BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19838_g1_i1 len=932 path=[1272:0-548 3512:549-575 3961:576-576
2211:577-931]

Length=932
                                                                      Score     E

ref|XP_011073424.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    122   2e-28   
ref|XP_004235954.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    119   4e-27   
ref|XP_006364220.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    115   8e-26   
ref|XP_008227083.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    113   1e-25   
ref|NP_001237468.1|  uncharacterized protein LOC100527024               111   3e-25   
ref|XP_006584524.1|  PREDICTED: uncharacterized protein LOC100527...    111   8e-25   
ref|XP_006583121.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    111   1e-24   
ref|XP_006584523.1|  PREDICTED: uncharacterized protein LOC100527...    111   1e-24   
ref|XP_006584522.1|  PREDICTED: uncharacterized protein LOC100527...    112   1e-24   
ref|XP_010250157.1|  PREDICTED: LOW QUALITY PROTEIN: palmitoyl-mo...    111   2e-24   
gb|KHN37989.1|  Palmitoyl-monogalactosyldiacylglycerol delta-7 de...    110   2e-24   
ref|XP_003529803.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    111   3e-24   
gb|KHN01326.1|  Palmitoyl-monogalactosyldiacylglycerol delta-7 de...    110   3e-24   
ref|XP_008227612.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    109   3e-24   
ref|XP_010535145.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    110   3e-24   
ref|XP_010535146.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    110   5e-24   
ref|XP_009613437.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    110   5e-24   
ref|XP_006427289.1|  hypothetical protein CICLE_v10025838mg             109   5e-24   
ref|XP_007135758.1|  hypothetical protein PHAVU_010G156200g             110   5e-24   
ref|XP_006427290.1|  hypothetical protein CICLE_v10025838mg             109   1e-23   
ref|XP_007214725.1|  hypothetical protein PRUPE_ppa026015mg             108   1e-23   
ref|XP_008227503.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    107   1e-23   
ref|XP_004152346.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    108   1e-23   
ref|XP_007212724.1|  hypothetical protein PRUPE_ppa018861mg             107   2e-23   
gb|KGN52898.1|  hypothetical protein Csa_4G006050                       107   2e-23   
ref|XP_007213424.1|  hypothetical protein PRUPE_ppa025710mg             107   2e-23   
ref|XP_007023199.1|  Fatty acid desaturase 5 isoform 2                  107   3e-23   
ref|XP_008454223.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    107   3e-23   
ref|XP_007023198.1|  Fatty acid desaturase 5 isoform 1                  107   4e-23   
ref|XP_007023200.1|  Fatty acid desaturase 5 isoform 3                  107   4e-23   
gb|ADC80920.1|  delta-9 fatty acid desaturase                           107   4e-23   Vernicia fordii [tung oil tree]
ref|XP_010465577.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    107   4e-23   
ref|XP_007023208.1|  Fatty acid desaturase 5                            107   5e-23   
ref|XP_006377890.1|  hypothetical protein POPTR_0011s15530g             107   5e-23   
ref|XP_006465322.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    107   5e-23   
ref|XP_007099502.1|  Fatty acid desaturase 5                            107   6e-23   
gb|KDP37076.1|  hypothetical protein JCGZ_06132                         106   7e-23   
ref|XP_002517641.1|  delta 9 desaturase, putative                       106   8e-23   Ricinus communis
ref|XP_006377886.1|  hypothetical protein POPTR_0011s15500g             106   9e-23   
ref|XP_007214506.1|  hypothetical protein PRUPE_ppa016744mg             100   2e-22   
ref|XP_009772953.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    105   2e-22   
ref|XP_004152343.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    104   2e-22   
gb|KGN52905.1|  hypothetical protein Csa_4G006120                       104   2e-22   
emb|CDO98157.1|  unnamed protein product                                103   3e-22   
ref|XP_007212768.1|  hypothetical protein PRUPE_ppa019551mg             103   3e-22   
ref|XP_004152345.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    104   3e-22   
ref|XP_008454490.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    103   3e-22   
ref|XP_002317667.2|  hypothetical protein POPTR_0011s15490g             104   4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_006297955.1|  hypothetical protein CARUB_v10013996mg             103   4e-22   
ref|XP_006297956.1|  hypothetical protein CARUB_v10013996mg             104   4e-22   
gb|ABK95469.1|  unknown                                               99.8    5e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010487426.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    104   5e-22   
ref|XP_010503522.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    103   6e-22   
ref|XP_008454218.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    103   6e-22   
ref|XP_008227235.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    103   6e-22   
ref|XP_008454217.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    103   6e-22   
ref|XP_010097224.1|  Palmitoyl-monogalactosyldiacylglycerol delta...    103   8e-22   
ref|XP_007214509.1|  hypothetical protein PRUPE_ppa016543mg             102   8e-22   
ref|XP_006406909.1|  hypothetical protein EUTSA_v10020955mg             102   1e-21   
ref|XP_010475329.1|  PREDICTED: delta-9 acyl-lipid desaturase 1         102   2e-21   
ref|XP_007214752.1|  hypothetical protein PRUPE_ppa024947mg             101   2e-21   
ref|XP_011040604.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    102   2e-21   
ref|XP_010523152.1|  PREDICTED: delta-9 acyl-lipid desaturase 1-like    100   3e-21   
ref|XP_008339469.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    101   3e-21   
ref|XP_010485742.1|  PREDICTED: delta-9 acyl-lipid desaturase 1-like    101   3e-21   
gb|KGN52902.1|  hypothetical protein Csa_4G006090                     99.8    3e-21   
ref|XP_008454222.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    101   3e-21   
ref|XP_004289152.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  99.4    4e-21   
ref|XP_010545760.1|  PREDICTED: delta-9 acyl-lipid desaturase 1-l...    101   4e-21   
ref|XP_004165001.1|  PREDICTED: LOW QUALITY PROTEIN: palmitoyl-mo...    101   4e-21   
ref|XP_010545761.1|  PREDICTED: delta-9 acyl-lipid desaturase 1-l...    101   5e-21   
ref|XP_007211716.1|  hypothetical protein PRUPE_ppa009359mg             100   5e-21   
ref|XP_008227398.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    100   5e-21   
ref|XP_010457724.1|  PREDICTED: delta-9 acyl-lipid desaturase 1-like    100   5e-21   
ref|XP_010033965.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    101   5e-21   
ref|XP_008347604.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    100   6e-21   
ref|XP_004295331.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...    100   6e-21   
ref|XP_010522172.1|  PREDICTED: delta-9 acyl-lipid desaturase 1-like    100   6e-21   
ref|XP_008342219.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  98.6    8e-21   
ref|XP_008363691.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  99.0    8e-21   
ref|NP_172098.1|  delta-9 acyl-lipid desaturase 1                       100   8e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDY67591.1|  BnaC08g46400D                                        98.2    8e-21   
dbj|BAC43716.1|  putative delta 9 desaturase                            100   9e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AES86572.2|  fatty-acid desaturase                                   100   9e-21   
ref|XP_008227081.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  99.8    9e-21   
ref|XP_006306294.1|  hypothetical protein CARUB_v10012159mg           99.8    9e-21   
gb|ABS86965.1|  delta-9 fatty acid desaturase                           100   9e-21   Descurainia sophia
ref|XP_004287917.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  99.8    1e-20   
gb|ABK25490.1|  unknown                                                 100   1e-20   Picea sitchensis
gb|AAM12238.1|AF438199_1  desaturase delta 9                            100   1e-20   Picea glauca
ref|XP_004166509.1|  PREDICTED: LOW QUALITY PROTEIN: palmitoyl-mo...  99.4    1e-20   
ref|XP_004289153.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  99.4    1e-20   
ref|XP_004305975.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  99.4    1e-20   
ref|XP_004152344.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  99.4    1e-20   
ref|XP_004304083.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  99.4    1e-20   
ref|XP_006417959.1|  hypothetical protein EUTSA_v10008299mg           99.4    1e-20   
ref|XP_008379939.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  99.4    1e-20   
ref|XP_008365544.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  99.4    1e-20   
ref|XP_002889584.1|  hypothetical protein ARALYDRAFT_887802           99.0    2e-20   
ref|XP_007213180.1|  hypothetical protein PRUPE_ppa026434mg           98.6    2e-20   
ref|XP_008379691.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  98.6    2e-20   
ref|XP_001764456.1|  predicted protein                                98.6    2e-20   
ref|XP_004288866.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  98.6    2e-20   
ref|XP_007216501.1|  hypothetical protein PRUPE_ppa024024mg           98.6    3e-20   
ref|XP_003604375.1|  Palmitoyl-monogalactosyldiacylglycerol delta...    100   3e-20   
emb|CDX75848.1|  BnaC03g39310D                                        99.0    3e-20   
gb|KFK38939.1|  hypothetical protein AALP_AA3G179700                  99.0    3e-20   
emb|CDY10193.1|  BnaC05g04360D                                        98.2    3e-20   
ref|XP_009119068.1|  PREDICTED: delta-9 desaturase-like 5 protein     98.2    3e-20   
ref|XP_006306159.1|  hypothetical protein CARUB_v10011680mg           98.2    3e-20   
ref|XP_006417958.1|  hypothetical protein EUTSA_v10008185mg           98.6    3e-20   
gb|AAG28599.1|AF247133_1  delta5 acyl-CoA desaturase                  98.6    3e-20   Limnanthes douglasii
ref|XP_009146193.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  98.6    4e-20   
gb|KGN65118.1|  hypothetical protein Csa_1G227450                     98.2    4e-20   
emb|CDY30116.1|  BnaC05g37460D                                        98.6    4e-20   
emb|CDY58467.1|  BnaA03g57540D                                        98.6    4e-20   
ref|XP_008373965.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  99.0    4e-20   
ref|XP_009135459.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  98.6    4e-20   
ref|XP_008227397.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  97.8    5e-20   
ref|XP_004305976.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  97.8    5e-20   
ref|XP_008454216.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  97.8    5e-20   
ref|XP_006305459.1|  hypothetical protein CARUB_v10009877mg           97.4    5e-20   
ref|XP_009342619.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  97.4    5e-20   
ref|XP_004291743.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  97.4    6e-20   
ref|XP_009341399.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  97.4    6e-20   
ref|XP_010457725.1|  PREDICTED: delta-9 desaturase-like 1 protein     97.4    6e-20   
emb|CDY57820.1|  BnaA10g28080D                                        97.4    7e-20   
gb|EYU21651.1|  hypothetical protein MIMGU_mgv1a008650mg              97.8    7e-20   
ref|XP_007212738.1|  hypothetical protein PRUPE_ppa019148mg           97.1    7e-20   
ref|XP_010545762.1|  PREDICTED: delta-9 desaturase-like 2 protein     97.8    8e-20   
ref|XP_009110994.1|  PREDICTED: delta-9 desaturase-like 4 protein     97.1    8e-20   
ref|XP_002993364.1|  hypothetical protein SELMODRAFT_45794            97.1    8e-20   
ref|XP_002882967.1|  hypothetical protein ARALYDRAFT_479040           97.8    8e-20   
ref|XP_010475332.1|  PREDICTED: delta-9 desaturase-like 1 protein...  97.1    8e-20   
ref|XP_002972750.1|  hypothetical protein SELMODRAFT_413328           97.1    8e-20   
gb|KFK38940.1|  hypothetical protein AALP_AA3G179800                  96.3    8e-20   
ref|XP_008454221.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  97.1    8e-20   
emb|CDY15574.1|  BnaA08g28580D                                        97.1    8e-20   
ref|XP_009365434.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  97.8    8e-20   
ref|XP_002265410.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  97.8    9e-20   Vitis vinifera
ref|XP_009347410.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  97.8    9e-20   
ref|XP_010485731.1|  PREDICTED: delta-9 desaturase-like 1 protein     97.1    9e-20   
ref|XP_008228692.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  97.8    9e-20   
emb|CDY58470.1|  BnaA03g57560D                                        97.1    9e-20   
ref|XP_010414136.1|  PREDICTED: delta-9 acyl-lipid desaturase 2 i...  97.1    1e-19   
ref|XP_010510206.1|  PREDICTED: delta-9 acyl-lipid desaturase 2-like  96.7    1e-19   
ref|XP_010475331.1|  PREDICTED: delta-9 desaturase-like 1 protein...  96.7    1e-19   
gb|AAK92773.1|  putative delta 9 desaturase                           97.4    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566529.1|  palmitoyl-monogalactosyldiacylglycerol delta-7 ...  97.4    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294655.1|  hypothetical protein CARUB_v10023700mg           96.7    1e-19   
ref|XP_010414137.1|  PREDICTED: delta-9 acyl-lipid desaturase 2 i...  96.7    1e-19   
ref|XP_004173672.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  93.6    1e-19   
gb|AAM63459.1|  putative delta 9 desaturase                           97.4    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001785645.1|  predicted protein                                95.9    1e-19   
ref|XP_004303300.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  97.4    1e-19   
ref|XP_010691134.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  97.1    1e-19   
ref|XP_008449174.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  96.3    1e-19   
ref|XP_010465581.1|  PREDICTED: probable lipid desaturase ADS3.2,...  97.1    1e-19   
ref|XP_009135462.1|  PREDICTED: probable lipid desaturase ADS3.2,...  97.1    1e-19   
emb|CDX97710.1|  BnaA05g23690D                                        97.1    2e-19   
ref|XP_008443946.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  96.3    2e-19   
ref|XP_009365113.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  96.3    2e-19   
ref|XP_006417932.1|  hypothetical protein EUTSA_v10008319mg           96.3    2e-19   
ref|XP_002889586.1|  predicted protein                                95.9    2e-19   
ref|XP_006406907.1|  hypothetical protein EUTSA_v10021971mg           96.7    2e-19   
ref|XP_007215498.1|  hypothetical protein PRUPE_ppa006843mg           97.1    2e-19   
gb|KFK42936.1|  delta 9 desaturase                                    95.9    2e-19   
ref|XP_002892337.1|  fatty acid desaturase family protein             95.9    2e-19   
emb|CDY47714.1|  BnaA10g04030D                                        95.9    2e-19   
ref|XP_009350927.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  95.9    2e-19   
gb|KGN52908.1|  Delta-9 fatty acid desaturase                         96.3    2e-19   
ref|XP_008454220.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  95.5    2e-19   
ref|XP_009118557.1|  PREDICTED: delta-9 acyl-lipid desaturase 1-like  95.9    2e-19   
emb|CDY09991.1|  BnaC08g44600D                                        95.5    2e-19   
ref|XP_004288836.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  95.5    2e-19   
emb|CBI36333.3|  unnamed protein product                              95.1    2e-19   
emb|CDY72496.1|  BnaCnng77950D                                        94.4    2e-19   
ref|XP_009113145.1|  PREDICTED: probable lipid desaturase ADS3.2,...  96.3    2e-19   
ref|XP_004152340.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  95.9    2e-19   
ref|XP_009113146.1|  PREDICTED: probable lipid desaturase ADS3.2,...  95.9    3e-19   
ref|NP_565721.1|  16:0delta9 desaturase 2                             95.5    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008367122.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  92.4    3e-19   
ref|XP_009119090.1|  PREDICTED: delta-9 acyl-lipid desaturase 1       95.5    3e-19   
ref|XP_008230150.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  93.2    3e-19   
ref|XP_002881171.1|  hypothetical protein ARALYDRAFT_482064           95.5    3e-19   
ref|XP_008227399.1|  PREDICTED: delta-9 acyl-lipid desaturase 1-like  95.5    3e-19   
emb|CDX86526.1|  BnaC08g01770D                                        95.1    3e-19   
emb|CDY30120.1|  BnaC05g37420D                                        95.9    3e-19   
ref|XP_008230049.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  95.1    3e-19   
ref|XP_007207066.1|  hypothetical protein PRUPE_ppa026616mg           95.1    3e-19   
ref|XP_007214141.1|  hypothetical protein PRUPE_ppa018402mg           95.1    3e-19   
ref|XP_009338528.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  95.1    4e-19   
emb|CDY30117.1|  BnaC05g37450D                                        95.1    4e-19   
emb|CDY47715.1|  BnaA10g04040D                                        94.7    4e-19   
ref|XP_008365464.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  95.1    4e-19   
ref|XP_009119089.1|  PREDICTED: delta-9 desaturase-like 1 protein     94.7    5e-19   
ref|NP_172100.1|  delta-9 desaturase-like 2 protein                   94.7    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008337014.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  94.7    5e-19   
ref|XP_010691135.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  94.7    5e-19   
emb|CDY10171.1|  BnaC05g04140D                                        94.4    5e-19   
ref|XP_008443948.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  94.0    6e-19   
ref|XP_006417930.1|  hypothetical protein EUTSA_v10008191mg           94.7    6e-19   
ref|XP_008365460.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  94.7    6e-19   
ref|XP_008354628.1|  PREDICTED: LOW QUALITY PROTEIN: palmitoyl-mo...  94.4    6e-19   
gb|KFK24701.1|  hypothetical protein AALP_AA8G013500                  94.4    6e-19   
ref|XP_004506950.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  95.5    6e-19   
ref|XP_006417931.1|  hypothetical protein EUTSA_v10008320mg           94.4    6e-19   
ref|XP_010522174.1|  PREDICTED: delta-9 desaturase-like 3 protein     94.7    6e-19   
ref|XP_006410268.1|  hypothetical protein EUTSA_v10016982mg           94.4    7e-19   
ref|XP_010457762.1|  PREDICTED: delta-9 desaturase-like 5 protein     94.4    7e-19   
ref|NP_172125.1|  delta-9 desaturase-like 5 protein                   94.4    7e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892336.1|  fatty acid desaturase family protein             94.4    7e-19   
ref|XP_007215729.1|  hypothetical protein PRUPE_ppa009061mg           94.4    7e-19   
emb|CDY56609.1|  BnaCnng30700D                                        94.4    7e-19   
ref|XP_004304084.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  93.6    7e-19   
ref|XP_009141172.1|  PREDICTED: delta-9 acyl-lipid desaturase 2-like  94.4    7e-19   
emb|CDY19096.1|  BnaA04g18360D                                        94.4    7e-19   
gb|KFK31220.1|  hypothetical protein AALP_AA6G083900                  94.4    7e-19   
ref|XP_009144215.1|  PREDICTED: delta-9 acyl-lipid desaturase 2       94.4    7e-19   
gb|KGN52899.1|  hypothetical protein Csa_4G006060                     94.7    7e-19   
ref|XP_010457727.1|  PREDICTED: delta-9 desaturase-like 1 protein...  94.0    7e-19   
gb|KFK42935.1|  hypothetical protein AALP_AA1G057900                  94.4    8e-19   
ref|XP_009132780.1|  PREDICTED: delta-9 acyl-lipid desaturase 2-like  94.4    8e-19   
emb|CDY23946.1|  BnaC03g17450D                                        94.4    8e-19   
ref|XP_010457726.1|  PREDICTED: delta-9 desaturase-like 1 protein...  94.0    8e-19   
gb|KFK42955.1|  delta 9 desaturase                                    94.0    8e-19   
emb|CDX97712.1|  BnaA05g23670D                                        94.7    8e-19   
ref|XP_004152195.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  94.4    8e-19   
ref|XP_004305981.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  94.0    8e-19   
ref|XP_007217808.1|  hypothetical protein PRUPE_ppa027208mg           94.0    9e-19   
gb|AAF82163.1|AC068143_5  Contains similarity to a delta 9 desatu...  94.0    9e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008454215.1|  PREDICTED: delta-9 acyl-lipid desaturase 1-like  94.4    9e-19   
gb|AAM63359.1|  delta 9 desaturase                                    94.0    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009365117.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  94.0    1e-18   
ref|NP_172124.2|  delta-9 desaturase-like 4 protein                   93.6    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889585.1|  fatty acid desaturase family protein             93.6    1e-18   
ref|XP_008443947.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  94.0    1e-18   
ref|XP_004169065.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  91.7    1e-18   
ref|XP_009119066.1|  PREDICTED: delta-9 desaturase-like 5 protein     93.6    1e-18   
emb|CDY57823.1|  BnaA10g28100D                                        93.6    1e-18   
ref|XP_010475330.1|  PREDICTED: delta-9 desaturase-like 1 protein...  93.6    1e-18   
ref|XP_009146500.1|  PREDICTED: delta-9 acyl-lipid desaturase 1-like  94.0    1e-18   
emb|CDX82427.1|  BnaA03g33940D                                        90.9    1e-18   
ref|XP_010475335.1|  PREDICTED: delta-9 desaturase-like 2 protein...  93.6    1e-18   
ref|XP_006304671.1|  hypothetical protein CARUB_v10011896mg           93.6    1e-18   
gb|KFK42937.1|  hypothetical protein AALP_AA1G058100                  93.6    1e-18   
ref|XP_009110993.1|  PREDICTED: delta-9 desaturase-like 5 protein     93.2    1e-18   
gb|KCW53828.1|  hypothetical protein EUGRSUZ_J03065                   93.2    1e-18   
ref|XP_010486028.1|  PREDICTED: delta-9 desaturase-like 5 protein     93.2    2e-18   
ref|XP_007212463.1|  hypothetical protein PRUPE_ppa015024mg           92.4    2e-18   
ref|XP_008230048.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  92.8    2e-18   
ref|XP_004164998.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  92.8    2e-18   
emb|CDX86524.1|  BnaC08g01790D                                        92.8    2e-18   
gb|KGN65119.1|  hypothetical protein Csa_1G227460                     92.8    2e-18   
gb|KFK42956.1|  hypothetical protein AALP_AA1G060900                  92.4    2e-18   
ref|XP_009348244.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  92.8    2e-18   
gb|KGN52906.1|  hypothetical protein Csa_4G006130                     92.8    2e-18   
ref|XP_008342136.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  92.8    2e-18   
ref|XP_009350079.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  92.4    3e-18   
ref|XP_008353605.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  92.0    3e-18   
ref|XP_007216438.1|  hypothetical protein PRUPE_ppa021916mg           92.4    3e-18   
ref|XP_006300242.1|  hypothetical protein CARUB_v10016482mg           93.2    3e-18   
ref|XP_009111006.1|  PREDICTED: delta-9 desaturase-like 1 protein     92.4    3e-18   
ref|XP_004151086.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  91.3    3e-18   
emb|CDX86536.1|  BnaC08g01670D                                        92.4    3e-18   
emb|CDY15561.1|  BnaA08g28450D                                        92.4    3e-18   
gb|KGN52903.1|  hypothetical protein Csa_4G006100                     89.0    3e-18   
ref|XP_009365115.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  92.4    3e-18   
ref|NP_172102.1|  delta-9 desaturase-like 3 protein                   91.7    5e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDY10195.1|  BnaC05g04380D                                        91.7    5e-18   
ref|XP_010489854.1|  PREDICTED: probable lipid desaturase ADS3.2,...  92.4    5e-18   
gb|KFK42939.1|  hypothetical protein AALP_AA1G058300                  91.7    6e-18   
ref|XP_008244981.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  91.7    6e-18   
emb|CDY12890.1|  BnaA09g13840D                                        92.0    6e-18   
dbj|BAB02317.1|  fatty-acid desaturase-like protein                   91.3    7e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63203.1|  delta 9 desaturase, putative                          90.9    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172099.1|  delta-9 desaturase-like 1 protein                   90.9    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008230023.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  91.3    8e-18   
emb|CDY06197.1|  BnaA09g50060D                                        90.9    9e-18   
ref|XP_004173275.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  90.1    9e-18   
ref|XP_004151650.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  89.7    9e-18   
emb|CDY09989.1|  BnaC08g44620D                                        90.9    9e-18   
ref|XP_010465579.1|  PREDICTED: probable lipid desaturase ADS3.2,...  91.7    1e-17   
ref|XP_010522173.1|  PREDICTED: delta-9 desaturase-like 1 protein     93.2    1e-17   
ref|XP_010503542.1|  PREDICTED: probable lipid desaturase ADS3.2,...  91.3    1e-17   
ref|XP_009365116.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  90.9    1e-17   
ref|XP_008344231.1|  PREDICTED: LOW QUALITY PROTEIN: delta-9 acyl...  89.7    1e-17   
gb|KGN52909.1|  hypothetical protein Csa_4G006160                     91.3    1e-17   
ref|XP_008454214.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  90.9    1e-17   
ref|XP_004152339.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  90.5    1e-17   
ref|XP_004146983.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  90.5    1e-17   
ref|XP_008451259.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  90.9    1e-17   
gb|AAW51921.1|  plastidial lipid-desaturase precursor                 90.9    1e-17   
gb|KGN44746.1|  hypothetical protein Csa_7G376370                     90.5    2e-17   
ref|XP_009135463.1|  PREDICTED: probable lipid desaturase ADS3.2,...  90.9    2e-17   
gb|KFM24513.1|  Palmitoyl-monogalactosyldiacylglycerol delta-7 de...  92.8    2e-17   
ref|XP_004161539.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  90.5    2e-17   
ref|NP_188208.4|  putative lipid desaturase ADS3.2                    90.9    2e-17   
gb|KGN52907.1|  Delta 9 desaturase                                    90.1    2e-17   
ref|XP_001694618.1|  MGDG specific palmitate delta-7 desaturase       89.4    3e-17   
ref|XP_004293151.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  89.4    3e-17   
emb|CDY09990.1|  BnaC08g44610D                                        89.4    3e-17   
ref|XP_004152341.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  89.4    4e-17   
gb|KGN44747.1|  hypothetical protein Csa_7G377870                     88.2    5e-17   
ref|XP_004146984.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  88.2    6e-17   
gb|KGN52901.1|  hypothetical protein Csa_4G006080                     84.3    7e-17   
emb|CDX75850.1|  BnaC03g39330D                                        88.6    7e-17   
emb|CDY06195.1|  BnaA09g50080D                                        88.2    8e-17   
ref|XP_004172080.1|  PREDICTED: LOW QUALITY PROTEIN: palmitoyl-mo...  88.6    8e-17   
ref|XP_009118556.1|  PREDICTED: delta-9 desaturase-like 1 protein     87.8    9e-17   
ref|XP_008451258.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  88.2    1e-16   
ref|XP_009118555.1|  PREDICTED: delta-9 desaturase-like 1 protein     87.8    1e-16   
gb|KFK42957.1|  hypothetical protein AALP_AA1G061000                  87.4    1e-16   
ref|XP_004305670.1|  PREDICTED: LOW QUALITY PROTEIN: delta-9 acyl...  87.4    1e-16   
gb|AAF80135.1|AC024174_17  Contains similarity to delta 9 desatur...  87.0    2e-16   
ref|XP_010501340.1|  PREDICTED: delta-9 desaturase-like 2 protein     85.9    2e-16   
dbj|BAA23134.1|  Delta-9 desaturase                                   86.7    2e-16   
gb|AAB50679.1|  delta 9 acyl-lipid desaturase/delta 9 acyl-CoA de...  87.0    2e-16   
ref|XP_005651076.1|  hypothetical protein COCSUDRAFT_27077            87.4    5e-16   
emb|CDY06196.1|  BnaA09g50070D                                        81.6    2e-15   
ref|XP_004152342.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  82.4    2e-15   
ref|XP_009135460.1|  PREDICTED: probable lipid desaturase ADS3.2,...  84.7    2e-15   
ref|XP_007512453.1|  predicted protein                                84.0    5e-15   
ref|XP_008351486.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  82.0    6e-15   
ref|XP_002502668.1|  predicted protein                                82.4    7e-15   
ref|WP_015121808.1|  fatty-acid desaturase                            82.0    8e-15   
ref|XP_007212793.1|  hypothetical protein PRUPE_ppa020081mg           81.3    9e-15   
ref|XP_002955233.1|  MGDG specific palmitate delta-7 desaturase       82.4    1e-14   
ref|XP_008375247.1|  PREDICTED: palmitoyl-monogalactosyldiacylgly...  80.5    1e-14   
dbj|GAL94571.1|  fatty acid desaturase                                81.3    1e-14   
ref|WP_015955341.1|  acyl-CoA desaturase                              81.6    1e-14   
ref|WP_002769634.1|  acyl-CoA desaturase                              81.6    1e-14   
ref|WP_002733282.1|  acyl-CoA desaturase                              81.6    1e-14   
ref|WP_002789763.1|  acyl-CoA desaturase                              81.6    1e-14   
ref|WP_002795871.1|  acyl-CoA desaturase                              81.6    1e-14   
ref|WP_002792703.1|  acyl-CoA desaturase                              81.3    1e-14   
ref|WP_002763349.1|  acyl-CoA desaturase                              81.3    1e-14   
ref|WP_002755543.1|  acyl-CoA desaturase                              81.3    1e-14   
ref|WP_002748596.1|  acyl-CoA desaturase                              81.3    1e-14   
ref|WP_008206913.1|  acyl-CoA desaturase                              81.3    2e-14   
emb|CDY72005.1|  BnaAnng39560D                                        79.3    2e-14   
emb|CDX97711.1|  BnaA05g23680D                                        81.3    3e-14   
ref|XP_010489853.1|  PREDICTED: probable lipid desaturase ADS3.2,...  79.3    3e-14   
ref|WP_015111530.1|  Delta-9 acyl-phospholipid desaturase             79.7    5e-14   
ref|WP_036267048.1|  acyl-CoA desaturase                              79.7    5e-14   
ref|WP_013325496.1|  acyl-CoA desaturase                              79.7    6e-14   
ref|WP_026079759.1|  acyl-CoA desaturase                              79.7    6e-14   
ref|WP_015141858.1|  fatty-acid desaturase                            79.7    6e-14   
ref|WP_019495536.1|  acyl-CoA desaturase                              79.3    7e-14   
ref|WP_011611109.1|  acyl-CoA desaturase                              79.3    7e-14   
ref|XP_001421919.1|  predicted protein                                80.5    7e-14   
ref|XP_003064240.1|  predicted protein                                79.3    8e-14   
ref|WP_015170515.1|  Delta-9 acyl-phospholipid desaturase             79.3    8e-14   
ref|WP_015216737.1|  Delta-9 acyl-phospholipid desaturase             79.0    9e-14   
ref|WP_015141857.1|  fatty-acid desaturase                            79.0    9e-14   
ref|WP_015228589.1|  fatty-acid desaturase                            79.0    1e-13   
ref|WP_028089207.1|  acyl-CoA desaturase                              78.6    1e-13   
ref|WP_015225320.1|  Delta-9 acyl-phospholipid desaturase             78.6    1e-13   
ref|WP_011320892.1|  acyl-CoA desaturase                              78.6    1e-13   
ref|WP_028083217.1|  acyl-CoA desaturase                              78.6    1e-13   
ref|WP_015140908.1|  fatty-acid desaturase                            78.6    1e-13   
ref|WP_016950901.1|  acyl-CoA desaturase                              78.6    1e-13   
ref|WP_006511867.1|  fatty-acid desaturase                            78.6    1e-13   
ref|WP_017652362.1|  acyl-CoA desaturase                              78.6    1e-13   
ref|XP_010462578.1|  PREDICTED: delta-9 desaturase-like 1 protein     79.0    1e-13   
gb|AIE74182.1|  Fatty acid desaturase; Delta-9 fatty acid desaturase  78.6    1e-13   
ref|WP_017309511.1|  acyl-CoA desaturase                              78.6    1e-13   
ref|WP_015197143.1|  Delta-9 acyl-phospholipid desaturase             78.6    1e-13   
ref|WP_015208130.1|  fatty-acid desaturase                            78.6    2e-13   
ref|WP_010995768.1|  acyl-CoA desaturase                              78.6    2e-13   
ref|WP_008233847.1|  Fatty acid desaturase                            78.2    2e-13   
ref|WP_017317393.1|  acyl-CoA desaturase                              78.2    2e-13   
ref|WP_027401795.1|  acyl-CoA desaturase                              78.2    2e-13   
emb|CEG00631.1|  Fatty acid desaturase, type 1                        78.2    2e-13   
ref|WP_017287062.1|  acyl-CoA desaturase                              78.2    2e-13   
ref|WP_008225505.1|  Fatty acid desaturase                            77.8    2e-13   
ref|WP_035150649.1|  acyl-CoA desaturase                              77.8    2e-13   
ref|WP_013192165.1|  acyl-CoA desaturase                              77.8    2e-13   
ref|WP_015177399.1|  Stearoyl-CoA 9-desaturase                        77.8    3e-13   
ref|WP_016872709.1|  acyl-CoA desaturase                              77.8    3e-13   
ref|WP_007307491.1|  acyl-CoA desaturase                              77.8    3e-13   
ref|WP_017292972.1|  acyl-CoA desaturase                              77.8    3e-13   
ref|WP_021836317.1|  Fatty acid desaturase; Delta-9 fatty acid de...  77.8    3e-13   
ref|WP_006275612.1|  acyl-CoA desaturase                              77.4    3e-13   
ref|WP_009632128.1|  fatty-acid desaturase                            77.4    3e-13   
ref|WP_009458159.1|  MULTISPECIES: acyl-CoA desaturase                77.4    3e-13   
ref|WP_006199118.1|  acyl-CoA desaturase                              77.4    3e-13   
ref|WP_015083212.1|  type 1 fatty acid desaturase                     77.4    4e-13   
ref|WP_016861608.1|  acyl-CoA desaturase                              77.4    4e-13   
ref|WP_016869547.1|  acyl-CoA desaturase                              77.4    4e-13   
ref|WP_039202949.1|  acyl-CoA desaturase                              77.4    4e-13   
ref|WP_011141944.1|  fatty acid desaturase                            77.8    4e-13   
ref|WP_006455010.1|  acyl-CoA desaturase                              77.0    4e-13   
ref|WP_026723023.1|  acyl-CoA desaturase                              77.0    4e-13   
dbj|BAM53904.1|  acyl-CoA desaturase                                  77.0    5e-13   
ref|WP_036483066.1|  acyl-CoA desaturase                              77.0    6e-13   
ref|WP_010873728.1|  acyl-CoA desaturase                              77.4    6e-13   
ref|WP_017749146.1|  acyl-CoA desaturase                              76.6    6e-13   
ref|WP_024125916.1|  delta-9 acyl-lipid desaturase DesC               76.6    6e-13   
ref|WP_026731239.1|  acyl-CoA desaturase                              76.6    6e-13   
ref|WP_017663221.1|  hypothetical protein                             76.6    7e-13   
ref|WP_020472036.1|  hypothetical protein                             77.4    7e-13   
ref|WP_038081634.1|  acyl-CoA desaturase                              76.3    8e-13   
emb|CAF18423.1|  delta 9 acyl-lipid desaturase                        76.6    8e-13   
ref|WP_006633583.1|  acyl-CoA desaturase                              76.3    8e-13   
ref|WP_012412456.1|  acyl-CoA desaturase                              76.3    9e-13   
ref|WP_015120381.1|  fatty-acid desaturase                            76.3    9e-13   
ref|WP_015128829.1|  Delta-9 acyl-phospholipid desaturase             76.3    9e-13   
ref|WP_017319592.1|  acyl-CoA desaturase                              76.3    1e-12   
ref|WP_026794929.1|  MULTISPECIES: acyl-CoA desaturase                76.3    1e-12   
ref|WP_027254476.1|  acyl-CoA desaturase                              76.3    1e-12   
ref|WP_026788471.1|  MULTISPECIES: acyl-CoA desaturase                76.3    1e-12   
ref|WP_017720149.1|  acyl-CoA desaturase                              76.3    1e-12   
ref|WP_007358227.1|  MULTISPECIES: acyl-CoA desaturase                75.9    1e-12   
ref|WP_036534031.1|  acyl-CoA desaturase                              75.9    1e-12   
ref|WP_027844500.1|  acyl-CoA desaturase                              75.9    1e-12   
ref|WP_009556265.1|  fatty-acid desaturase                            75.9    1e-12   
ref|WP_015217907.1|  Delta-9 acyl-phospholipid desaturase             75.5    1e-12   
ref|WP_009344602.1|  acyl-CoA desaturase                              75.5    2e-12   
ref|WP_019504588.1|  acyl-CoA desaturase                              75.5    2e-12   
ref|WP_006633584.1|  acyl-CoA desaturase                              75.5    2e-12   
ref|WP_012594005.1|  acyl-CoA desaturase                              75.5    2e-12   
ref|WP_017308755.1|  hypothetical protein                             76.3    2e-12   
ref|WP_026099734.1|  acyl-CoA desaturase                              75.5    2e-12   
ref|WP_007358226.1|  MULTISPECIES: acyl-CoA desaturase                75.5    2e-12   
ref|WP_015162117.1|  fatty-acid desaturase                            75.5    2e-12   
ref|WP_015134529.1|  Delta-9 acyl-phospholipid desaturase             75.1    2e-12   
ref|WP_024124703.1|  delta-9 acyl-lipid desaturase DesC2              75.1    2e-12   
ref|WP_015783237.1|  acyl-CoA desaturase                              75.1    2e-12   
ref|WP_006529825.1|  fatty-acid desaturase                            75.1    2e-12   
ref|WP_029632500.1|  acyl-CoA desaturase [                            75.1    2e-12   
ref|WP_037215876.1|  acyl-CoA desaturase                              75.1    2e-12   
ref|WP_015177398.1|  Delta-9 acyl-phospholipid desaturase             75.1    3e-12   
ref|WP_039739791.1|  acyl-CoA desaturase                              75.1    3e-12   
ref|WP_015186542.1|  Delta-9 acyl-phospholipid desaturase             75.1    3e-12   
ref|WP_015194211.1|  Stearoyl-CoA 9-desaturase                        75.1    3e-12   
ref|WP_011058212.1|  acyl-CoA desaturase                              75.1    3e-12   
ref|WP_010052052.1|  stearoyl-CoA 9-desaturase                        75.1    4e-12   
ref|WP_039716385.1|  acyl-CoA desaturase                              74.7    4e-12   
ref|WP_009547757.1|  MULTISPECIES: acyl-CoA desaturase                74.3    4e-12   
gb|KGN52900.1|  hypothetical protein Csa_4G006070                     72.8    5e-12   
ref|WP_015156085.1|  Delta-9 acyl-phospholipid desaturase             74.3    5e-12   
ref|WP_006616281.1|  acyl-CoA desaturase                              74.3    5e-12   
ref|WP_015201361.1|  stearoyl-CoA 9-desaturase                        73.9    5e-12   
ref|WP_015221813.1|  Delta-9 acyl-phospholipid desaturase             74.3    5e-12   
ref|WP_006624509.1|  MULTISPECIES: acyl-CoA desaturase                73.9    5e-12   
ref|XP_003083986.1|  delta 9 desaturase-like protein (ISS)            75.1    8e-12   
ref|WP_015117768.1|  fatty-acid desaturase                            74.3    9e-12   
dbj|BAP18395.1|  fatty acid desaturase                                73.6    9e-12   
ref|WP_015151947.1|  fatty-acid desaturase                            73.6    9e-12   
gb|ETW96820.1|  hypothetical protein ETSY1_25070                      73.9    1e-11   
ref|WP_023073908.1|  acyl- desaturase                                 73.6    1e-11   
ref|WP_034421552.1|  hypothetical protein                             73.6    1e-11   
ref|WP_008275541.1|  acyl-CoA desaturase                              73.2    1e-11   
ref|WP_012953945.1|  acyl-CoA desaturase                              73.2    1e-11   
ref|WP_022605174.1|  fatty-acid desaturase                            72.8    1e-11   
gb|AAB61353.1|  delta-9 desaturase                                    72.8    1e-11   
ref|WP_030008228.1|  acyl-CoA desaturase                              72.8    2e-11   
ref|WP_012307798.1|  acyl-CoA desaturase                              73.2    2e-11   
ref|WP_015151717.1|  fatty-acid desaturase                            72.8    2e-11   
ref|WP_024545831.1|  acyl-CoA desaturase                              72.4    2e-11   
ref|WP_012362253.1|  MULTISPECIES: fatty acid desaturase              73.2    2e-11   
ref|WP_039755013.1|  fatty acid desaturase                            73.2    2e-11   
gb|KFF41182.1|  Delta-9 acyl-phospholipid desaturase                  72.0    3e-11   
ref|XP_001701270.1|  fatty acid desaturase                            73.6    3e-11   
ref|XP_005850941.1|  hypothetical protein CHLNCDRAFT_34160            73.6    3e-11   
ref|WP_008185731.1|  acyl-CoA desaturase                              72.0    3e-11   
ref|WP_006516486.1|  fatty-acid desaturase                            72.0    3e-11   
ref|WP_034850449.1|  hypothetical protein                             72.0    3e-11   
ref|WP_035985102.1|  acyl-CoA desaturase                              72.0    3e-11   
ref|WP_026073014.1|  acyl-CoA desaturase                              72.0    3e-11   
ref|WP_008231543.1|  Fatty acid desaturase                            72.0    3e-11   
ref|WP_026081666.1|  fatty acid desaturase                            72.4    4e-11   
ref|WP_015181896.1|  fatty-acid desaturase                            72.0    4e-11   
gb|ACF98531.1|  delta-9 desaturase-like protein                       73.2    4e-11   
ref|WP_037223771.1|  acyl-CoA desaturase                              71.6    4e-11   
ref|WP_012162077.1|  acyl-CoA desaturase                              71.6    4e-11   
ref|WP_010479938.1|  acyl-CoA desaturase                              71.6    4e-11   
ref|WP_012912792.1|  stearoyl-CoA 9-desaturase                        72.0    5e-11   
ref|WP_006520140.1|  fatty-acid desaturase                            71.6    5e-11   
ref|WP_011057490.1|  acyl-CoA desaturase                              71.2    6e-11   
ref|WP_033199756.1|  fatty acid desaturase                            71.6    6e-11   
ref|XP_009351237.1|  PREDICTED: delta-9 desaturase-like 5 protein     68.6    7e-11   
ref|WP_011486163.1|  fatty acid desaturase                            71.6    7e-11   
ref|WP_015124437.1|  fatty-acid desaturase                            70.9    8e-11   
ref|WP_008318856.1|  fatty-acid desaturase                            70.9    8e-11   
ref|WP_020474626.1|  hypothetical protein                             71.2    9e-11   
ref|WP_020717913.1|  Delta-9 acyl-phospholipid desaturase             70.9    9e-11   
gb|KFK24702.1|  hypothetical protein AALP_AA8G013600                  72.0    1e-10   
ref|WP_009788089.1|  acyl-CoA desaturase                              70.5    1e-10   
ref|WP_023066084.1|  fatty acid desaturase family protein             70.5    1e-10   
ref|WP_035122412.1|  fatty acid desaturase                            70.1    2e-10   
ref|WP_023175071.1|  stearoyl-CoA 9-desaturase                        69.7    2e-10   
ref|WP_038025900.1|  acyl-CoA desaturase                              69.7    2e-10   
gb|AIF01706.1|  Delta-9 acyl-phospholipid desaturase                  69.7    2e-10   
ref|WP_011243859.1|  acyl-CoA desaturase                              69.7    2e-10   
ref|XP_002949045.1|  hypothetical protein VOLCADRAFT_89326            70.5    3e-10   
ref|WP_014748402.1|  fatty-acid desaturase                            69.7    3e-10   
ref|WP_036005492.1|  acyl-CoA desaturase                              68.9    4e-10   
ref|WP_039726743.1|  acyl-CoA desaturase                              68.9    4e-10   



