BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19830_g2_i1 len=1091 path=[1247:0-152 1400:153-711 1959:712-747
1995:748-1090]

Length=1091
                                                                      Score     E

ref|XP_003609913.1|  Expansin                                           254   1e-78   
ref|XP_002266243.1|  PREDICTED: expansin-A4                             249   1e-76   Vitis vinifera
emb|CAN73461.1|  hypothetical protein VITISV_033906                     248   2e-76   Vitis vinifera
emb|CBI30173.3|  unnamed protein product                                249   5e-76   
ref|XP_010423881.1|  PREDICTED: expansin-A9-like                        245   2e-75   
ref|XP_002870966.1|  ATEXPA9                                            244   4e-75   
ref|XP_010558331.1|  PREDICTED: expansin-A9                             244   6e-75   
ref|XP_006398690.1|  hypothetical protein EUTSA_v10014430mg             244   6e-75   
ref|XP_010490643.1|  PREDICTED: expansin-A9                             244   9e-75   
ref|XP_009130690.1|  PREDICTED: expansin-A9-like                        243   1e-74   
emb|CDX80810.1|  BnaC03g00640D                                          243   2e-74   
ref|XP_010452058.1|  PREDICTED: expansin-A9-like                        243   2e-74   
gb|KHN02295.1|  Expansin-A16                                            243   4e-74   
ref|NP_195846.1|  expansin A9                                           242   4e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288496.1|  hypothetical protein CARUB_v10001761mg             242   5e-74   
ref|XP_003553565.1|  PREDICTED: expansin-A16-like                       242   7e-74   
ref|XP_009122794.1|  PREDICTED: expansin-A9                             241   1e-73   
ref|XP_008343537.1|  PREDICTED: expansin-A4-like                        240   2e-73   
gb|KFK24708.1|  hypothetical protein AALP_AA8G014300                    239   5e-73   
emb|CDY10456.1|  BnaCnng03570D                                          239   6e-73   
ref|NP_001150534.1|  alpha-expansin 6 precursor                         239   7e-73   Zea mays [maize]
gb|EYU41589.1|  hypothetical protein MIMGU_mgv1a026815mg                238   1e-72   
gb|ACF87150.1|  unknown                                                 237   4e-72   Zea mays [maize]
ref|XP_003527088.1|  PREDICTED: expansin-A15-like                       236   5e-72   
ref|XP_009343581.1|  PREDICTED: expansin-A4-like                        237   5e-72   
ref|XP_011013147.1|  PREDICTED: expansin-A1                             236   5e-72   
ref|XP_006291698.1|  hypothetical protein CARUB_v10017862mg             236   6e-72   
gb|AAR82849.1|  expansin-1                                              236   6e-72   Petunia x hybrida [garden petunia]
gb|AAK48848.1|AF350939_1  expansin                                      236   6e-72   Prunus cerasus [pie cherry]
gb|AEU08407.1|  expansin 2                                              236   8e-72   
gb|KHG15821.1|  Expansin-A4 -like protein                               236   1e-71   
gb|AFK38404.1|  unknown                                                 235   1e-71   
ref|XP_002533097.1|  Alpha-expansin 4 precursor, putative               236   1e-71   Ricinus communis
ref|XP_009380637.1|  PREDICTED: expansin-A4                             236   1e-71   
ref|XP_003523015.1|  PREDICTED: expansin-A15-like                       235   1e-71   
emb|CDY48101.1|  BnaC02g03580D                                          235   2e-71   
ref|NP_001288956.1|  expansin-A9-like precursor                         235   2e-71   
emb|CDY04847.1|  BnaAnng00290D                                          235   2e-71   
emb|CDY07024.1|  BnaA04g22910D                                          235   2e-71   
gb|AEN70870.1|  alpha-expansin 1                                        235   2e-71   
ref|NP_001234085.1|  expansin precursor                                 234   2e-71   
ref|XP_008371813.1|  PREDICTED: expansin-A4-like                        235   3e-71   
gb|AAR82850.1|  expansin-2                                              235   3e-71   Petunia x hybrida [garden petunia]
ref|XP_007205740.1|  hypothetical protein PRUPE_ppa010180mg             235   3e-71   
ref|XP_010521846.1|  PREDICTED: expansin-A6                             234   3e-71   
ref|XP_008240857.1|  PREDICTED: expansin-A6-like                        234   3e-71   
ref|XP_009765412.1|  PREDICTED: expansin-A10                            234   4e-71   
gb|AEN70883.1|  alpha-expansin 1                                        234   4e-71   
ref|XP_006440617.1|  hypothetical protein CICLE_v10021897mg             234   5e-71   
gb|AGF90535.1|  alpha-expansin 1                                        233   6e-71   
emb|CDY40233.1|  BnaA09g35150D                                          234   6e-71   
ref|NP_178409.2|  expansin A15                                          233   7e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009760985.1|  PREDICTED: expansin-A10-like                       233   7e-71   
gb|KEH35551.1|  expansin A10                                            233   7e-71   
gb|AAC32927.1|  putative expansin                                       233   8e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004300427.1|  PREDICTED: expansin-A4-like                        233   8e-71   
gb|AEN70867.1|  alpha-expansin 1                                        233   9e-71   
ref|XP_010534508.1|  PREDICTED: expansin-A4                             233   9e-71   
gb|ADY68810.1|  alpha-expansin 1                                        233   9e-71   
ref|XP_009141827.1|  PREDICTED: expansin-A4-like                        233   9e-71   
gb|AEN70868.1|  alpha-expansin 1                                        233   9e-71   
gb|KFK34799.1|  hypothetical protein AALP_AA5G194700                    233   9e-71   
gb|KHG02505.1|  Expansin-A2                                             233   9e-71   
ref|NP_001234881.1|  expansin9 precursor                                233   9e-71   
ref|XP_004970396.1|  PREDICTED: expansin-A2-like                        233   1e-70   
emb|CDP02244.1|  unnamed protein product                                233   1e-70   
gb|ABL86680.1|  EXA1                                                    233   1e-70   Gossypium barbadense [Egyptian cotton]
gb|ABL86681.1|  EX4                                                     233   1e-70   Gossypium barbadense [Egyptian cotton]
gb|AAP48989.1|  expansin                                                233   1e-70   Sambucus nigra
emb|CDX76090.1|  BnaA04g03540D                                          233   1e-70   
gb|AEN70885.1|  alpha-expansin 1                                        233   1e-70   
gb|AEN70869.1|  alpha-expansin 1                                        233   1e-70   
ref|XP_008223717.1|  PREDICTED: expansin-A4                             233   1e-70   
gb|AEN70875.1|  alpha-expansin 1                                        233   1e-70   
gb|AEN70871.1|  alpha-expansin 1                                        233   1e-70   
ref|XP_006477470.1|  PREDICTED: expansin-A1-like                        234   1e-70   
ref|NP_191109.1|  expansin A16                                          233   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009357738.1|  PREDICTED: expansin-A4-like                        233   2e-70   
dbj|BAC67194.1|  expansin                                               233   2e-70   Pyrus communis
dbj|BAC67193.1|  expansin                                               233   2e-70   Pyrus communis
gb|AEN70891.1|  expansin                                                233   2e-70   
dbj|BAJ10398.1|  alpha-expansin                                         232   2e-70   
ref|XP_008777004.1|  PREDICTED: expansin-A4-like                        233   2e-70   
gb|AEN70914.1|  expansin                                                233   2e-70   
gb|AFB77223.1|  expansin 1                                              232   2e-70   
gb|ADY68814.1|  expansin                                                232   2e-70   
ref|XP_007218834.1|  hypothetical protein PRUPE_ppa010198mg             232   2e-70   
ref|XP_010505648.1|  PREDICTED: expansin-A4                             232   2e-70   
gb|ABM66452.1|  expansin                                                232   2e-70   Vicia faba [broad bean]
ref|XP_009589509.1|  PREDICTED: expansin-A10-like                       231   2e-70   
gb|EPS66901.1|  hypothetical protein M569_07876                         231   2e-70   
ref|NP_001288942.1|  expansin-A16 precursor                             232   3e-70   
gb|AEN70881.1|  alpha-expansin 1                                        232   3e-70   
ref|XP_006366709.1|  PREDICTED: expansin-A10-like                       231   3e-70   
gb|ACA05165.1|  expansin 2                                              232   3e-70   Dimocarpus longan [longan]
gb|AFK38068.1|  unknown                                                 232   3e-70   
