILCFAWWKFYIRNKTSQENELRGIDLQTGKFTFRQIKAATN  174
            T  I++ V ++ CLI   L   WW+  +R K  +E +  G+D+  G FT +QIKAATN
Sbjct  326  TAPIIIGVVAA-CLICLALGIFWWRVNLRTKNGREKDFGGLDVHIGSFTLKQIKAATN  382



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511558873218