>ref|XP_011073424.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic [Sesamum indicum]
Length=382

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 102/188 (54%), Gaps = 24/188 (13%)
 Frame = +3

Query  42   PSPA-AKPFFFSLPQSCSPLLREKQTPTSLQSSPLIYTTKLG------QNRFFN-CKEEK  197
            PSP+ AKPF FS P     L       T      L Y T+        +N FF+  K E 
Sbjct  6    PSPSRAKPFQFS-PLHTPNLKPNSSKTTQKHKQSLHYATEARFAHNCLKNGFFSKGKYES  64

Query  198  YKRLSPIV--CIRPASDDREDTP-------QAAKNQKRVEFWTRMAKSLEVAPGSQMVKV  350
             +R+  IV     P S D +D+             ++R  +W R   SL+VA    +V +
Sbjct  65   SRRVMAIVRAASVPLSGDEKDSSFGRILLSDVVVQRRRNVYWGRKWNSLDVATVGVVVAM  124

Query  351  MFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFA  527
                 H LC+ APF F W AF VA GLY++T +LGI+LS+HRNLSHRSFKLPKWLEY FA
Sbjct  125  -----HLLCVLAPFTFNWGAFWVAVGLYVITGLLGITLSFHRNLSHRSFKLPKWLEYLFA  179

Query  528  YCGVHALQ  551
            YCGV ALQ
Sbjct  180  YCGVQALQ  187


 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A+ + G+ WHNNHHAFEYSARHGLEWWQ+D+TWYVVR LQ  GLATDVKLPT AQK++
Sbjct  319  VAMLAFGEGWHNNHHAFEYSARHGLEWWQIDMTWYVVRLLQAIGLATDVKLPTTAQKQR  377



>ref|XP_004235954.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic [Solanum lycopersicum]
Length=387

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 103/181 (57%), Gaps = 24/181 (13%)
 Frame = +3

Query  66   FFSLPQSCSPLLREKQTPTSLQS-SPLIYTTKLGQNRFFNC----KEEKYKR---LSPIV  221
            F  LP++     R  QT  ++ S S    TTK+G    +NC     + ++ R   L PIV
Sbjct  16   FSPLPRAVHRQGRSTQTTKNVNSLSCTSMTTKIGVVNKWNCYGLEGKVRFSRRVMLMPIV  75

Query  222  ---CIRPASDDREDT-------PQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHC  371
                 +P S++  ++             + R   W R   S+++A  + +V +     H 
Sbjct  76   NAAVTQPVSENERESNFKRILLSDVVVTRPRDVLWGRKWNSMDMASAAVVVSM-----HL  130

Query  372  LCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHAL  548
            LCLFAPF F + A  +AFGLY++T +LGI+LS+HRNLSHRSFKLPKWLEYFFAYCGV AL
Sbjct  131  LCLFAPFTFNYAALGIAFGLYVITGLLGITLSFHRNLSHRSFKLPKWLEYFFAYCGVQAL  190

Query  549  Q  551
            Q
Sbjct  191  Q  191


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGL+WWQLD+TWYVVR LQ  GLATDVKLPT   K++
Sbjct  323  VALLAFGEGWHNNHHAFEYSARHGLKWWQLDMTWYVVRFLQAIGLATDVKLPTDTHKQR  381



>ref|XP_006364220.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Solanum tuberosum]
Length=390

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 91/152 (60%), Gaps = 23/152 (15%)
 Frame = +3

Query  150  TTKLGQNRFFNC----KEEKYKR---LSPIV---CIRPASDDREDT-------PQAAKNQ  278
            TTK+G+   +NC     + ++ R   L PIV     +P S++  ++             +
Sbjct  48   TTKIGEVNKWNCYGLEGKVRFSRRVMLMPIVSAAVTQPVSENERESNCKRILLSDVVVTR  107

Query  279  KRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLGI  455
             R   W R   S+++A  + +V +     H LCLFAPF F + A  +AFGLYI+T +LGI
Sbjct  108  PREVLWGRKWNSVDMASAAVVVSM-----HLLCLFAPFTFNYAALGIAFGLYIITGLLGI  162

Query  456  SLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            +LS+HRNLSHRSFKLPKWLEYFFAYCG  ALQ
Sbjct  163  TLSFHRNLSHRSFKLPKWLEYFFAYCGAQALQ  194


 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGL+WWQLD+TWYVVR LQ  GLATDVKLPT   K++
Sbjct  326  VALLAFGEGWHNNHHAFEYSARHGLKWWQLDMTWYVVRFLQAIGLATDVKLPTDTHKQR  384



>ref|XP_008227083.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Prunus mume]
Length=298

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 66/91 (73%), Gaps = 5/91 (5%)
 Frame = +3

Query  285  VEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLS  464
            VEFW R     +++       V+F  +HCLCLFAPF F W AF VA  LY++T LG++LS
Sbjct  13   VEFWGRKWNIQDIS-----TVVVFLASHCLCLFAPFHFNWGAFWVAMALYLLTGLGVTLS  67

Query  465  YHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            YHRNL+HRSF LPKWLEY+FAYCGV +LQ S
Sbjct  68   YHRNLAHRSFTLPKWLEYYFAYCGVLSLQGS  98


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL  LG+ WHNNHHAFEYSAR GLEWWQ D TWYV++ LQ  GLATDVK+PT  QK++
Sbjct  228  VALLVLGEGWHNNHHAFEYSARQGLEWWQFDFTWYVIKFLQAIGLATDVKVPTEIQKQR  286



>ref|NP_001237468.1| uncharacterized protein LOC100527024 [Glycine max]
 gb|ACU16061.1| unknown [Glycine max]
Length=229

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 87/154 (56%), Gaps = 23/154 (15%)
 Frame = +3

Query  111  QTPTSLQSSPLIY----TTKLGQNRFFN--CKEEKYKRLSPIVCIRPASDDREDTPQAAK  272
            QT  SLQ++P  Y    T K   N  F    KEE   R   I+           +    K
Sbjct  53   QTKISLQNNPFTYNLAVTAKANANAAFGEGFKEEGASRHRKILL----------SEVEVK  102

Query  273  NQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML-  449
             ++RV F+ R   SL+      ++ +     H LC+FAPF F W AF VA  LYIVT L 
Sbjct  103  RERRV-FFGRKWNSLDFGTAGIVLAM-----HLLCVFAPFHFNWPAFWVAVALYIVTGLF  156

Query  450  GISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            G++LS+HRNLSHRSFKLPKWLEYFFAYCGV ALQ
Sbjct  157  GVTLSFHRNLSHRSFKLPKWLEYFFAYCGVLALQ  190



>ref|XP_006584524.1| PREDICTED: uncharacterized protein LOC100527024 isoform X3 [Glycine 
max]
Length=292

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 87/154 (56%), Gaps = 23/154 (15%)
 Frame = +3

Query  111  QTPTSLQSSPLIY----TTKLGQNRFFN--CKEEKYKRLSPIVCIRPASDDREDTPQAAK  272
            QT  SLQ++P  Y    T K   N  F    KEE   R   I+           +    K
Sbjct  53   QTKISLQNNPFTYNLAVTAKANANAAFGEGFKEEGASRHRKILL----------SEVEVK  102

Query  273  NQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML-  449
             ++RV F+ R   SL+      ++ +     H LC+FAPF F W AF VA  LYIVT L 
Sbjct  103  RERRV-FFGRKWNSLDFGTAGIVLAM-----HLLCVFAPFHFNWPAFWVAVALYIVTGLF  156

Query  450  GISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            GI+LS+HRNLSHRSFKLPKWLEYFFAYCGV ALQ
Sbjct  157  GITLSFHRNLSHRSFKLPKWLEYFFAYCGVLALQ  190



>ref|XP_006583121.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like isoform X2 [Glycine max]
Length=292

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 88/153 (58%), Gaps = 18/153 (12%)
 Frame = +3

Query  108  KQTPTSLQSSPLIY----TTKLGQNRFFNCKEEKYKRLSPIVCIRPASDDREDTPQAAKN  275
            KQT  SL+++P  Y    T K   N  F    E  +     V ++       +     K 
Sbjct  51   KQTKISLKNNPFTYNLAVTAKANANAAFGEGLEAGE-----VTLKHRKILLSEVE--VKR  103

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML-G  452
            Q+RV F+ R   SL+V     ++ +     H LCLFAPF F W AF VA  LYIVT L G
Sbjct  104  QRRV-FFGRKWNSLDVGTAGIVLAM-----HLLCLFAPFHFNWPAFRVAVALYIVTGLFG  157

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LS+HRNLSHRSFKLPKWLEYFFAYCGV ALQ
Sbjct  158  ITLSFHRNLSHRSFKLPKWLEYFFAYCGVLALQ  190



>ref|XP_006584523.1| PREDICTED: uncharacterized protein LOC100527024 isoform X2 [Glycine 
max]
Length=334

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 87/154 (56%), Gaps = 23/154 (15%)
 Frame = +3

Query  111  QTPTSLQSSPLIY----TTKLGQNRFFN--CKEEKYKRLSPIVCIRPASDDREDTPQAAK  272
            QT  SLQ++P  Y    T K   N  F    KEE   R   I+           +    K
Sbjct  53   QTKISLQNNPFTYNLAVTAKANANAAFGEGFKEEGASRHRKILL----------SEVEVK  102

Query  273  NQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML-  449
             ++RV F+ R   SL+      ++ +     H LC+FAPF F W AF VA  LYIVT L 
Sbjct  103  RERRV-FFGRKWNSLDFGTAGIVLAM-----HLLCVFAPFHFNWPAFWVAVALYIVTGLF  156

Query  450  GISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            GI+LS+HRNLSHRSFKLPKWLEYFFAYCGV ALQ
Sbjct  157  GITLSFHRNLSHRSFKLPKWLEYFFAYCGVLALQ  190



>ref|XP_006584522.1| PREDICTED: uncharacterized protein LOC100527024 isoform X1 [Glycine 
max]
Length=390

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 87/154 (56%), Gaps = 23/154 (15%)
 Frame = +3

Query  111  QTPTSLQSSPLIY----TTKLGQNRFFN--CKEEKYKRLSPIVCIRPASDDREDTPQAAK  272
            QT  SLQ++P  Y    T K   N  F    KEE   R   I+           +    K
Sbjct  53   QTKISLQNNPFTYNLAVTAKANANAAFGEGFKEEGASRHRKILL----------SEVEVK  102

Query  273  NQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML-  449
             ++RV F+ R   SL+      ++ +     H LC+FAPF F W AF VA  LYIVT L 
Sbjct  103  RERRV-FFGRKWNSLDFGTAGIVLAM-----HLLCVFAPFHFNWPAFWVAVALYIVTGLF  156

Query  450  GISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            GI+LS+HRNLSHRSFKLPKWLEYFFAYCGV ALQ
Sbjct  157  GITLSFHRNLSHRSFKLPKWLEYFFAYCGVLALQ  190


 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQ+D+TWYVVR LQ  GLATDVKLPT +QK+K
Sbjct  322  VALLAFGEGWHNNHHAFEYSARHGLEWWQIDMTWYVVRFLQAIGLATDVKLPTESQKQK  380



>ref|XP_010250157.1| PREDICTED: LOW QUALITY PROTEIN: palmitoyl-monogalactosyldiacylglycerol 
delta-7 desaturase, chloroplastic-like [Nelumbo nucifera]
Length=388

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 68/97 (70%), Gaps = 7/97 (7%)
 Frame = +3

Query  264  AAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT  443
              K ++RV F  R   SL+VA    ++ +     H LCLFAPF F W AF VA  LY+VT
Sbjct  97   VVKQRRRVYF-GRKWNSLDVATAGVVLAM-----HVLCLFAPFTFNWGAFWVAVALYVVT  150

Query  444  ML-GISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             L GI+LS+HRNLSHRSFKLPKWLEYFFAYCGV ALQ
Sbjct  151  GLFGITLSFHRNLSHRSFKLPKWLEYFFAYCGVQALQ  187


 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQLDITWY VR LQ  GLA DVK+PT +QK++
Sbjct  319  VALLAFGEGWHNNHHAFEYSARHGLEWWQLDITWYTVRLLQAIGLAKDVKVPTESQKQR  377



>gb|KHN37989.1| Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic 
[Glycine soja]
Length=350

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 87/154 (56%), Gaps = 23/154 (15%)
 Frame = +3

Query  111  QTPTSLQSSPLIY----TTKLGQNRFFN--CKEEKYKRLSPIVCIRPASDDREDTPQAAK  272
            QT  SLQ++P  Y    T K   N  F    KEE   R   I+           +    K
Sbjct  53   QTKISLQNNPFTYNLAVTAKANANAAFGEGFKEEGASRHRKILL----------SEVEVK  102

Query  273  NQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML-  449
             ++RV F+ R   SL+      ++ +     H LC+FAPF F W AF VA  LYIVT L 
Sbjct  103  RERRV-FFGRKWNSLDFGTAGIVLAM-----HLLCVFAPFHFNWPAFWVAVALYIVTGLF  156

Query  450  GISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            GI+LS+HRNLSHRSFKLPKWLEYFFAYCGV ALQ
Sbjct  157  GITLSFHRNLSHRSFKLPKWLEYFFAYCGVLALQ  190



>ref|XP_003529803.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like isoform X1 [Glycine max]
Length=390

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 88/153 (58%), Gaps = 18/153 (12%)
 Frame = +3

Query  108  KQTPTSLQSSPLIY----TTKLGQNRFFNCKEEKYKRLSPIVCIRPASDDREDTPQAAKN  275
            KQT  SL+++P  Y    T K   N  F    E  +     V ++       +     K 
Sbjct  51   KQTKISLKNNPFTYNLAVTAKANANAAFGEGLEAGE-----VTLKHRKILLSEVE--VKR  103

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML-G  452
            Q+RV F+ R   SL+V     ++ +     H LCLFAPF F W AF VA  LYIVT L G
Sbjct  104  QRRV-FFGRKWNSLDVGTAGIVLAM-----HLLCLFAPFHFNWPAFRVAVALYIVTGLFG  157

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LS+HRNLSHRSFKLPKWLEYFFAYCGV ALQ
Sbjct  158  ITLSFHRNLSHRSFKLPKWLEYFFAYCGVLALQ  190


 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQLD+TWYVVR L+  GLATDVKLPT + K+K
Sbjct  322  VALLAFGEGWHNNHHAFEYSARHGLEWWQLDMTWYVVRFLEAIGLATDVKLPTESHKQK  380



>gb|KHN01326.1| Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic 
[Glycine soja]
Length=390

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 88/153 (58%), Gaps = 18/153 (12%)
 Frame = +3

Query  108  KQTPTSLQSSPLIY----TTKLGQNRFFNCKEEKYKRLSPIVCIRPASDDREDTPQAAKN  275
            KQT  SL+++P  Y    T K   N  F    E  +     V ++       +     K 
Sbjct  51   KQTKISLKNNPFTYNLAVTAKANANAAFGEGLEAGE-----VTLKHRKILLSEVE--VKR  103

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML-G  452
            Q+RV F+ R   SL+V     ++ +     H LCLFAPF F W AF VA  LYIVT L G
Sbjct  104  QRRV-FFGRKWNSLDVGTAGIVLAM-----HLLCLFAPFHFNWPAFRVAVALYIVTGLFG  157

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LS+HRNLSHRSFKLPKWLEYFFAYCGV ALQ
Sbjct  158  ITLSFHRNLSHRSFKLPKWLEYFFAYCGVLALQ  190


 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQLD+TWYVVR LQ  GLATDVKLPT + K+K
Sbjct  322  VALLAFGEGWHNNHHAFEYSARHGLEWWQLDMTWYVVRFLQAIGLATDVKLPTESHKQK  380



>ref|XP_008227612.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Prunus mume]
Length=298

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 64/91 (70%), Gaps = 5/91 (5%)
 Frame = +3

Query  285  VEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLS  464
            VEFW R     +++       VMF  +HCLCLFAPF F W AF VA  L ++T LG++LS
Sbjct  13   VEFWGRKWNIQDIST-----VVMFLASHCLCLFAPFHFNWGAFWVAMALSLLTGLGVTLS  67

Query  465  YHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            YHRNL+HRSF LPKWLEY FAYCGV +LQ S
Sbjct  68   YHRNLAHRSFTLPKWLEYSFAYCGVLSLQGS  98


 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL  LG+ WHNNHHAFEYSAR GLEWWQ D TWY+++ LQ  GLATDVK+PT  QK++
Sbjct  228  VALLVLGEGWHNNHHAFEYSARQGLEWWQFDFTWYIIKFLQAIGLATDVKVPTEIQKQQ  286



>ref|XP_010535145.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Tarenaya hassleriana]
Length=373

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 94/179 (53%), Gaps = 16/179 (9%)
 Frame = +3

Query  42   PSPAAKPFFF---SLPQ-----SCSPLLREKQTPTSLQSSPLIYTTKLGQNRFFNCKEEK  197
            P    KPFF    SLP      + + L    +TP S ++S  +    LG    F    EK
Sbjct  8    PLTKPKPFFLFSSSLPHPRKLDTRTTLNLNHETPDSSKTS--LNRRMLGLGPSFCAFPEK  65

Query  198  YKRLSPIVCIRPASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLC  377
              R +       A+  R         +KR  FW R   SL+V   + +V +     H L 
Sbjct  66   GIRRNVSAEAEAANYGRILLSDVVVKRKRKVFWGRRWNSLDVGTAAVVVAM-----HVLS  120

Query  378  LFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            LFAPF F W AF VAFGLY+VT +LGI+LS+HRNLSH+SFKL KWLEY  AYCG  ALQ
Sbjct  121  LFAPFQFNWSAFWVAFGLYVVTGLLGITLSFHRNLSHKSFKLAKWLEYLCAYCGTQALQ  179


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A+ S G+ WHNNHHAFE+SAR GLEWWQ+D+TWY+VR LQ  GLATDVKLP+ AQK +
Sbjct  311  VAVLSFGEGWHNNHHAFEFSARAGLEWWQVDMTWYLVRFLQTVGLATDVKLPSQAQKER  369



>ref|XP_010535146.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Tarenaya hassleriana]
Length=377

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 66/93 (71%), Gaps = 6/93 (6%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLG  452
            +KR  FW R   SL+V   + +V +     H L LFAPF F W AF VAFGLY+VT +LG
Sbjct  96   RKRRVFWGRRWNSLDVGTAAVVVAM-----HLLSLFAPFQFNWSAFWVAFGLYVVTGLLG  150

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LSYHRNLSH+SFKLPKWLEY  AYCG  ALQ
Sbjct  151  ITLSYHRNLSHKSFKLPKWLEYLCAYCGAQALQ  183


 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A+ + G+ WHNNHHAFE+SARHGLEWWQ+D+TWY+VR LQ  GLAT+VKLP+ AQK +
Sbjct  315  VAVLAFGEGWHNNHHAFEFSARHGLEWWQIDMTWYLVRFLQAVGLATNVKLPSQAQKER  373



>ref|XP_009613437.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic [Nicotiana tomentosiformis]
Length=385

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 76/127 (60%), Gaps = 24/127 (19%)
 Frame = +3

Query  180  NCKEEKYKRL--SPIVCIRPASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVM  353
            N KE  + R+  S +V  RP                R   + R   S+++   + +V + 
Sbjct  84   NGKESSFNRILFSDVVVKRP----------------RNVLFGRQWNSVDLGSAAVVVAM-  126

Query  354  FPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAY  530
                H LCL APF F W A  +AFGLYIVT +LGI+LS+HRNLSHRSFKLPKWLEYFFAY
Sbjct  127  ----HLLCLLAPFNFNWAAVGIAFGLYIVTGLLGITLSFHRNLSHRSFKLPKWLEYFFAY  182

Query  531  CGVHALQ  551
            CGV ALQ
Sbjct  183  CGVQALQ  189


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQLD+TWYVVR LQ  GLA+DVKLPT   K++
Sbjct  321  VALLAFGEGWHNNHHAFEYSARHGLEWWQLDMTWYVVRFLQAIGLASDVKLPTDTHKQR  379



>ref|XP_006427289.1| hypothetical protein CICLE_v10025838mg [Citrus clementina]
 gb|ESR40529.1| hypothetical protein CICLE_v10025838mg [Citrus clementina]
Length=297

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLG  452
            ++R  F  R   SL+++    ++ +     H L LFAPFCFTW +  VAFGLY+VT +LG
Sbjct  100  RRRSLFSGRNWNSLDISTAGVVLAM-----HLLALFAPFCFTWSSLRVAFGLYVVTGLLG  154

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LS+HRNLSHRSFKLPKWLEY FAYCGV +LQ
Sbjct  155  ITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQ  187



>ref|XP_007135758.1| hypothetical protein PHAVU_010G156200g [Phaseolus vulgaris]
 gb|ESW07752.1| hypothetical protein PHAVU_010G156200g [Phaseolus vulgaris]
Length=425

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 85/154 (55%), Gaps = 19/154 (12%)
 Frame = +3

Query  105  EKQTPTSLQSSPLIY----TTKLGQNRFFNCKEEKYKRLSPIVCIRPASDDREDTPQAAK  272
            +KQ+  SL+++P  Y    T K   N  F    E    L            R    +   
Sbjct  86   QKQSKISLKNNPFCYNLAVTAKATANAAFGGGLEAEGSLK---------HRRILLSEVEV  136

Query  273  NQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML-  449
             ++R  F+ R   SL+V     MV VM    H LCLFAPF F W AF VA  LY+VT L 
Sbjct  137  KRERSVFFGRKWNSLDVGTAG-MVLVM----HVLCLFAPFHFNWPAFWVAVALYVVTGLF  191

Query  450  GISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            GI+LS+HRNLSHRSFKLPKWLEYFFAYCG  ALQ
Sbjct  192  GITLSFHRNLSHRSFKLPKWLEYFFAYCGALALQ  225


 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQLD+TWYVVR LQ  GLAT+VKLPT +QK++
Sbjct  357  VALLAFGEGWHNNHHAFEYSARHGLEWWQLDMTWYVVRFLQAVGLATEVKLPTESQKQR  415



>ref|XP_006427290.1| hypothetical protein CICLE_v10025838mg [Citrus clementina]
 gb|ESR40530.1| hypothetical protein CICLE_v10025838mg [Citrus clementina]
 gb|KDO48594.1| hypothetical protein CISIN_1g016803mg [Citrus sinensis]
Length=382

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLG  452
            ++R  F  R   SL+++    ++ +     H L LFAPFCFTW +  VAFGLY+VT +LG
Sbjct  100  RRRSLFSGRNWNSLDISTAGVVLAM-----HLLALFAPFCFTWSSLRVAFGLYVVTGLLG  154

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LS+HRNLSHRSFKLPKWLEY FAYCGV +LQ
Sbjct  155  ITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQ  187


 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQ+D+TWYVVR LQ  GLATDVKLP+  QK++
Sbjct  319  VALLAFGEGWHNNHHAFEYSARHGLEWWQVDLTWYVVRFLQAVGLATDVKLPSETQKQR  377



>ref|XP_007214725.1| hypothetical protein PRUPE_ppa026015mg [Prunus persica]
 gb|EMJ15924.1| hypothetical protein PRUPE_ppa026015mg [Prunus persica]
Length=298

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 63/91 (69%), Gaps = 5/91 (5%)
 Frame = +3

Query  285  VEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLS  464
            VEFW R     ++      + V+F   HCLCLFAPF F W AF VA  L ++T LG++LS
Sbjct  13   VEFWGRQWNIQDIT-----IVVLFLALHCLCLFAPFHFNWRAFWVAMALSLLTGLGVTLS  67

Query  465  YHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            YHRNL+HRSF LPKWLEY FAYCGV +LQ S
Sbjct  68   YHRNLAHRSFTLPKWLEYSFAYCGVLSLQGS  98


 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL +LG+ WHNNHHAFEYSAR GLEWWQ D TWY+++ LQ  GLATDVK+PT  QK++
Sbjct  228  VALLALGEGWHNNHHAFEYSARQGLEWWQFDFTWYIIKFLQAIGLATDVKVPTEIQKQR  286



>ref|XP_008227503.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Prunus mume]
Length=299

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 67/91 (74%), Gaps = 5/91 (5%)
 Frame = +3

Query  285  VEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLS  464
            +EFW R   SL++A       V+F + HCLC+ APF FTW AF VA  LY+VT LG++LS
Sbjct  13   LEFWGRKWNSLDIA-----TAVVFFILHCLCVIAPFHFTWPAFWVACALYLVTGLGVTLS  67

Query  465  YHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            +HRNL+H+SF+LPKWLEY FAY GV +LQ S
Sbjct  68   FHRNLAHKSFRLPKWLEYLFAYFGVLSLQGS  98