gb|AAM22625.1|AF428178_1  expansin 11 precursor                         232   3e-70   Rumex palustris
ref|XP_009629442.1|  PREDICTED: expansin-A10-like                       231   3e-70   
ref|XP_002878036.1|  ATEXPA16                                           232   3e-70   
gb|ABD48785.1|  alpha-expansin 1                                        232   3e-70   Gossypium hirsutum [American cotton]
ref|XP_007027486.1|  Alpha-expansin 3 precursor                         233   4e-70   
emb|CDY24952.1|  BnaC03g22200D                                          232   4e-70   
ref|XP_006411198.1|  hypothetical protein EUTSA_v10017119mg             232   4e-70   
gb|KHG28809.1|  Expansin-A5 -like protein                               231   4e-70   
gb|ADY68818.1|  expansin                                                231   4e-70   
ref|XP_003554526.2|  PREDICTED: expansin-A15-like isoform X1            231   4e-70   
ref|XP_010321849.1|  PREDICTED: expansin-A10-like                       231   4e-70   
emb|CDY45181.1|  BnaA06g33850D                                          231   4e-70   
ref|XP_009139160.1|  PREDICTED: expansin-A16-like                       231   4e-70   
ref|XP_010921302.1|  PREDICTED: expansin-A10-like                       231   5e-70   
gb|AEN70887.1|  alpha-expansin 1                                        231   5e-70   
gb|AEN70907.1|  expansin                                                231   5e-70   
ref|XP_011070988.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A10...    231   5e-70   
ref|XP_010256907.1|  PREDICTED: expansin-A4                             231   5e-70   
ref|XP_009409019.1|  PREDICTED: expansin-A4-like                        231   5e-70   
ref|XP_002881669.1|  ATEXPA4                                            231   5e-70   
ref|XP_002876856.1|  ATEXPA15                                           231   5e-70   
ref|XP_009364387.1|  PREDICTED: expansin-A4                             231   6e-70   
ref|XP_002312253.1|  expansin 4 family protein                          231   6e-70   Populus trichocarpa [western balsam poplar]
ref|XP_004302749.1|  PREDICTED: expansin-A4-like                        231   6e-70   
gb|KHN18562.1|  Expansin-A15                                            231   6e-70   
ref|XP_004143121.1|  PREDICTED: expansin-A4-like                        231   6e-70   
ref|XP_007150329.1|  hypothetical protein PHAVU_005G144500g             231   6e-70   
ref|XP_006403453.1|  hypothetical protein EUTSA_v10010989mg             231   6e-70   
gb|ACD37706.1|  alpha expansin                                          231   6e-70   Gossypium hirsutum [American cotton]
ref|XP_009597793.1|  PREDICTED: expansin-A6-like                        231   6e-70   
ref|XP_010517323.1|  PREDICTED: expansin-A4-like                        231   7e-70   
emb|CDY07642.1|  BnaA03g18690D                                          231   7e-70   
gb|ABR17119.1|  unknown                                                 231   7e-70   Picea sitchensis
ref|XP_004981242.1|  PREDICTED: expansin-A7-like                        231   8e-70   
ref|XP_002463623.1|  hypothetical protein SORBIDRAFT_01g003120          231   8e-70   Sorghum bicolor [broomcorn]
gb|ADY68815.1|  expansin                                                231   8e-70   
ref|XP_007016396.1|  Expansin A4, ALPHA 1.6,EXPA4                       231   8e-70   
gb|AEN70901.1|  expansin                                                231   8e-70   
ref|XP_009767600.1|  PREDICTED: expansin-A15-like                       231   8e-70   
ref|XP_008802710.1|  PREDICTED: expansin-A4                             231   8e-70   
ref|XP_002283358.1|  PREDICTED: expansin-A4                             231   8e-70   Vitis vinifera
ref|XP_002988969.1|  hypothetical protein SELMODRAFT_128883             231   9e-70   
ref|XP_006291657.1|  hypothetical protein CARUB_v10017813mg             231   9e-70   
gb|AAM22624.1|AF428177_1  expansin 10 precursor                         231   9e-70   Rumex palustris
gb|ABO32366.1|  expansin                                                230   1e-69   Litchi chinensis [litchi]
gb|ADY68817.1|  expansin                                                231   1e-69   
gb|AFZ78600.1|  expansin protein                                        230   1e-69   
ref|XP_010922313.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A4-...    230   1e-69   
ref|XP_006488339.1|  PREDICTED: expansin-A4-like                        230   1e-69   
ref|XP_010690765.1|  PREDICTED: expansin-A4                             230   1e-69   
ref|XP_008233635.1|  PREDICTED: expansin-A4-like                        230   1e-69   
emb|CDY20467.1|  BnaC04g05770D                                          230   1e-69   
gb|KEH35550.1|  expansin A10                                            230   1e-69   
ref|XP_006424843.1|  hypothetical protein CICLE_v10029094mg             230   1e-69   
ref|XP_009780854.1|  PREDICTED: expansin-A4-like                        230   1e-69   
ref|XP_011098644.1|  PREDICTED: expansin-A10                            229   1e-69   
ref|XP_002284858.1|  PREDICTED: expansin-A1                             230   1e-69   Vitis vinifera
gb|AAR09170.1|  alpha-expansin 3                                        230   1e-69   Populus tremula x Populus tremuloides
gb|ACT67493.1|  expansin A1                                             230   1e-69   Raphanus sativus
ref|XP_010043542.1|  PREDICTED: expansin-A4-like                        230   1e-69   
ref|XP_009409516.1|  PREDICTED: expansin-A6-like                        230   1e-69   
gb|AAM22626.1|AF428179_1  expansin 12 precursor                         230   1e-69   Rumex palustris
ref|XP_008357089.1|  PREDICTED: expansin-A6                             230   1e-69   
gb|KCW83632.1|  hypothetical protein EUGRSUZ_B00524                     229   2e-69   
ref|XP_009143296.1|  PREDICTED: expansin-A4-like                        230   2e-69   
ref|XP_008464122.1|  PREDICTED: expansin-A4                             230   2e-69   
ref|XP_010030057.1|  PREDICTED: expansin-A15-like                       230   2e-69   
gb|AAC96081.1|  alpha-expansin precursor                                230   2e-69   Nicotiana tabacum [American tobacco]
dbj|BAH36862.1|  alpha expansin                                         230   2e-69   Rosa hybrid cultivar
ref|XP_011027216.1|  PREDICTED: expansin-A4                             230   2e-69   
ref|XP_010508990.1|  PREDICTED: expansin-A4-like                        230   2e-69   
ref|XP_004486999.1|  PREDICTED: expansin-A6-like                        230   2e-69   
ref|XP_010425091.1|  PREDICTED: expansin-A15-like                       230   2e-69   
ref|XP_007141864.1|  hypothetical protein PHAVU_008G232200g             230   2e-69   
emb|CAN73252.1|  hypothetical protein VITISV_027049                     229   2e-69   Vitis vinifera
ref|XP_010258311.1|  PREDICTED: expansin-A1 isoform X2                  229   2e-69   
ref|XP_002522457.1|  Alpha-expansin 1 precursor, putative               229   2e-69   Ricinus communis
ref|XP_010258310.1|  PREDICTED: expansin-A1 isoform X1                  229   2e-69   
ref|XP_007205748.1|  hypothetical protein PRUPE_ppa010226mg             229   2e-69   
gb|AAM47000.1|AF512542_1  alpha-expansin precursor                      230   2e-69   Gossypium hirsutum [American cotton]
gb|ADY68811.1|  alpha-expansin 1                                        229   2e-69   
ref|XP_002315218.1|  alpha-expansin 9 precursor family protein          229   2e-69   Populus trichocarpa [western balsam poplar]
ref|XP_009594513.1|  PREDICTED: expansin-A4-like                        229   2e-69   
ref|XP_006846223.1|  hypothetical protein AMTR_s00012p00230920          229   2e-69   
gb|AAY43797.1|  expansin                                                229   2e-69   Gossypium hirsutum [American cotton]
gb|AAO92741.1|  expansin                                                229   3e-69   Gossypium hirsutum [American cotton]
ref|XP_010528418.1|  PREDICTED: expansin-A3                             230   3e-69   
ref|XP_006294843.1|  hypothetical protein CARUB_v10023894mg             229   3e-69   
ref|XP_007162798.1|  hypothetical protein PHAVU_001G181600g             230   3e-69   
ref|XP_011075523.1|  PREDICTED: expansin-A10                            229   3e-69   
ref|NP_181500.1|  expansin A4                                           229   3e-69   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001288907.1|  expansin-A15-like precursor                        229   3e-69   
ref|XP_008387521.1|  PREDICTED: expansin-A9-like                        231   3e-69   
ref|NP_001242978.1|  expansin-A4-like precursor                         229   3e-69   
gb|AFZ78605.1|  expansin protein                                        229   3e-69   
gb|ABB59694.1|  alpha-expansin 2                                        229   3e-69   Gossypium hirsutum [American cotton]
gb|KHN26255.1|  Expansin-A15                                            228   3e-69   
ref|XP_010033123.1|  PREDICTED: expansin-A4                             229   3e-69   
ref|XP_002456550.1|  hypothetical protein SORBIDRAFT_03g038290          229   3e-69   Sorghum bicolor [broomcorn]
gb|AEN70895.1|  expansin                                                229   4e-69   
ref|XP_002309181.2|  hypothetical protein POPTR_0006s10850g             229   4e-69   Populus trichocarpa [western balsam poplar]
ref|XP_011089478.1|  PREDICTED: expansin-A6                             229   4e-69   
ref|XP_008387765.1|  PREDICTED: expansin-A4-like                        229   4e-69   
gb|AAM46997.1|AF512539_1  alpha-expansin precursor                      229   4e-69   Gossypium hirsutum [American cotton]
ref|XP_010427324.1|  PREDICTED: expansin-A16-like                       229   4e-69   
ref|NP_001105040.1|  alpha expansin1 precursor                          229   4e-69   Zea mays [maize]
ref|XP_010093601.1|  hypothetical protein L484_006489                   229   4e-69   
ref|XP_009761115.1|  PREDICTED: expansin-A6-like                        229   4e-69   
ref|XP_011048141.1|  PREDICTED: expansin-A15-like                       229   4e-69   
ref|XP_007009225.1|  Expansin A4, ALPHA 1.6,EXPA4                       229   4e-69   
ref|XP_007205762.1|  hypothetical protein PRUPE_ppa010314mg             229   4e-69   
ref|XP_002315043.1|  expansin 4 family protein                          229   4e-69   Populus trichocarpa [western balsam poplar]
ref|XP_008367551.1|  PREDICTED: expansin-A1-like                        229   4e-69   
ref|XP_006435913.1|  hypothetical protein CICLE_v10032524mg             229   5e-69   
ref|XP_004249536.1|  PREDICTED: expansin-A6-like                        229   5e-69   
ref|XP_010532011.1|  PREDICTED: expansin-A4-like                        229   5e-69   
gb|AEN70900.1|  expansin                                                229   5e-69   
emb|CDY69611.1|  BnaCnng64440D                                          229   5e-69   
ref|XP_004304289.1|  PREDICTED: expansin-A15-like                       228   5e-69   
ref|NP_001288961.1|  expansin-A4 precursor                              229   5e-69   
gb|AEQ55274.1|  expansin                                                229   5e-69   
ref|XP_010502317.1|  PREDICTED: expansin-A15                            229   5e-69   
dbj|BAC67192.1|  expansin                                               229   5e-69   Pyrus communis
dbj|BAH36863.1|  alpha expansin                                         228   5e-69   Rosa hybrid cultivar
gb|ACM90160.1|  expansin 2                                              229   5e-69   Pyrus pyrifolia [sha li]
ref|XP_011031225.1|  PREDICTED: expansin-A4-like                        229   5e-69   
emb|CDY02943.1|  BnaC04g25430D                                          229   5e-69   
dbj|BAE06067.1|  expansin                                               229   5e-69   Sagittaria pygmaea
ref|XP_008384848.1|  PREDICTED: expansin-A4                             229   5e-69   
gb|KDP44940.1|  hypothetical protein JCGZ_01440                         229   5e-69   
gb|KDP31268.1|  hypothetical protein JCGZ_11644                         228   5e-69   
ref|XP_010106493.1|  hypothetical protein L484_025251                   229   5e-69   
ref|XP_010066900.1|  PREDICTED: expansin-A1                             228   6e-69   
gb|KEH39447.1|  expansin A10                                            229   6e-69   
ref|XP_002298353.1|  alpha-expansin 1 family protein                    229   6e-69   Populus trichocarpa [western balsam poplar]
gb|AAC33529.1|  expansin                                                228   6e-69   Prunus armeniaca
gb|AEQ55273.1|  expansin                                                228   6e-69   
gb|AFK48363.1|  unknown                                                 228   6e-69   
emb|CDP12277.1|  unnamed protein product                                228   6e-69   
ref|XP_011019014.1|  PREDICTED: expansin-A8-like                        228   6e-69   
ref|XP_002514740.1|  Alpha-expansin 15 precursor, putative              228   6e-69   Ricinus communis
emb|CAH18933.1|  expansin                                               228   6e-69   Pyrus communis
ref|XP_004240235.1|  PREDICTED: expansin-A8-like                        228   7e-69   
ref|XP_010516124.1|  PREDICTED: expansin-A16                            228   7e-69   
gb|AEN70893.1|  expansin                                                228   7e-69   
ref|XP_010931278.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A7        228   7e-69   
gb|AAF35902.1|AF230333_1  expansin 3                                    228   7e-69   Zinnia violacea [garden zinnia]
ref|XP_006600699.1|  PREDICTED: expansin-A15-like isoform X2            228   7e-69   
gb|KEH33311.1|  expansin A10                                            228   7e-69   
ref|NP_001266044.1|  expansin-A5-like precursor                         228   7e-69   
ref|XP_009360325.1|  PREDICTED: expansin-A1                             228   8e-69   
emb|CDM84787.1|  unnamed protein product                                228   8e-69   
gb|ADC35365.1|  alpha-expansin 2                                        228   8e-69   Coffea arabica [arabica coffee]
gb|ACG46282.1|  alpha-expansin 6 precursor                              229   8e-69   Zea mays [maize]
ref|XP_010257816.1|  PREDICTED: expansin-A1                             228   8e-69   
gb|AAQ08016.1|  expansin                                                228   8e-69   Melilotus albus
ref|XP_006365348.1|  PREDICTED: expansin-A8-like                        228   9e-69   
ref|XP_009141922.1|  PREDICTED: expansin-A8-like                        228   9e-69   
ref|XP_009398502.1|  PREDICTED: expansin-A7-like                        228   9e-69   
emb|CDP09064.1|  unnamed protein product                                228   9e-69   
emb|CDY03019.1|  BnaC07g22080D                                          228   1e-68   
gb|EYU35820.1|  hypothetical protein MIMGU_mgv1a012373mg                228   1e-68   
ref|XP_007027012.1|  Expansin A4, ALPHA 1.6,EXPA4                       228   1e-68   
gb|AAL87022.1|  cell wall protein EXP3 precursor                        228   1e-68   Mirabilis jalapa
gb|KDP35637.1|  hypothetical protein JCGZ_09075                         228   1e-68   
gb|AAG13982.1|AF297521_1  expansin 1                                    228   1e-68   Prunus avium [gean]
ref|XP_003549683.2|  PREDICTED: expansin-A15-like isoform X1            228   1e-68   
gb|KEH34458.1|  expansin A10                                            228   1e-68   
ref|XP_009622932.1|  PREDICTED: expansin-A8-like                        228   1e-68   
ref|XP_008461679.1|  PREDICTED: expansin-A4                             228   1e-68   
ref|NP_001234165.1|  expansin precursor                                 228   1e-68   
gb|AEQ55271.1|  expansin                                                228   1e-68   
emb|CAN79985.1|  hypothetical protein VITISV_038036                     228   1e-68   Vitis vinifera
ref|XP_006395739.1|  hypothetical protein EUTSA_v10004804mg             228   1e-68   
ref|NP_001062516.1|  Os08g0561900                                       228   1e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004961745.1|  PREDICTED: expansin-A4-like                        227   1e-68   
gb|KEH22886.1|  expansin-A1-like protein                                228   1e-68   
gb|KHG18125.1|  Expansin-A10 -like protein                              227   1e-68   
gb|ACK43223.1|  alpha-expansin                                          227   1e-68   Ziziphus jujuba [Chinese jujube]
ref|XP_006435550.1|  hypothetical protein CICLE_v10032484mg             228   1e-68   
gb|ABK22806.1|  unknown                                                 227   2e-68   Picea sitchensis
ref|XP_003552923.2|  PREDICTED: expansin-A3-like                        228   2e-68   
ref|XP_009341751.1|  PREDICTED: expansin-A4-like                        228   2e-68   
ref|XP_002283530.1|  PREDICTED: expansin-A4                             228   2e-68   
ref|XP_006366490.1|  PREDICTED: expansin-A6                             228   2e-68   
gb|AAS99354.1|  expansin 1 precursor                                    228   2e-68   
gb|AEQ55276.1|  expansin                                                227   2e-68   
gb|KDP20458.1|  hypothetical protein JCGZ_05303                         228   2e-68   
ref|XP_010937609.1|  PREDICTED: expansin-A4                             228   2e-68   
ref|XP_009353647.1|  PREDICTED: expansin-A6-like                        228   2e-68   
ref|XP_009399925.1|  PREDICTED: expansin-A15-like                       227   2e-68   
emb|CDY24897.1|  BnaC03g22750D                                          227   2e-68   
gb|KHG29956.1|  Expansin-A4 -like protein                               227   2e-68   
emb|CBI15209.3|  unnamed protein product                                229   2e-68   
ref|XP_007138173.1|  hypothetical protein PHAVU_009G186400g             227   2e-68   