 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L +LG+ WHNNHHAF+YSAR G EWWQ+D+TWYV+R  Q+ GLATDVK PT +QKR+
Sbjct  229  LGLFALGEGWHNNHHAFDYSARQGFEWWQIDLTWYVIRFFQLLGLATDVKTPTESQKRR  287



>ref|XP_004152346.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis sativus]
 ref|XP_004164999.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis sativus]
Length=380

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 85/166 (51%), Gaps = 12/166 (7%)
 Frame = +3

Query  75   LPQSCSPLLREKQTPTSLQSSPLIYTTKLG-----QNRFFNCKEEKYKRLSPIVCIRPAS  239
            LP    P +   Q P      P   + +L      QNR  +   E ++  S       A 
Sbjct  23   LPTLNFPSIPHDQLPFHFVGRPNFNSLRLNSPIHIQNRAISSPTEAFEPESLPPPPASAV  82

Query  240  DDREDTPQAAKNQKRVE-FWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFV  416
            D R         ++R E FW R   SL++     +V       H L LFAPF F W AF 
Sbjct  83   DGRRILLSDVVVKRRREVFWGRKWNSLDIGTAGVVVA-----THLLTLFAPFQFNWAAFW  137

Query  417  VAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            VA  LYI+T L GI+LS+HRNLSHRSFKLPKWLEY FAYCGV ALQ
Sbjct  138  VAISLYIITGLFGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQALQ  183


 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFE+SARHGLEWWQLD+TWYVVR LQ  GLATDVK+PT  QK K
Sbjct  315  VALLAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVRLLQAIGLATDVKIPTQLQKEK  373



>ref|XP_007212724.1| hypothetical protein PRUPE_ppa018861mg [Prunus persica]
 gb|EMJ13923.1| hypothetical protein PRUPE_ppa018861mg [Prunus persica]
Length=298

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 63/91 (69%), Gaps = 5/91 (5%)
 Frame = +3

Query  285  VEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLS  464
            VE W R     +++       V+F   HCLCLFAPF F W AF VA  LY +T+LG++LS
Sbjct  13   VELWGRKWNIQDIST-----VVVFLALHCLCLFAPFHFNWGAFWVAMALYFLTVLGVTLS  67

Query  465  YHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            YHRNL+HRSF LPKWLEY FAYCGV +LQ S
Sbjct  68   YHRNLAHRSFTLPKWLEYSFAYCGVLSLQGS  98


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL  LG+ WHNNHHAFEYSAR GLEWWQ D TW +++ +Q  GLATDVK+PT  QK++
Sbjct  228  VALLVLGEGWHNNHHAFEYSARQGLEWWQFDFTWCIIKFIQAIGLATDVKVPTQIQKQR  286



>gb|KGN52898.1| hypothetical protein Csa_4G006050 [Cucumis sativus]
Length=287

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 63/93 (68%), Gaps = 6/93 (6%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML-G  452
            ++R  FW R   SL++     +V       H L LFAPF F W AF VA  LYI+T L G
Sbjct  3    RRREVFWGRKWNSLDIGTAGVVVA-----THLLTLFAPFQFNWAAFWVAISLYIITGLFG  57

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LS+HRNLSHRSFKLPKWLEY FAYCGV ALQ
Sbjct  58   ITLSFHRNLSHRSFKLPKWLEYLFAYCGVQALQ  90


 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFE+SARHGLEWWQLD+TWYVVR LQ  GLATDVK+PT  QK K
Sbjct  222  VALLAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVRLLQAIGLATDVKIPTQLQKEK  280



>ref|XP_007213424.1| hypothetical protein PRUPE_ppa025710mg [Prunus persica]
 gb|EMJ14623.1| hypothetical protein PRUPE_ppa025710mg [Prunus persica]
Length=302

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 63/91 (69%), Gaps = 5/91 (5%)
 Frame = +3

Query  285  VEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLS  464
            VEFW R     ++      + V+F   HCLCLFAPF F W AF VA  L ++T LG++LS
Sbjct  13   VEFWGRKWNIQDIT-----IVVLFLALHCLCLFAPFHFNWRAFWVAMALSLLTGLGVTLS  67

Query  465  YHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            YHRNL+HRSF LPKWLEY FAYCGV +LQ S
Sbjct  68   YHRNLAHRSFTLPKWLEYSFAYCGVLSLQGS  98


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            ++L +LG+ WHNNHHAFEYSAR GLEWWQ D TWY+++ LQ  GLATDVK+PT  QK++
Sbjct  232  VSLLALGEGWHNNHHAFEYSARQGLEWWQFDFTWYIIKFLQAIGLATDVKVPTEIQKQR  290



>ref|XP_007023199.1| Fatty acid desaturase 5 isoform 2, partial [Theobroma cacao]
 gb|EOY25821.1| Fatty acid desaturase 5 isoform 2, partial [Theobroma cacao]
Length=356

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLG  452
            +K+  FW R   +L++A    +V +     H L LFAPF F W AF +A GLY VT +LG
Sbjct  104  RKKEVFWGRKWNTLDMATAGVVVGM-----HLLSLFAPFHFNWPAFWLAVGLYGVTGLLG  158

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LS+HRNLSHRSFK+PKWLEYFFAYCGV ALQ
Sbjct  159  ITLSFHRNLSHRSFKVPKWLEYFFAYCGVQALQ  191


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITW  684
            +AL + G+ WHNNHHAFEYSARHGLEWWQLD+TW
Sbjct  323  VALLAFGEGWHNNHHAFEYSARHGLEWWQLDMTW  356



>ref|XP_008454223.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis melo]
Length=385

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 75/131 (57%), Gaps = 7/131 (5%)
 Frame = +3

Query  165  QNRFFNCKEEKYKRLSPIVCIRPASDDREDTPQAAKNQKRVE-FWTRMAKSLEVAPGSQM  341
            QNR  +   E ++  S    +    D R         ++R E FW R   SL++     +
Sbjct  63   QNRAISSPTEAFEPESLPPPLASGVDGRRILLSDVVVKRRREVFWGRKWTSLDIGTAGVV  122

Query  342  VKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEY  518
            V       H L LFAPF F W AF VA  LYI+T L GI+LS+HRNLSHRSFKLPKWLEY
Sbjct  123  VA-----THLLTLFAPFQFNWAAFWVAISLYIITGLFGITLSFHRNLSHRSFKLPKWLEY  177

Query  519  FFAYCGVHALQ  551
             FAYCGV ALQ
Sbjct  178  LFAYCGVQALQ  188


 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFE+SARHGLEWWQLD+TWYVVR LQ  GLATDVK+PT  QK K
Sbjct  320  VALLAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVRLLQALGLATDVKIPTQLQKEK  378



>ref|XP_007023198.1| Fatty acid desaturase 5 isoform 1 [Theobroma cacao]
 gb|EOY25820.1| Fatty acid desaturase 5 isoform 1 [Theobroma cacao]
Length=386

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLG  452
            +K+  FW R   +L++A    +V +     H L LFAPF F W AF +A GLY VT +LG
Sbjct  104  RKKEVFWGRKWNTLDMATAGVVVGM-----HLLSLFAPFHFNWPAFWLAVGLYGVTGLLG  158

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LS+HRNLSHRSFK+PKWLEYFFAYCGV ALQ
Sbjct  159  ITLSFHRNLSHRSFKVPKWLEYFFAYCGVQALQ  191


 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQLD+TW V++ LQV G AT+VKLPT  QK++
Sbjct  323  VALLAFGEGWHNNHHAFEYSARHGLEWWQLDMTWCVIKFLQVIGQATEVKLPTEVQKKR  381



>ref|XP_007023200.1| Fatty acid desaturase 5 isoform 3 [Theobroma cacao]
 gb|EOY25822.1| Fatty acid desaturase 5 isoform 3 [Theobroma cacao]
Length=346

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLG  452
            +K+  FW R   +L++A    +V +     H L LFAPF F W AF +A GLY VT +LG
Sbjct  104  RKKEVFWGRKWNTLDMATAGVVVGM-----HLLSLFAPFHFNWPAFWLAVGLYGVTGLLG  158

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LS+HRNLSHRSFK+PKWLEYFFAYCGV ALQ
Sbjct  159  ITLSFHRNLSHRSFKVPKWLEYFFAYCGVQALQ  191



>gb|ADC80920.1| delta-9 fatty acid desaturase [Vernicia fordii]
Length=312

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 70/97 (72%), Gaps = 7/97 (7%)
 Frame = +3

Query  264  AAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT  443
            A K +++V F  R   +L+++    ++ +     H L LFAPF F W AF VAFGLY+VT
Sbjct  27   AVKRERKV-FLGRKWNTLDISTAGVVLAM-----HLLSLFAPFYFNWSAFWVAFGLYVVT  80

Query  444  -MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             +LGI+LS+HRNLSHRSFKLPKWLEY FAYCGV ALQ
Sbjct  81   GLLGITLSFHRNLSHRSFKLPKWLEYSFAYCGVQALQ  117


 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A+ + G+ WHNNHHAFEYSARHGLEWWQ+D+TWYVVR L+  GLATDVK+P+  QK++
Sbjct  249  VAVLAFGEGWHNNHHAFEYSARHGLEWWQIDMTWYVVRFLEAIGLATDVKVPSEMQKQR  307



>ref|XP_010465577.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic [Camelina sativa]
Length=372

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 68/96 (71%), Gaps = 6/96 (6%)
 Frame = +3

Query  267  AKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-  443
             K +++V +W R  K+++       V V+  + H LCL APF F W A  VAFGLYIVT 
Sbjct  86   VKKKEKVHWWEREWKAMDFGA----VAVVLSM-HLLCLLAPFQFNWRAVSVAFGLYIVTG  140

Query  444  MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            +LGI+LS+HRNLSH++FKLPKWLEY FAYCG  ALQ
Sbjct  141  LLGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQALQ  176


 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A  + G+ WHNNHHAFE+SARHGLEWWQLD+TWYVVR LQ  GLATDVKLP+ AQK++
Sbjct  308  VAALAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVRFLQAIGLATDVKLPSEAQKKR  366



>ref|XP_007023208.1| Fatty acid desaturase 5 [Theobroma cacao]
 gb|EOY25830.1| Fatty acid desaturase 5 [Theobroma cacao]
Length=386

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLG  452
            +K+  FW R   + ++A    +V +     H L LFAPF F W AF +A GLY+VT +LG
Sbjct  104  RKKKAFWGRKWNTSDMAIAGVIVSM-----HLLSLFAPFHFNWPAFWLAVGLYVVTGLLG  158

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LS+HRNLSHRSFK+PKWLEYFFAYCGV ALQ
Sbjct  159  ITLSFHRNLSHRSFKVPKWLEYFFAYCGVQALQ  191


 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL S G+ WHNNHHAF+YSARHGLEWWQLD+TW V++ LQV GLAT+VKLPT  QK++
Sbjct  323  MALLSFGEGWHNNHHAFKYSARHGLEWWQLDMTWCVIKFLQVIGLATEVKLPTEVQKKR  381



>ref|XP_006377890.1| hypothetical protein POPTR_0011s15530g [Populus trichocarpa]
 gb|ERP55687.1| hypothetical protein POPTR_0011s15530g [Populus trichocarpa]
Length=386

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 64/88 (73%), Gaps = 6/88 (7%)
 Frame = +3

Query  291  FWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSY  467
            FW R   S ++A  + +  V     H L LFAPF FTW AF VA G+ IVT +LGI+LS+
Sbjct  109  FWGRKWNSSDIANAAIVSSV-----HFLSLFAPFYFTWPAFWVALGIGIVTGLLGITLSF  163

Query  468  HRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            HRNLSHRSFKLPKWLEYFFAYCGV ALQ
Sbjct  164  HRNLSHRSFKLPKWLEYFFAYCGVQALQ  191


 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LAL + G+ WHNNHHAFEYSARHGLEWWQ+D+TWYVVR LQ  GLATDVKLP+  QK++
Sbjct  323  LALLTFGEGWHNNHHAFEYSARHGLEWWQIDMTWYVVRFLQAIGLATDVKLPSEVQKQR  381



>ref|XP_006465322.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Citrus sinensis]
Length=382

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLG  452
            ++R  F  R   SL+++    ++ +     H L LFAPFCFTW +  VA GLY+VT +LG
Sbjct  100  RRRSLFSGRNWNSLDISTAGVVLAM-----HLLALFAPFCFTWSSLWVALGLYVVTGLLG  154

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LS+HRNLSHRSFKLPKWLEY FAYCGV +LQ
Sbjct  155  ITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQ  187


 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQ+D+TWYVVR LQ  GLATDVKLP+  QK++
Sbjct  319  VALLAFGEGWHNNHHAFEYSARHGLEWWQVDLTWYVVRFLQAVGLATDVKLPSETQKQR  377



>ref|XP_007099502.1| Fatty acid desaturase 5 [Theobroma cacao]
 gb|EOY20528.1| Fatty acid desaturase 5 [Theobroma cacao]
Length=385

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLG  452
            +K+  FW R   + ++A    +V +     H L LFAPF F W AF +A GLY+VT +LG
Sbjct  103  RKKKVFWGRKWNTSDMAIAGVIVSM-----HLLSLFAPFHFNWPAFWLAVGLYVVTGLLG  157

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LS+HRNLSHRSFK+PKWLEYFFAYCGV ALQ
Sbjct  158  ITLSFHRNLSHRSFKVPKWLEYFFAYCGVQALQ  190


 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL S G+ WHNNHHAFEYSA+HGLEWWQLD+ W V++ LQV GLAT+VKLPT  QK++
Sbjct  322  MALLSFGEGWHNNHHAFEYSAKHGLEWWQLDMAWCVIKFLQVIGLATEVKLPTEVQKKR  380



>gb|KDP37076.1| hypothetical protein JCGZ_06132 [Jatropha curcas]
Length=371

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 63/93 (68%), Gaps = 6/93 (6%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLG  452
            ++R  FW R   S+++     ++       H L L APF F W AF VAFGLY VT +LG
Sbjct  89   RERNVFWGRKWNSMDIGTAGVVLAT-----HLLSLLAPFYFNWSAFWVAFGLYCVTGLLG  143

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LS+HRNLSHRSFKLPKWLEY FAYCGV A Q
Sbjct  144  ITLSFHRNLSHRSFKLPKWLEYLFAYCGVQAFQ  176


 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQ+D+TWYVVR LQ  GLATDVK+P   QK++
Sbjct  308  VALLAFGEGWHNNHHAFEYSARHGLEWWQIDMTWYVVRFLQAIGLATDVKIPNEIQKQR  366



>ref|XP_002517641.1| delta 9 desaturase, putative [Ricinus communis]
 gb|EEF44805.1| delta 9 desaturase, putative [Ricinus communis]
Length=386

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 66/93 (71%), Gaps = 6/93 (6%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLG  452
            ++R  F  R    L++A    ++ +     H L LFAPF F W AF VAFGLY++T +LG
Sbjct  104  RERNVFLGRKWNLLDIATAGVVLAM-----HLLSLFAPFYFNWSAFWVAFGLYVITGLLG  158

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LS+HRNLSHRSFKLPKWLEY FAYCGV ALQ
Sbjct  159  ITLSFHRNLSHRSFKLPKWLEYLFAYCGVQALQ  191


 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQ+D+TWYVVR L+  GLATDVK+P   QK+K
Sbjct  323  VALLAFGEGWHNNHHAFEYSARHGLEWWQIDMTWYVVRLLEAIGLATDVKVPNETQKQK  381



>ref|XP_006377886.1| hypothetical protein POPTR_0011s15500g [Populus trichocarpa]
 gb|ERP55683.1| hypothetical protein POPTR_0011s15500g [Populus trichocarpa]
Length=386

 Score =   106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 63/88 (72%), Gaps = 6/88 (7%)
 Frame = +3

Query  291  FWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSY  467
            FW R   S ++A  + +  V     H L LFAPF FTW AF V  GL IVT +LGI+LS+
Sbjct  109  FWGRKWNSSDIANAAIVSSV-----HFLSLFAPFYFTWPAFWVTIGLGIVTGLLGITLSF  163

Query  468  HRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            HRNLSHRSFKLPKWLEYFFAYCGV ALQ
Sbjct  164  HRNLSHRSFKLPKWLEYFFAYCGVQALQ  191


 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LAL + G+ WHNNHHAFEYSARHGLEWWQ+D+TWYVVR LQ  GLATDVKLP+  QK++
Sbjct  323  LALLTFGEGWHNNHHAFEYSARHGLEWWQIDMTWYVVRFLQAIGLATDVKLPSEVQKQR  381



>ref|XP_007214506.1| hypothetical protein PRUPE_ppa016744mg [Prunus persica]
 gb|EMJ15705.1| hypothetical protein PRUPE_ppa016744mg [Prunus persica]
Length=114

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +++ +LG+ WHNNHHAFEYSARHGLEWWQ+DITWYV+R LQ  GLATDVK+PT  QK++
Sbjct  44   MSIITLGEGWHNNHHAFEYSARHGLEWWQIDITWYVIRFLQAIGLATDVKVPTEIQKQR  102



>ref|XP_009772953.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Nicotiana sylvestris]
Length=385

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 74/127 (58%), Gaps = 24/127 (19%)
 Frame = +3

Query  180  NCKEEKYKRL--SPIVCIRPASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVM  353
            N KE  + R+  S +V  RP                R   + R   S+++   + +V + 
Sbjct  84   NGKESNFNRILFSDVVVKRP----------------RDVLFGRQWNSVDLGSAAVVVAM-  126

Query  354  FPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAY  530
                H L L APF F W A  +AFGLYI+T +LGI+LS+HRNLSHRSFKLPKWLEY FAY
Sbjct  127  ----HLLSLLAPFTFNWAAVGIAFGLYIITGLLGITLSFHRNLSHRSFKLPKWLEYLFAY  182

Query  531  CGVHALQ  551
            CGV ALQ
Sbjct  183  CGVQALQ  189


 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQLD+TWYVVR LQ  GLATDVKLPT   K++
Sbjct  321  VALLAFGEGWHNNHHAFEYSARHGLEWWQLDMTWYVVRFLQAIGLATDVKLPTDTHKQR  379



>ref|XP_004152343.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis sativus]
 ref|XP_004165002.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis sativus]
Length=317

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H LC+FAPF F W AF VAF LYI+T + GIS+SYHRNLSH+SFKLPKWLEY FAYCGVH
Sbjct  52   HVLCIFAPFHFNWSAFWVAFVLYILTGLFGISISYHRNLSHKSFKLPKWLEYVFAYCGVH  111

Query  543  ALQ  551
            A+Q
Sbjct  112  AIQ  114


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            ++LPS G+SWHNNHHAFEYSAR G+EWW++DI WYV+  LQ  GLATDVK P+ A  ++
Sbjct  247  ISLPSFGESWHNNHHAFEYSARAGIEWWEVDIGWYVILFLQAIGLATDVKQPSQAHMQR  305



>gb|KGN52905.1| hypothetical protein Csa_4G006120 [Cucumis sativus]
Length=338

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H LC+FAPF F W AF VAF LYI+T + GIS+SYHRNLSH+SFKLPKWLEY FAYCGVH
Sbjct  52   HVLCIFAPFHFNWSAFWVAFVLYILTGLFGISISYHRNLSHKSFKLPKWLEYVFAYCGVH  111

Query  543  ALQ  551
            A+Q
Sbjct  112  AIQ  114


 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            ++LPS G+SWHNNHHAFEYSAR G+EWW++DI WYV+  LQ  GLATDVK P+ A  ++
Sbjct  268  ISLPSFGESWHNNHHAFEYSARAGIEWWEVDIGWYVILFLQAIGLATDVKQPSQAHMQR  326



>emb|CDO98157.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H L LFAPF F W AF +A GLY++T +LGI+LS+HRNLSHRSFKLPKWLEYFFAYCGV 
Sbjct  2    HFLSLFAPFTFNWGAFWIAVGLYVITGLLGITLSFHRNLSHRSFKLPKWLEYFFAYCGVQ  61

Query  543  ALQ  551
            ALQ
Sbjct  62   ALQ  64


 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFE+SARHGLEWWQ+D+TWY VR LQ  GLAT VKLPT +QK++
Sbjct  196  VALLAFGEGWHNNHHAFEHSARHGLEWWQIDVTWYAVRLLQAIGLATAVKLPTESQKQR  254



>ref|XP_007212768.1| hypothetical protein PRUPE_ppa019551mg [Prunus persica]
 gb|EMJ13967.1| hypothetical protein PRUPE_ppa019551mg [Prunus persica]
Length=275

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +3

Query  348  VMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFA  527
            V+F   HCLC+FAPF F W AF VA  LY+ T LGI+LSYHR+L+HRS +LPKWLEYFFA
Sbjct  6    VVFLALHCLCIFAPFHFNWPAFWVAITLYVATGLGITLSYHRSLAHRSLRLPKWLEYFFA  65

Query  528  YCGVHALQVSSYQVTS  575
            YCGV +LQ S  +  S
Sbjct  66   YCGVLSLQGSPIEWVS  81


 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LA+   G+ WHNNHHAFEYSARHGL+WWQ+D TWY +R LQ  GLATDVK+PT  QK++
Sbjct  207  LAIIVFGEGWHNNHHAFEYSARHGLKWWQIDFTWYTIRFLQAIGLATDVKVPTEIQKQR  265



>ref|XP_004152345.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis sativus]
 ref|XP_004165000.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis sativus]
Length=301

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = +3

Query  360  LAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCG  536
              H LC+FAPF F W AF VAF LY++T + GIS+SYHRNL+HRSF LPKWLEY FAYCG
Sbjct  37   FVHLLCIFAPFHFNWSAFWVAFVLYVITGLFGISVSYHRNLAHRSFNLPKWLEYLFAYCG  96

Query  537  VHALQ  551
            VHALQ
Sbjct  97   VHALQ  101


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+ L   G+ WHNNHHAFEYSARHGLEWW++D  WYV+  LQ  G+AT VK+P    K+K
Sbjct  233  LVGLLGFGEGWHNNHHAFEYSARHGLEWWEIDFGWYVIMFLQAIGVATHVKVPLQHHKKK  292



>ref|XP_008454490.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis melo]
Length=252

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = +3

Query  360  LAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCG  536
              H LC+FAPF F W AF VAF LY++T + GIS+SYHRNL+HRSF LPKWLEY FAYCG
Sbjct  36   FVHILCIFAPFHFNWSAFWVAFVLYVITGLFGISISYHRNLAHRSFILPKWLEYLFAYCG  95

Query  537  VHALQ  551
            VHALQ
Sbjct  96   VHALQ  100



>ref|XP_002317667.2| hypothetical protein POPTR_0011s15490g [Populus trichocarpa]
 gb|EEE98279.2| hypothetical protein POPTR_0011s15490g [Populus trichocarpa]
Length=386

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 61/88 (69%), Gaps = 6/88 (7%)
 Frame = +3

Query  291  FWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSY  467
            FW R   S ++     +  V     H L LF PF FTW AF VA G+ IVT +LGI+LS+
Sbjct  109  FWGRKWNSSDIVNAGVISAV-----HFLSLFGPFYFTWPAFWVALGIGIVTGLLGITLSF  163

Query  468  HRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            HRNLSHRSFKLPKWLEYFFAYCGV ALQ
Sbjct  164  HRNLSHRSFKLPKWLEYFFAYCGVQALQ  191


 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LAL + G+ WHNNHHAFEYSARHGLEWWQ+D+TWYVVR LQ  GLATDVKLP+  QK++
Sbjct  323  LALLTFGEGWHNNHHAFEYSARHGLEWWQIDMTWYVVRFLQAIGLATDVKLPSEVQKQR  381



>ref|XP_006297955.1| hypothetical protein CARUB_v10013996mg [Capsella rubella]
 gb|EOA30853.1| hypothetical protein CARUB_v10013996mg [Capsella rubella]
Length=302

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 67/96 (70%), Gaps = 6/96 (6%)
 Frame = +3

Query  267  AKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-  443
             K +++V +W R  K+++       V V+  + H L L APF F W A  VAFGLYIVT 
Sbjct  82   VKKKEKVHWWEREWKAMDFGA----VAVVLSM-HLLSLLAPFQFNWRAVSVAFGLYIVTG  136

Query  444  MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            +LGI+LS+HRNLSH++FKLPKWLEY FAYCG  ALQ
Sbjct  137  LLGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQALQ  172



>ref|XP_006297956.1| hypothetical protein CARUB_v10013996mg [Capsella rubella]
 gb|EOA30854.1| hypothetical protein CARUB_v10013996mg [Capsella rubella]
Length=368

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 67/95 (71%), Gaps = 6/95 (6%)
 Frame = +3

Query  270  KNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-M  446
            K +++V +W R  K+++       V V+  + H L L APF F W A  VAFGLYIVT +
Sbjct  83   KKKEKVHWWEREWKAMDFGA----VAVVLSM-HLLSLLAPFQFNWRAVSVAFGLYIVTGL  137

Query  447  LGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            LGI+LS+HRNLSH++FKLPKWLEY FAYCG  ALQ
Sbjct  138  LGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQALQ  172


 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A  + G+ WHNNHHAFE+SARHGLEWWQLD+TWYVVR LQ  GLATDVKLP+ AQK++
Sbjct  304  VAALAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVRFLQALGLATDVKLPSEAQKQR  362



>gb|ABK95469.1| unknown [Populus trichocarpa]
Length=130

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LAL + G+ WHNNHHAFEYSARHGLEWWQ+D+TWYVVR LQ  GLATDVKLP+  QK++
Sbjct  67   LALLTFGEGWHNNHHAFEYSARHGLEWWQIDMTWYVVRFLQAIGLATDVKLPSEVQKQR  125



>ref|XP_010487426.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like isoform X1 [Camelina sativa]
 ref|XP_010487427.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like isoform X2 [Camelina sativa]
Length=373

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 67/96 (70%), Gaps = 6/96 (6%)
 Frame = +3

Query  267  AKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-  443
             K +++V +W R  K+++       V V+  + H L L APF F W A  VAFGLYIVT 
Sbjct  87   VKKKEKVHWWEREWKAMDFGA----VAVVLSM-HLLSLLAPFQFNWRAVSVAFGLYIVTG  141

Query  444  MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            +LGI+LS+HRNLSH++FKLPKWLEY FAYCG  ALQ
Sbjct  142  LLGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQALQ  177


 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A  + G+ WHNNHHAFE+SARHGLEWWQLDITWYVVR LQ  GLATDVKLP+ AQKR+
Sbjct  309  VAALAFGEGWHNNHHAFEFSARHGLEWWQLDITWYVVRFLQAIGLATDVKLPSEAQKRR  367



>ref|XP_010503522.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Camelina sativa]
Length=373

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 67/95 (71%), Gaps = 6/95 (6%)
 Frame = +3

Query  270  KNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-M  446
            K +++V +W R  K+++       V V+  + H L L APF F W A  VAFGLYIVT +
Sbjct  88   KKKEKVHWWEREWKAMDFGA----VAVVLSM-HLLSLLAPFQFNWRAVSVAFGLYIVTGL  142

Query  447  LGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            LGI+LS+HRNLSH++FKLPKWLEY FAYCG  ALQ
Sbjct  143  LGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQALQ  177


 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A  + G+ WHNNHHAFE+SARHGLEWWQLD+TWYVVR LQ  GLATDVKLP+ AQK++
Sbjct  309  VAALAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVRFLQAIGLATDVKLPSEAQKKR  367



>ref|XP_008454218.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like isoform X2 [Cucumis melo]
Length=299

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H LC+FAPF F W AF VAF LY++T + GIS+SYHRNLSH+SFKLPKWLEY FAYCGVH
Sbjct  38   HVLCIFAPFHFNWSAFWVAFVLYVLTGLFGISISYHRNLSHKSFKLPKWLEYVFAYCGVH  97

Query  543  ALQ  551
            A Q
Sbjct  98   AFQ  100


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            ++L + G+ WHNNHHAFEYSAR G+EWWQ DI WYV+  LQ  GLAT+VKLP+ +   K
Sbjct  237  VSLVTFGEGWHNNHHAFEYSARLGIEWWQFDIGWYVIMFLQAIGLATNVKLPSQSHMHK  295



>ref|XP_008227235.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Prunus mume]
Length=288

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LLALP+LG+ WHNNHHAF+YSAR GLEWWQ+DITWY++R LQV GLATDVK PT  QK++
Sbjct  221  LLALPTLGEGWHNNHHAFDYSARQGLEWWQIDITWYLIRFLQVVGLATDVKTPTETQKKR  280


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 63/94 (67%), Gaps = 5/94 (5%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGI  455
            ++ +EF  R     ++A     + V+F L H L L AP  F+W A  +AF LY+VT LGI
Sbjct  9    KRGIEFMGRQWNLFDIAS----LVVVFSL-HLLALLAPVHFSWGALWLAFALYVVTGLGI  63

Query  456  SLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            +L +HR+L+HRSFKLP+WLEYFF YCGV  LQ S
Sbjct  64   TLGFHRSLAHRSFKLPRWLEYFFVYCGVLTLQGS  97



>ref|XP_008454217.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like isoform X1 [Cucumis melo]
Length=324

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H LC+FAPF F W AF VAF LY++T + GIS+SYHRNLSH+SFKLPKWLEY FAYCGVH
Sbjct  38   HVLCIFAPFHFNWSAFWVAFVLYVLTGLFGISISYHRNLSHKSFKLPKWLEYVFAYCGVH  97

Query  543  ALQ  551
            A Q
Sbjct  98   AFQ  100


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            ++L S G+SWHNNHHAFEYSAR G+EWW++DI WYV+  LQ  GLATDVK P+ A K++
Sbjct  254  ISLLSFGESWHNNHHAFEYSARVGIEWWEVDIGWYVILFLQAIGLATDVKQPSQAHKQR  312



>ref|XP_010097224.1| Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase [Morus 
notabilis]
 gb|EXB67291.1| Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase [Morus 
notabilis]
Length=391

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 61/91 (67%), Gaps = 6/91 (7%)
 Frame = +3

Query  282  RVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML-GIS  458
            R  FW R   SL++     ++       H L LFAPF F W AF VA  LY+VT L GI+
Sbjct  111  RRVFWGRKWNSLDMGTAGVVLAT-----HLLSLFAPFHFNWGAFWVAIALYVVTGLFGIT  165

Query  459  LSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            LS+HRNLSHRSFKLPKWLEY FAYCGV ALQ
Sbjct  166  LSFHRNLSHRSFKLPKWLEYLFAYCGVLALQ  196


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQLD+TW VVR LQ  G ATDVK+P   QK++
Sbjct  328  VALLAFGEGWHNNHHAFEYSARHGLEWWQLDMTWCVVRLLQAIGFATDVKVPNETQKQR  386



>ref|XP_007214509.1| hypothetical protein PRUPE_ppa016543mg, partial [Prunus persica]
 gb|EMJ15708.1| hypothetical protein PRUPE_ppa016543mg, partial [Prunus persica]
Length=291

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LLALP+LGD WHNNHHAF+YSA+ GLEWWQ+DITWY++R LQV GLATDVK PT  QK++
Sbjct  211  LLALPTLGDGWHNNHHAFDYSAQQGLEWWQIDITWYLIRFLQVVGLATDVKTPTETQKKR  270


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +3

Query  387  PFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            P  F+W A  +AF LY+VT LGI+L YHR+L+HRSFKLP+WLEYFFAYCGV  LQ S
Sbjct  31   PVHFSWSALWLAFALYVVTGLGITLGYHRSLAHRSFKLPRWLEYFFAYCGVLTLQGS  87



>ref|XP_006406909.1| hypothetical protein EUTSA_v10020955mg [Eutrema salsugineum]
 dbj|BAJ33684.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48362.1| hypothetical protein EUTSA_v10020955mg [Eutrema salsugineum]
Length=375

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 65/96 (68%), Gaps = 6/96 (6%)
 Frame = +3

Query  267  AKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-  443
             K + +V +W R  K ++       V V+  + H L L APF F W A  VAFGLYIVT 
Sbjct  89   VKKKDKVLWWERKWKPMDFGA----VAVVLSM-HLLSLLAPFQFNWRAVSVAFGLYIVTG  143

Query  444  MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            +LGI+LS+HRNLSH+SFKLPKWLEY FAYCG  ALQ
Sbjct  144  LLGITLSFHRNLSHKSFKLPKWLEYLFAYCGAQALQ  179


 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A  + G+ WHNNHHAFE+SARHGLEWWQLD+TWYVVR LQ  GLATDVKLP+ AQK++
Sbjct  311  VAALAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVRFLQAVGLATDVKLPSEAQKQR  369



>ref|XP_010475329.1| PREDICTED: delta-9 acyl-lipid desaturase 1 [Camelina sativa]
Length=305

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 73/123 (59%), Gaps = 21/123 (17%)
 Frame = +3

Query  186  KEEKYKRLSPIVCIRPASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPL-  362
            KEE +K+++                +A K +K+   W R  K L++      VK    L 
Sbjct  8    KEENHKKMAA--------------DKAEKGRKKRAMWERKWKRLDI------VKAFASLF  47

Query  363  AHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
             H LCL APF FTW A  VA  +Y V  LGI++SYHRNL+HRSFK+PKWLEYFFAYCG+ 
Sbjct  48   VHFLCLLAPFNFTWPALRVALIVYTVGGLGITVSYHRNLAHRSFKVPKWLEYFFAYCGLL  107

Query  543  ALQ  551
            A+Q
Sbjct  108  AIQ  110


 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVKLP+ +Q+R+
Sbjct  242  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSDSQRRR  300



>ref|XP_007214752.1| hypothetical protein PRUPE_ppa024947mg [Prunus persica]
 gb|EMJ15951.1| hypothetical protein PRUPE_ppa024947mg [Prunus persica]
Length=273

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 61/91 (67%), Gaps = 5/91 (5%)
 Frame = +3

Query  285  VEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLS  464
            VEFW R     ++      V V+F   HCLCLFAP  F W AF VA  L ++T LG +LS
Sbjct  13   VEFWGRKWNIQDIC-----VVVVFLALHCLCLFAPLHFNWRAFWVAMALSLLTGLGETLS  67