ref|XP_009631918.1|  PREDICTED: expansin-A4-like                        228   2e-68   
ref|NP_001288852.1|  expansin-A3 precursor                              228   2e-68   
ref|XP_002312101.1|  alpha-expansin 9 precursor family protein          227   2e-68   
ref|XP_011035307.1|  PREDICTED: expansin-A6                             227   2e-68   
ref|XP_009349313.1|  PREDICTED: expansin-A6-like                        227   2e-68   
ref|NP_001288899.1|  expansin-A6 precursor                              227   2e-68   
ref|XP_010920576.1|  PREDICTED: expansin-A4-like                        227   2e-68   
gb|EAZ43667.1|  hypothetical protein OsJ_28292                          228   2e-68   
emb|CDM84777.1|  unnamed protein product                                227   2e-68   
gb|AAL87025.1|  cell wall protein Exp1 precursor                        227   2e-68   
ref|XP_003518007.1|  PREDICTED: expansin-A1-like                        227   2e-68   
gb|AAD47901.1|AF085330_1  expansin                                      227   2e-68   
ref|XP_010505357.1|  PREDICTED: expansin-A3-like                        227   3e-68   
ref|XP_006445551.1|  hypothetical protein CICLE_v10017738mg             226   3e-68   
gb|AAM12782.1|  putative expansin                                       226   3e-68   
ref|XP_007017076.1|  Expansin A8, ALPHA 1.11,EXPA8                      227   3e-68   
gb|ACA05166.1|  expansin 3                                              227   3e-68   
ref|XP_006350774.1|  PREDICTED: expansin-A6                             227   3e-68   
ref|XP_009339059.1|  PREDICTED: expansin-A1-like                        227   3e-68   
ref|XP_010415602.1|  PREDICTED: expansin-A1-like                        227   3e-68   
gb|AEQ55290.1|  expansin                                                227   3e-68   
gb|ABA62612.1|  expansin                                                227   3e-68   
gb|EAZ08022.1|  hypothetical protein OsI_30286                          227   3e-68   
ref|XP_010504408.1|  PREDICTED: expansin-A16-like                       227   3e-68   
emb|CDX74942.1|  BnaA05g06880D                                          227   3e-68   
ref|XP_008393347.1|  PREDICTED: expansin-A1-like                        226   3e-68   
gb|ABN09939.1|  expansin A4                                             227   3e-68   
ref|XP_008370248.1|  PREDICTED: expansin-A4-like                        227   3e-68   
ref|XP_009129104.1|  PREDICTED: expansin-A15                            226   3e-68   
ref|XP_006302737.1|  hypothetical protein CARUB_v10020849mg             226   3e-68   
gb|AAR09168.1|  alpha-expansin 1                                        227   3e-68   
ref|XP_004142066.1|  PREDICTED: expansin-A4-like                        227   3e-68   
ref|XP_003544930.1|  PREDICTED: expansin-A8                             226   3e-68   
gb|KHG20113.1|  Expansin-A4 -like protein                               227   3e-68   
ref|NP_001284471.1|  expansin-A4 precursor                              227   3e-68   
gb|AFB77224.1|  expansin 2                                              226   3e-68   
gb|AEQ55275.1|  expansin                                                227   3e-68   
ref|XP_004297292.1|  PREDICTED: expansin-A1-like                        226   3e-68   
ref|NP_181300.1|  expansin-A3                                           227   3e-68   
gb|AAG13983.1|AF297522_1  expansin 2                                    226   4e-68   
ref|XP_007158645.1|  hypothetical protein PHAVU_002G170300g             228   4e-68   
ref|XP_010517036.1|  PREDICTED: expansin-A3                             227   4e-68   
gb|AFZ78606.1|  expansin protein                                        227   4e-68   
gb|KHG01029.1|  Expansin-A15 -like protein                              226   4e-68   
ref|XP_008354429.1|  PREDICTED: expansin-A4-like                        226   4e-68   
ref|XP_003537990.1|  PREDICTED: expansin-A4-like                        226   4e-68   
ref|XP_008242138.1|  PREDICTED: expansin-A8-like                        226   4e-68   
gb|AGU13763.1|  expansin                                                226   4e-68   
ref|XP_003543517.1|  PREDICTED: expansin-A4                             226   4e-68   
ref|XP_010917068.1|  PREDICTED: expansin-A10-like                       226   4e-68   
ref|XP_008363931.1|  PREDICTED: expansin-A4-like                        226   4e-68   
ref|XP_004517024.1|  PREDICTED: expansin-A15-like                       226   4e-68   
ref|XP_010670609.1|  PREDICTED: expansin-A4                             226   4e-68   
ref|XP_009404081.1|  PREDICTED: expansin-A15                            226   4e-68   
ref|XP_006409928.1|  hypothetical protein EUTSA_v10017116mg             226   4e-68   
gb|AFQ21787.1|  EXP4 protein                                            226   5e-68   
ref|XP_004147685.1|  PREDICTED: expansin-A4-like                        226   5e-68   
gb|AAC39512.1|  expansin                                                226   5e-68   
gb|ACI02326.1|  expansion-related protein                               226   5e-68   
ref|XP_009387743.1|  PREDICTED: expansin-A2-like                        226   5e-68   
ref|XP_008241367.1|  PREDICTED: expansin-A9-like                        227   5e-68   
ref|XP_009788740.1|  PREDICTED: expansin-A3-like                        226   5e-68   
ref|XP_010111142.1|  hypothetical protein L484_010756                   226   5e-68   
gb|KDP21654.1|  hypothetical protein JCGZ_03325                         226   5e-68   
gb|EYU22406.1|  hypothetical protein MIMGU_mgv1a012585mg                226   6e-68   
gb|ACJ85313.1|  unknown                                                 226   6e-68   
gb|AFK39658.1|  unknown                                                 226   6e-68   
gb|AAV85475.1|  expansin                                                226   6e-68   
ref|XP_008366663.1|  PREDICTED: expansin-A9-like                        227   6e-68   
dbj|BAK05504.1|  predicted protein                                      226   6e-68   
ref|XP_002532867.1|  Alpha-expansin 8 precursor, putative               226   6e-68   
ref|NP_001055842.1|  Os05g0477600                                       226   6e-68   
ref|XP_003564501.1|  PREDICTED: expansin-A2                             226   6e-68   
emb|CDY31742.1|  BnaA04g16780D                                          226   6e-68   
ref|XP_010470942.1|  PREDICTED: expansin-A1-like                        226   7e-68   
gb|KFK42332.1|  hypothetical protein AALP_AA2G242600                    226   7e-68   
gb|ACF84785.1|  unknown                                                 226   7e-68   
gb|KCW65541.1|  hypothetical protein EUGRSUZ_G02938                     226   7e-68   
ref|NP_001275780.1|  expansin 2 precursor                               226   7e-68   
ref|XP_003538409.1|  PREDICTED: expansin-A6                             226   7e-68   
ref|XP_010044491.1|  PREDICTED: expansin-A1-like                        225   8e-68   
gb|KFK36856.1|  hypothetical protein AALP_AA4G180600                    226   8e-68   
gb|AAM62937.1|  Alpha-expansin 4 precursor (At-EXP4) (AtEx4) (Ath...    226   8e-68   
gb|AFK34543.1|  unknown                                                 225   8e-68   
gb|AAB81662.1|  expansin                                                225   8e-68   
ref|XP_002887242.1|  ATEXPA1                                            225   8e-68   
ref|XP_008230781.1|  PREDICTED: expansin-A15                            225   8e-68   
gb|ACK36943.1|  expansin                                                226   8e-68   
ref|XP_006341021.1|  PREDICTED: expansin-A3                             226   9e-68   
ref|XP_008784594.1|  PREDICTED: expansin-A4-like                        226   9e-68   
ref|XP_008797331.1|  PREDICTED: expansin-A15-like                       225   9e-68   
ref|XP_002981865.1|  hypothetical protein SELMODRAFT_179212             226   9e-68   
ref|NP_001051731.1|  Os03g0822000                                       226   9e-68   
gb|ACJ48968.2|  expansin                                                226   9e-68   
gb|ACO07292.1|  expansin 10                                             226   9e-68   
ref|XP_009122138.1|  PREDICTED: expansin-A2                             225   9e-68   
ref|XP_007099524.1|  Expansin A8, ALPHA 1.11,EXPA8                      226   9e-68   
ref|XP_010031088.1|  PREDICTED: expansin-A8-like                        225   1e-67   
ref|XP_009381075.1|  PREDICTED: expansin-A7-like                        225   1e-67   
ref|XP_009346913.1|  PREDICTED: expansin-A4-like                        225   1e-67   
ref|NP_001234761.1|  expansin18 precursor                               226   1e-67   
gb|ABR04073.1|  expansin 1                                              225   1e-67   
gb|KDP27163.1|  hypothetical protein JCGZ_19862                         225   1e-67   
ref|XP_007203396.1|  hypothetical protein PRUPE_ppa021118mg             226   1e-67   
ref|XP_002297611.1|  expansin S1 precursor family protein               225   1e-67   