Query  465  YHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            YHRNL+HRSF LPKWLEY FAYCGV +LQ S
Sbjct  68   YHRNLAHRSFTLPKWLEYSFAYCGVLSLQGS  98


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            + L + G+ WHNNHHAFEYSAR GLEWWQ D TWY+++ LQ  GLATDVK+PT  QK++
Sbjct  207  VTLLTFGEGWHNNHHAFEYSARQGLEWWQFDFTWYIIKFLQAIGLATDVKVPTQIQKQR  265



>ref|XP_011040604.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Populus euphratica]
Length=386

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = +3

Query  291  FWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSY  467
            FW R   S ++     +  V     H L LF PF FTW AF VA G+  VT +LGI+LS+
Sbjct  109  FWGRKWNSSDIVNAGVISAV-----HFLSLFGPFYFTWPAFWVALGIGTVTGLLGITLSF  163

Query  468  HRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            HRNLSHRSFKLPKWLEYFFAYCGV ALQ
Sbjct  164  HRNLSHRSFKLPKWLEYFFAYCGVQALQ  191


 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LAL + G+ WHNNHHAFEYSARHGLEWWQ+D+TWYVVR LQ  GLATDVKLP+  QK++
Sbjct  323  LALLTFGEGWHNNHHAFEYSARHGLEWWQIDMTWYVVRFLQAIGLATDVKLPSEVQKQR  381



>ref|XP_010523152.1| PREDICTED: delta-9 acyl-lipid desaturase 1-like [Tarenaya hassleriana]
Length=262

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 5/99 (5%)
 Frame = +3

Query  255  TPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLY  434
            T +A  + KR +++ R  K L+V     +V V     H LCL APF FTW+A  ++  LY
Sbjct  19   TSEAKTSGKRRQYFRRQWKRLDVIRTMTVVAV-----HLLCLLAPFHFTWEALWLSLMLY  73

Query  435  IVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             V  LG++LSYHRNL+HRSFKLPKWLEY FAY G+ ALQ
Sbjct  74   PVISLGVTLSYHRNLAHRSFKLPKWLEYLFAYIGLFALQ  112


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAF  SARHGLEWWQ+D+TWYV+R L+  GLATDVKLPT +QKR+
Sbjct  197  LSVFSFGESWHNNHHAFGSSARHGLEWWQIDLTWYVIRFLEAVGLATDVKLPTESQKRR  255



>ref|XP_008339469.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Malus domestica]
Length=291

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 61/90 (68%), Gaps = 5/90 (6%)
 Frame = +3

Query  288  EFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSY  467
             FW R    L++A     + V     H LCLFAPF FTW AF VAF L+ VT  G++LSY
Sbjct  17   NFWGREWNLLDIATAGIFLSV-----HVLCLFAPFYFTWTAFWVAFVLFFVTGFGVTLSY  71

Query  468  HRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            HRNL+HRSF+LPK LEY FAYCGV ++Q S
Sbjct  72   HRNLAHRSFRLPKLLEYLFAYCGVLSVQGS  101


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  586  ALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
             L +LG+ WHNNHHAFEYSARHGL+WWQ+D+TWY+++ L+  GLATDVKLP+ A K++
Sbjct  224  GLVALGEGWHNNHHAFEYSARHGLQWWQIDVTWYIIKFLEFLGLATDVKLPSAAHKQR  281



>ref|XP_010485742.1| PREDICTED: delta-9 acyl-lipid desaturase 1-like [Camelina sativa]
Length=305

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 65/99 (66%), Gaps = 7/99 (7%)
 Frame = +3

Query  258  PQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPL-AHCLCLFAPFCFTWDAFVVAFGLY  434
             +A K +K+   W R  K L++      VK    L  H LCL APF FTW A  VA  +Y
Sbjct  18   DKAEKGRKKRAMWERKWKRLDI------VKAFASLFVHFLCLLAPFNFTWPALRVALIVY  71

Query  435  IVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             V  LGI++SYHRNL+HRSFK+PKWLEYFFAYCG+ A+Q
Sbjct  72   TVGGLGITVSYHRNLAHRSFKVPKWLEYFFAYCGLLAIQ  110


 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVKLP+ +Q+R+
Sbjct  242  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSDSQRRR  300



>gb|KGN52902.1| hypothetical protein Csa_4G006090 [Cucumis sativus]
Length=218

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H LC+FAPF FTW+AF VA  LY +T + GI++SYHRNLSH+SF+LPKWLEY FAYCG H
Sbjct  38   HALCIFAPFNFTWNAFWVALILYSITGLFGITISYHRNLSHKSFQLPKWLEYLFAYCGAH  97

Query  543  ALQ  551
            ALQ
Sbjct  98   ALQ  100



>ref|XP_008454222.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis melo]
Length=348

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 71/121 (59%), Gaps = 9/121 (7%)
 Frame = +3

Query  201  KRLSPIVCIRPASDDREDTPQAAKNQKR---VEFWTRMAKSLEVAPGSQMVKVMFPLAHC  371
            K + P    +P   D E   +  K   +     FW R   +L+     + V  +    H 
Sbjct  9    KEVKPHEGHKPLVMDNESKQEEPKEMVKPPVRSFWRRKWTTLD-----KRVAYIISFVHL  63

Query  372  LCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHAL  548
            LC+FAPF F W AF VA  L ++T + G+++SYHRNL+H+SF+LPKWLEY FAYCGVHAL
Sbjct  64   LCIFAPFQFNWSAFRVAVALKVITGLFGMTISYHRNLAHKSFQLPKWLEYLFAYCGVHAL  123

Query  549  Q  551
            Q
Sbjct  124  Q  124


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPT  741
            L+ L S G+ WHNNHHAF YSAR GLEWWQLD  WYV++ LQV GLAT+VKLP+
Sbjct  277  LVGLTSFGEGWHNNHHAFSYSARLGLEWWQLDAGWYVIKFLQVIGLATNVKLPS  330



>ref|XP_004289152.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=216

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 62/94 (66%), Gaps = 5/94 (5%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGI  455
            QK V F  R    +++A       +   + H + L APF FTW AF +   LY VT +GI
Sbjct  9    QKPVYFLGRQWNGVDIAS-----VITLSVVHLIALLAPFYFTWSAFWLGVALYFVTGVGI  63

Query  456  SLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            +LS+HRNL+H+SFKLPKWLEYFFAYC VH+LQ S
Sbjct  64   TLSFHRNLAHKSFKLPKWLEYFFAYCAVHSLQGS  97



>ref|XP_010545760.1| PREDICTED: delta-9 acyl-lipid desaturase 1-like isoform X1 [Tarenaya 
hassleriana]
Length=366

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A+ +LG+ WHNNHHAFE+SAR GLEWWQLD+TWY++R LQV GLATDVKLPT AQKR+
Sbjct  304  VAVIALGEGWHNNHHAFEFSARQGLEWWQLDVTWYIIRFLQVIGLATDVKLPTEAQKRR  362


 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 82/173 (47%), Gaps = 30/173 (17%)
 Frame = +3

Query  45   SPAAKPFFFSLPQSCSPLLREKQTPTSLQSSPLIYTTKL----GQNRFFNCKEEKYKRLS  212
            +P   P F S P S S      + P SL  + L  T ++    G  R  +  EE  +R+ 
Sbjct  26   NPNPNPLFHSKPYSIS-----DRNP-SLSKTILPQTKRIFAICGDGRR-DPWEENQRRI-  77

Query  213  PIVCIRPASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPF  392
                  P SD        A + K+  FW R     +    S++  V     H L L APF
Sbjct  78   ------PFSD-------VAVDGKKRAFWKRRWNYWDATRASEIAWV-----HVLSLLAPF  119

Query  393  CFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             F   A  +A  ++++   GI+LSYHRNL+HRSF LPKWLEY FA CG  A Q
Sbjct  120  HFNLAALRLAVVIHLIAGFGITLSYHRNLAHRSFNLPKWLEYSFALCGTLAGQ  172



>ref|XP_004165001.1| PREDICTED: LOW QUALITY PROTEIN: palmitoyl-monogalactosyldiacylglycerol 
delta-7 desaturase, chloroplastic-like [Cucumis sativus]
Length=355

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H LC+FAPF FTW+AF VA  LY +T L GI++SYHRNLSH+SF+LPKWLEY FAYCG H
Sbjct  23   HALCIFAPFNFTWNAFWVALXLYSITGLFGITISYHRNLSHKSFQLPKWLEYLFAYCGAH  82

Query  543  ALQ  551
            ALQ
Sbjct  83   ALQ  85


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            ++L S G+ WHNNHHAFEYSA++GLEWWQLD  WYV+  L+  G+ATDVKLPT   K++
Sbjct  218  VSLLSFGEGWHNNHHAFEYSAKYGLEWWQLDFGWYVIMFLKAIGVATDVKLPTQCHKQR  276



>ref|XP_010545761.1| PREDICTED: delta-9 acyl-lipid desaturase 1-like isoform X2 [Tarenaya 
hassleriana]
Length=365

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A+ +LG+ WHNNHHAFE+SAR GLEWWQLD+TWY++R LQV GLATDVKLPT AQKR+
Sbjct  303  VAVIALGEGWHNNHHAFEFSARQGLEWWQLDVTWYIIRFLQVIGLATDVKLPTEAQKRR  361


 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 82/173 (47%), Gaps = 30/173 (17%)
 Frame = +3

Query  45   SPAAKPFFFSLPQSCSPLLREKQTPTSLQSSPLIYTTKL----GQNRFFNCKEEKYKRLS  212
            +P   P F S P S S      + P SL  + L  T ++    G  R  +  EE  +R+ 
Sbjct  26   NPNPNPLFHSKPYSIS-----DRNP-SLSKTILPQTKRIFAICGDGRR-DPWEENQRRI-  77

Query  213  PIVCIRPASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPF  392
                  P SD        A + K+  FW R     +    S++  V     H L L APF
Sbjct  78   ------PFSD-------VAVDGKKRAFWKRRWNYWDATRASEIAWV-----HVLSLLAPF  119

Query  393  CFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             F   A  +A  ++++   GI+LSYHRNL+HRSF LPKWLEY FA CG  A Q
Sbjct  120  HFNLAALRLAVVIHLIAGFGITLSYHRNLAHRSFNLPKWLEYSFALCGTLAGQ  172



>ref|XP_007211716.1| hypothetical protein PRUPE_ppa009359mg [Prunus persica]
 gb|EMJ12915.1| hypothetical protein PRUPE_ppa009359mg [Prunus persica]
Length=295

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  351  MFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAY  530
            MF   HCL LFAPF FTW AF+VAF L +VT  GI+LSYHRNL+HRSF++PK LEY FAY
Sbjct  33   MFLSVHCLALFAPFYFTWTAFLVAFWLAVVTGFGITLSYHRNLAHRSFRVPKLLEYLFAY  92

Query  531  CGVHALQVS  557
            CGV AL+ S
Sbjct  93   CGVLALEGS  101


 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L +LG+ WHNNHHAFEYSAR GLEWWQ+D+TWY+++ L+  GLATDVK+P+ A +++
Sbjct  231  LGLVALGEGWHNNHHAFEYSARQGLEWWQIDLTWYIIKFLEALGLATDVKVPSEAHRKR  289



>ref|XP_008227398.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Prunus mume]
Length=299

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 66/96 (69%), Gaps = 5/96 (5%)
 Frame = +3

Query  288  EFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSY  467
            EFW R    L++     +  V+F   HCLC+ APF FTW AF VA  LY+VT LG++LS+
Sbjct  14   EFWGRKWNLLDI-----VTAVVFFSLHCLCVMAPFHFTWPAFRVACALYLVTGLGVTLSF  68

Query  468  HRNLSHRSFKLPKWLEYFFAYCGVHALQVSSYQVTS  575
            HRNL+H+SF++PKWLEY FAY GV +LQ S  +  S
Sbjct  69   HRNLAHKSFRIPKWLEYLFAYFGVLSLQGSPIEWVS  104


 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L +LG+ WHNNHHAF++SAR G EWWQ+D+TWYV+R LQ  GLA DVK PT AQKR+
Sbjct  229  LGLFALGEGWHNNHHAFDFSARQGFEWWQIDVTWYVIRFLQAIGLAKDVKTPTEAQKRR  287



>ref|XP_010457724.1| PREDICTED: delta-9 acyl-lipid desaturase 1-like [Camelina sativa]
Length=305

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 74/123 (60%), Gaps = 21/123 (17%)
 Frame = +3

Query  186  KEEKYKRLSPIVCIRPASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPL-  362
            KEE ++++        A+D  E      K +K+   W R  K L++      VK    L 
Sbjct  8    KEENHRKM--------AADKGE------KGRKKRAMWERKWKRLDI------VKAFASLF  47

Query  363  AHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
             H LCL APF FTW A  VA  +Y V  LGI++SYHRNL+HRSFK+PKWLEYFFAYCG+ 
Sbjct  48   VHFLCLLAPFNFTWPALRVALIIYTVGGLGITVSYHRNLAHRSFKVPKWLEYFFAYCGLL  107

Query  543  ALQ  551
            A+Q
Sbjct  108  AIQ  110


 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVKLP+ +Q+R+
Sbjct  242  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSDSQRRR  300



>ref|XP_010033965.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Eucalyptus grandis]
 gb|KCW53827.1| hypothetical protein EUGRSUZ_J03065 [Eucalyptus grandis]
Length=381

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A+ + G+ WHNNHHAFEYSARHGLEWWQLD+TWYVVR LQV GLATDVKLP  AQK++
Sbjct  314  VAVLAFGEGWHNNHHAFEYSARHGLEWWQLDMTWYVVRLLQVLGLATDVKLPNEAQKQR  372


 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 60/93 (65%), Gaps = 6/93 (6%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML-G  452
            +KR  F  R   SL++     ++ +     H L L APF F+W A  VA  LY+VT L G
Sbjct  95   RKRRVFSGRKWSSLDIGTAGVVLAM-----HLLSLLAPFYFSWSALWVAVSLYVVTGLFG  149

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LS+HRNLSHRSFKL KWLEY FAYCG  ALQ
Sbjct  150  ITLSFHRNLSHRSFKLSKWLEYLFAYCGTLALQ  182



>ref|XP_008347604.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Malus domestica]
Length=297

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+ALP+LG+ WHNNHHAF+YSAR GLEWWQ+DITWYV+  LQV GLATDVK PT  QK++
Sbjct  226  LVALPTLGEGWHNNHHAFDYSARQGLEWWQVDITWYVITILQVAGLATDVKTPTETQKKR  285


 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 62/91 (68%), Gaps = 5/91 (5%)
 Frame = +3

Query  279  KRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGIS  458
            +RVEF  R     ++   + ++ V+  L H L L APF F W AF +   LY +T LG++
Sbjct  9    RRVEFIGRQWNLFDI---TTLIVVL--LFHILSLLAPFYFNWGAFWLFVALYFLTGLGVT  63

Query  459  LSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            L YHR+L+HRSFKLP+WLEYFFAYCGV ALQ
Sbjct  64   LGYHRSLAHRSFKLPRWLEYFFAYCGVLALQ  94



>ref|XP_004295331.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=295

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = +3

Query  297  TRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRN  476
            TR+    E      +  +   L HCL L APF FTW AF V   LY +T LGISL YHRN
Sbjct  7    TRVVLGRECHFIDVVTWITVILLHCLALMAPFQFTWGAFWVFLALYFLTGLGISLGYHRN  66

Query  477  LSHRSFKLPKWLEYFFAYCGVHALQVS  557
            L+HRS KLPKWLEYFFAYCGV  LQ S
Sbjct  67   LAHRSLKLPKWLEYFFAYCGVVTLQGS  93


 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LLALP+LG+ WH+NHH+F++SAR GLEWWQ+D+TWY +R LQVFGLATDVK PT AQK++
Sbjct  223  LLALPTLGEGWHHNHHSFDFSARLGLEWWQIDLTWYFIRFLQVFGLATDVKTPTEAQKKR  282



>ref|XP_010522172.1| PREDICTED: delta-9 acyl-lipid desaturase 1-like [Tarenaya hassleriana]
Length=294

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 65/100 (65%), Gaps = 6/100 (6%)
 Frame = +3

Query  252  DTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGL  431
            + P+   +++R  FW R  K L+V   S     MF   H LCL APF F   A  +A  +
Sbjct  6    EKPERMMSERRA-FWGRKWKRLDVVKAS-----MFLFVHFLCLLAPFHFNRRALRLALAV  59

Query  432  YIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            Y V  LGI++SYHRNL+HRS+KLPKWLEYFFAYCG+ ALQ
Sbjct  60   YTVGGLGITVSYHRNLAHRSYKLPKWLEYFFAYCGLLALQ  99


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY++R L+  GLATDVKLP+ AQ R+
Sbjct  231  LSVFSFGESWHNNHHAFESSARQGLEWWQVDISWYIIRFLETVGLATDVKLPSQAQLRR  289



>ref|XP_008342219.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like, partial [Malus domestica]
Length=213

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 64/101 (63%), Gaps = 5/101 (5%)
 Frame = +3

Query  273  NQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLG  452
             Q RVEF  R    +++      V V+F L HCL L APF F W AF VA  LY V  + 
Sbjct  6    TQWRVEFLGREWNFVDIGS----VVVVFSL-HCLTLLAPFHFNWPAFWVAVALYFVVGVS  60

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQVSSYQVTS  575
            ++LSYHR LSHRSFKLPKWLEYFFAYCGV + Q S  +  S
Sbjct  61   VNLSYHRQLSHRSFKLPKWLEYFFAYCGVLSFQRSPLEWVS  101



>ref|XP_008363691.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Malus domestica]
Length=237

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 64/100 (64%), Gaps = 5/100 (5%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGI  455
            Q RVEF  R    +++      V V+F L HCL L APF F W AF VA  LY V  + +
Sbjct  7    QWRVEFLGREWNFVDIGS----VVVVFSL-HCLTLLAPFHFNWPAFWVAVALYFVVGVSV  61

Query  456  SLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQVSSYQVTS  575
            +LSYHR LSHRSFKLPKWLEYFFAYCGV + Q S  +  S
Sbjct  62   NLSYHRQLSHRSFKLPKWLEYFFAYCGVLSFQRSPLEWVS  101



>ref|NP_172098.1| delta-9 acyl-lipid desaturase 1 [Arabidopsis thaliana]
 sp|O65797.1|ADS1_ARATH RecName: Full=Delta-9 acyl-lipid desaturase 1 [Arabidopsis thaliana]
 gb|AAF80131.1|AC024174_13 Contains a very strong similarity to delta 9 desaturase mRNA 
from Arabidopsis thaliana gb|D88536 and contains a fatty acid 
desaturase PF|01069 domain. EST gb|Z30750 comes from this 
gene [Arabidopsis thaliana]
 gb|AAG48796.1|AF332433_1 putative delta 9 desaturase [Arabidopsis thaliana]
 dbj|BAA25180.1| delta 9 desaturase [Arabidopsis thaliana]
 gb|AEE27937.1| delta-9 acyl-lipid desaturase 1 [Arabidopsis thaliana]
Length=305

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 70/113 (62%), Gaps = 12/113 (11%)
 Frame = +3

Query  231  PASDDREDTPQAAKNQ-----KRVEFWTRMAKSLEVAPGSQMVKVMFPL-AHCLCLFAPF  392
             AS+  E+  + A ++     K+   W R  K L++      VK    L  H LCL APF
Sbjct  4    SASEKEENNKKMAADKAEMGRKKRAMWERKWKRLDI------VKAFASLFVHFLCLLAPF  57

Query  393  CFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             FTW A  VA  +Y V  LGI++SYHRNL+HRSFK+PKWLEYFFAYCG+ A+Q
Sbjct  58   NFTWPALRVALIVYTVGGLGITVSYHRNLAHRSFKVPKWLEYFFAYCGLLAIQ  110


 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVKLP+ +Q+R+
Sbjct  242  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRR  300



>emb|CDY67591.1| BnaC08g46400D [Brassica napus]
Length=197

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+L ++GDSWHNNHHAFE SARHG EWWQ+DITWY++R  ++ GLATDVKLP+  QK+K
Sbjct  132  LSLFTMGDSWHNNHHAFETSARHGFEWWQIDITWYLIRLFEILGLATDVKLPSEFQKQK  190



>dbj|BAC43716.1| putative delta 9 desaturase [Arabidopsis thaliana]
Length=305

 Score =   100 bits (248),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 70/113 (62%), Gaps = 12/113 (11%)
 Frame = +3

Query  231  PASDDREDTPQAAKNQ-----KRVEFWTRMAKSLEVAPGSQMVKVMFPL-AHCLCLFAPF  392
             AS+  E+  + A ++     K+   W R  K L++      VK    L  H LCL APF
Sbjct  4    SASEKEENNKKMAADKAEMGRKKRAMWERKWKRLDI------VKAFASLFVHFLCLLAPF  57

Query  393  CFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             FTW A  VA  +Y V  LGI++SYHRNL+HRSFK+PKWLEYFFAYCG+ A+Q
Sbjct  58   NFTWPALRVALIVYTVGGLGITVSYHRNLAHRSFKVPKWLEYFFAYCGLLAIQ  110


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVKLP+ +Q+R+
Sbjct  242  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRR  300



>gb|AES86572.2| fatty-acid desaturase [Medicago truncatula]
Length=394

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 65/96 (68%), Gaps = 7/96 (7%)
 Frame = +3

Query  267  AKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-  443
             K +K V F+ R   SL++        V+    H LCLFAPF F W AF V+  LY+VT 
Sbjct  102  VKREKEV-FFGRKWNSLDIG-----TFVIVLSMHLLCLFAPFNFNWPAFWVSVALYVVTG  155

Query  444  MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            + GI+ S+HRNLSHRSFKLPKWLEYFFAYCGV ALQ
Sbjct  156  LFGITTSFHRNLSHRSFKLPKWLEYFFAYCGVLALQ  191


 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWW+LD+TWY+V+ LQ  GLATDVK+P+ +QK++
Sbjct  323  VALLAFGEGWHNNHHAFEYSARHGLEWWELDMTWYLVKFLQAIGLATDVKVPSESQKQR  381



>ref|XP_008227081.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Prunus mume]
Length=296

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHA  545
            HCLC+FAPF F W AF VA  LY+ T LGI+L YHR+L+HRS +LPKWLEYFFAYCGV +
Sbjct  31   HCLCVFAPFHFNWPAFWVAITLYVATCLGITLGYHRSLAHRSLRLPKWLEYFFAYCGVLS  90

Query  546  LQVSSYQVTS  575
            LQ S  +  S
Sbjct  91   LQGSPIEWVS  100


 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LA+   G+ WHNNHHAFEYSARHGLEWWQ+D TWY +R LQ  GLATDVK+PT  QK++
Sbjct  226  LAIIVFGEGWHNNHHAFEYSARHGLEWWQIDFTWYTIRFLQAIGLATDVKVPTEFQKQR  284



>ref|XP_006306294.1| hypothetical protein CARUB_v10012159mg [Capsella rubella]
 gb|EOA39192.1| hypothetical protein CARUB_v10012159mg [Capsella rubella]
Length=305

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 64/99 (65%), Gaps = 7/99 (7%)
 Frame = +3

Query  258  PQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPL-AHCLCLFAPFCFTWDAFVVAFGLY  434
             +A K +KR   W R  + L++      VK    L  H LCL APF FTW A  VA  +Y
Sbjct  18   DKAEKGRKRKAMWERKWRRLDI------VKAFASLFVHFLCLLAPFNFTWPALRVALIVY  71

Query  435  IVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             V  LGI++SYHRNL+HRSFK+PKWLEYF AYCG+ A+Q
Sbjct  72   TVGGLGITVSYHRNLAHRSFKVPKWLEYFLAYCGLLAIQ  110


 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVKLP+ +Q+R+
Sbjct  242  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRR  300



>gb|ABS86965.1| delta-9 fatty acid desaturase [Descurainia sophia]
Length=377

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+A+ + GD WHNNHHAFE+SARHGLEWWQ+D+TWY++R L+V GLAT+VKLPT +QK++
Sbjct  311  LVAIMTAGDGWHNNHHAFEFSARHGLEWWQIDVTWYIIRFLEVIGLATNVKLPTESQKKR  370


 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 54/92 (59%), Gaps = 7/92 (8%)
 Frame = +3

Query  279  KRVEFWTRMAKSLEVAPGSQMVKVMFPLA-HCLCLFAPFCFTWDAFVVAFGLYIVTMLGI  455
            K+  FW R     +      M K++  +  H L L APF F W AF V   L I+  + I
Sbjct  95   KKRAFWERNWNYWD------MTKLVIIVGLHLLSLSAPFYFNWTAFRVFLSLAIINGICI  148

Query  456  SLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            +LSYHRNLSHRSF LPKWLEY FAY GV A +
Sbjct  149  TLSYHRNLSHRSFDLPKWLEYLFAYGGVLAFE  180



>ref|XP_004287917.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=307

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 62/94 (66%), Gaps = 5/94 (5%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGI  455
            QK V F  R    +++A       +   + H + L APF FTW AF +   LY VT +G+
Sbjct  9    QKPVYFLGRQWNGVDIAS-----VITLSVVHLIALLAPFYFTWSAFWLGVALYYVTGVGV  63

Query  456  SLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            +LS+HRNL+H+SFKLPKWLEYFFAYC VH+LQ S
Sbjct  64   TLSFHRNLAHKSFKLPKWLEYFFAYCAVHSLQGS  97


 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L  L + G+ WHNNHHAFEYSAR G EWWQ+DITWY++R L++ GLATDVKLPT  QK +
Sbjct  227  LFGLLAHGEGWHNNHHAFEYSARQGFEWWQIDITWYLIRFLEMVGLATDVKLPTELQKNR  286



>gb|ABK25490.1| unknown [Picea sitchensis]
Length=383

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H LCL APF FTW AF V   LY+VT +LGI+LSYHRNLSHRSF+LPKWLEY FAYCGV 
Sbjct  124  HALCLLAPFTFTWKAFGVFAVLYVVTGLLGITLSYHRNLSHRSFRLPKWLEYLFAYCGVQ  183

Query  543  ALQ  551
            A+Q
Sbjct  184  AVQ  186


 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A  + G+ WHNNHHAF+YSARHGLEWWQ D TWYV++ L+  GLA DV+ P    K +
Sbjct  318  VAALAFGEGWHNNHHAFQYSARHGLEWWQFDPTWYVIKILEAVGLAKDVRAPLEQHKTR  376



>gb|AAM12238.1|AF438199_1 desaturase delta 9 [Picea glauca]
Length=382

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H LCL APF FTW AF V   LY+VT +LGI+LSYHRNLSHRSF+LPKWLEY FAYCGV 
Sbjct  123  HALCLLAPFTFTWKAFGVFAVLYVVTGLLGITLSYHRNLSHRSFRLPKWLEYLFAYCGVQ  182

Query  543  ALQ  551
            A+Q
Sbjct  183  AVQ  185


 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A  + G+ WHNNHHAF+YSARHGLEWWQ D TWYV++ L+  GLA DV+ P    K +
Sbjct  317  VAALAFGEGWHNNHHAFQYSARHGLEWWQFDPTWYVIKILEALGLAKDVRAPLEQHKTR  375



>ref|XP_004166509.1| PREDICTED: LOW QUALITY PROTEIN: palmitoyl-monogalactosyldiacylglycerol 
delta-7 desaturase, chloroplastic-like [Cucumis sativus]
Length=280

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  336  QMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTM-LGISLSYHRNLSHRSFKLPKWL  512
            Q+    F   H +C+ APF F W+AF VAF LYI+T   GI++SYHRNLSHRSF+LPKWL
Sbjct  6    QIYGSFFIFLHFICILAPFHFNWNAFWVAFALYIITGCFGITISYHRNLSHRSFRLPKWL  65

Query  513  EYFFAYCGVHALQ  551
            EYFFAYCG  A Q
Sbjct  66   EYFFAYCGALAFQ  78


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            + L S G+ WHNNHHAFEYSAR GLEWWQ+DI+WY++  LQV GLAT+VK+P+ + K++
Sbjct  210  MCLISFGEGWHNNHHAFEYSARQGLEWWQIDISWYIIWFLQVIGLATEVKVPSQSHKQR  268



>ref|XP_004289153.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=307

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 62/94 (66%), Gaps = 5/94 (5%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGI  455
            QK + F  R    +++A       +   + H + L APF FTW AF +   LY VT +G+
Sbjct  9    QKPIYFLGRQWNGVDIAS-----VITLSVVHLIALLAPFYFTWSAFWLGVALYFVTGVGV  63

Query  456  SLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            +LS+HRNL+H+SFKLPKWLEYFFAYC VH+LQ S
Sbjct  64   TLSFHRNLAHKSFKLPKWLEYFFAYCAVHSLQGS  97


 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L  L + G+ WHNNHHAFEYSA+HG EWWQ+DITWY++R L++ GLATDVKLPT  QK +
Sbjct  227  LFGLLAHGEGWHNNHHAFEYSAQHGFEWWQIDITWYLIRFLKMVGLATDVKLPTELQKNR  286



>ref|XP_004305975.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=305

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = +3

Query  282  RVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISL  461
            RVEFW R    +++     +    F   H L L APF FTW AF +A  LY ++ +G++L
Sbjct  12   RVEFWGREWNLVDM-----ITFTSFAFLHFLSLLAPFYFTWTAFWLAIALYFISGVGVTL  66

Query  462  SYHRNLSHRSFKLPKWLEYFFAYCGVHAL  548
            S+HRNLSHRSFKLP+WLEYFFAYCGV +L
Sbjct  67   SFHRNLSHRSFKLPRWLEYFFAYCGVLSL  95


 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+ L + G+ WHNNHHAF++SARHGLEWWQ+D+TWYV+R L++ GLATDVKLPT  QK++
Sbjct  228  LIGLLAHGEGWHNNHHAFQHSARHGLEWWQIDVTWYVIRFLELVGLATDVKLPTETQKKQ  287



>ref|XP_004152344.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis sativus]
Length=294

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H LC+FAPF FTW+AF VA  LY +T + GI++SYHRNLSH+SF+LPKWLEY FAYCG H
Sbjct  38   HALCIFAPFNFTWNAFWVALILYSITGLFGITISYHRNLSHKSFQLPKWLEYLFAYCGAH  97

Query  543  ALQ  551
            ALQ
Sbjct  98   ALQ  100


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            ++L S G+ WHNNHHAFEYSA++GLEWWQLD  WYV+  L+  G+ATDVKLPT   K++
Sbjct  233  VSLLSFGEGWHNNHHAFEYSAKYGLEWWQLDFGWYVIMFLKAIGVATDVKLPTQCHKQR  291



>ref|XP_004304083.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like isoform 1 [Fragaria vesca subsp. 
vesca]
Length=313

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 61/91 (67%), Gaps = 5/91 (5%)
 Frame = +3

Query  285  VEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLS  464
            VEFW R    +++     +    F   H L L APF FTW AF +A  LY +T + ++LS
Sbjct  9    VEFWGREWNFVDM-----VTFTTFAFLHFLSLLAPFYFTWAAFSLAIALYFITGVAVTLS  63

Query  465  YHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            +HRNLSHRSFKLP+WLEYFFAYCGV +LQ S
Sbjct  64   FHRNLSHRSFKLPRWLEYFFAYCGVLSLQRS  94


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+ L + G+ WHNNHHAF++SARHGLEWWQ+D+TWYV+R L++ GLATDVKLPT  QK++
Sbjct  224  LIGLLAHGEGWHNNHHAFQHSARHGLEWWQIDVTWYVIRFLELVGLATDVKLPTETQKKQ  283



>ref|XP_006417959.1| hypothetical protein EUTSA_v10008299mg [Eutrema salsugineum]
 gb|ESQ36312.1| hypothetical protein EUTSA_v10008299mg [Eutrema salsugineum]
Length=304

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 65/101 (64%), Gaps = 7/101 (7%)
 Frame = +3

Query  249  EDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFG  428
            ED  +  + ++ +  W R  K L++   S  + V     H LCL APF FTW A  VA  
Sbjct  16   EDKAEMGRRKRAI--WERKWKRLDIVKASASLFV-----HFLCLLAPFNFTWPALRVALI  68

Query  429  LYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            +Y V  LGI++SYHRNL+HRSFK+PKWLEY FAYCG+ A+Q
Sbjct  69   VYTVGGLGITVSYHRNLAHRSFKVPKWLEYLFAYCGLLAIQ  109


 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVKLP+ +Q+R+
Sbjct  241  LSVFSFGESWHNNHHAFESSARQGLEWWQVDISWYIVRFLEIIGLATDVKLPSESQRRR  299



>ref|XP_008379939.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Malus domestica]
Length=297

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 62/92 (67%), Gaps = 5/92 (5%)
 Frame = +3

Query  282  RVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISL  461
             +EFW R    +++A  + +  +     H L L APF F W AF +A  LY +T +G++L
Sbjct  12   HIEFWGRQWNFVDIATLAGLSYL-----HYLALLAPFHFNWTAFWLAVALYFITGVGVTL  66

Query  462  SYHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            S+HRNLSHRSF LPKWLEYFFAYCGV +LQ S
Sbjct  67   SFHRNLSHRSFILPKWLEYFFAYCGVLSLQRS  98


 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +L L + G+ WHNNHHAFE+SARHG EWWQ+D+TWYV+R LQ   LATDVKLPT  QK++
Sbjct  228  ILGLLTHGEGWHNNHHAFEFSARHGFEWWQIDVTWYVIRFLQAVXLATDVKLPTETQKKR  287



>ref|XP_008365544.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Malus domestica]
Length=297

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 62/92 (67%), Gaps = 5/92 (5%)
 Frame = +3

Query  282  RVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISL  461
             +EFW R    +++A  + +  +     H L L APF F W AF +A  LY +T +G++L
Sbjct  12   HIEFWGRQWNFVDIATLAGLSYL-----HYLALLAPFHFNWTAFWLAVALYFITGVGVTL  66