gb|EPS70210.1|  hypothetical protein M569_04549                         225   1e-67   
ref|NP_001265970.1|  expansin-A8-like precursor                         225   1e-67   
ref|XP_010511994.1|  PREDICTED: expansin-A1                             225   1e-67   
emb|CDX70161.1|  BnaA10g25100D                                          225   1e-67   
dbj|BAO57279.1|  alpha-expansin                                         225   1e-67   
ref|XP_003616026.1|  Expansin                                           225   1e-67   
ref|XP_011077214.1|  PREDICTED: expansin-A6-like                        225   1e-67   
gb|ABK93541.1|  unknown                                                 225   1e-67   
ref|XP_009757427.1|  PREDICTED: expansin-A4-like                        225   1e-67   
ref|NP_001240136.1|  expansin-A1-like precursor                         225   1e-67   
dbj|BAD00017.1|  expansin                                               224   1e-67   
gb|KDP22771.1|  hypothetical protein JCGZ_00358                         225   1e-67   
gb|AAM47002.1|AF512544_1  alpha-expansin precursor                      225   1e-67   
ref|XP_006338442.1|  PREDICTED: expansin-A10-like                       226   1e-67   
gb|AAM22621.1|  expansin 7 precursor                                    225   1e-67   
ref|XP_002313434.1|  alpha-expansin 1 family protein                    225   1e-67   
emb|CDP00110.1|  unnamed protein product                                225   1e-67   
gb|AGF90536.1|  expansin 2                                              224   2e-67   
ref|XP_006438715.1|  hypothetical protein CICLE_v10032548mg             224   2e-67   
ref|XP_011080662.1|  PREDICTED: expansin-A4-like                        225   2e-67   
gb|ABR18394.1|  unknown                                                 224   2e-67   
ref|XP_008462508.1|  PREDICTED: expansin-A9-like                        226   2e-67   
ref|XP_010938009.1|  PREDICTED: expansin-A2-like                        225   2e-67   
ref|XP_006358751.1|  PREDICTED: expansin-A8                             224   2e-67   
ref|XP_004490713.1|  PREDICTED: expansin-A8-like                        224   2e-67   
ref|XP_007215892.1|  hypothetical protein PRUPE_ppa010654mg             224   2e-67   
ref|XP_010264435.1|  PREDICTED: expansin-A4                             225   2e-67   
gb|ACN94264.1|  expansin                                                225   2e-67   
ref|XP_011094866.1|  PREDICTED: expansin-A6                             225   2e-67   
emb|CDY64407.1|  BnaC02g47920D                                          224   2e-67   
gb|ABN09940.1|  expansin A5                                             225   2e-67   
ref|XP_009613959.1|  PREDICTED: expansin-A6-like                        225   2e-67   
ref|XP_003607738.1|  Expansin                                           226   2e-67   
gb|ACJ84647.1|  unknown                                                 224   2e-67   
ref|NP_177112.1|  expansin A1                                           224   2e-67   
ref|XP_003538280.1|  PREDICTED: expansin-A8                             224   2e-67   
gb|AEE69071.1|  expansin-4                                              224   2e-67   
ref|NP_001288831.1|  expansin precursor                                 224   2e-67   
ref|XP_002881524.1|  ATEXPA3                                            224   2e-67   
ref|XP_010554612.1|  PREDICTED: expansin-A4                             224   2e-67   
ref|XP_006650810.1|  PREDICTED: expansin-A7-like                        225   2e-67   
ref|XP_010098821.1|  hypothetical protein L484_022586                   225   2e-67   
ref|XP_002283741.1|  PREDICTED: expansin-A10                            224   2e-67   
ref|XP_009369278.1|  PREDICTED: expansin-A1-like                        224   2e-67   
gb|KFK33492.1|  hypothetical protein AALP_AA5G020100                    224   2e-67   
gb|ABN09942.1|  expansin A5                                             224   2e-67   
ref|XP_003621257.1|  Alpha-expansin                                     224   3e-67   
ref|XP_010067412.1|  PREDICTED: expansin-A4                             226   3e-67   
ref|XP_007046062.1|  Expansin A1, ALPHA 1.2,EXPA1                       229   3e-67   
ref|XP_008782645.1|  PREDICTED: expansin-A2-like                        224   3e-67   
ref|XP_010108480.1|  hypothetical protein L484_010673                   224   3e-67   
gb|AFK41150.1|  unknown                                                 224   3e-67   
ref|XP_003529476.1|  PREDICTED: expansin-A15-like                       224   3e-67   
ref|XP_009388613.1|  PREDICTED: expansin-A7                             224   3e-67   
ref|XP_009384320.1|  PREDICTED: expansin-A2-like                        224   3e-67   
gb|EYU18981.1|  hypothetical protein MIMGU_mgv1a012125mg                224   3e-67   
ref|XP_002309061.1|  expansin family protein                            224   3e-67   
ref|NP_001289251.1|  expansin-A4-like precursor                         224   3e-67   
ref|XP_010103644.1|  hypothetical protein L484_011237                   224   3e-67   
ref|XP_009419260.1|  PREDICTED: expansin-A7-like                        224   3e-67   
ref|XP_008389456.1|  PREDICTED: expansin-A10                            224   3e-67   
gb|KHN04238.1|  Expansin-A8                                             224   3e-67   
ref|XP_010525408.1|  PREDICTED: expansin-A8                             224   3e-67   
gb|AAD49956.1|AF167360_1  expansin                                      224   3e-67   
gb|ACK43222.1|  expansin 2                                              224   3e-67   
gb|KHG12430.1|  Expansin-A4 -like protein                               224   3e-67   
ref|XP_009142702.1|  PREDICTED: expansin-A8                             224   3e-67   
ref|XP_011042710.1|  PREDICTED: expansin-A4-like                        224   4e-67   
ref|NP_001234081.1|  expansin A4 precursor                              224   4e-67   
gb|KHN48407.1|  Expansin-A8                                             224   4e-67   
ref|XP_006431177.1|  hypothetical protein CICLE_v10012611mg             223   4e-67   
ref|XP_006429095.1|  hypothetical protein CICLE_v10012518mg             224   4e-67   
ref|XP_001761996.1|  predicted protein                                  224   4e-67   
ref|XP_010276443.1|  PREDICTED: expansin-A15-like                       223   4e-67   
gb|ABJ90221.1|  expansin 2                                              224   4e-67   
emb|CDX77222.1|  BnaC04g40170D                                          224   4e-67   
ref|XP_006654542.1|  PREDICTED: expansin-A4-like                        223   4e-67   
ref|XP_003616412.1|  Expansin                                           224   4e-67   
ref|XP_002523388.1|  Alpha-expansin 1 precursor, putative               223   4e-67   
ref|XP_002266625.1|  PREDICTED: expansin-A6                             224   4e-67   
ref|XP_009776279.1|  PREDICTED: expansin-A8-like isoform X1             224   4e-67   
ref|XP_008457477.1|  PREDICTED: expansin-A4-like                        224   4e-67   
ref|XP_003544219.1|  PREDICTED: expansin-A6-like                        224   4e-67   
gb|EYU46016.1|  hypothetical protein MIMGU_mgv1a012336mg                224   4e-67   
ref|XP_004302596.1|  PREDICTED: expansin-A2-like                        224   4e-67   
ref|XP_002975078.1|  hypothetical protein SELMODRAFT_102623             224   4e-67   
gb|KDO72599.1|  hypothetical protein CISIN_1g026331mg                   223   4e-67   
gb|ABM54492.1|  expansin 2                                              224   5e-67   
gb|AEE69072.1|  expansin-5                                              224   5e-67   
dbj|BAC67191.1|  expansin                                               223   5e-67   
ref|XP_006339024.1|  PREDICTED: expansin-A3-like                        223   5e-67   
ref|XP_009410516.1|  PREDICTED: expansin-A4-like                        223   5e-67   
ref|XP_010257730.1|  PREDICTED: expansin-A15-like                       223   5e-67   
gb|KDO49685.1|  hypothetical protein CISIN_1g025193mg                   223   5e-67   
ref|XP_003613849.1|  Expansin                                           223   5e-67   
ref|XP_009374380.1|  PREDICTED: expansin-A4-like                        223   5e-67   
dbj|BAJ10397.1|  alpha-expansin                                         223   5e-67   
emb|CBI16120.3|  unnamed protein product                                224   6e-67   
ref|XP_004307732.1|  PREDICTED: expansin-A8-like                        223   6e-67   
gb|AIG88581.1|  expansin                                                223   6e-67   
gb|KFK36651.1|  alpha-expansin 4                                        224   6e-67   
gb|AAM46998.1|AF512540_1  alpha-expansin precursor                      223   6e-67   
ref|XP_009768238.1|  PREDICTED: expansin-A6-like                        223   6e-67   
ref|XP_003519349.1|  PREDICTED: expansin-A4-like                        223   6e-67   



>ref|XP_003609913.1| Expansin [Medicago truncatula]
 gb|AES92110.1| expansin A1 [Medicago truncatula]
Length=284

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 163/226 (72%), Gaps = 7/226 (3%)
 Frame = +2

Query  209  AHGWLDAHATFYGPPEGTIGGACGLEQF-KETYSPYttalsaalfnnaasCGACYEIKCV  385
            A  W  AHATFY    GT GGACG E   K+ Y   T A+S  LFN   +CGACYEI+CV
Sbjct  58   AGSWKKAHATFYEGGSGTFGGACGYEDVVKDGYGLDTAAVSTVLFNKGLACGACYEIRCV  117

Query  386  NSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVV  547
            +S   CK  Q  I VTATDLCP      + +G WC PP+ HFDL+ PAYL+IAEYKAG++
Sbjct  118  DSPQGCKPGQASIKVTATDLCPPNFAQSSENGGWCNPPREHFDLAKPAYLKIAEYKAGII  177

Query  548  PVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWG  727
            PV YRRVPC R+GG  FT++G+ +FNL+ V+NVGG+GDV KV+V  E +  W  LKRNWG
Sbjct  178  PVQYRRVPCKRQGGIHFTITGNPYFNLIKVANVGGAGDVVKVQVKGEDKLTWTDLKRNWG  237

Query  728  EKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRN  865
            EKWET AML+G++L F+VTT+DG+ +TS+ + PK WQ+GQTF G+N
Sbjct  238  EKWETGAMLTGETLTFKVTTSDGRCITSERITPKGWQFGQTFVGKN  283



>ref|XP_002266243.1| PREDICTED: expansin-A4 [Vitis vinifera]
Length=272

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 166/222 (75%), Gaps = 4/222 (2%)
 Frame = +2

Query  218  WLDAHATFYGPPEG--TIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCVN  388
            W +AHATFYG  +   T+GGACG  +  K+ Y   T ALS  LFN   +CGAC+EIKCV+
Sbjct  51   WHNAHATFYGGADASQTMGGACGYGDLHKQGYGVQTAALSTVLFNGGQACGACFEIKCVD  110

Query  389  STGQCKTPQKPIIVTATDLCP-TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRR  565
                CK  Q  ++VTAT+LCP + +G WC PP+ HFDLS PA+LQIAEYKAG+VPV YRR
Sbjct  111  DPQGCKRGQASLMVTATNLCPPSSNGGWCNPPREHFDLSQPAFLQIAEYKAGIVPVQYRR  170

Query  566  VPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETN  745
            VPC +KGG RFT+SG+ +FNLV + NVGG+GD++ V+V  + + KW  LKRNWG+ WET+
Sbjct  171  VPCKKKGGIRFTISGNPYFNLVFIWNVGGAGDITSVQVKGDRKLKWTTLKRNWGQNWETD  230

Query  746  AMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
            AML G+SL FRV  +DG+  TS ++APK+WQ+GQTFEG+N +
Sbjct  231  AMLVGESLTFRVRVSDGRYSTSWHIAPKNWQFGQTFEGKNFK  272



>emb|CAN73461.1| hypothetical protein VITISV_033906 [Vitis vinifera]
Length=272

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 166/222 (75%), Gaps = 4/222 (2%)
 Frame = +2

Query  218  WLDAHATFYGPPEG--TIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCVN  388
            W +AHATFYG  +   T+GGACG  +  K+ Y   T ALS  LFN   +CGAC+EIKCV+
Sbjct  51   WHNAHATFYGGADASQTMGGACGYGDLHKQGYGVQTAALSTVLFNGGQACGACFEIKCVD  110

Query  389  STGQCKTPQKPIIVTATDLCP-TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRR  565
                CK  Q  ++VTAT+LCP + +G WC PP+ HFDLS PA+LQIAEYKAG+VPV YRR
Sbjct  111  DPQGCKRGQASLMVTATNLCPPSSNGGWCNPPREHFDLSQPAFLQIAEYKAGIVPVQYRR  170