Query  462  SYHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            S+HRNLSHRSF LPKWLEYFFAYCGV +LQ S
Sbjct  67   SFHRNLSHRSFILPKWLEYFFAYCGVLSLQRS  98


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +L L + G+ WHNNHHAFE+SARHG EWWQ+D+TWYV+R LQ   LATDVKLPT  QK++
Sbjct  228  ILGLLTHGEGWHNNHHAFEFSARHGFEWWQIDVTWYVIRFLQAVALATDVKLPTETQKKR  287



>ref|XP_002889584.1| hypothetical protein ARALYDRAFT_887802 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65843.1| hypothetical protein ARALYDRAFT_887802 [Arabidopsis lyrata subsp. 
lyrata]
Length=305

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 69/113 (61%), Gaps = 12/113 (11%)
 Frame = +3

Query  231  PASDDRED-----TPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPL-AHCLCLFAPF  392
             AS+  E+       +A   +K+   W R  K L++      VK    L  H LCL APF
Sbjct  4    SASEKEENHRKMAADKAEMGRKKRALWERKWKRLDI------VKAFASLFVHFLCLLAPF  57

Query  393  CFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             FTW A  VA  +Y V  LGI++SYHRNL+HRSFK+PKWLEYFFAYCG+ A+Q
Sbjct  58   NFTWPALRVALIVYTVGGLGITVSYHRNLAHRSFKVPKWLEYFFAYCGLLAIQ  110


 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVKLP+ +Q+R+
Sbjct  242  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRR  300



>ref|XP_007213180.1| hypothetical protein PRUPE_ppa026434mg, partial [Prunus persica]
 gb|EMJ14379.1| hypothetical protein PRUPE_ppa026434mg, partial [Prunus persica]
Length=285

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 5/89 (6%)
 Frame = +3

Query  291  FWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYH  470
            FW R    L++     +  V+F   HCLC+ APF FTW AF VA  LY+VT LG++LS+H
Sbjct  1    FWGRKWNLLDI-----VTAVVFFSLHCLCVMAPFHFTWPAFWVACALYLVTGLGVTLSFH  55

Query  471  RNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            RNL+H+SF++PKWLEY FAY GV +LQ S
Sbjct  56   RNLAHKSFRIPKWLEYLFAYFGVLSLQGS  84


 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L +LG+ WHNNHHAF++SAR G EWWQ+D+TWYV+R LQ  GLAT+VK PT AQKR+
Sbjct  215  LGLFALGEGWHNNHHAFDFSARQGFEWWQIDVTWYVIRFLQAIGLATNVKTPTEAQKRR  273



>ref|XP_008379691.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Malus domestica]
Length=312

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 62/94 (66%), Gaps = 5/94 (5%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGI  455
            Q RVEF  R    +++      V V+F L H L L APF FTW AF VA  LY V  + +
Sbjct  7    QWRVEFLGREWNFVDIGS----VVVVFAL-HLLTLLAPFHFTWPAFWVAVALYFVVGVSV  61

Query  456  SLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            +LSYHR LSHRSFKLPKWLEYFFAYCGV + Q S
Sbjct  62   NLSYHRQLSHRSFKLPKWLEYFFAYCGVLSFQRS  95


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+ L + G+ WHNNHHAFE+SARHGLEWW++D+TWYV+R L++ GLAT+V+ PT  QK++
Sbjct  225  LIGLMAHGEGWHNNHHAFEHSARHGLEWWEIDVTWYVIRFLEIIGLATEVQRPTETQKKR  284



>ref|XP_001764456.1| predicted protein [Physcomitrella patens]
 gb|EDQ70723.1| predicted protein [Physcomitrella patens]
Length=292

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H LCLFAP  F+W+A  V  GLY++T MLGI+LSYHRNLSH+SFK+PKWLEY FAYCGV 
Sbjct  36   HGLCLFAPATFSWEAVGVFMGLYVITGMLGITLSYHRNLSHKSFKVPKWLEYTFAYCGVQ  95

Query  543  ALQ  551
            A+Q
Sbjct  96   AVQ  98


 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQLD TW+V+R L+  GLAT VKLP      K
Sbjct  231  VALLAFGEGWHNNHHAFEYSARHGLEWWQLDPTWWVIRGLEAVGLATKVKLPRKDHMEK  289



>ref|XP_004288866.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=307

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 64/96 (67%), Gaps = 9/96 (9%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLA--HCLCLFAPFCFTWDAFVVAFGLYIVTML  449
            QK V F  R    +++A        +F L   H L L APF FTW AF +A  LY VT +
Sbjct  9    QKPVYFLGRQWNFVDIAS-------LFTLGSIHLLALLAPFYFTWSAFWLAVALYYVTGV  61

Query  450  GISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            G++LS+HRNL+H+SFKLPKWLEYFFAYC VH+LQ S
Sbjct  62   GVTLSFHRNLAHKSFKLPKWLEYFFAYCAVHSLQGS  97


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L  L + G+ WHNNHHAFEYSAR G EWWQ+DITWY++R L++ GLATDVKLPT  QK +
Sbjct  227  LFGLLAHGEGWHNNHHAFEYSARQGFEWWQIDITWYLIRFLEIVGLATDVKLPTELQKNR  286



>ref|XP_007216501.1| hypothetical protein PRUPE_ppa024024mg [Prunus persica]
 gb|EMJ17700.1| hypothetical protein PRUPE_ppa024024mg [Prunus persica]
Length=318

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 63/92 (68%), Gaps = 5/92 (5%)
 Frame = +3

Query  282  RVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISL  461
            RV+ + R    +++      V V+F L HCL L APF F   A  +A  LY++T LG++L
Sbjct  21   RVQLFGRQWNFMDIGS----VVVIFGL-HCLALLAPFHFNLSAVWLAMALYVLTGLGVTL  75

Query  462  SYHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            SYHRNLSH+SFKLPKWLEYFFAYCG  ALQ S
Sbjct  76   SYHRNLSHKSFKLPKWLEYFFAYCGTLALQGS  107


 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L  L + G+ WHNNHHAFEYSAR G EWWQ+D+TWYV+R LQ  GLATDVKLPT  QK++
Sbjct  237  LFGLLAHGEGWHNNHHAFEYSARQGFEWWQIDLTWYVIRVLQAVGLATDVKLPTETQKKR  296



>ref|XP_003604375.1| Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase [Medicago 
truncatula]
Length=572

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 65/96 (68%), Gaps = 7/96 (7%)
 Frame = +3

Query  267  AKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTM  446
             K +K V F+ R   SL++        V+    H LCLFAPF F W AF V+  LY+VT 
Sbjct  102  VKREKEV-FFGRKWNSLDIG-----TFVIVLSMHLLCLFAPFNFNWPAFWVSVALYVVTG  155

Query  447  L-GISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            L GI+ S+HRNLSHRSFKLPKWLEYFFAYCGV ALQ
Sbjct  156  LFGITTSFHRNLSHRSFKLPKWLEYFFAYCGVLALQ  191


 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWW+LD+TWY+V+ LQ  GLATDVK+P+ +QK++
Sbjct  323  VALLAFGEGWHNNHHAFEYSARHGLEWWELDMTWYLVKFLQAIGLATDVKVPSESQKQR  381



>emb|CDX75848.1| BnaC03g39310D [Brassica napus]
Length=363

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            ++A  + G+ WHNNHHAFE+SARHGLEWWQLD+TWYVVR LQ  GLATDVKLP+ AQK++
Sbjct  298  MVAALAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVRFLQAIGLATDVKLPSEAQKQR  357


 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H L L APF F W A  VAFGLY+VT +LG++LS+HRNLSH+SFKLPKWLEY FAY G  
Sbjct  115  HVLSLLAPFHFNWRAVSVAFGLYVVTGLLGVTLSFHRNLSHKSFKLPKWLEYLFAYFGAQ  174

Query  543  ALQ  551
            ALQ
Sbjct  175  ALQ  177



>gb|KFK38939.1| hypothetical protein AALP_AA3G179700 [Arabis alpina]
Length=372

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A  + G+ WHNNHHAFEYSARHGLEWWQLD+TWYVVR LQ  GLATDVKLP+ AQK++
Sbjct  308  VAALAFGEGWHNNHHAFEYSARHGLEWWQLDMTWYVVRFLQAIGLATDVKLPSEAQKQR  366


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H L L APF F W A  VAF LYI+T +LG++LS+HRNL+H+SFKLPKWLEY FAYCG  
Sbjct  114  HLLSLLAPFQFNWKAVSVAFVLYIITGLLGVTLSFHRNLTHKSFKLPKWLEYLFAYCGAQ  173

Query  543  ALQ  551
            ALQ
Sbjct  174  ALQ  176



>emb|CDY10193.1| BnaC05g04360D [Brassica napus]
Length=299

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+L ++GDSWHNNHHAFE+SAR GLEWWQ+DITWY++R  +V GLATDVKLP+ +QK+K
Sbjct  236  LSLVTMGDSWHNNHHAFEWSARQGLEWWQIDITWYLIRLFEVLGLATDVKLPSESQKQK  294


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 56/108 (52%), Gaps = 6/108 (6%)
 Frame = +3

Query  228  RPASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWD  407
             P  DD        + +K+  F  R   S ++A    +  V     H  CL APF + W+
Sbjct  3    NPIRDDGSSQSDMVRKEKKPYF-QRYWTSADIARALTVTTV-----HFWCLLAPFNYKWE  56

Query  408  AFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            A      L  VT L I+ SYHRNLSH SFKLPKWLEY FAY  V ALQ
Sbjct  57   ALRFGLILAAVTNLLITFSYHRNLSHGSFKLPKWLEYPFAYAAVFALQ  104



>ref|XP_009119068.1| PREDICTED: delta-9 desaturase-like 5 protein [Brassica rapa]
Length=299

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+L ++GDSWHNNHHAFE+SAR GLEWWQ+DITWY++R  +V GLATDVKLP+ +QK+K
Sbjct  236  LSLVTMGDSWHNNHHAFEWSARQGLEWWQIDITWYLIRLFEVLGLATDVKLPSESQKQK  294


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 56/108 (52%), Gaps = 6/108 (6%)
 Frame = +3

Query  228  RPASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWD  407
             P  DD        + +KR  F  R   S ++A    +  V     H  CL APF + W+
Sbjct  3    NPTRDDGSSQSDMVRKEKRPYF-QRYWTSADIARALTVTTV-----HFWCLLAPFNYKWE  56

Query  408  AFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            A      L  VT L I+ SYHRNLSH SFKLPKWLEY FAY  V ALQ
Sbjct  57   ALRFGLILAAVTNLLITFSYHRNLSHGSFKLPKWLEYPFAYAAVFALQ  104



>ref|XP_006306159.1| hypothetical protein CARUB_v10011680mg [Capsella rubella]
 gb|EOA39057.1| hypothetical protein CARUB_v10011680mg [Capsella rubella]
Length=299

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L ++G+SWHNNHHAFE SARHGLEW+Q+DITWYV+R LQ  GLAT+VKLPT AQKRK
Sbjct  236  LGLLTMGESWHNNHHAFEASARHGLEWYQVDITWYVIRLLQALGLATNVKLPTDAQKRK  294


 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 60/107 (56%), Gaps = 6/107 (6%)
 Frame = +3

Query  231  PASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDA  410
             A  D     +  + QKR     R    ++V   S +  V     H LCL APF F W+A
Sbjct  4    AAKYDGSSQSKPQRKQKRAYI-LRKWTQIDVVRASAVGAV-----HLLCLVAPFNFKWEA  57

Query  411  FVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            F     L +VT L I+LSYHRNL+HRSFKLPKWLEY FAY  + A+Q
Sbjct  58   FWFGAVLNLVTNLSITLSYHRNLTHRSFKLPKWLEYSFAYSALFAIQ  104



>ref|XP_006417958.1| hypothetical protein EUTSA_v10008185mg [Eutrema salsugineum]
 gb|ESQ36311.1| hypothetical protein EUTSA_v10008185mg [Eutrema salsugineum]
Length=328

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L ++G+SWHNNHHAFE SARHGLEW+Q+DITWY++R  Q  GLATDVKLPT AQKRK
Sbjct  265  LGLFTMGESWHNNHHAFEASARHGLEWYQVDITWYLIRFFQALGLATDVKLPTEAQKRK  323


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 59/107 (55%), Gaps = 12/107 (11%)
 Frame = +3

Query  240  DDREDTPQAAKNQKRVEF---WTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDA  410
            D    + +  + +KR      WTR+  +   A G+          H LC+ APF + W+A
Sbjct  8    DGSGSSQKMVRKEKRAYIFRKWTRVDLARASAVGA---------VHFLCILAPFTYKWEA  58

Query  411  FVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             +    L  VT L I+ SYHRNL+HRSFKLPKWLEY FAY  + ALQ
Sbjct  59   LLFGVILAFVTNLSITFSYHRNLTHRSFKLPKWLEYPFAYSALFALQ  105



>gb|AAG28599.1|AF247133_1 delta5 acyl-CoA desaturase [Limnanthes douglasii]
Length=356

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
             +AL + G+ WHNNHHAFE SARHGLEWW++D+TWYV+R LQ  GLAT+VKLPT AQK+K
Sbjct  291  FVALCAFGEGWHNNHHAFEQSARHGLEWWEIDVTWYVIRTLQAIGLATNVKLPTEAQKQK  350


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 61/111 (55%), Gaps = 8/111 (7%)
 Frame = +3

Query  228  RPASD-DREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTW  404
            +P  D +R  T +    +K   FW R     +  P      V   + H L   APF F+W
Sbjct  54   KPKDDLERFRTSEVVLERKAKGFWRR-----KWNPRDIQNAVTLLVLHALAAMAPFYFSW  108

Query  405  DAFVVAFGL--YIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            DAF ++F L  +   +LGI+L +HR L+H  FKLPK +EYFFAYCG  ALQ
Sbjct  109  DAFWISFILLGFASGVLGITLCFHRCLTHGGFKLPKLVEYFFAYCGSLALQ  159



>ref|XP_009146193.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic [Brassica rapa]
Length=374

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 6/95 (6%)
 Frame = +3

Query  270  KNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-M  446
            K   +  +W R   S++    + +V +     H L L APF F W A  VAF LYIVT +
Sbjct  87   KKTDKAVWWEREWTSMDFGAVAVVVSM-----HLLSLLAPFQFNWRAVSVAFVLYIVTGL  141

Query  447  LGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            LGI+LS+HRNL+HRSFKLPKWLEY FAYCG  ALQ
Sbjct  142  LGITLSFHRNLTHRSFKLPKWLEYLFAYCGAQALQ  176


 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A  + G+ WHNNHHAFE+SARHGLEWWQ D+TWYVVR LQ  GLAT+VKLP+ AQK++
Sbjct  308  VAALAFGEGWHNNHHAFEFSARHGLEWWQFDMTWYVVRFLQAIGLATEVKLPSEAQKQR  366



>gb|KGN65118.1| hypothetical protein Csa_1G227450 [Cucumis sativus]
Length=319

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +3

Query  333  SQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTM-LGISLSYHRNLSHRSFKLPKW  509
             + +   F   H +C+ APF F W+AF VAF LYI+T   GI++SYHRNLSHRSF+LPKW
Sbjct  22   DKYMAAFFIFLHFICILAPFHFNWNAFWVAFALYIITGCFGITISYHRNLSHRSFRLPKW  81

Query  510  LEYFFAYCGVHALQ  551
            LEYFFAYCG  A Q
Sbjct  82   LEYFFAYCGALAFQ  95


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            + L S G+ WHNNHHAFEYSAR GLEWWQ+DI+WY++  LQV GLAT+VK+P+ + K++
Sbjct  249  MCLISFGEGWHNNHHAFEYSARQGLEWWQIDISWYIIWFLQVIGLATEVKVPSQSHKQR  307



>emb|CDY30116.1| BnaC05g37460D [Brassica napus]
Length=372

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 6/95 (6%)
 Frame = +3

Query  270  KNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-M  446
            K   +  +W R   S++    + +V +     H L L APF F W A  VAF LYIVT +
Sbjct  87   KKTDKAVWWEREWTSMDFGAVAVVVSM-----HLLSLLAPFQFNWRAVSVAFVLYIVTGL  141

Query  447  LGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            LGI+LS+HRNL+HRSFKLPKWLEY FAYCG  ALQ
Sbjct  142  LGITLSFHRNLTHRSFKLPKWLEYLFAYCGAQALQ  176


 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A  + G+ WHNNHHAFE+SARHGLEWWQ D+TWYVVR LQ  GLAT+VKLP+ AQK++
Sbjct  308  VAALAFGEGWHNNHHAFEFSARHGLEWWQFDMTWYVVRFLQAIGLATEVKLPSEAQKQR  366



>emb|CDY58467.1| BnaA03g57540D [Brassica napus]
Length=370

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            ++A  + G+ WHNNHHAFE+SARHGLEWWQLD+TWYVVR LQ  GLATDVKLP+ AQK++
Sbjct  305  MVAALAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVRFLQAIGLATDVKLPSEAQKQR  364


 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H L L APF F W A  VAFGLY+VT +LG++LS+HRNLSH+SFKLPKWLEY FAY G  
Sbjct  115  HVLSLLAPFHFNWRAVSVAFGLYVVTGLLGVTLSFHRNLSHKSFKLPKWLEYLFAYFGAQ  174

Query  543  ALQ  551
            ALQ
Sbjct  175  ALQ  177



>ref|XP_008373965.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic [Malus domestica]
Length=394

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A+ + G+ WHNNHHAFEYSARHGL+WWQLD+TWYVVR LQ  GLATDVKLPT A K+K
Sbjct  332  VAILAFGEGWHNNHHAFEYSARHGLKWWQLDMTWYVVRFLQAIGLATDVKLPTEAHKQK  390


 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 73/126 (58%), Gaps = 24/126 (19%)
 Frame = +3

Query  189  EEKYKR--LSPIVCIRPASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPL  362
            E K+KR  LS ++  RP               K V F  R    ++VA    +V +    
Sbjct  98   EYKFKRILLSDVIVKRP---------------KNV-FMGRKWIPMDVATAGVVVAM----  137

Query  363  AHCLCLFAPFCFTWDAFVVAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEYFFAYCGV  539
             H L LFAPF F W AF VA  LY+VT L GI+LS+HRNLSH+SFKLPK+LEY FAYCG 
Sbjct  138  -HLLSLFAPFQFNWGAFWVAMALYVVTGLFGITLSFHRNLSHKSFKLPKFLEYLFAYCGS  196

Query  540  HALQVS  557
             ALQ S
Sbjct  197  QALQGS  202



>ref|XP_009135459.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Brassica rapa]
Length=373

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            ++A  + G+ WHNNHHAFE+SARHGLEWWQLD+TWYVVR LQ  GLATDVKLP+ AQK++
Sbjct  308  MVAALAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVRFLQAIGLATDVKLPSEAQKQR  367


 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H L L APF F W A  VAFGLY+VT +LG++LS+HRNLSH+SFKLPKWLEY FAY G  
Sbjct  115  HVLSLLAPFHFNWRAVWVAFGLYVVTGLLGVTLSFHRNLSHKSFKLPKWLEYLFAYFGAQ  174

Query  543  ALQ  551
            ALQ
Sbjct  175  ALQ  177



>ref|XP_008227397.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Prunus mume]
Length=295

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  351  MFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAY  530
            MF   HCL LFAPF FTW AF VAF L  VT  GI+LSYHRNL+HRSF++PK LEY FAY
Sbjct  33   MFLSVHCLALFAPFYFTWTAFWVAFWLAFVTGFGITLSYHRNLAHRSFRVPKLLEYLFAY  92

Query  531  CGVHALQVS  557
            CGV AL+ S
Sbjct  93   CGVLALEGS  101


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L   +LG+ WHNNHHAFEYSAR GLEWWQ+D+TWY+++ L+  GLATDVK+P+ A +++
Sbjct  231  LGFLALGEGWHNNHHAFEYSARQGLEWWQIDLTWYIIKFLEALGLATDVKVPSEAHRQR  289



>ref|XP_004305976.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=303

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 5/92 (5%)
 Frame = +3

Query  282  RVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISL  461
            RV+F  R    +++A  + +        H L L APF FTW AF +A  LY ++ +G++L
Sbjct  12   RVDFLGREWNFVDIATFTSL-----AFLHFLSLLAPFYFTWTAFWLAIALYFISGVGVTL  66

Query  462  SYHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            S+HRNLSHRSFKLP+WLEYFFAYCGV +LQ S
Sbjct  67   SFHRNLSHRSFKLPRWLEYFFAYCGVLSLQRS  98


 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+AL + G+ WHNNHHAF++SARHGLEWWQ+D+TWYV+R L++ GLAT+VKLPT  QK++
Sbjct  228  LIALLAHGEGWHNNHHAFQHSARHGLEWWQIDVTWYVIRFLELVGLATEVKLPTETQKKQ  287



>ref|XP_008454216.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis melo]
Length=319

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H LC+FAPF FTW AF VA  LY VT L GI++SYHRNLSH+SFKLPKWLEY FAYCGV 
Sbjct  38   HALCIFAPFHFTWSAFWVAVVLYSVTSLFGITISYHRNLSHKSFKLPKWLEYLFAYCGVQ  97

Query  543  ALQ  551
            A Q
Sbjct  98   AFQ  100


 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            ++L S G+ WHNNHHAFEYSA++GLEWWQLD  WYV+  L+  G+ATDVKLPT + K +
Sbjct  254  VSLLSFGEGWHNNHHAFEYSAKYGLEWWQLDFGWYVIMFLKAIGVATDVKLPTESHKLR  312



>ref|XP_006305459.1| hypothetical protein CARUB_v10009877mg [Capsella rubella]
 gb|EOA38357.1| hypothetical protein CARUB_v10009877mg [Capsella rubella]
Length=299

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L ++G+SWHNNHHAFE SARHGLEW+Q+DITWY++R  Q  GLATDVKLPT AQKRK
Sbjct  236  LGLFTMGESWHNNHHAFEASARHGLEWYQVDITWYLIRFFQALGLATDVKLPTDAQKRK  294


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 59/107 (55%), Gaps = 12/107 (11%)
 Frame = +3

Query  240  DDREDTPQAAKNQKRVEF---WTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDA  410
            +D     ++ +  KR  F   WTR+      A G+          H LCL APF F W+A
Sbjct  7    EDGTSQSKSLRRGKRAYFFRKWTRIDLMRASAVGA---------VHVLCLLAPFNFKWEA  57

Query  411  FVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
                  L +VT L I+ SYHRNL+HRSFKLPKWLEY FAY  + ALQ
Sbjct  58   LRFGVILAVVTSLSITFSYHRNLTHRSFKLPKWLEYPFAYSALFALQ  104



>ref|XP_009342619.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Pyrus x bretschneideri]
Length=304

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHA  545
            H LCLFAPF FTW AF +AFGL+++T LG++LS+HRNL+H+SF+LPKWLEY FAY  V +
Sbjct  35   HFLCLFAPFYFTWGAFWLAFGLHMLTGLGVTLSFHRNLAHKSFRLPKWLEYLFAYIAVLS  94

Query  546  LQVS  557
            LQ S
Sbjct  95   LQGS  98


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LA+ +LG+ WHNNHHAF+YSAR GLEWWQ+D+TWYV++ LQ  G ATDVK PT +QK++
Sbjct  229  LAIVALGEGWHNNHHAFDYSARQGLEWWQIDLTWYVIKILQAIGWATDVKTPTESQKQR  287



>ref|XP_004291743.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=292

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 62/91 (68%), Gaps = 5/91 (5%)
 Frame = +3

Query  285  VEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLS  464
            V+ W R     ++   + ++ +     H LCLFAPF FTW AF VAF LYI+T LG++L 
Sbjct  14   VQLWGRPWNLQDIGTAATLLAL-----HGLCLFAPFHFTWAAFWVAFALYILTGLGVTLG  68

Query  465  YHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            +HR+L+H+SF+LPKWLEY FAY GV + Q S
Sbjct  69   FHRHLAHKSFQLPKWLEYLFAYLGVLSFQGS  99


 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LL   SLG+ WHNNHHAFE SARHGLEWWQ+D+TWY +RALQ  GLATDVK PT +Q R 
Sbjct  228  LLGWTSLGEGWHNNHHAFENSARHGLEWWQVDLTWYAIRALQAIGLATDVKTPTESQMRS  287



>ref|XP_009341399.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Pyrus x bretschneideri]
Length=304

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHA  545
            H LCLFAPF FTW AF +AFGL+++T LG++LS+HRNL+H+SF+LPKWLEY FAY  V +
Sbjct  35   HFLCLFAPFYFTWGAFWLAFGLHMLTGLGVTLSFHRNLAHKSFRLPKWLEYLFAYIAVLS  94

Query  546  LQVS  557
            LQ S
Sbjct  95   LQGS  98


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LA+ +LG+ WHNNHHAF+YSAR GLEWWQ+D+TWYV++ LQ  G ATDVK PT +QK++
Sbjct  229  LAMVALGEGWHNNHHAFDYSARQGLEWWQIDLTWYVIKILQAIGWATDVKTPTESQKQR  287



>ref|XP_010457725.1| PREDICTED: delta-9 desaturase-like 1 protein [Camelina sativa]
Length=300

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L ++G+SWHNNHHAFE SARHGLEW+Q+DITWY++R  Q  GLATDVKLPT AQKRK
Sbjct  237  LGLFTMGESWHNNHHAFEASARHGLEWYQVDITWYLIRFFQALGLATDVKLPTDAQKRK  295


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 56/98 (57%), Gaps = 12/98 (12%)
 Frame = +3

Query  267  AKNQKRVEF---WTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYI  437
             + +KR  F   WTR+      A G+          H LCL APF F W+A      L I
Sbjct  17   VRREKRAYFFRKWTRIDLMRASAVGA---------VHVLCLLAPFNFKWEALRFGVMLAI  67

Query  438  VTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            VT L I+ SYHRNL+HRSFKLPKWLEY FAY  + ALQ
Sbjct  68   VTSLSITFSYHRNLTHRSFKLPKWLEYPFAYSALFALQ  105



>emb|CDY57820.1| BnaA10g28080D [Brassica napus]
Length=299

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+L ++GDSWHNNHHAFE+SAR GLEWWQ+DITWY++R  +V GLATDVK P+ +QK+K
Sbjct  236  LSLVTMGDSWHNNHHAFEWSARQGLEWWQIDITWYLIRLFEVLGLATDVKFPSESQKQK  294


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 56/108 (52%), Gaps = 6/108 (6%)
 Frame = +3

Query  228  RPASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWD  407
             P  DD        + +KR  F  R   S ++A    +  V     H  CL APF + W+
Sbjct  3    NPTRDDGSSQSDMVRKEKRPYF-QRYWTSADIARALTVTTV-----HFWCLLAPFNYKWE  56

Query  408  AFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            A      L  VT L I+ SYHRNLSH SFKLPKWLEY FAY  V ALQ
Sbjct  57   ALRFGLILAAVTNLLITFSYHRNLSHVSFKLPKWLEYPFAYAAVFALQ  104



>gb|EYU21651.1| hypothetical protein MIMGU_mgv1a008650mg [Erythranthe guttata]
Length=367

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A+ + G+ WHNNHHAFEYSARHGLEWWQ+D TWYV+R L   GLATDVKLPT AQK+K
Sbjct  305  VAMLAFGEGWHNNHHAFEYSARHGLEWWQIDFTWYVIRLLLAVGLATDVKLPTTAQKKK  363


 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 59/82 (72%), Gaps = 6/82 (7%)
 Frame = +3

Query  309  KSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML-GISLSYHRNLSH  485
             SL++A    +V     + H LC +AP  F  +A  VA GLY++T L GI+LS+HRNLSH
Sbjct  97   NSLDIATLGVVV-----VMHLLCFWAPLTFNRNAVSVALGLYVMTGLFGITLSFHRNLSH  151

Query  486  RSFKLPKWLEYFFAYCGVHALQ  551
            RSFKLPKWLEYFFAYCGV ALQ
Sbjct  152  RSFKLPKWLEYFFAYCGVQALQ  173



>ref|XP_007212738.1| hypothetical protein PRUPE_ppa019148mg, partial [Prunus persica]
 gb|EMJ13937.1| hypothetical protein PRUPE_ppa019148mg, partial [Prunus persica]
Length=281

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +3

Query  348  VMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFA  527
            V+F + HCLC+ APF FTW AF VA  LY+VT  G++LS+HRNL+H+SF+LPKWLEY FA
Sbjct  11   VVFFILHCLCVMAPFHFTWPAFWVACALYLVTGFGVTLSFHRNLAHKSFRLPKWLEYLFA  70

Query  528  YCGVHALQVS  557
            Y GV +LQ S
Sbjct  71   YFGVLSLQGS  80


 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L +LG+ WHNNHHAF+YSAR GLEWWQ+D TWYV+R  Q+ GLATDVK PT +QKR+
Sbjct  211  LGLFALGEGWHNNHHAFDYSARQGLEWWQIDFTWYVIRFFQLLGLATDVKTPTESQKRR  269



>ref|XP_010545762.1| PREDICTED: delta-9 desaturase-like 2 protein [Tarenaya hassleriana]
Length=375

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL ++G+ WHNNHHAFE+SARHGLEWWQLD+TWYV+  L+  GLATDVKLPT AQK++
Sbjct  311  IALLTMGEGWHNNHHAFEFSARHGLEWWQLDVTWYVIMFLRAVGLATDVKLPTEAQKQR  369


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 55/91 (60%), Gaps = 5/91 (5%)
 Frame = +3

Query  279  KRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGIS  458
            K+  FW R     ++   +++  V     H L L APF F   A  VA GLY++T+L I+
Sbjct  93   KKRAFWKRWWNYWDLTRATEISYV-----HLLSLLAPFQFNLSALRVALGLYVITILSIT  147

Query  459  LSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            LSYHRNL+HRSF LPKWLEY  A+ G  A Q
Sbjct  148  LSYHRNLAHRSFNLPKWLEYSLAFIGTLAGQ  178



>ref|XP_009110994.1| PREDICTED: delta-9 desaturase-like 4 protein [Brassica rapa]
Length=301

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+L ++GDSWHNNHHAFE SARHG EWWQ+DITWY++R  ++ GLATDVKLP+  QK+K
Sbjct  236  LSLFTMGDSWHNNHHAFETSARHGFEWWQIDITWYLIRLFEILGLATDVKLPSEFQKQK  294


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 59/107 (55%), Gaps = 6/107 (6%)
 Frame = +3

Query  231  PASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDA  410
            P  DD        + +KR  F  R   S +V     M  +   + H LCL APF + W+A
Sbjct  4    PTRDDGSSQSGLVRKEKRAYF-QREWNSFDV-----MSTLTVTIVHLLCLLAPFNYKWEA  57

Query  411  FVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
                  L+ V  LGI+ SYHRNLSHRSFKLPKWLEY FAY  V ALQ
Sbjct  58   LRFGLVLFAVVQLGITFSYHRNLSHRSFKLPKWLEYPFAYSAVFALQ  104



>ref|XP_002993364.1| hypothetical protein SELMODRAFT_45794, partial [Selaginella moellendorffii]
 gb|EFJ05549.1| hypothetical protein SELMODRAFT_45794, partial [Selaginella moellendorffii]
Length=293

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQ D+TWYVVR+LQ  GLAT VKLP+H Q+ K
Sbjct  232  VALLAFGEGWHNNHHAFEYSARHGLEWWQFDMTWYVVRSLQALGLATKVKLPSHEQRVK  290


 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +3

Query  360  LAHCLCLFAPFCFTWDAFVVAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEYFFAYCG  536
            L H  CL APF FTW AF     LY+ T L GI+LSYHRNLSH+SFKLPKWLEY FAYCG
Sbjct  36   LVHGFCLLAPFTFTWGAFGSFVALYVTTGLFGITLSYHRNLSHKSFKLPKWLEYTFAYCG  95

Query  537  VHALQ  551
              A+Q
Sbjct  96   AQAMQ  100



>ref|XP_002882967.1| hypothetical protein ARALYDRAFT_479040 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59226.1| hypothetical protein ARALYDRAFT_479040 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  595  SLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            + G+ WHNNHHAFE+SARHGLEWWQLD+TWYVVR LQ  GLATDVKLP+ AQK++
Sbjct  311  AFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVRFLQAIGLATDVKLPSEAQKQR  365


 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H L L APF F W A  VAFGLYIVT +LGI+LS+HRNLSH++FKLPKWLEY FAYCG  
Sbjct  113  HLLSLLAPFQFNWRAVSVAFGLYIVTGLLGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQ  172

Query  543  ALQ  551
            ALQ
Sbjct  173  ALQ  175



>ref|XP_010475332.1| PREDICTED: delta-9 desaturase-like 1 protein isoform X3 [Camelina 
sativa]
Length=299

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LAL +LG+SWHNNHHAFE SARHGLEW+Q+D+TWY++R  Q  GLAT+VKLPT AQKRK
Sbjct  236  LALFTLGESWHNNHHAFEASARHGLEWYQVDVTWYLIRFFQALGLATNVKLPTDAQKRK  294


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 60/109 (55%), Gaps = 10/109 (9%)
 Frame = +3

Query  231  PASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDA  410
             A  D     ++ + +KR  F+ R     +V   S +V V     H LCL APF F W+A
Sbjct  4    AAKYDGSSQSKSERKEKRA-FFLRKWTQFDVEKASAVVIV-----HLLCLMAPFYFKWEA  57

Query  411  FVVAFGLYIVTMLGI--SLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
              V FG  +   + I  + SYHRNL+HRSFKLPKWLEY  AY  + ALQ
Sbjct  58   --VLFGAILTKAINIFITFSYHRNLTHRSFKLPKWLEYLSAYIALFALQ  104



>ref|XP_002972750.1| hypothetical protein SELMODRAFT_413328 [Selaginella moellendorffii]
 gb|EFJ25971.1| hypothetical protein SELMODRAFT_413328 [Selaginella moellendorffii]
Length=297

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQ D+TWYVVR+LQ  GLAT VKLP+H Q+ K
Sbjct  236  VALLAFGEGWHNNHHAFEYSARHGLEWWQFDMTWYVVRSLQALGLATKVKLPSHEQRVK  294


 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +3

Query  360  LAHCLCLFAPFCFTWDAFVVAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEYFFAYCG  536
            L H  CL APF FTW AF     LY+ T L GI+LSYHRNLSH+SFKLPKWLEY FAYCG
Sbjct  40   LVHGFCLLAPFTFTWGAFGSFAALYVTTGLFGITLSYHRNLSHKSFKLPKWLEYTFAYCG  99

Query  537  VHALQ  551
              A+Q
Sbjct  100  AQAMQ  104



>gb|KFK38940.1| hypothetical protein AALP_AA3G179800 [Arabis alpina]
Length=245

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LA+ +LG+SWHNNHHAFE+SARHGLEWWQLDITWY+VR LQ  GLAT+VK  T A K++
Sbjct  182  LAIVTLGESWHNNHHAFEFSARHGLEWWQLDITWYIVRFLQAIGLATNVKFVTEAHKQR  240


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  417  VAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            +A GL  +   GI+LSYHRNLSHRSF LPKWLEY FA CG  A Q
Sbjct  6    LAVGLSFIAGTGITLSYHRNLSHRSFTLPKWLEYLFALCGTLAFQ  50



>ref|XP_008454221.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis melo]
Length=306

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  360  LAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGV  539
            + H  C+FAPF FTW AF +AF LY+VT L IS+SYHRNL+HRSFKLPK LEYF AYC  
Sbjct  26   IVHIGCIFAPFHFTWHAFCLAFALYVVTGLSISVSYHRNLAHRSFKLPKLLEYFLAYCAA  85

Query  540  HALQ  551
            HALQ
Sbjct  86   HALQ  89


 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++L + G+ WHNNHHAFEYSAR GLEWWQ+D  WY +R LQ  GLA +VKLP+   K++
Sbjct  242  LVSLLAFGEGWHNNHHAFEYSARFGLEWWQIDFGWYTIRVLQAIGLAKNVKLPSTIHKQR  301



>emb|CDY15574.1| BnaA08g28580D [Brassica napus]
Length=301

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+L ++GDSWHNNHHAFE SARHG EWWQ+DITWY++R  ++ GLATDVKLP+  QK+K
Sbjct  236  LSLFTMGDSWHNNHHAFETSARHGFEWWQIDITWYLIRLFEILGLATDVKLPSEFQKQK  294


 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 59/107 (55%), Gaps = 6/107 (6%)
 Frame = +3

Query  231  PASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDA  410
            P  DD        + +KR  F  R   S +V     M  +   + H LCL APF + W+A
Sbjct  4    PTRDDGPSQSGLVRKEKRAYF-QREWNSFDV-----MRTLTVTIVHLLCLLAPFNYKWEA  57

Query  411  FVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
                  L+ V  LGI+ SYHRNLSHRSFKLPKWLEY FAY  V ALQ
Sbjct  58   LRFGLVLFAVVQLGITFSYHRNLSHRSFKLPKWLEYPFAYSAVFALQ  104



>ref|XP_009365434.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic [Pyrus x bretschneideri]
Length=394

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A+ + G+ WHNNHHAFEYSARHGL+WWQLD+TWYVVR LQ  GLATDVKLPT A K++
Sbjct  332  VAILAFGEGWHNNHHAFEYSARHGLKWWQLDMTWYVVRFLQAIGLATDVKLPTEAHKQR  390


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H L LFAPF F W AF VA  LY+VT L GI+LS+HRNLSH+SFKLPK+LEYFFAYCG  
Sbjct  138  HLLSLFAPFQFNWGAFWVAVALYVVTGLFGITLSFHRNLSHKSFKLPKFLEYFFAYCGSQ  197

Query  543  ALQVS  557
            ALQ S
Sbjct  198  ALQGS  202



>ref|XP_002265410.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic [Vitis vinifera]
Length=382

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 59/85 (69%), Gaps = 6/85 (7%)
 Frame = +3

Query  300  RMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRN  476
            R   SL+V     ++ +     H L +FAPF F W AF +A  LY VT +LGI+LSYHRN
Sbjct  103  RKWNSLDVGTAGVILAM-----HFLSVFAPFVFNWSAFWLAMALYAVTGLLGITLSYHRN  157

Query  477  LSHRSFKLPKWLEYFFAYCGVHALQ  551
            LSH+SFKLPKWLEY FAYCGV ALQ
Sbjct  158  LSHKSFKLPKWLEYSFAYCGVQALQ  182


 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            + L + G+ WHNNHHAFEYSARHGLEWWQ+D+TWYVVR LQ  GLATDVKLPT   K++
Sbjct  314  VGLLAFGEGWHNNHHAFEYSARHGLEWWQIDMTWYVVRFLQALGLATDVKLPTELHKQR  372



>ref|XP_009347410.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Pyrus x bretschneideri]
Length=394

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A+ + G+ WHNNHHAFEYSARHGL+WWQLD+TWYVVR LQ  GLATDVKLPT A K++
Sbjct  332  VAILAFGEGWHNNHHAFEYSARHGLKWWQLDMTWYVVRFLQAIGLATDVKLPTEAHKQR  390


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H L LFAPF F W AF VA  LY+VT L GI+LS+HRNLSH+SFKLPK+LEYFFAYCG  
Sbjct  138  HLLSLFAPFQFNWGAFWVAVALYVVTGLFGITLSFHRNLSHKSFKLPKFLEYFFAYCGSQ  197

Query  543  ALQVS  557
            ALQ S
Sbjct  198  ALQGS  202



>ref|XP_010485731.1| PREDICTED: delta-9 desaturase-like 1 protein [Camelina sativa]
Length=299

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L ++G+SWHNNHHAFE SARHGLEW+Q+D+TWY++R  Q  GLATDVKLPT AQKRK
Sbjct  236  LGLFTMGESWHNNHHAFEASARHGLEWYQVDVTWYLIRFFQALGLATDVKLPTDAQKRK  294


 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 59/106 (56%), Gaps = 12/106 (11%)
 Frame = +3

Query  243  DREDTPQAAKNQKRVEF---WTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAF  413
            D     ++ + +KR  F   WTR+      A G         + H LCL APF F W+A 
Sbjct  8    DDSSQSKSLRREKRAYFFRKWTRIDLMRASAVG---------VVHVLCLLAPFNFKWEAL  58

Query  414  VVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
                 L IVT L I+ SYHRNL+HRSFKLPKWLEY FAY  + ALQ
Sbjct  59   QFGVMLAIVTSLSITFSYHRNLTHRSFKLPKWLEYPFAYSALFALQ  104



>ref|XP_008228692.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic [Prunus mume]
Length=395

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGL WWQLD+TWYVVR LQ  GLATDVKLPT A K++
Sbjct  333  VALLAFGEGWHNNHHAFEYSARHGLNWWQLDMTWYVVRFLQAIGLATDVKLPTEAHKQR  391


 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H L LFAPF F W AF VA  LY+VT L GI+LSYHRNLSH+SFKLPKWLEY FAY  V 
Sbjct  139  HLLSLFAPFQFNWGAFWVAVALYVVTGLFGITLSYHRNLSHKSFKLPKWLEYLFAYFAVQ  198

Query  543  ALQVS  557
            ALQ S
Sbjct  199  ALQGS  203



>emb|CDY58470.1| BnaA03g57560D [Brassica napus]
Length=333

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKR  756
            +A+ + G+ WHNNHHAFE+SARHGLEWWQLD+TWY++R L+  GLAT+VKLPT AQKR
Sbjct  272  VAIITFGEGWHNNHHAFEFSARHGLEWWQLDVTWYLIRFLKAIGLATNVKLPTEAQKR  329


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  375  CLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             L+APF F+W AF + F L I+  + I+LSYHRNLSHRSF LPKWLEY FAY GV A Q
Sbjct  82   VLWAPFHFSWAAFRLFFWLVIIKGICITLSYHRNLSHRSFDLPKWLEYLFAYGGVLAFQ  140



>ref|XP_010414136.1| PREDICTED: delta-9 acyl-lipid desaturase 2 isoform X1 [Camelina 
sativa]
 ref|XP_010469700.1| PREDICTED: delta-9 acyl-lipid desaturase 2 [Camelina sativa]
Length=307

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVK+PT AQ+R+
Sbjct  244  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKVPTEAQRRR  302


 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 58/97 (60%), Gaps = 5/97 (5%)
 Frame = +3

Query  261  QAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIV  440
            +  K ++R  FW R  + L+    S        + H L L APF FTW A  V F  Y +
Sbjct  21   EEEKKKRRWVFWDRRWRRLDYVKFSASF-----IVHSLALLAPFYFTWSALWVTFLFYTI  75

Query  441  TMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
              LGI++SYHRNL+HRSFK+PKWLEY  AYC + A+Q
Sbjct  76   GGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQ  112



>ref|XP_010510206.1| PREDICTED: delta-9 acyl-lipid desaturase 2-like [Camelina sativa]
Length=305

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVK+PT AQ+R+
Sbjct  242  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKVPTEAQRRR  300


 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 57/94 (61%), Gaps = 5/94 (5%)
 Frame = +3

Query  270  KNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML  449
            K ++R  FW R  + L+    S        + H L L APF FTW A  V F  Y +  L
Sbjct  22   KKKRRWVFWDRRWRRLDYVKFSASF-----IVHSLALLAPFYFTWSALWVTFLFYTIGGL  76

Query  450  GISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            GI++SYHRNL+HRSFK+PKWLEY  AYC + A+Q
Sbjct  77   GITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQ  110



>ref|XP_010475331.1| PREDICTED: delta-9 desaturase-like 1 protein isoform X2 [Camelina 
sativa]
Length=300

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LAL +LG+SWHNNHHAFE SARHGLEW+Q+D+TWY++R  Q  GLAT+VKLPT AQKRK
Sbjct  237  LALFTLGESWHNNHHAFEASARHGLEWYQVDVTWYLIRFFQALGLATNVKLPTDAQKRK  295


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  270  KNQKRVEF---WTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIV  440
            + +KR  F   WTR+      A G+          H LCL APF F W+A      L IV
Sbjct  18   RREKRAYFFRKWTRIDLMRASAVGA---------VHVLCLLAPFNFKWEALQFGVMLAIV  68

Query  441  TMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            T L I+ SYHRNL+HRSFKLPKWLEY FAY  + ALQ
Sbjct  69   TSLSITFSYHRNLTHRSFKLPKWLEYPFAYSALFALQ  105



>gb|AAK92773.1| putative delta 9 desaturase [Arabidopsis thaliana]
Length=371

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H L L APF F W A  VAFGLYIVT +LGI+LS+HRNLSH++FKLPKWLEY FAYCG  
Sbjct  113  HLLSLLAPFQFNWRAVSVAFGLYIVTGLLGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQ  172

Query  543  ALQ  551
            ALQ
Sbjct  173  ALQ  175


 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A  + G+ WHNNHHAFE+SARHGLEWWQLD+TWYVV+ LQ  GLATDVKLP+ AQK++
Sbjct  307  VAALAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVKFLQAIGLATDVKLPSEAQKQR  365



>ref|NP_566529.1| palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase [Arabidopsis 
thaliana]
 sp|Q949X0.2|ADS3_ARATH RecName: Full=Palmitoyl-monogalactosyldiacylglycerol delta-7 
desaturase, chloroplastic; AltName: Full=FAD5; AltName: Full=Monogalactosyldiacylglycerol-specific 
palmitic acid desaturase; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB02316.1| delta 9 desaturase-like protein [Arabidopsis thaliana]
 gb|AAN41357.1| putative delta 9 desaturase [Arabidopsis thaliana]
 dbj|BAD23903.1| monogalactosyldiacylglycerol-specific palmitic acid desaturase 
[Arabidopsis thaliana]
 gb|AAW51920.1| palmitoyl-monogalactosyldiacylglycerol delta7-desaturase [Arabidopsis 
thaliana]
 gb|AEE75737.1| palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase [Arabidopsis 
thaliana]
Length=371

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H L L APF F W A  VAFGLYIVT +LGI+LS+HRNLSH++FKLPKWLEY FAYCG  
Sbjct  113  HLLSLLAPFQFNWRAVSVAFGLYIVTGLLGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQ  172

Query  543  ALQ  551
            ALQ
Sbjct  173  ALQ  175


 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A  + G+ WHNNHHAFE+SARHGLEWWQLD+TWYVV+ LQ  GLATDVKLP+ AQK++
Sbjct  307  VAALAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVKFLQAIGLATDVKLPSEAQKQR  365



>ref|XP_006294655.1| hypothetical protein CARUB_v10023700mg [Capsella rubella]
 gb|EOA27553.1| hypothetical protein CARUB_v10023700mg [Capsella rubella]
Length=306

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVK+PT AQ+R+
Sbjct  243  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKVPTEAQRRR  301


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 59/99 (60%), Gaps = 5/99 (5%)
 Frame = +3

Query  255  TPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLY  434
            +P   K ++R  FW R  + L+    S        + H L L APF FTW A  V F  Y
Sbjct  18   SPVEEKKKRRWVFWDRRWRRLDYVKFSASF-----IVHSLALLAPFYFTWSALWVTFLFY  72

Query  435  IVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             +  LGI++SYHRNL+HRSFK+PKWLEY  AYC + A+Q
Sbjct  73   TIGGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQ  111



>ref|XP_010414137.1| PREDICTED: delta-9 acyl-lipid desaturase 2 isoform X2 [Camelina 
sativa]
Length=305

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVK+PT AQ+R+
Sbjct  242  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKVPTEAQRRR  300


 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 57/94 (61%), Gaps = 5/94 (5%)
 Frame = +3

Query  270  KNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML  449
            K ++R  FW R  + L+    S        + H L L APF FTW A  V F  Y +  L
Sbjct  22   KKKRRWVFWDRRWRRLDYVKFSASF-----IVHSLALLAPFYFTWSALWVTFLFYTIGGL  76

Query  450  GISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            GI++SYHRNL+HRSFK+PKWLEY  AYC + A+Q
Sbjct  77   GITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQ  110



>ref|XP_004173672.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like, partial [Cucumis sativus]
Length=141

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +3

Query  333  SQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTM-LGISLSYHRNLSHRSFKLPKW  509
             + +  +F   H +C+ APF F W+AF +A   Y++T   GI++SYHRNLSHRSF+LPKW
Sbjct  21   DKYMAALFITMHLICILAPFHFNWNAFWIAVAFYVITGCFGINISYHRNLSHRSFRLPKW  80

Query  510  LEYFFAYCGVHALQ  551
            LEYFFAYCG  A Q
Sbjct  81   LEYFFAYCGTLAFQ  94



>gb|AAM63459.1| putative delta 9 desaturase [Arabidopsis thaliana]
Length=371

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H L L APF F W A  VAFGLYIVT +LGI+LS+HRNLSH++FKLPKWLEY FAYCG  
Sbjct  113  HLLSLLAPFQFNWRAVSVAFGLYIVTGLLGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQ  172

Query  543  ALQ  551
            ALQ
Sbjct  173  ALQ  175


 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A  + G+ WHNNHHAFE+SARHGLEWWQLD+TWYVV+ LQ  GLATDVKLP+ AQK++
Sbjct  307  VAALAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVKFLQAIGLATDVKLPSEAQKQR  365



>ref|XP_001785645.1| predicted protein [Physcomitrella patens]
 gb|EDQ49543.1| predicted protein [Physcomitrella patens]
Length=257

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H LCL AP  F+WDA  V+ GLY++T L GI+LS+HRNLSH+SFKLPKWLEY FAYCGV 
Sbjct  2    HGLCLLAPATFSWDALGVSLGLYVITGLFGITLSFHRNLSHKSFKLPKWLEYSFAYCGVQ  61

Query  543  ALQ  551
            A+Q
Sbjct  62   AVQ  64


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWWQLD TW+++ AL+  G+AT VKLP      K
Sbjct  196  VALLAFGEGWHNNHHAFEYSARHGLEWWQLDPTWWIICALEAVGVATKVKLPKKEHMEK  254



>ref|XP_004303300.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=393

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGL+WWQLD+TWYVVR LQ  GLATDVK+P+  QK++
Sbjct  331  VALLAFGEGWHNNHHAFEYSARHGLDWWQLDMTWYVVRLLQAIGLATDVKVPSEVQKQR  389


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 70/126 (56%), Gaps = 24/126 (19%)
 Frame = +3

Query  189  EEKYKR--LSPIVCIRPASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPL  362
            + KY R  LS ++  RP                R  F  R   ++++A    +V +    
Sbjct  97   QGKYNRILLSDVIVKRP----------------RHVFKGRKWSTMDLATAGVVVGM----  136

Query  363  AHCLCLFAPFCFTWDAFVVAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEYFFAYCGV  539
             H L L APF F W A  VA  LY+VT L GI+LSYHRNLSHRSFKLPKWLEY FAYCG 
Sbjct  137  -HVLSLLAPFQFNWGALWVAVSLYVVTGLFGITLSYHRNLSHRSFKLPKWLEYLFAYCGA  195

Query  540  HALQVS  557
             ALQ S
Sbjct  196  QALQGS  201



>ref|XP_010691134.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Beta vulgaris subsp. vulgaris]
Length=387

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL S G+ WHNNHHAFEYSARHGL+WWQ+D+TWY +R LQV GLA DVKLPT  QK++
Sbjct  319  VALLSFGEGWHNNHHAFEYSARHGLKWWQIDMTWYTIRFLQVIGLAKDVKLPTEVQKQR  377


 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTM-LGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H L +FAPF F W AF VA  LY+ T  LGI+LSYHRNLSHRSFKLPKWLEYFFAYCG  
Sbjct  125  HVLAVFAPFTFNWGAFWVAIVLYLATGCLGITLSYHRNLSHRSFKLPKWLEYFFAYCGAL  184

Query  543  ALQ  551
            ALQ
Sbjct  185  ALQ  187



>ref|XP_008449174.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis melo]
Length=297

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +3

Query  360  LAHCLCLFAPFCFTWDAFVVAFGLYI-VTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCG  536
            + H LC+FAPF F W AF VAF LY+ V + GI+LSYHRNL+H+SFKLPKWLEY FAY G
Sbjct  33   MTHSLCIFAPFHFNWKAFWVAFTLYVLVAIFGITLSYHRNLTHKSFKLPKWLEYSFAYMG  92

Query  537  VHALQ  551
            V ALQ
Sbjct  93   VMALQ  97


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQK  753
            L++L + G+ WHNNHHAFEYSARHGLEWWQLDI WY++  LQ  GLAT+VK PT  QK
Sbjct  228  LVSLVTFGEGWHNNHHAFEYSARHGLEWWQLDIPWYIILCLQALGLATNVKFPTEKQK  285



>ref|XP_010465581.1| PREDICTED: probable lipid desaturase ADS3.2, chloroplastic [Camelina 
sativa]
Length=357

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A+ +LG+ WHNNHHAFE+SARHGLEWWQLD+TWY++R L+  GLAT+VKLPT +QK++
Sbjct  295  VAIFTLGEGWHNNHHAFEFSARHGLEWWQLDVTWYLIRFLEAIGLATNVKLPTESQKKR  353


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 55/92 (60%), Gaps = 5/92 (5%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGI  455
            +K+  FW R     +V   + +  V     H L L APF F+W AF V   +  +  L I
Sbjct  88   RKKRAFWERSWTYWDVIKLAVVSGV-----HLLSLLAPFYFSWAAFWVFTWILYIHSLCI  142

Query  456  SLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            +LSYHRNLSHRSF +PKWLEY FAY G+ A+Q
Sbjct  143  TLSYHRNLSHRSFDMPKWLEYLFAYGGLLAVQ  174



>ref|XP_009135462.1| PREDICTED: probable lipid desaturase ADS3.2, chloroplastic [Brassica 
rapa]
Length=384

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKR  756
            +A+ + G+ WHNNHHAFE+SARHGLEWWQLD+TWY++R L+  GLAT+VKLPT AQKR
Sbjct  323  VAIITFGEGWHNNHHAFEFSARHGLEWWQLDVTWYLIRFLKAIGLATNVKLPTEAQKR  380


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 90/177 (51%), Gaps = 18/177 (10%)
 Frame = +3

Query  57   KPFFFSLPQSCSPL-----LREKQTPTSLQSSPLIYTTKLGQNRFFNCKEEK--YKRLSP  215
            KP+  SL  +  PL       +++ P S  ++   Y T    N   + +     +K+L+ 
Sbjct  21   KPYMASLSTTLKPLASFSPFVKQRNPNSNSNALFTYHTPNSTNYMLSKRGGSVAHKKLT-  79

Query  216  IVCIRPASDDREDTP-----QAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCL  380
             V +  A D  E        +    +++  FW R  K  EV   S+ V V     H L L
Sbjct  80   FVAVHDAPDQVESFSRIPFSEVVVAREKKPFWKRSWKLGEVFKLSRYVVV-----HLLSL  134

Query  381  FAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            +APF F+W AF + F L I+  + I+LSYHRNLSHRSF LPKWLEY FAY GV A Q
Sbjct  135  WAPFHFSWAAFRLFFWLVIIKGICITLSYHRNLSHRSFDLPKWLEYLFAYGGVLAFQ  191



>emb|CDX97710.1| BnaA05g23690D [Brassica napus]
Length=374

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = +3

Query  291  FWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSY  467
            +W R   S++    + +V +     H L L APF F W A  VAF LYIVT +LGI+LS+
Sbjct  94   WWEREWTSMDFGAVAVVVSM-----HLLSLLAPFQFNWRAVSVAFVLYIVTGLLGITLSF  148

Query  468  HRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            HRNL+HRSFKLPKWLEY FAYCG  ALQ
Sbjct  149  HRNLTHRSFKLPKWLEYLFAYCGAQALQ  176


 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A  + G+ WHNNHHAFE+SARHGLEWWQ D+TWYVVR LQ  GLAT+VKLP+ AQK++
Sbjct  308  VAALAFGEGWHNNHHAFEFSARHGLEWWQFDMTWYVVRFLQAIGLATEVKLPSEAQKQR  366



>ref|XP_008443946.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis melo]
Length=318

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  333  SQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTM-LGISLSYHRNLSHRSFKLPKW  509
             + +  +F + H +C+ APF F W+AF VA  LYI+T   GI++SYHRNLSHRSFKLPKW
Sbjct  21   DKYMAALFIIMHSICITAPFHFNWNAFWVAVVLYIITGCFGITISYHRNLSHRSFKLPKW  80

Query  510  LEYFFAYCGVHALQ  551
            LEYFFAYCG  A Q
Sbjct  81   LEYFFAYCGSLAFQ  94


 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            + L S G+ WHNNHHAFEYSA+HGLEWWQ+DI+WY+++ LQV GLAT+VK+P+ + K++
Sbjct  248  MCLFSFGEGWHNNHHAFEYSAKHGLEWWQIDISWYIIQFLQVIGLATEVKVPSQSHKQR  306



>ref|XP_009365113.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Pyrus x bretschneideri]
Length=302

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +L L + G+ WHNNHHAFE+SARHG EWWQ+D+TWYV+R LQ  GLATDVKLPT  QK++
Sbjct  228  ILGLLTHGEGWHNNHHAFEFSARHGFEWWQIDVTWYVIRFLQAVGLATDVKLPTETQKKR  287


 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 5/92 (5%)
 Frame = +3

Query  282  RVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISL  461
             VEFW R    +++A  + +  +     H L L APF F W A  +A  LY +T +G++L
Sbjct  12   HVEFWGRQWNFVDIATLAGLSYL-----HYLALLAPFHFNWTALWLAVALYFITGVGVTL  66

Query  462  SYHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            S+HR LSHRSF LPKWLEYFFAYCGV +LQ S
Sbjct  67   SFHRKLSHRSFNLPKWLEYFFAYCGVLSLQRS  98



>ref|XP_006417932.1| hypothetical protein EUTSA_v10008319mg [Eutrema salsugineum]
 gb|ESQ36285.1| hypothetical protein EUTSA_v10008319mg [Eutrema salsugineum]
Length=299

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ ++G+SWHNNHHAFE SAR GLEWWQ+DITWY++R L+V GLATDVKLP+  QKRK
Sbjct  236  LSIFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLLEVVGLATDVKLPSEFQKRK  294


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 65/111 (59%), Gaps = 7/111 (6%)
 Frame = +3

Query  219  VCIRPASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCF  398
            +C+ P  DD         ++KR+ F+    +   +    +M+ V+  + H LCL APF +
Sbjct  1    MCV-PTGDDGFSQTGVLPDEKRLYFY----RKWPLVDVIRMLTVL--IVHFLCLLAPFNY  53

Query  399  TWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             W+A      +++VT L I+ SYHRNLSHRSFKLPKWLEY  AY  + ALQ
Sbjct  54   NWEALQFGSVVFLVTGLSITFSYHRNLSHRSFKLPKWLEYPCAYSALFALQ  104



>ref|XP_002889586.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65845.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=299

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LAL ++G+SWHNNHHAFE SARHGLEW+QLDITWY++R  Q  GLAT+VKLPT  QKRK
Sbjct  236  LALLTMGESWHNNHHAFEASARHGLEWYQLDITWYLIRFFQALGLATNVKLPTDDQKRK  294


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 58/104 (56%), Gaps = 6/104 (6%)
 Frame = +3

Query  240  DDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVV  419
            DD     ++ + +KR  F  R     +V   S +      + H LCL APF + W+A   
Sbjct  7    DDGSSQNKSVRKEKRAPF-LRKWTQFDVGRASTV-----GIVHLLCLLAPFNYKWEALRF  60

Query  420  AFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
               + IVT L I+ SYHRNL+HRSF LPKWLEY FAY  + ALQ
Sbjct  61   GTIITIVTNLSITFSYHRNLTHRSFTLPKWLEYPFAYSALFALQ  104



>ref|XP_006406907.1| hypothetical protein EUTSA_v10021971mg [Eutrema salsugineum]
 gb|ESQ48360.1| hypothetical protein EUTSA_v10021971mg [Eutrema salsugineum]
Length=356

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  586  ALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            A+ +LG+ WHNNHHAFE+SARHGLEWWQLD+TWY++R L+  GLAT+VKLP+ AQK++
Sbjct  295  AIITLGEGWHNNHHAFEFSARHGLEWWQLDVTWYLIRFLEAIGLATNVKLPSQAQKKR  352


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 55/92 (60%), Gaps = 5/92 (5%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGI  455
            +K+  FW R   S +V+       VMF   H L L AP  F+W AF +   L ++    I
Sbjct  81   RKKCAFWERSWTSWDVSK-----LVMFVGLHLLSLSAPVYFSWAAFRLFLWLAVIIGFCI  135

Query  456  SLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            +LSYHRNLSHRSF LPKWLEY FAY GV + Q
Sbjct  136  TLSYHRNLSHRSFDLPKWLEYLFAYGGVLSFQ  167



>ref|XP_007215498.1| hypothetical protein PRUPE_ppa006843mg [Prunus persica]
 gb|EMJ16697.1| hypothetical protein PRUPE_ppa006843mg [Prunus persica]
Length=393

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H L LFAPF F W AF VA  LY+VT L GI+LSYHRNLSH+SFKLPKWLEY FAYC V 
Sbjct  137  HLLSLFAPFQFNWGAFWVAVALYVVTGLFGITLSYHRNLSHKSFKLPKWLEYLFAYCAVQ  196

Query  543  ALQVS  557
            ALQ S
Sbjct  197  ALQGS  201


 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGL WWQLD+TWYVV+ LQ  GLATDVKLPT A K++
Sbjct  331  VALLAFGEGWHNNHHAFEYSARHGLNWWQLDMTWYVVKFLQAIGLATDVKLPTEAHKQR  389



>gb|KFK42936.1| delta 9 desaturase [Arabis alpina]
Length=305

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVKLP+ +Q+R+
Sbjct  242  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRR  300


 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +3

Query  363  AHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
             H LCL APF FTW A  VA  +Y V  LGI++SYHRNL+HRSFK+PKWLEY FAYCG+ 
Sbjct  48   VHFLCLLAPFNFTWSALRVAIIVYTVGGLGITVSYHRNLAHRSFKIPKWLEYLFAYCGLL  107

Query  543  ALQ  551
            A+Q
Sbjct  108  AIQ  110



>ref|XP_002892337.1| fatty acid desaturase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68596.1| fatty acid desaturase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=299

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+L ++G+SWHNNHHAFE SAR GLEWWQ+DITWY++R  +V GLATDVKLP+  QKRK
Sbjct  236  LSLFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLFEVLGLATDVKLPSEFQKRK  294


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 58/107 (54%), Gaps = 6/107 (6%)
 Frame = +3

Query  231  PASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDA  410
            P  +D      A   +KR      + +    A   + + VM  + H LCL APF + W+A
Sbjct  4    PIREDGSSQRGALSKEKR----PYIHREWSWADIIRALTVM--VVHFLCLLAPFNYKWEA  57

Query  411  FVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
                  LY +T L I+ SYHRNL+HRSFKLPKWLEY  AY  V ALQ
Sbjct  58   LRFGLVLYALTSLSITFSYHRNLAHRSFKLPKWLEYPLAYFAVFALQ  104



>emb|CDY47714.1| BnaA10g04030D [Brassica napus]
Length=303

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 65/102 (64%), Gaps = 9/102 (9%)
 Frame = +3

Query  249  EDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPL-AHCLCLFAPFCFTWDAFVVAF  425
            ED  +  + ++ +  W R  K L++      VK    L  H LCL APF FTW A  VA 
Sbjct  15   EDKAEMRRRKRAI--WERKWKRLDI------VKAFASLFVHFLCLLAPFHFTWPALRVAL  66

Query  426  GLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             +Y V  LGI++SYHRNL+HRSFK+PKWLEY FAYCG+ A+Q
Sbjct  67   VVYTVGGLGITVSYHRNLAHRSFKVPKWLEYLFAYCGLLAIQ  108


 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVKLP+ +Q+R+
Sbjct  240  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRR  298



>ref|XP_009350927.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Pyrus x bretschneideri]
Length=299

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 58/90 (64%), Gaps = 5/90 (6%)
 Frame = +3

Query  288  EFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSY  467
             FW R    L++         MF   H LCLFAPF FTW AF VA  L  VT  G++LSY
Sbjct  17   NFWGRKWNLLDIVTAG-----MFLSVHVLCLFAPFYFTWTAFWVALVLAYVTGFGVTLSY  71

Query  468  HRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            HRNL+HRSF+LPK LEY FAYCGV ++Q S
Sbjct  72   HRNLAHRSFRLPKLLEYSFAYCGVLSVQGS  101


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L +LG+ WHNNHHAFEYSA+HGLEWWQ+D+TWY+++ L+  GLATDVK P+ A K++
Sbjct  231  LGLVALGEGWHNNHHAFEYSAQHGLEWWQIDVTWYIIKFLEALGLATDVKTPSEAHKQR  289



>gb|KGN52908.1| Delta-9 fatty acid desaturase [Cucumis sativus]
Length=341

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +3

Query  354  FPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEYFFAY  530
            F + H LC+FAPF FTW AF +AF LY++T L G++LSYHR+L+H+SFKLPKWLEY FAY
Sbjct  49   FLVMHFLCVFAPFYFTWPAFWLAFVLYVITGLFGLTLSYHRHLTHKSFKLPKWLEYTFAY  108

Query  531  CGVHALQ  551
             GVH LQ
Sbjct  109  IGVHTLQ  115


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +LAL   G+ WHNNHHAFEYSARHGLEWWQLD+TW+V+  LQ  GLATD+KLP+     K
Sbjct  274  VLALLIFGEGWHNNHHAFEYSARHGLEWWQLDVTWWVILFLQAIGLATDLKLPSQHHMHK  333



>ref|XP_008454220.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like isoform X3 [Cucumis melo]
Length=299

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +3

Query  342  VKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEY  518
            V  +F L H LC+FAPF   W AF +   L+ +T + GI++SYHRNLSH+SF++PKWLEY
Sbjct  30   VASVFLLLHLLCIFAPFQINWGAFSICLVLFTITSLFGITISYHRNLSHKSFQIPKWLEY  89

Query  519  FFAYCGVHALQ  551
             FAYCGVHALQ
Sbjct  90   LFAYCGVHALQ  100


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            ++L + G+ WHNNHHAFEYSAR G+EWWQ DI WYV+  LQ  GLAT+VKLP+ +   K
Sbjct  237  VSLVTFGEGWHNNHHAFEYSARLGIEWWQFDIGWYVIMFLQAIGLATNVKLPSQSHMHK  295



>ref|XP_009118557.1| PREDICTED: delta-9 acyl-lipid desaturase 1-like [Brassica rapa]
Length=303

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVKLP+ +Q+R+
Sbjct  240  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRR  298


 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 7/101 (7%)
 Frame = +3

Query  249  EDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFG  428
            ED  +  + ++ +  W R  + L++        V     H LCL APF FTW A  VA  
Sbjct  15   EDKAEMGRRKRAI--WERKWRRLDIVKACASFFV-----HFLCLLAPFNFTWPALRVALV  67

Query  429  LYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            +Y V  LGI++SYHRNL+HRSFK+PKWLEY FAYCG+ A+Q
Sbjct  68   VYTVGGLGITVSYHRNLAHRSFKVPKWLEYLFAYCGLLAIQ  108



>emb|CDY09991.1| BnaC08g44600D [Brassica napus]
Length=303

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVKLP+ +Q+R+
Sbjct  240  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRR  298


 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 7/101 (7%)
 Frame = +3

Query  249  EDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFG  428
            ED  +  + ++ +  W R  + L++        V     H LCL APF FTW A  VA  
Sbjct  15   EDKAEMGRKKRAI--WERKWRRLDIVKAFASFFV-----HFLCLLAPFNFTWPALRVALV  67