Query  566  VPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETN  745
            VPC +KGG RFT+SG+ +FNLV + NVGG+GD++ V+V  + + KW  LKRNWG+ WET+
Sbjct  171  VPCKKKGGIRFTISGNPYFNLVFIWNVGGAGDITSVQVKGDRKLKWTTLKRNWGQNWETD  230

Query  746  AMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
            AML G+SL FRV  +DG+  TS ++APK+WQ+GQTFEG+N +
Sbjct  231  AMLVGESLTFRVRXSDGRYSTSWHIAPKNWQFGQTFEGKNFK  272



>emb|CBI30173.3| unnamed protein product [Vitis vinifera]
Length=336

 Score =   249 bits (637),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 166/222 (75%), Gaps = 4/222 (2%)
 Frame = +2

Query  218  WLDAHATFYGPPEG--TIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCVN  388
            W +AHATFYG  +   T+GGACG  +  K+ Y   T ALS  LFN   +CGAC+EIKCV+
Sbjct  115  WHNAHATFYGGADASQTMGGACGYGDLHKQGYGVQTAALSTVLFNGGQACGACFEIKCVD  174

Query  389  STGQCKTPQKPIIVTATDLCP-TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRR  565
                CK  Q  ++VTAT+LCP + +G WC PP+ HFDLS PA+LQIAEYKAG+VPV YRR
Sbjct  175  DPQGCKRGQASLMVTATNLCPPSSNGGWCNPPREHFDLSQPAFLQIAEYKAGIVPVQYRR  234

Query  566  VPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETN  745
            VPC +KGG RFT+SG+ +FNLV + NVGG+GD++ V+V  + + KW  LKRNWG+ WET+
Sbjct  235  VPCKKKGGIRFTISGNPYFNLVFIWNVGGAGDITSVQVKGDRKLKWTTLKRNWGQNWETD  294

Query  746  AMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
            AML G+SL FRV  +DG+  TS ++APK+WQ+GQTFEG+N +
Sbjct  295  AMLVGESLTFRVRVSDGRYSTSWHIAPKNWQFGQTFEGKNFK  336



>ref|XP_010423881.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/272 (49%), Positives = 182/272 (67%), Gaps = 24/272 (9%)
 Frame = +2

Query  83   MISKKYL*LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--  256
            M +K    ++V+++TA           L V   +P V+ G     W++AHATFYG  +  
Sbjct  1    MAAKVLTLMAVMVVTA-----------LTVNAKIPGVYNGGP---WVNAHATFYGGADAS  46

Query  257  GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVT  433
            GT+GGACG    + + Y   T ALS ALFNN  SCG+C+E+KCVN  G C      I++T
Sbjct  47   GTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILIT  106

Query  434  ATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGER  595
            AT+ CP      + +G WC PP+ HFDL+MP +L IA+YKAG+VPV YRR+PC +KGG R
Sbjct  107  ATNFCPPNFAQASDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIR  166

Query  596  FTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNF  775
            FT++G +FFNLV V+NV G+GDV KV V      +W+ L RNWG+ W++NA+L G+SL+F
Sbjct  167  FTINGFKFFNLVLVTNVAGAGDVRKVSVKGT-NTQWLDLSRNWGQNWQSNAVLVGQSLSF  225

Query  776  RVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
            RV T+DG++ TS N+AP +WQ+GQT+ G+N R
Sbjct  226  RVKTSDGRSSTSNNIAPSNWQFGQTYSGKNFR  257



>ref|XP_002870966.1| ATEXPA9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47225.1| ATEXPA9 [Arabidopsis lyrata subsp. lyrata]
Length=258

 Score =   244 bits (624),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 179/264 (68%), Gaps = 24/264 (9%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            ++V+++TA             V   +P V+ G     W++AHATFYG  +  GT+GGACG
Sbjct  9    MAVMVVTA-----------FTVNAKIPGVYTGGP---WINAHATFYGEADASGTMGGACG  54

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCG+CYE+KCVN  G C      I+VTAT+ CP  
Sbjct  55   YGNLYSQGYGVNTAALSTALFNNGLSCGSCYELKCVNDPGWCLPGNPSILVTATNFCPPN  114

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                + DG WC PP+ HFDL+MP +L IA+YKAG+VPV YRR+PC +KGG RFT++G ++
Sbjct  115  FNQASDDGGWCNPPREHFDLAMPMFLTIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKY  174

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV V+NV G+GDV+KV V      +W+ L RNWG+ W++NA+L G+SL+FRV T+DG+
Sbjct  175  FNLVLVTNVAGAGDVNKVSVKGT-NTQWLDLSRNWGQNWQSNAVLIGQSLSFRVKTSDGR  233

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
            + TS N+AP +WQ+GQT+ G+N R
Sbjct  234  SSTSNNIAPSNWQFGQTYSGKNFR  257



>ref|XP_010558331.1| PREDICTED: expansin-A9 [Tarenaya hassleriana]
Length=268

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 134/273 (49%), Positives = 184/273 (67%), Gaps = 17/273 (6%)
 Frame = +2

Query  83   MISKKYL*LSVLIITAAMATELQASILLI-VLCALPCVFGGDSAHGWLDAHATFYGPPE-  256
            M S+ Y    VL+   A+   + AS L   V   +P V+ G     W+DAHATFYG  + 
Sbjct  1    MASESY---RVLMKLVAVVPAVTASFLAAEVDAKIPGVYSGGP---WIDAHATFYGGADA  54

Query  257  -GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIV  430
             GT+GGACG    + + Y   T ALS ALFNN  SCGAC+E+KC++    C      I++
Sbjct  55   SGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCIDDPRWCLPGNPSILI  114

Query  431  TATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGE  592
            TAT+ CP      + +G WC PP+ HFDL+MP +L++A+YKAG+VPV YRRVPC +KGG 
Sbjct  115  TATNFCPPNFAQASDNGGWCNPPREHFDLAMPMFLKLAQYKAGIVPVSYRRVPCRKKGGI  174

Query  593  RFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLN  772
            RFT++G ++FNLV V+NV G+GDV KV V     E W+ + RNWG+ W++NA+L G++L+
Sbjct  175  RFTINGFKYFNLVLVTNVAGAGDVVKVSVKGTNTE-WITMSRNWGQNWQSNAVLVGQALS  233

Query  773  FRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
            FRVTT+DG++  S+N+AP SWQ+GQTF G+N R
Sbjct  234  FRVTTSDGRSSASKNIAPPSWQFGQTFSGKNFR  266



>ref|XP_006398690.1| hypothetical protein EUTSA_v10014430mg [Eutrema salsugineum]
 gb|ESQ40143.1| hypothetical protein EUTSA_v10014430mg [Eutrema salsugineum]
Length=261

 Score =   244 bits (623),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/272 (48%), Positives = 182/272 (67%), Gaps = 21/272 (8%)
 Frame = +2

Query  83   MISKKYL*LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--  256
            M +K    ++V+++ A  AT + A I        P V+ G     W++AHATFYG  +  
Sbjct  1    MAAKVITVMAVMVVAALTATTVSAKI--------PGVYTGGP---WVNAHATFYGEADAS  49

Query  257  GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVT  433
            GT+GGACG    + + Y   T ALS ALFNN  SCGAC+E+KCVN  G C      I++T
Sbjct  50   GTMGGACGYGNLYSQGYGVNTAALSTALFNNGVSCGACFELKCVNDPGWCLPGNPSILIT  109

Query  434  ATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGER  595
            AT+ CP      + +G WC PP+ HFDL+MP +L IA+Y+AG+VPV YRR+PC +KGG R
Sbjct  110  ATNFCPPNFAQASDNGGWCNPPREHFDLAMPMFLSIAKYRAGIVPVSYRRIPCRKKGGMR  169

Query  596  FTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNF  775
            FT++G ++FNLV V+NV G+G+V  V V      +W+ L RNWG+ W++NA+L G+SL+F
Sbjct  170  FTINGSKYFNLVLVTNVAGAGNVVSVSVKGS-NTQWMVLSRNWGQNWQSNAILVGQSLSF  228