Query  429  LYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            +Y V  LGI++SYHRNL+HRSFK+PKWLEY FAYCG+ A+Q
Sbjct  68   VYTVGGLGITVSYHRNLAHRSFKVPKWLEYLFAYCGLLAIQ  108



>ref|XP_004288836.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=297

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LLALP+LG+ WHNNHHAF+YSAR GLEWW++D+TWY +R L+  GLATDV+ PT  QK++
Sbjct  225  LLALPTLGEGWHNNHHAFDYSARQGLEWWEIDLTWYFIRLLEAAGLATDVRTPTETQKKR  284


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHA  545
            HCL L AP  FTWDAF +   LY +T LGI+L YHRNL+HRS KL K LEYFFAYCGV  
Sbjct  32   HCLALLAPSQFTWDAFWLFVVLYFLTSLGITLGYHRNLAHRSLKLRKELEYFFAYCGVLT  91

Query  546  LQVS  557
            LQ S
Sbjct  92   LQGS  95



>emb|CBI36333.3| unnamed protein product [Vitis vinifera]
Length=264

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            + L + G+ WHNNHHAFEYSARHGLEWWQ+D+TWYVVR LQ  GLATDVKLPT   K++
Sbjct  196  VGLLAFGEGWHNNHHAFEYSARHGLEWWQIDMTWYVVRFLQALGLATDVKLPTELHKQR  254


 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVH  542
            H L +FAPF F W AF +A  LY VT +LGI+LSYHRNLSH+SFKLPKWLEY FAYCGV 
Sbjct  2    HFLSVFAPFVFNWSAFWLAMALYAVTGLLGITLSYHRNLSHKSFKLPKWLEYSFAYCGVQ  61

Query  543  ALQ  551
            ALQ
Sbjct  62   ALQ  64



>emb|CDY72496.1| BnaCnng77950D, partial [Brassica napus]
Length=227

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+L ++G+SWHNNHHAFE SAR GLEWWQ+DITWY++R  ++ GLATDVKLP+  QK+K
Sbjct  162  LSLFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLFEILGLATDVKLPSEFQKQK  220



>ref|XP_009113145.1| PREDICTED: probable lipid desaturase ADS3.2, chloroplastic isoform 
X1 [Brassica rapa]
Length=362

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LLA+   G+ WHNNHHAFE+SARHGLEWWQLD+TWY++  L+  GLAT+VKLP+ AQK+K
Sbjct  299  LLAILMFGEGWHNNHHAFEFSARHGLEWWQLDVTWYIISFLEAIGLATNVKLPSDAQKKK  358


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 61/106 (58%), Gaps = 5/106 (5%)
 Frame = +3

Query  237  SDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFV  416
            S  R    +  K +++  FW R   S +V    + V +M    H L L AP  F W AF 
Sbjct  61   SSWRTPLSEDVKGRQKSAFWERSWNSTDV----RNVVIMGGF-HLLSLLAPLYFNWAAFR  115

Query  417  VAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQV  554
            ++  LY +  + I+LSYHRNLSHRSF LPKWLEY FAY GV A QV
Sbjct  116  LSVWLYTIFAICITLSYHRNLSHRSFDLPKWLEYLFAYGGVLAFQV  161



>ref|XP_004152340.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis sativus]
 ref|XP_004165076.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis sativus]
Length=313

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +3

Query  354  FPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAY  530
            F + H LC+FAPF FTW AF +AF LY++T + G++LSYHR+L+H+SFKLPKWLEY FAY
Sbjct  49   FLVMHFLCVFAPFYFTWPAFWLAFVLYVITGLFGLTLSYHRHLTHKSFKLPKWLEYTFAY  108

Query  531  CGVHALQ  551
             GVH LQ
Sbjct  109  IGVHTLQ  115


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +LAL   G+ WHNNHHAFEYSARHGLEWWQLD+TW+V+  LQ  GLATD+KLP+     K
Sbjct  246  VLALLIFGEGWHNNHHAFEYSARHGLEWWQLDVTWWVILFLQAIGLATDLKLPSQHHMHK  305



>ref|XP_009113146.1| PREDICTED: probable lipid desaturase ADS3.2, chloroplastic isoform 
X2 [Brassica rapa]
Length=354

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LLA+   G+ WHNNHHAFE+SARHGLEWWQLD+TWY++  L+  GLAT+VKLP+ AQK+K
Sbjct  291  LLAILMFGEGWHNNHHAFEFSARHGLEWWQLDVTWYIISFLEAIGLATNVKLPSDAQKKK  350


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 60/105 (57%), Gaps = 5/105 (5%)
 Frame = +3

Query  237  SDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFV  416
            S  R    +  K +++  FW R   S +V    + V +M    H L L AP  F W AF 
Sbjct  61   SSWRTPLSEDVKGRQKSAFWERSWNSTDV----RNVVIMGGF-HLLSLLAPLYFNWAAFR  115

Query  417  VAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            ++  LY +  + I+LSYHRNLSHRSF LPKWLEY FAY GV A Q
Sbjct  116  LSVWLYTIFAICITLSYHRNLSHRSFDLPKWLEYLFAYGGVLAFQ  160



>ref|NP_565721.1| 16:0delta9 desaturase 2 [Arabidopsis thaliana]
 sp|Q9SID2.2|ADS2_ARATH RecName: Full=Delta-9 acyl-lipid desaturase 2 [Arabidopsis thaliana]
 dbj|BAA25181.1| delta 9 desaturase [Arabidopsis thaliana]
 gb|AAK76592.1| putative delta 9 desaturase [Arabidopsis thaliana]
 gb|AAL85119.1| putative delta 9 desaturase [Arabidopsis thaliana]
 gb|AAD26482.2| delta 9 desaturase [Arabidopsis thaliana]
 gb|AEC08533.1| 16:0delta9 desaturase 2 [Arabidopsis thaliana]
Length=307

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR  ++ GLATDVK+PT AQ+R+
Sbjct  244  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFFEIIGLATDVKVPTEAQRRR  302


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 60/101 (59%), Gaps = 7/101 (7%)
 Frame = +3

Query  255  TPQAA--KNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFG  428
            TP A   K ++R  FW R  + L+    S    V     H L L APF FTW A  V F 
Sbjct  17   TPAAVEEKKKRRWVFWDRRWRRLDYVKFSASFTV-----HSLALLAPFYFTWSALWVTFL  71

Query  429  LYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             Y +  LGI++SYHRNL+HRSFK+PKWLEY  AYC + A+Q
Sbjct  72   FYTIGGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQ  112



>ref|XP_008367122.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Malus domestica]
Length=148

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            + L + G+ WHNNHHAFE+ ARHGLEWWQ+DITWYV+R L+  GLATDVKLPT  QK +
Sbjct  68   IGLLAHGEGWHNNHHAFEHXARHGLEWWQIDITWYVIRFLEAVGLATDVKLPTETQKNR  126



>ref|XP_009119090.1| PREDICTED: delta-9 acyl-lipid desaturase 1 [Brassica rapa]
Length=303

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLATDVKLP+ +Q+R+
Sbjct  240  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRR  298


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 64/102 (63%), Gaps = 9/102 (9%)
 Frame = +3

Query  249  EDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPL-AHCLCLFAPFCFTWDAFVVAF  425
            ED  +  + ++ +  W R  K L++      VK    L  H LCL APF FTW A  VA 
Sbjct  15   EDKAEMGRRKRAI--WERKWKRLDI------VKAFASLFVHFLCLLAPFHFTWPALRVAL  66

Query  426  GLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             +Y V  LGI++SYHRNL+HRSFK+PKWLEY FAY G+ A+Q
Sbjct  67   VVYTVGGLGITVSYHRNLAHRSFKVPKWLEYLFAYFGLLAIQ  108



>ref|XP_008230150.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Prunus mume]
Length=177

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L  L + G+ WHNNHHAF+YSAR GLEWWQ+D TWY++R LQ  GLAT+VKLPT AQK++
Sbjct  91   LFGLLAHGEGWHNNHHAFDYSARQGLEWWQIDTTWYLIRFLQALGLATEVKLPTEAQKKR  150



>ref|XP_002881171.1| hypothetical protein ARALYDRAFT_482064 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57430.1| hypothetical protein ARALYDRAFT_482064 [Arabidopsis lyrata subsp. 
lyrata]
Length=305

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR  ++ GLATDVK+PT AQ+R+
Sbjct  242  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFFEIIGLATDVKVPTEAQRRR  300


 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 59/99 (60%), Gaps = 5/99 (5%)
 Frame = +3

Query  255  TPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLY  434
            TP   K ++R  FW R  + L+    S    V     H L L APF FTW A  V F  Y
Sbjct  17   TPPEEKKKRRWVFWDRRWRRLDYVKFSASFTV-----HSLALLAPFYFTWSALWVTFLFY  71

Query  435  IVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             +  LGI++SYHRNL+HRSFK+PKWLEY  AYC + A+Q
Sbjct  72   TIGGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQ  110



>ref|XP_008227399.1| PREDICTED: delta-9 acyl-lipid desaturase 1-like [Prunus mume]
Length=298

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  351  MFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAY  530
            +F   HCLC+ APF FTW AF VA  LY+VT +G++LS+HR+L+HRSF++PKWLEY FAY
Sbjct  30   VFLTMHCLCVMAPFHFTWPAFWVAVALYVVTGVGVTLSFHRHLAHRSFRIPKWLEYLFAY  89

Query  531  CGVHALQVS  557
             GV +LQ S
Sbjct  90   FGVLSLQGS  98


 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L +LG+ WHNNHHAF+YSAR G EWWQ+D+TWYV+R L+  GLATDVK PT AQK +
Sbjct  228  LGLLALGEGWHNNHHAFDYSARQGFEWWQIDVTWYVIRFLEAIGLATDVKTPTEAQKER  286



>emb|CDX86526.1| BnaC08g01770D [Brassica napus]
Length=301

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ ++GDSWHNNHHAF+ SAR GLEWWQ+DITWY++R  +V GLATDVKLPT  QK+K
Sbjct  236  LSIFTMGDSWHNNHHAFQSSARQGLEWWQIDITWYLIRLFEVLGLATDVKLPTEYQKQK  294


 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 58/107 (54%), Gaps = 6/107 (6%)
 Frame = +3

Query  231  PASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDA  410
            P  DD        + + R  F  R   S +V     M  +   + H LCL APF + W+A
Sbjct  4    PTRDDGSSQSGLVRKENRAYF-QREWNSFDV-----MRTLTVTIVHLLCLLAPFNYKWEA  57

Query  411  FVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
                  L+ V  LGI+ SYHRNLSHRSFKLPKWLEY FAY  V ALQ
Sbjct  58   LRFGLVLFAVVQLGITFSYHRNLSHRSFKLPKWLEYPFAYSAVFALQ  104



>emb|CDY30120.1| BnaC05g37420D [Brassica napus]
Length=366

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 73/137 (53%), Gaps = 19/137 (14%)
 Frame = +3

Query  180  NCKEEKYKRLSPIVCIRP---ASDDREDTPQAAKNQKRV----------EFWTRMAKSLE  320
            N K    KRL  + C +P   A D   +T    ++ ++V           FW R     +
Sbjct  41   NSKLHFTKRLV-VACKKPTFTAEDALRETTLTEESHRKVPFSEVVRKKRVFWERRWNYWD  99

Query  321  VAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKL  500
            V+    ++ V     H L L+APF F W AF VA GL ++   GI+LSYHRNLSHRSF L
Sbjct  100  VSRAIGILGV-----HLLSLYAPFHFNWSAFRVAVGLSVIAGTGITLSYHRNLSHRSFVL  154

Query  501  PKWLEYFFAYCGVHALQ  551
            PKWLEY FA+CG  A Q
Sbjct  155  PKWLEYLFAWCGTLAFQ  171


 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LA+ +LG+SWHNNHHAFE+SARHGLEWWQ+DITWY +R LQ  GLAT+VKL T A K++
Sbjct  303  LAIVTLGESWHNNHHAFEFSARHGLEWWQIDITWYFIRLLQALGLATNVKLVTEAHKQR  361



>ref|XP_008230049.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Prunus mume]
Length=302

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+ L + G+ WHNNHHAFEYSA+HG EWWQ+DITWY++R LQ  GLATDVKLPT  QK++
Sbjct  228  LIGLMAHGEGWHNNHHAFEYSAQHGFEWWQIDITWYLIRFLQAVGLATDVKLPTETQKKR  287


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 62/92 (67%), Gaps = 5/92 (5%)
 Frame = +3

Query  282  RVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISL  461
             VEF  R    +++A  + +V +     H L + APF FTW AF  A  LY ++ +G++L
Sbjct  12   HVEFMGRQWNFVDLATLAGLVYL-----HYLAVLAPFYFTWPAFRSAVALYYISGVGVTL  66

Query  462  SYHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            S+HRNLSH+SFKLPKWLEYFFAYCGV + Q S
Sbjct  67   SFHRNLSHKSFKLPKWLEYFFAYCGVLSFQRS  98



>ref|XP_007207066.1| hypothetical protein PRUPE_ppa026616mg, partial [Prunus persica]
 gb|EMJ08265.1| hypothetical protein PRUPE_ppa026616mg, partial [Prunus persica]
Length=297

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  348  VMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFA  527
            V     H L L APF F W AF +A  LY +T LG++LSYHR LSHRSFKLPKWLEYFFA
Sbjct  11   VFLSTLHVLVLLAPFHFNWRAFWLAVALYCLTGLGVTLSYHRQLSHRSFKLPKWLEYFFA  70

Query  528  YCGVHALQVS  557
            YCGV ++Q S
Sbjct  71   YCGVLSVQGS  80


 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +  L + G+ WHNNHHAF+YSARHG EWW++D+TWYV+R L++ GLATDVKLP+  QK++
Sbjct  210  VFGLLTHGEGWHNNHHAFQYSARHGFEWWEVDVTWYVIRFLEIVGLATDVKLPSETQKKR  269



>ref|XP_007214141.1| hypothetical protein PRUPE_ppa018402mg, partial [Prunus persica]
 gb|EMJ15340.1| hypothetical protein PRUPE_ppa018402mg, partial [Prunus persica]
Length=280

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L +LG+ WHNNHHAF+YSAR GLEWWQ+D+TWYV+R L+  GLATDVK PT AQK +
Sbjct  210  LGLLALGEGWHNNHHAFDYSARQGLEWWQIDVTWYVIRFLEAIGLATDVKTPTEAQKER  268


 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  351  MFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAY  530
            +F   HCLC+ APF FTW A  VAF LY VT +G++LS+HR+L+HRSF++PKWLEY FAY
Sbjct  12   VFLTMHCLCVMAPFHFTWPALWVAFALYAVTGVGVTLSFHRHLAHRSFRIPKWLEYLFAY  71

Query  531  CGVHALQVS  557
             GV +LQ S
Sbjct  72   FGVLSLQGS  80



>ref|XP_009338528.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Pyrus x bretschneideri]
Length=299

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L +LG+ WHNNHHAFEYSARHGLEWWQ+D+TWY+++ L+  GLATDVK PT A K++
Sbjct  231  LGLVALGEGWHNNHHAFEYSARHGLEWWQIDVTWYLIKFLEALGLATDVKTPTEAHKQR  289


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 57/89 (64%), Gaps = 5/89 (6%)
 Frame = +3

Query  291  FWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYH  470
            FW R    L++         MF   H LCLFAPF FTW AF +   L  VT  G++LSYH
Sbjct  18   FWGRKWNLLDIVTAG-----MFLSVHVLCLFAPFYFTWTAFWLMLVLGYVTGFGVTLSYH  72

Query  471  RNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            RNL+HRSF+LPK LEY FAYCGV ++Q S
Sbjct  73   RNLAHRSFRLPKLLEYLFAYCGVLSVQGS  101



>emb|CDY30117.1| BnaC05g37450D [Brassica napus]
Length=302

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +A+ +LGD WHNNHHAF++SARHGLEWWQLD+TW ++R L+  GLAT+VKLPT AQK++
Sbjct  240  VAILTLGDGWHNNHHAFQFSARHGLEWWQLDVTWCLIRFLEAIGLATNVKLPTEAQKKR  298


 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 55/92 (60%), Gaps = 5/92 (5%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGI  455
            +K+  F  R   S +V    ++V V     H L L APF F W AF +   L ++  + I
Sbjct  27   RKKSAFLERSWNSRDVRKLVRVVGV-----HLLSLLAPFHFNWSAFKLCLWLSVIIGICI  81

Query  456  SLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            +LSYHRNLSHRSF LPKWLEY FAY GV A Q
Sbjct  82   TLSYHRNLSHRSFNLPKWLEYLFAYGGVLAFQ  113



>emb|CDY47715.1| BnaA10g04040D [Brassica napus]
Length=297

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LA  ++G+SWHNNHHAFE SARHGLEW+QLDITWY++R  Q   LATDVKLP+ AQKRK
Sbjct  236  LAPVTMGESWHNNHHAFEASARHGLEWYQLDITWYLIRFFQALSLATDVKLPSEAQKRK  294


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 6/97 (6%)
 Frame = +3

Query  261  QAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIV  440
            +A + +KR  F+ R   S+++     +V V     H LC+ APF + W+A +  F L  V
Sbjct  14   KAMRKEKRAYFF-RKWTSVDLMRALSVVAV-----HLLCVMAPFNYKWEALLFGFILAAV  67

Query  441  TMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            T L I+ SYHRNL+H+SFKLPKWLEY FAY  + ALQ
Sbjct  68   TNLSITFSYHRNLTHKSFKLPKWLEYPFAYSALFALQ  104



>ref|XP_008365464.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Malus domestica]
Length=321

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L  L + G+ WHNNHHAFEYSAR GLEWWQ+D+TWYV+R LQ  GLATDVKLPT  QK++
Sbjct  238  LFGLLAHGEGWHNNHHAFEYSARQGLEWWQVDLTWYVIRFLQAVGLATDVKLPTEIQKKR  297


 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHA  545
            H L L APF F   A  +A  LY++T LG++LSYHRNLSH+SFKLPKWLEY FAYCGV +
Sbjct  45   HFLALLAPFHFNGSAVWLAMALYVITGLGVTLSYHRNLSHKSFKLPKWLEYSFAYCGVLS  104

Query  546  LQVS  557
            LQ S
Sbjct  105  LQGS  108



>ref|XP_009119089.1| PREDICTED: delta-9 desaturase-like 1 protein [Brassica rapa]
Length=297

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LA  ++G+SWHNNHHAFE SARHGLEW+QLDITWY++R  Q   LATDVKLP+ AQKRK
Sbjct  236  LAPVTMGESWHNNHHAFEASARHGLEWYQLDITWYLIRFFQALSLATDVKLPSEAQKRK  294


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 6/97 (6%)
 Frame = +3

Query  261  QAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIV  440
            +A + +KR  F+ R   S+++     +V V     H LC+ APF + W+A +  F L  V
Sbjct  14   KAMRKEKRAYFF-RKWTSVDLMRALSVVAV-----HLLCVLAPFNYKWEALLFGFILAAV  67

Query  441  TMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            T L I+ SYHRNL+H+SFKLPKWLEY FAY  + ALQ
Sbjct  68   TNLSITFSYHRNLTHKSFKLPKWLEYPFAYSALFALQ  104



>ref|NP_172100.1| delta-9 desaturase-like 2 protein [Arabidopsis thaliana]
 sp|Q9LND8.1|ADSL2_ARATH RecName: Full=Delta-9 desaturase-like 2 protein [Arabidopsis 
thaliana]
 gb|AAF80133.1|AC024174_15 Contains similarity to delta 9 desaturase mRNA and contains a 
fatty acid desaturase PF|01069 domain [Arabidopsis thaliana]
 gb|AAT47784.1| At1g06100 [Arabidopsis thaliana]
 gb|AAU94398.1| At1g06100 [Arabidopsis thaliana]
 gb|AEE27939.1| delta-9 desaturase-like 2 protein [Arabidopsis thaliana]
Length=299

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LAL ++G+SWHNNHHAFE SARHGLEW+QLDITWY++   Q  GLAT+VKLPT AQKRK
Sbjct  236  LALLTMGESWHNNHHAFETSARHGLEWYQLDITWYLIWFFQALGLATNVKLPTDAQKRK  294


 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 59/104 (57%), Gaps = 6/104 (6%)
 Frame = +3

Query  240  DDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVV  419
            DD     ++ + +KR     R     +V   S +  V     H LCL APF + W+AF  
Sbjct  7    DDGSSQKKSVRKEKRAYV-LRKWTQFDVGRASTVGTV-----HLLCLLAPFNYKWEAFRF  60

Query  420  AFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
               L I+T L I+ SYHRNL+HRSFKLPKWLEY FAY  + ALQ
Sbjct  61   GIILAILTNLCITFSYHRNLTHRSFKLPKWLEYPFAYSALLALQ  104



>ref|XP_008337014.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Malus domestica]
Length=299

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 57/90 (63%), Gaps = 5/90 (6%)
 Frame = +3

Query  288  EFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSY  467
             FW R    L++         MF   H LCLFAPF FTW AF +   L  VT  GI+LSY
Sbjct  17   NFWGRKWNLLDIVTAG-----MFLSVHVLCLFAPFYFTWTAFWLMLVLGYVTGFGITLSY  71

Query  468  HRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            HRNL+HRSF+LPK LEY FAYCGV ++Q S
Sbjct  72   HRNLAHRSFRLPKLLEYLFAYCGVLSVQGS  101


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  604  DSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            + WHNNHHAFEYSAR GLEWWQ+D+TWY+++ L+  GLATDVK P+ A K++
Sbjct  238  EGWHNNHHAFEYSARQGLEWWQIDVTWYIIKFLEXLGLATDVKTPSEAHKQR  289



>ref|XP_010691135.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Beta vulgaris subsp. vulgaris]
Length=307

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +3

Query  360  LAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCG  536
            + H L LFAPF F W AF VA  LY+VT +LGI LSYHRNL+H+SFKLPKWLEY FAYCG
Sbjct  47   MMHVLALFAPFTFNWGAFRVAIVLYLVTALLGICLSYHRNLTHKSFKLPKWLEYLFAYCG  106

Query  537  VHALQ  551
              ALQ
Sbjct  107  ALALQ  111


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL S G+ WHNNHHAF YSARHGLEWWQ+D+TWY++R L V GLA DV+LPT A K +
Sbjct  243  VALLSFGEGWHNNHHAFGYSARHGLEWWQVDMTWYIIRLLDVIGLAKDVRLPTEAHKER  301



>emb|CDY10171.1| BnaC05g04140D [Brassica napus]
Length=297

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LA  ++G+SWHNNHHAFE SARHGLEW+QLDITWY++R  Q  GLATDVKLP+ AQK K
Sbjct  236  LAPVTMGESWHNNHHAFEASARHGLEWYQLDITWYLIRFFQALGLATDVKLPSEAQKHK  294


 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 63/104 (61%), Gaps = 5/104 (5%)
 Frame = +3

Query  240  DDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVV  419
            +D   + + A  +++  F+ R   S++V   S ++ V     H  C+ APF + W+A + 
Sbjct  6    EDGSGSSRKAMRKEKRAFFFRKWTSVDVMRASSVMAV-----HLSCVLAPFNYKWEALLF  60

Query  420  AFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             F L  VT L I+ SYHRNL+H+SFKLPKWLEY FAY  + ALQ
Sbjct  61   GFLLAAVTNLSITFSYHRNLTHKSFKLPKWLEYPFAYSALFALQ  104



>ref|XP_008443948.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like isoform X2 [Cucumis melo]
Length=248

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            + L + G+SWHNNHHAFEYSARHGLEWWQ+DI WY++R LQV GLAT+VK+P+ + K++
Sbjct  178  ICLLTHGESWHNNHHAFEYSARHGLEWWQIDICWYIIRFLQVIGLATEVKVPSQSHKQR  236



>ref|XP_006417930.1| hypothetical protein EUTSA_v10008191mg [Eutrema salsugineum]
 gb|ESQ36283.1| hypothetical protein EUTSA_v10008191mg [Eutrema salsugineum]
Length=326

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ ++G+SWHNNHHAFE SAR GLEWWQ+DITWY++R L+V GLATDVKLP+  QK+K
Sbjct  263  LSIFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLLEVVGLATDVKLPSEFQKQK  321


 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 56/110 (51%), Gaps = 12/110 (11%)
 Frame = +3

Query  231  PASDDREDTPQAAKNQKRVEF---WTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFT  401
            P  DD        + +KR  F   WT         P   +  +   + H  CL APF + 
Sbjct  31   PTRDDGSSQSGMLRKEKRAYFQRKWT---------PADVIRALTVLIVHFWCLLAPFNYK  81

Query  402  WDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            W+A    F L   T L ++ SYHRNL+HRSFKLPKWLEY FAY  V ALQ
Sbjct  82   WEALRFGFILVAATNLSVTFSYHRNLAHRSFKLPKWLEYPFAYAAVFALQ  131



>ref|XP_008365460.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Malus domestica]
Length=311

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+ L + G+ WHNNHHAFE+SARHGLEWWQ+DITWYV+R L+  GLATDVKLPT  QK +
Sbjct  225  LIGLLAHGEGWHNNHHAFEHSARHGLEWWQIDITWYVIRFLEAVGLATDVKLPTETQKNR  284


 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHA  545
            H L L APF F W AF VA  LY+V  + ++LSYHR LSHRSFKLPKWLEYFFAYCGV +
Sbjct  32   HLLTLLAPFHFNWPAFWVAIALYLVVGVSVNLSYHRQLSHRSFKLPKWLEYFFAYCGVLS  91

Query  546  LQVS  557
             Q S
Sbjct  92   FQRS  95



>ref|XP_008354628.1| PREDICTED: LOW QUALITY PROTEIN: palmitoyl-monogalactosyldiacylglycerol 
delta-7 desaturase, chloroplastic-like [Malus domestica]
Length=299

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 57/90 (63%), Gaps = 5/90 (6%)
 Frame = +3

Query  288  EFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSY  467
             FW R    L++         MF   H LCLFAPF FTW AF +   L  VT  GI+LSY
Sbjct  17   NFWGRKWNLLDIVTAG-----MFLSXHVLCLFAPFYFTWTAFWLMLVLGYVTGFGITLSY  71

Query  468  HRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            HRNL+HRSF+LPK LEY FAYCGV ++Q S
Sbjct  72   HRNLAHRSFRLPKLLEYLFAYCGVLSVQGS  101


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  604  DSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            + WHNNHHAFEYSAR GLEWWQ+D+TWY+++ L+  GLATDVK P+   K++
Sbjct  238  EGWHNNHHAFEYSARQGLEWWQIDVTWYIIKFLEXLGLATDVKTPSEXHKQR  289



>gb|KFK24701.1| hypothetical protein AALP_AA8G013500 [Arabis alpina]
Length=298

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LAL + G+SWHNNHHAFE SARHGLEW+Q+D TWY++R LQ  GLATDVKLP+ AQKRK
Sbjct  235  LALLTNGESWHNNHHAFEASARHGLEWYQIDATWYLIRFLQALGLATDVKLPSAAQKRK  293


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +3

Query  318  EVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFK  497
            E A    M      + H  CL APF   W+  +  + L  VT + ++ SYHRNL+HRSFK
Sbjct  27   EWARFDVMRATTIMVMHLFCLLAPFHCKWEDLLFGYCLNTVTHICVTFSYHRNLTHRSFK  86

Query  498  LPKWLEYFFAYCGVHALQ  551
            LPKWLEY FAY  + A Q
Sbjct  87   LPKWLEYPFAYSAMFAHQ  104



>ref|XP_004506950.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cicer arietinum]
Length=393

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT-MLG  452
            ++R  F  R   SL+VA    ++ +     H LCLFAPF F W AF VA  LY+VT + G
Sbjct  105  RERKLFLGRKWNSLDVATAGIVLSM-----HLLCLFAPFNFNWPAFWVAVSLYVVTGLFG  159

Query  453  ISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            I+LS+HR+LSH+SFKLPK LEY FAYCGV ALQ
Sbjct  160  ITLSFHRHLSHKSFKLPKLLEYLFAYCGVLALQ  192


 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +AL + G+ WHNNHHAFEYSARHGLEWW++D+TWY+V+ LQ  GLAT+VK+P+  QK++
Sbjct  324  VALLAFGEGWHNNHHAFEYSARHGLEWWEIDMTWYMVKFLQAIGLATEVKVPSDIQKQR  382



>ref|XP_006417931.1| hypothetical protein EUTSA_v10008320mg [Eutrema salsugineum]
 gb|ESQ36284.1| hypothetical protein EUTSA_v10008320mg [Eutrema salsugineum]
Length=299

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ ++G+SWHNNHHAFE SAR GLEWW+LDITWY++R L++ GLATDVKLP+  QKRK
Sbjct  236  LSIFTMGESWHNNHHAFESSARQGLEWWELDITWYLIRLLELVGLATDVKLPSEFQKRK  294


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 61/107 (57%), Gaps = 6/107 (6%)
 Frame = +3

Query  231  PASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDA  410
            P  DD         ++KR  F     +   +    +M+ V+  + H LCL APF + W+A
Sbjct  4    PTRDDGFSQTGVLPDEKRPYF----HRKWPLVDVIRMLIVL--IVHFLCLLAPFNYNWEA  57

Query  411  FVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
                  LY+VT+  I+ SYHRNLSHRSFK+PKWLEY FAY  V ALQ
Sbjct  58   LRFGLVLYVVTIFSITFSYHRNLSHRSFKIPKWLEYPFAYTAVFALQ  104



>ref|XP_010522174.1| PREDICTED: delta-9 desaturase-like 3 protein [Tarenaya hassleriana]
Length=323

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 64/102 (63%), Gaps = 15/102 (15%)
 Frame = +3

Query  246  REDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAF  425
            R+  P   +  KR++    + ++L VA            +H LCL APF FTW+A  ++ 
Sbjct  42   RKRRPYFRRQWKRID----VIRTLTVAS-----------SHLLCLLAPFYFTWEALRLSL  86

Query  426  GLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             LY V  LGI+LSYHRNL+HRSFKLPKWLEY FAY G+ ALQ
Sbjct  87   TLYPVVSLGITLSYHRNLAHRSFKLPKWLEYLFAYIGLFALQ  128


 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAF  SARHGLEWWQ+D+TWYV+R L+   LATDVKLPT++Q R+
Sbjct  260  LSVSSFGESWHNNHHAFGSSARHGLEWWQIDLTWYVIRFLEAVRLATDVKLPTNSQIRR  318



>ref|XP_006410268.1| hypothetical protein EUTSA_v10016982mg [Eutrema salsugineum]
 gb|ESQ51721.1| hypothetical protein EUTSA_v10016982mg [Eutrema salsugineum]
Length=308

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLA DVKLPT +Q+R+
Sbjct  245  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLAYDVKLPTESQRRR  303


 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 60/96 (63%), Gaps = 5/96 (5%)
 Frame = +3

Query  264  AAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT  443
            A K ++R  FW R  + L+    S  + V     H + L APF F W A  V F +Y + 
Sbjct  23   AEKRRRRWVFWERKWRRLDYFKLSASLFV-----HSMALLAPFYFKWSALWVTFLVYTIG  77

Query  444  MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             LGI++SYHRNL+HRSFK+PKWLEY FAYC + A+Q
Sbjct  78   GLGITVSYHRNLAHRSFKVPKWLEYLFAYCALLAIQ  113



>ref|XP_010457762.1| PREDICTED: delta-9 desaturase-like 5 protein [Camelina sativa]
Length=299

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ ++G+SWHNNHHAFE SAR GLEWWQ+DITWY++R L+V GLATDVKLP+  QK+K
Sbjct  236  LSIFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLLEVLGLATDVKLPSEFQKQK  294


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +3

Query  360  LAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGV  539
            + H  CL APF + W+A      LY +  L I+ SYHRNL+HRSFKLPKWLEY  AY  V
Sbjct  41   IVHFFCLLAPFNYKWEALRFGLVLYALNALSITFSYHRNLAHRSFKLPKWLEYPSAYFAV  100

Query  540  HALQ  551
             ALQ
Sbjct  101  FALQ  104



>ref|NP_172125.1| delta-9 desaturase-like 5 protein [Arabidopsis thaliana]
 sp|Q9LMI3.1|ADSL5_ARATH RecName: Full=Delta-9 desaturase-like 5 protein [Arabidopsis 
thaliana]
 gb|AAF82164.1|AC068143_6 Contains similarity to a delta 9 desaturase from Arabidopsis 
thaliana gb|D88537 and contains a fatty acid desaturase PF|01069 
domain. ESTs gb|AA041026, gb|AI992605 come from this gene 
[Arabidopsis thaliana]
 gb|AAG48790.1|AF332427_1 putative delta 9 desaturase [Arabidopsis thaliana]
 gb|AEE27978.1| delta-9 desaturase-like 5 protein [Arabidopsis thaliana]
Length=299

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+L ++G+SWHNNHHAFE SAR GLEWWQ+DITWY++R  +V GLATDVKLP+  QK+K
Sbjct  236  LSLFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLFEVLGLATDVKLPSEIQKQK  294


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 58/112 (52%), Gaps = 16/112 (14%)
 Frame = +3

Query  231  PASDDREDTPQAAKNQKRVEF-----WTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFC  395
            P  +D  +   A   +KR        W  + ++L V              H LCL APF 
Sbjct  4    PIREDGSNKRGAVSKEKRPYIHREWSWADIIRALTVIN-----------VHFLCLLAPFN  52

Query  396  FTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            + W+A    F LY +T L I+ SYHRNL+HRSFKLPKWLEY  AY  V ALQ
Sbjct  53   YKWEALRFGFVLYALTSLSITFSYHRNLAHRSFKLPKWLEYPLAYFAVFALQ  104



>ref|XP_002892336.1| fatty acid desaturase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68595.1| fatty acid desaturase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=299

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+L ++G+SWHNNHHAFE SAR GLEWWQ+DITWY++R  +V GLATDVKLP+  QK+K
Sbjct  236  LSLFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLFEVLGLATDVKLPSDFQKQK  294


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = +3

Query  231  PASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDA  410
            P  DD     +A   +KR  F  R    ++V     +V     + H LCL APF + W+A
Sbjct  4    PTRDDVSSQSRAVSIEKRAYF-QRKWPLVDVIRALTVV-----IVHFLCLLAPFNYEWEA  57

Query  411  FVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            F     L+++T L I+ SYHRNLSHRSFK+PKW+EY FAY  V ALQ
Sbjct  58   FRFGLVLFVITTLSITFSYHRNLSHRSFKIPKWIEYPFAYSAVFALQ  104



>ref|XP_007215729.1| hypothetical protein PRUPE_ppa009061mg [Prunus persica]
 gb|EMJ16928.1| hypothetical protein PRUPE_ppa009061mg [Prunus persica]
Length=308

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+ L + G+ WHNNHHAFE SARHGLEWWQ+D+TWYV+R L+  GLATDVKLPT  QK++
Sbjct  225  LIGLMAHGEGWHNNHHAFEQSARHGLEWWQVDVTWYVIRFLEAIGLATDVKLPTETQKKR  284


 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHA  545
            HCL L APF F W AF  A  LY VT + ++LSYHR LSHRSFKLPKWLEY FAYC V +
Sbjct  32   HCLTLLAPFHFNWPAFWAAVALYFVTGVSVNLSYHRQLSHRSFKLPKWLEYLFAYCAVLS  91

Query  546  LQVS  557
             Q S
Sbjct  92   FQRS  95



>emb|CDY56609.1| BnaCnng30700D [Brassica napus]
Length=307

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLA DVKLPT +Q+R+
Sbjct  244  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLAYDVKLPTESQRRR  302


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 60/96 (63%), Gaps = 5/96 (5%)
 Frame = +3

Query  264  AAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT  443
            A K +++  FW R  + L+     ++   +F   H + L APF F+W A  V F  Y + 
Sbjct  22   AEKRKRKWVFWERKWRRLDYF---KLTASLF--VHSMALLAPFYFSWSALWVTFLFYTIG  76

Query  444  MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             LGI++SYHRNL+HRSFK+PKWLEY  AYC + A+Q
Sbjct  77   GLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQ  112



>ref|XP_004304084.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like isoform 2 [Fragaria vesca subsp. 
vesca]
Length=263

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+ L + G+ WHNNHHAF++SARHGLEWWQ+D+TWYV+R L++ GLATDVKLPT  QK++
Sbjct  174  LIGLLAHGEGWHNNHHAFQHSARHGLEWWQIDVTWYVIRFLELVGLATDVKLPTETQKKQ  233


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  447  LGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            + ++LS+HRNLSHRSFKLP+WLEYFFAYCGV +LQ S
Sbjct  8    VAVTLSFHRNLSHRSFKLPRWLEYFFAYCGVLSLQRS  44



>ref|XP_009141172.1| PREDICTED: delta-9 acyl-lipid desaturase 2-like [Brassica rapa]
Length=307

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLA DVKLPT +Q+R+
Sbjct  244  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLAYDVKLPTESQRRR  302


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 66/107 (62%), Gaps = 9/107 (8%)
 Frame = +3

Query  231  PASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDA  410
            P+S ++E    A K ++R  FW R  + L+     ++   +F   H + + APF F+W A
Sbjct  15   PSSPEKE----AEKRKQRWAFWGRKWRRLDYF---KLTASLF--VHSMAILAPFYFSWSA  65

Query  411  FVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
              V F  Y +  LGI++SYHRNL+HRSFK+PKWLEY  AYC + A+Q
Sbjct  66   LWVTFLFYTIGGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQ  112



>emb|CDY19096.1| BnaA04g18360D [Brassica napus]
 emb|CDY15379.1| BnaC04g42440D [Brassica napus]
Length=307

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLA DVKLPT +Q+R+
Sbjct  244  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLAYDVKLPTESQRRR  302


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 66/107 (62%), Gaps = 9/107 (8%)
 Frame = +3

Query  231  PASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDA  410
            P+S ++E    A K ++R  FW R  + L+     ++   +F   H + L APF F+W A
Sbjct  15   PSSPEKE----AEKRKQRWAFWGRKWRRLDYF---KLTASLF--VHSMALLAPFYFSWSA  65

Query  411  FVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
              V F  Y +  LGI++SYHRNL+HRSFK+PKWLEY  AYC + A+Q
Sbjct  66   LWVTFLFYTIGGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQ  112



>gb|KFK31220.1| hypothetical protein AALP_AA6G083900 [Arabis alpina]
Length=302

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLA DVKLPT +Q+R+
Sbjct  239  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLAYDVKLPTESQRRR  297


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 63/112 (56%), Gaps = 6/112 (5%)
 Frame = +3

Query  219  VCIRPASDDREDTPQ-AAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFC  395
            + +    ++ + TP    K ++R  FW R  + L+    S  +     + H L L APF 
Sbjct  1    MSVTSTVENHQKTPSPEEKRKRRWVFWDRRWRRLDYFKLSASL-----IVHSLALMAPFY  55

Query  396  FTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            F W A  V    Y +  LGI++SYHRNL+H+SFK+PKWLEY  AYC + A+Q
Sbjct  56   FKWSALWVTLLFYTIGGLGITVSYHRNLAHKSFKVPKWLEYLLAYCALLAIQ  107



>ref|XP_009144215.1| PREDICTED: delta-9 acyl-lipid desaturase 2 [Brassica rapa]
 emb|CDY10798.1| BnaA05g11380D [Brassica napus]
Length=307

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+DI+WY+VR L++ GLA DVKLPT +Q+R+
Sbjct  244  LSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLAYDVKLPTESQRRR  302


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 60/96 (63%), Gaps = 5/96 (5%)
 Frame = +3

Query  264  AAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVT  443
            A K +++  FW R  + L+     ++   +F   H + L APF F+W A  V F  Y + 
Sbjct  22   AEKRKRKWVFWERKWRRLDYF---KLTASLF--VHSMALLAPFYFSWSALWVTFLFYTIG  76

Query  444  MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             LGI++SYHRNL+HRSFK+PKWLEY  AYC + A+Q
Sbjct  77   GLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQ  112



>gb|KGN52899.1| hypothetical protein Csa_4G006060 [Cucumis sativus]
Length=342

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 66/106 (62%), Gaps = 7/106 (7%)
 Frame = +3

Query  237  SDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFV  416
             + +++ P+      R  FW R   +L+     + V  +    H LC+FAPF F W AF 
Sbjct  19   DESKQEEPKKMVKPPR-SFWRRNWTTLD-----KRVAYIILFVHLLCIFAPFQFNWSAFR  72

Query  417  VAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            V   L ++T L G+++SYHRNL+H+SF+LPKWLEY FAYCGVH LQ
Sbjct  73   VTVALIVITGLFGMTISYHRNLAHKSFQLPKWLEYSFAYCGVHCLQ  118


 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKL--PTHAQ  750
            L+ L S G+ WHNNHHAF YSAR GLEWWQLD  WYV++ LQV GLAT+VKL  PTH Q
Sbjct  271  LVGLTSFGEGWHNNHHAFSYSARLGLEWWQLDAGWYVIKFLQVIGLATNVKLPSPTHMQ  329



>ref|XP_010457727.1| PREDICTED: delta-9 desaturase-like 1 protein isoform X2 [Camelina 
sativa]
Length=299

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L + G+SWHNNHHAFE SARHGLEW+Q+D+TWY++R  Q  GLAT+VKLPT AQKRK
Sbjct  236  LGLFTFGESWHNNHHAFEGSARHGLEWYQVDVTWYLIRFFQALGLATNVKLPTDAQKRK  294


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +3

Query  384  APFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            APF F W+A + ++ L +VT + I+ SYHRNL+HRSFKLPKWLEY FAY  + ALQ
Sbjct  49   APFYFKWEAILFSWILTMVTNICITFSYHRNLTHRSFKLPKWLEYLFAYTALFALQ  104



>gb|KFK42935.1| hypothetical protein AALP_AA1G057900 [Arabis alpina]
Length=305

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAF+ SAR GLEWWQ+DI WY+VR L++ GLATDVKLP+ +Q+R+
Sbjct  242  LSVFSFGESWHNNHHAFQSSARQGLEWWQIDIAWYIVRFLEIIGLATDVKLPSESQRRR  300


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +3

Query  336  QMVKVMFPL-AHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWL  512
             +VK    L  H LCL APF FTW A  VA  +Y+V  +GI++SYHRNL+HRSFK+PKWL
Sbjct  38   DIVKAFVSLFVHFLCLLAPFNFTWSALRVAIIVYMVAGIGITVSYHRNLAHRSFKVPKWL  97

Query  513  EYFFAYCGVHALQ  551
            EY  AYCG  A+Q
Sbjct  98   EYLLAYCGFLAIQ  110



>ref|XP_009132780.1| PREDICTED: delta-9 acyl-lipid desaturase 2-like [Brassica rapa]
 emb|CDX84791.1| BnaA03g14390D [Brassica napus]
Length=307

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+D++WY+VR+L++ GLA DVKLPT +Q+R+
Sbjct  244  LSVFSFGESWHNNHHAFESSARQGLEWWQIDLSWYIVRSLEIVGLAYDVKLPTESQRRR  302


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 67/108 (62%), Gaps = 9/108 (8%)
 Frame = +3

Query  228  RPASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWD  407
            +P+S ++E    A K ++R  FW R  + L+     ++   +F   H + L APF F+W 
Sbjct  14   KPSSSEKE----AEKRRQRWAFWGRKWRRLDYF---KLTASLF--VHSMALLAPFYFSWS  64

Query  408  AFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            A  V F  Y +  LGI++SYHRNL+HRSFK+PKWLEY  AYC + A+Q
Sbjct  65   ALWVTFLFYTIGGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQ  112



>emb|CDY23946.1| BnaC03g17450D [Brassica napus]
Length=307

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAFE SAR GLEWWQ+D++WY+VR+L++ GLA DVKLPT +Q+R+
Sbjct  244  LSVFSFGESWHNNHHAFESSARQGLEWWQIDLSWYIVRSLEIVGLAYDVKLPTESQRRR  302


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 67/108 (62%), Gaps = 9/108 (8%)
 Frame = +3

Query  228  RPASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWD  407
            +P+S ++E    A K ++R  FW R  + L+     ++   +F   H + L APF F+W 
Sbjct  14   KPSSSEKE----AEKRRQRWAFWGRKWRRLDYF---KLTASLF--VHSMALLAPFYFSWS  64

Query  408  AFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            A  V F  Y +  LGI++SYHRNL+HRSFK+PKWLEY  AYC + A+Q
Sbjct  65   ALWVTFLFYTIGGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQ  112



>ref|XP_010457726.1| PREDICTED: delta-9 desaturase-like 1 protein isoform X1 [Camelina 
sativa]
Length=306

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L + G+SWHNNHHAFE SARHGLEW+Q+D+TWY++R  Q  GLAT+VKLPT AQKRK
Sbjct  243  LGLFTFGESWHNNHHAFEGSARHGLEWYQVDVTWYLIRFFQALGLATNVKLPTDAQKRK  301


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +3

Query  384  APFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            APF F W+A + ++ L +VT + I+ SYHRNL+HRSFKLPKWLEY FAY  + ALQ
Sbjct  49   APFYFKWEAILFSWILTMVTNICITFSYHRNLTHRSFKLPKWLEYLFAYTALFALQ  104



>gb|KFK42955.1| delta 9 desaturase [Arabis alpina]
Length=300

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+L ++G+SWHNNHHAFE SAR GLEWWQ+DITWY++R  + FGLATDVKLP+  QK+K
Sbjct  237  LSLFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLFEFFGLATDVKLPSVLQKQK  295


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 56/107 (52%), Gaps = 5/107 (5%)
 Frame = +3

Query  231  PASDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDA  410
            P  DD         ++++   + R    ++V     +  V     H  CL APF + W+A
Sbjct  4    PTRDDGSSQSNVVVHKEKRALFQRKWTVVDVLRALTVASV-----HFWCLLAPFNYKWEA  58

Query  411  FVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
                  L  VT L ++ SYHRNL+HRSFKLPKWLEY FAY  V A+Q
Sbjct  59   LRFGLILVAVTNLSVTFSYHRNLAHRSFKLPKWLEYPFAYSAVFAIQ  105



>emb|CDX97712.1| BnaA05g23670D [Brassica napus]
Length=366

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LA+ +LG+SWHNNHHAFE+SARHGLEWWQ+DITWY +R LQ  GLAT+VKL T A K++
Sbjct  303  LAIVTLGESWHNNHHAFEFSARHGLEWWQIDITWYFIRLLQALGLATNVKLVTEAHKQR  361


 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 74/137 (54%), Gaps = 19/137 (14%)
 Frame = +3

Query  180  NCKEEKYKRLSPIVCIRPA--SDD--REDT---------PQAAKNQKRVEFWTRMAKSLE  320
            N K    KRL  + C +P   ++D  RE T         P +   +K+  FW R     +
Sbjct  41   NSKLHFTKRLV-VACKKPTFTAEDVLRETTITEESHPKVPYSEVVRKKRVFWERRWNYWD  99

Query  321  VAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKL  500
            V+    ++ V     H L L+APF   W AF VA GL ++   GI+LSYHRNLSHRSF L
Sbjct  100  VSRAIGILGV-----HLLSLYAPFHCNWSAFRVAVGLSVIAGTGITLSYHRNLSHRSFVL  154

Query  501  PKWLEYFFAYCGVHALQ  551
            PKWLEY FA+CG  A Q
Sbjct  155  PKWLEYLFAWCGTLAFQ  171



>ref|XP_004152195.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis sativus]
 ref|XP_004164997.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Cucumis sativus]
Length=325

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 7/106 (7%)
 Frame = +3

Query  237  SDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFV  416
             + +++ P+      R  FW R   +L+     + V  +    H LC+FAPF F W AF 
Sbjct  2    DESKQEEPKKMVKPPR-SFWRRNWTTLD-----KRVAYIILFVHLLCIFAPFQFNWSAFR  55

Query  417  VAFGLYIVT-MLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            V   L ++T + G+++SYHRNL+H+SF+LPKWLEY FAYCGVH LQ
Sbjct  56   VTVALIVITGLFGMTISYHRNLAHKSFQLPKWLEYSFAYCGVHCLQ  101


 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKL--PTHAQ  750
            L+ L S G+ WHNNHHAF YSAR GLEWWQLD  WYV++ LQV GLAT+VKL  PTH Q
Sbjct  254  LVGLTSFGEGWHNNHHAFSYSARLGLEWWQLDAGWYVIKFLQVIGLATNVKLPSPTHMQ  312



>ref|XP_004305981.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=284

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = +3

Query  315  LEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSF  494
            +E    + + K+ F   H L    PF F W AF +A  LY VT +G++LSYHRNLSHRSF
Sbjct  1    MEGKTKASITKLFFLAIHSLAFLGPFYFNWSAFWLAVALYFVTGVGMTLSYHRNLSHRSF  60

Query  495  KLPKWLEYFFAYCGVHALQVSSYQVTS  575
            KLP+WLEY FAYC V ALQ S  +  S
Sbjct  61   KLPRWLEYSFAYCAVLALQGSPIEWVS  87


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            +L L + G+ WHNNHHAFEYSAR GLEWW++D TWYV+R L+  GLATDVKLP+ A K++
Sbjct  212  VLGLLAHGEGWHNNHHAFEYSARQGLEWWEIDTTWYVIRFLEAIGLATDVKLPSEAHKKR  271



>ref|XP_007217808.1| hypothetical protein PRUPE_ppa027208mg, partial [Prunus persica]
 gb|EMJ19007.1| hypothetical protein PRUPE_ppa027208mg, partial [Prunus persica]
Length=292

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
             + L + G+ WHNNHHAFEYSA+HG EWWQ+DITWY++R LQ  GLATDVKLPT  QK++
Sbjct  218  FIGLMAHGEGWHNNHHAFEYSAQHGFEWWQIDITWYLIRFLQAVGLATDVKLPTETQKKR  277


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 61/92 (66%), Gaps = 5/92 (5%)
 Frame = +3

Query  282  RVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISL  461
             VEF  R    +++A  + +V +     H L + APF FTW AF  A  LY ++ +G++L
Sbjct  2    HVEFLGRQWNFVDLATLAGLVYL-----HYLAVLAPFYFTWPAFWSAVALYYISGVGVTL  56

Query  462  SYHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            S+HRNLSH+SFKLPKWLEY FAYCGV + Q S
Sbjct  57   SFHRNLSHKSFKLPKWLEYLFAYCGVLSFQRS  88



>gb|AAF82163.1|AC068143_5 Contains similarity to a delta 9 desaturase mRNA from Arabidopsis 
thaliana gb|D88536 and contains a fatty acid desaturase 
PF|01069 domain [Arabidopsis thaliana]
Length=319

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+L ++G+SWHNNHHAFE SAR GLEWWQ+DITWY++R  +V G+ATDVKLP+  QK+K
Sbjct  256  LSLFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLFEVLGIATDVKLPSELQKQK  314


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHA  545
            H LCL APF F W+A      L+ +T L I+ S+HRNLSHRSFK+PKWLEY +AY  V A
Sbjct  63   HFLCLLAPFNFKWEALRFGLVLFALTTLSITFSFHRNLSHRSFKIPKWLEYPWAYSAVFA  122

Query  546  LQ  551
            LQ
Sbjct  123  LQ  124



>ref|XP_008454215.1| PREDICTED: delta-9 acyl-lipid desaturase 1-like [Cucumis melo]
Length=341

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +3

Query  354  FPLAHCLCLFAPFCFTWDAFVVAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEYFFAY  530
            F + H LCL APF FTW AF +A  LYI+T L G++LSYHR+L+H+SFKLPKWLEY FAY
Sbjct  49   FLVMHFLCLLAPFYFTWPAFWLAVALYIITGLFGLTLSYHRHLTHKSFKLPKWLEYTFAY  108

Query  531  CGVHALQ  551
             GVH LQ
Sbjct  109  IGVHTLQ  115


 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPT  741
            +LAL   G+ WHNNHHAFEYSARHGLEWWQ D+TW+V+  LQ  GLATD+KLP+
Sbjct  274  VLALLIFGEGWHNNHHAFEYSARHGLEWWQFDVTWWVILFLQALGLATDLKLPS  327



>gb|AAM63359.1| delta 9 desaturase [Arabidopsis thaliana]
Length=308

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ S G+SWHNNHHAF+ SAR GLEWWQ+DI+WY+VR  ++ GLATDVK+PT AQ+R+
Sbjct  245  LSVFSFGESWHNNHHAFKSSARQGLEWWQIDISWYIVRFFEIIGLATDVKVPTEAQRRR  303


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 60/102 (59%), Gaps = 8/102 (8%)
 Frame = +3

Query  255  TPQAAKNQK---RVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAF  425
            TP A + +K   R  FW R  + L+    S    V     H L L APF FTW A  V F
Sbjct  17   TPAAVEEEKKKRRWVFWDRRWRRLDYVKFSASFTV-----HSLALLAPFYFTWSALWVTF  71

Query  426  GLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
              Y +  LGI++SYHRNL+HRSFK+PKWLEY  AYC + A+Q
Sbjct  72   LFYTIGGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQ  113



>ref|XP_009365117.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like [Pyrus x bretschneideri]
Length=321

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  580  LLALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L  L + G+ WHNNHHAFEYSAR G EWWQ+D+TWYV+R LQ  GLATDVKLPT  QK++
Sbjct  238  LFGLLAHGEGWHNNHHAFEYSARQGFEWWQVDLTWYVIRFLQAVGLATDVKLPTEIQKKR  297


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 62/94 (66%), Gaps = 5/94 (5%)
 Frame = +3

Query  276  QKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGI  455
            ++RV+   R    ++V      + V+  L H L L APF F   A  +A  LY++T LG+
Sbjct  20   KRRVQLLGRQWNFMDVGT----LVVVLGL-HFLALLAPFHFNGSAVWLAMALYVITGLGV  74

Query  456  SLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQVS  557
            +LSYHRNLSH+SFKLPKWLEY FAYCGV +LQ S
Sbjct  75   TLSYHRNLSHKSFKLPKWLEYSFAYCGVLSLQGS  108



>ref|NP_172124.2| delta-9 desaturase-like 4 protein [Arabidopsis thaliana]
 sp|Q9LMI4.2|ADSL4_ARATH RecName: Full=Delta-9 desaturase-like 4 protein [Arabidopsis 
thaliana]
 gb|AEE27977.1| delta-9 desaturase-like 4 protein [Arabidopsis thaliana]
Length=300

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+L ++G+SWHNNHHAFE SAR GLEWWQ+DITWY++R  +V G+ATDVKLP+  QK+K
Sbjct  237  LSLFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLFEVLGIATDVKLPSELQKQK  295


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  366  HCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHA  545
            H LCL APF F W+A      L+ +T L I+ S+HRNLSHRSFK+PKWLEY +AY  V A
Sbjct  44   HFLCLLAPFNFKWEALRFGLVLFALTTLSITFSFHRNLSHRSFKIPKWLEYPWAYSAVFA  103

Query  546  LQ  551
            LQ
Sbjct  104  LQ  105



>ref|XP_002889585.1| fatty acid desaturase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65844.1| fatty acid desaturase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=299

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 60/107 (56%), Gaps = 12/107 (11%)
 Frame = +3

Query  240  DDREDTPQAAKNQKRVEF---WTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDA  410
            DD     +A +  KR  F   WTR+      A GS          H LCL APF F W+A
Sbjct  7    DDGSSQSKAVRRGKRAFFFRKWTRIDVMRASAVGS---------VHLLCLLAPFNFKWEA  57

Query  411  FVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            F     L IVT L I+ SYHRNL+HRSFKLPKWLEY FAY  + ALQ
Sbjct  58   FRFGVILAIVTSLSITFSYHRNLTHRSFKLPKWLEYLFAYTALFALQ  104


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  595  SLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            ++G+SWHNNHHAFE SARHGLEW+Q+D+TWY++   Q  GLATDVKLPT AQKRK
Sbjct  240  TMGESWHNNHHAFEASARHGLEWYQVDLTWYLIWFFQALGLATDVKLPTDAQKRK  294



>ref|XP_008443947.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like isoform X1 [Cucumis melo]
Length=318

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            + L + G+SWHNNHHAFEYSARHGLEWWQ+DI WY++R LQV GLAT+VK+P+ + K++
Sbjct  248  ICLLTHGESWHNNHHAFEYSARHGLEWWQIDICWYIIRFLQVIGLATEVKVPSQSHKQR  306


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +3

Query  351  MFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISL-SYHRNLSHRSFKLPKWLEYFFA  527
            +  + H +C+ APF F W+AF VA  L+I+  +     SYHRNLSHRSFKLPKWLEYF A
Sbjct  27   LLIIMHLICITAPFHFNWNAFWVAAALHIIIDICGINISYHRNLSHRSFKLPKWLEYFLA  86

Query  528  YCGVHALQ  551
            YCG  A Q
Sbjct  87   YCGTLAFQ  94



>ref|XP_004169065.1| PREDICTED: palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, 
chloroplastic-like, partial [Cucumis sativus]
Length=176

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            + L +LG+SWHNNHHAFEYSAR GLEWWQ+DI WY++  LQV GLAT+VK+P+ + K++
Sbjct  106  MCLLTLGESWHNNHHAFEYSARQGLEWWQIDICWYIIWFLQVIGLATEVKVPSQSHKQR  164



>ref|XP_009119066.1| PREDICTED: delta-9 desaturase-like 5 protein [Brassica rapa]
Length=299

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ ++G+SWHNNHHAFE SAR GLEWWQ+DITWY++R  +V GLATDVKLP+  QK+K
Sbjct  236  LSIFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLFEVLGLATDVKLPSEFQKQK  294


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +3

Query  348  VMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFA  527
            V   + H LCL APF + W+A      L  VT L I+ SYHRNL+HRSFKLPKWLEY  A
Sbjct  37   VTVTMVHFLCLLAPFNYKWEALRFGLILVAVTNLLITFSYHRNLAHRSFKLPKWLEYPIA  96

Query  528  YCGVHALQ  551
            Y  V ALQ
Sbjct  97   YAVVFALQ  104



>emb|CDY57823.1| BnaA10g28100D [Brassica napus]
Length=299

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ ++G+SWHNNHHAFE SAR GLEWWQ+DITWY++R  +V GLATDVKLP+  QK+K
Sbjct  236  LSIFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLFEVLGLATDVKLPSEFQKQK  294


 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +3

Query  348  VMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFA  527
            V   + H LCL APF + W+A      L  VT L I+ SYHRNL+HRSFKLPKWLEY  A
Sbjct  37   VTVTMVHFLCLLAPFNYKWEALRFGLILVAVTNLLITFSYHRNLAHRSFKLPKWLEYPIA  96

Query  528  YCGVHALQ  551
            Y  V ALQ
Sbjct  97   YAAVFALQ  104



>ref|XP_010475330.1| PREDICTED: delta-9 desaturase-like 1 protein isoform X1 [Camelina 
sativa]
Length=300

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L ++G+SWHNNHHAFE SARHGLEW+Q+DITWY++R  Q  G ATDVK PT AQKRK
Sbjct  237  LGLFTMGESWHNNHHAFEASARHGLEWYQVDITWYLIRFFQALGFATDVKWPTDAQKRK  295


 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 56/98 (57%), Gaps = 12/98 (12%)
 Frame = +3

Query  267  AKNQKRVEF---WTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYI  437
             + +KR  F   WTR+      A G+          H LCL APF F W+A      L I
Sbjct  17   VRREKRAYFFRKWTRIDLMRASAVGA---------VHVLCLLAPFNFKWEALQFGVMLAI  67

Query  438  VTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            VT L I+ SYHRNL+HRSFKLPKWLEY FAY  + ALQ
Sbjct  68   VTSLSITFSYHRNLTHRSFKLPKWLEYPFAYSALFALQ  105



>ref|XP_009146500.1| PREDICTED: delta-9 acyl-lipid desaturase 1-like, partial [Brassica 
rapa]
Length=351

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            LA+ +LG+SWHNNHHAFE+SARHGLEWWQ+DITWY +R LQ  GLAT++KL T A K++
Sbjct  288  LAIVTLGESWHNNHHAFEFSARHGLEWWQIDITWYFIRLLQALGLATNIKLVTEAHKQR  346


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 74/137 (54%), Gaps = 19/137 (14%)
 Frame = +3

Query  180  NCKEEKYKRLSPIVCIRPA--SDD--REDT---------PQAAKNQKRVEFWTRMAKSLE  320
            N K    KRL  + C +P   ++D  RE T         P +   +K+  FW R     +
Sbjct  26   NSKLHFTKRLV-VACKKPTFTAEDVLRETTITEESHPKVPYSEVVRKKRVFWERRWNYWD  84

Query  321  VAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKL  500
            V+    ++ V     H L L+APF   W AF VA GL ++   GI+LSYHRNLSHRSF L
Sbjct  85   VSRAIGILGV-----HLLSLYAPFHCNWSAFRVAVGLSVIAGTGITLSYHRNLSHRSFVL  139

Query  501  PKWLEYFFAYCGVHALQ  551
            PKWLEY FA+CG  A Q
Sbjct  140  PKWLEYLFAWCGTLAFQ  156



>emb|CDX82427.1| BnaA03g33940D [Brassica napus]
Length=149

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKR  756
            +A  + G+ WHNNHHAFE+SARHGLEWWQ+D TWY+++ L+  GLAT+VKLP+ AQK+
Sbjct  87   VAAITFGEGWHNNHHAFEFSARHGLEWWQVDFTWYLIKFLEAIGLATNVKLPSEAQKK  144



>ref|XP_010475335.1| PREDICTED: delta-9 desaturase-like 2 protein isoform X1 [Camelina 
sativa]
 ref|XP_010475336.1| PREDICTED: delta-9 desaturase-like 2 protein isoform X2 [Camelina 
sativa]
Length=299

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L ++G+SWHNNHHAFE SARHGLEW+Q+D TWY++R  Q  GLAT+VKLPT AQKRK
Sbjct  236  LGLFTMGESWHNNHHAFEASARHGLEWYQVDTTWYLIRFFQALGLATNVKLPTDAQKRK  294


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +3

Query  384  APFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            APF F WDAF+  + L +VT + I+ SYHRNL+HRSFKLPKWLEY  AY  + ALQ
Sbjct  49   APFYFKWDAFLFGWILTMVTNIFITFSYHRNLTHRSFKLPKWLEYLSAYIALFALQ  104



>ref|XP_006304671.1| hypothetical protein CARUB_v10011896mg [Capsella rubella]
 gb|EOA37569.1| hypothetical protein CARUB_v10011896mg [Capsella rubella]
Length=297

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ ++G+SWHNNHHAFE SAR GLEWWQ+DITWY++R L+V GLATDVKLP+  QK K
Sbjct  236  LSIFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLLEVLGLATDVKLPSEFQKHK  294


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +3

Query  360  LAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGV  539
            + H LCL APF + W+A    F LY +T L I+ SYHRNL+HRSFKLPKWLEY  AY  V
Sbjct  41   IVHFLCLLAPFNYKWEALRFGFVLYALTSLSITFSYHRNLAHRSFKLPKWLEYPSAYFAV  100

Query  540  HALQ  551
             ALQ
Sbjct  101  FALQ  104



>gb|KFK42937.1| hypothetical protein AALP_AA1G058100 [Arabis alpina]
Length=299

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  595  SLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            ++G+SWHNNHHAFE SARHGLEW+Q+D+TWY++R  Q  GLATDVKLP+ AQKRK
Sbjct  240  TMGESWHNNHHAFEASARHGLEWYQVDVTWYLIRFFQALGLATDVKLPSDAQKRK  294


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 61/109 (56%), Gaps = 12/109 (11%)
 Frame = +3

Query  234  ASDDREDTPQAAKNQKRVEF---WTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTW  404
            + DD     +A + +KR  F   WTR   +   A G         + H LCL APF + W
Sbjct  5    SKDDGSSQNKAVRKEKRALFFRKWTRTDIARASAVG---------VVHLLCLLAPFNYKW  55

Query  405  DAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            +A      + +VT L I+ SYHRNL+HRSFKLPKWLEY FAY  + ALQ
Sbjct  56   EALRFGLIIAVVTNLSITFSYHRNLTHRSFKLPKWLEYSFAYSALFALQ  104



>ref|XP_009110993.1| PREDICTED: delta-9 desaturase-like 5 protein [Brassica rapa]
 emb|CDY15576.1| BnaA08g28600D [Brassica napus]
Length=299

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L+L ++G+SWHNNHHAF+ SAR GLEWWQ+DITWY++R  +V GLATDVKLP+  QK+K
Sbjct  236  LSLFTMGESWHNNHHAFQSSARQGLEWWQIDITWYLIRLFEVLGLATDVKLPSEYQKQK  294


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 61/115 (53%), Gaps = 20/115 (17%)
 Frame = +3

Query  228  RPASDDREDTPQAAKNQKRVEF-----WTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPF  392
             P  D           +KR  F     W  +A++L V            + H  CL APF
Sbjct  3    NPTKDSVPSQSGLVSKEKRAYFQRYWTWADVARALTVT-----------IVHFWCLLAPF  51

Query  393  CFTWDAFVVAFGLYIVTM--LGISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
             +TW+A  + FGL +VT+  L I+ SYHRNL+HRSFKLPKWLEY  AY  V ALQ
Sbjct  52   NYTWEA--LRFGLILVTLTNLLITFSYHRNLAHRSFKLPKWLEYPIAYAAVFALQ  104



>gb|KCW53828.1| hypothetical protein EUGRSUZ_J03065 [Eucalyptus grandis]
Length=282

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 62/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  237  SDDREDTPQAAKNQKRVEFWTRMAKSLEVAPGSQMVKVMFPLAHCLCLFAPFCFTWDAFV  416
            S  R         +KR  F  R   SL++     ++ +     H L L APF F+W A  
Sbjct  82   SGGRILLSDVVVKRKRRVFSGRKWSSLDIGTAGVVLAM-----HLLSLLAPFYFSWSALW  136

Query  417  VAFGLYIVTML-GISLSYHRNLSHRSFKLPKWLEYFFAYCGVHALQ  551
            VA  LY+VT L GI+LS+HRNLSHRSFKL KWLEY FAYCG  ALQ
Sbjct  137  VAVSLYVVTGLFGITLSFHRNLSHRSFKLSKWLEYLFAYCGTLALQ  182



>ref|XP_010486028.1| PREDICTED: delta-9 desaturase-like 5 protein [Camelina sativa]
Length=299

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L++ +LG+SWHNNHHAFE SAR GLEWWQ+DITWY++R L+  GLATDVKLP+  QK+K
Sbjct  236  LSIFTLGESWHNNHHAFESSARQGLEWWQIDITWYLIRLLEFLGLATDVKLPSEFQKQK  294


 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +3

Query  360  LAHCLCLFAPFCFTWDAFVVAFGLYIVTMLGISLSYHRNLSHRSFKLPKWLEYFFAYCGV  539
            + H LCL APF + W+A      LY +T L I+ SYHRNL+HRSFKLPKWLEY  AY  V
Sbjct  41   IVHFLCLLAPFNYKWEALRFGLVLYALTALSITFSYHRNLAHRSFKLPKWLEYPSAYFAV  100

Query  540  HALQ  551
             ALQ
Sbjct  101  FALQ  104



>ref|XP_007212463.1| hypothetical protein PRUPE_ppa015024mg [Prunus persica]
 gb|EMJ13662.1| hypothetical protein PRUPE_ppa015024mg [Prunus persica]
Length=255

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  583  LALPSLGDSWHNNHHAFEYSARHGLEWWQLDITWYVVRALQVFGLATDVKLPTHAQKRK  759
            L L +LG+ WHNNHHAFEYSAR GLEWWQ+D+TWY+++ L+  GLATDVK+P+ A +++
Sbjct  191  LGLVALGEGWHNNHHAFEYSARQGLEWWQIDLTWYIIKFLEALGLATDVKVPSEAHRKR  249



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1972844437608