Query  776  RVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
            RV T+DG++ TS+N+ P +WQ+GQTF G+N R
Sbjct  229  RVRTSDGRSSTSKNIVPSNWQFGQTFSGKNFR  260



>ref|XP_010490643.1| PREDICTED: expansin-A9 [Camelina sativa]
Length=258

 Score =   244 bits (622),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 132/272 (49%), Positives = 180/272 (66%), Gaps = 24/272 (9%)
 Frame = +2

Query  83   MISKKYL*LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--  256
            M +K    ++V+++TA             V   +P V+ G     W +AHATFYG  +  
Sbjct  1    MAAKVLTLMAVMVVTA-----------FTVNAKIPGVYNGGP---WTNAHATFYGEADAS  46

Query  257  GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVT  433
            GT+GGACG    + + Y   T ALS ALFNN  SCG+C+E+KCVN  G C      I++T
Sbjct  47   GTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILIT  106

Query  434  ATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGER  595
            AT+ CP      + +G WC PP+ HFDL+MP +L IA+YKAG+VPV YRR+PC +KGG R
Sbjct  107  ATNFCPPNFAQASDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIR  166

Query  596  FTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNF  775
            FT++G +FFNLV V+NV G+GDV KV V      +W+ L RNWG+ W++NA+L G+SL+F
Sbjct  167  FTINGFKFFNLVLVTNVAGAGDVRKVSVKGT-NTQWLDLSRNWGQNWQSNAVLVGQSLSF  225

Query  776  RVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
            RV T+DG++ TS NVAP +WQ+GQT+ G+N R
Sbjct  226  RVKTSDGRSSTSNNVAPSNWQFGQTYSGKNFR  257



>ref|XP_009130690.1| PREDICTED: expansin-A9-like [Brassica rapa]
 emb|CDY55128.1| BnaA03g55050D [Brassica napus]
Length=261

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 181/272 (67%), Gaps = 21/272 (8%)
 Frame = +2

Query  83   MISKKYL*LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--  256
            M++K    ++++++ A   T + A I        P V+ G     W++AHATFYG  +  
Sbjct  1    MVAKLMTAMAIMVVAALTLTTVNAKI--------PGVYTGGP---WVNAHATFYGEADAS  49

Query  257  GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVT  433
            GT+GGACG    + + Y   T ALS ALFNN  SCGAC+E+KCVN  G C      I++T
Sbjct  50   GTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILIT  109

Query  434  ATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGER  595
            AT+ CP      + +G WC PP+ HFDL+MP +L IA+YKAG+VPV YRR+PC +KGG R
Sbjct  110  ATNFCPPNFAQASDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGMR  169

Query  596  FTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNF  775
            FT++G ++FNLV V+NV G+G+V  V V       W+ L RNWG+ W++NA+L G+SL+F
Sbjct  170  FTINGSKYFNLVLVTNVAGAGNVQMVSVKGS-NTGWLGLSRNWGQNWQSNAILVGQSLSF  228

Query  776  RVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
            RV T+DG++ TS+N+ P +WQ+GQTF G+N R
Sbjct  229  RVKTSDGRSSTSKNIVPSNWQFGQTFSGKNFR  260



>emb|CDX80810.1| BnaC03g00640D [Brassica napus]
Length=261

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 179/263 (68%), Gaps = 14/263 (5%)
 Frame = +2

Query  113  VLIITAAMATELQASILLIVLCA-LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL  283
            V+ +  AMA  + A++ L  + A +P V+ G     W++AHATFYG  +  GT+GGACG 
Sbjct  2    VVKVMTAMAIMVVAALTLTTVNAKIPGVYTGGP---WVNAHATFYGEADASGTMGGACGY  58

Query  284  -EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP---  451
               + + Y   T ALS ALFNN  SCGAC+E+KCVN  G C      I++TAT+ CP   
Sbjct  59   GNLYSQGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNF  118

Query  452  ---TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFF  622
               + +G WC PP+ HFDL+MP +L IA+YKAG+VPV YRR+PC +KGG RFT++G ++F
Sbjct  119  AQASDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGMRFTINGSKYF  178

Query  623  NLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKA  802
            NLV V+NV G+G+V  V V       W+ L RNWG+ W++NA+L G+SL+FRV T+DG++
Sbjct  179  NLVLVTNVAGAGNVQMVSVKGS-NTGWLGLSRNWGQNWQSNAILVGQSLSFRVKTSDGRS  237

Query  803  VTSQNVAPKSWQYGQTFEGRNCR  871
             TS N+ P +WQ+GQTF G+N R
Sbjct  238  STSNNIVPSNWQFGQTFSGKNFR  260



>ref|XP_010452058.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 177/262 (68%), Gaps = 18/262 (7%)
 Frame = +2

Query  113  VLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-  283
            VL + A M      +  L V   +P V+ G     W++AHATFYG  +  GT+GGACG  
Sbjct  5    VLTLMAVMV-----ATALTVNAKIPGVYNGGP---WINAHATFYGGADASGTMGGACGYG  56

Query  284  EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP----  451
              + + Y   T ALS ALFNN  SCG+C+E+KCVN  G C      I++TAT+ CP    
Sbjct  57   NLYSQGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNFA  116

Query  452  --TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFN  625
              + +G WC PP+ HFDL+MP +L IA+YKAG+VPV YRR+PC +KGG RFT++G +FFN
Sbjct  117  QASDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKFFN  176

Query  626  LVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAV  805
            LV V+NV G+GDV KV V      +W+ L RNWG+ W++NA+L G+SL+FRV T+DG++ 
Sbjct  177  LVLVTNVAGAGDVRKVSVKGT-NTQWLDLSRNWGQNWQSNAVLVGQSLSFRVKTSDGRSS  235

Query  806  TSQNVAPKSWQYGQTFEGRNCR  871
            TS N+AP +WQ+GQT+ G+N R
Sbjct  236  TSNNIAPSNWQFGQTYSGKNFR  257



>gb|KHN02295.1| Expansin-A16 [Glycine soja]
Length=279

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 165/224 (74%), Gaps = 9/224 (4%)
 Frame = +2

Query  218  WLDAHATFYGPPEGTIGGACGLEQF-KETYSPYttalsaalfnnaasCGACYEIKCVNST  394
            W  A+ATFY    GT GGACG +   K+ Y   T ALS+ LF +  +CGACYEIKCVNST
Sbjct  55   WRQAYATFYEGGSGTFGGACGYDDVVKDGYGLDTAALSSVLFKHGEACGACYEIKCVNST  114

Query  395  GQCKTPQKPIIVTATDLCPTG------DGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVF  556
              CK P+  + VTAT+LCP        +G WC PP+ HFDL+ PAYL+IA+YKAG+VPV 
Sbjct  115  QWCK-PKPSVFVTATNLCPPNYSQPGDNGGWCNPPRQHFDLAKPAYLKIAQYKAGIVPVQ  173

Query  557  YRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEE-KWVPLKRNWGEK  733
            YRRVPC ++GG RFT++G+ +FNLV V NVGG+GD+++V+V  + +   W  LKRNWGEK
Sbjct  174  YRRVPCKKQGGIRFTITGNPYFNLVKVWNVGGAGDITEVQVKGDKKLINWTNLKRNWGEK  233

Query  734  WETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRN  865
            WETNAML G++L FRV  +DG+  TS +VAPK+WQ+GQTFEG+N
Sbjct  234  WETNAMLVGETLTFRVKASDGRYSTSSSVAPKNWQFGQTFEGKN  277



>ref|NP_195846.1| expansin A9 [Arabidopsis thaliana]
 sp|Q9LZ99.1|EXPA9_ARATH RecName: Full=Expansin-A9; Short=AtEXPA9; AltName: Full=Alpha-expansin-9; 
Short=At-EXP9; Short=AtEx9; AltName: Full=Ath-ExpAlpha-1.10; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB85531.1| expansin precursor-like protein [Arabidopsis thaliana]
 gb|AAK96777.1| expansin precursor-like protein [Arabidopsis thaliana]
 gb|AAL47389.1| expansin precursor-like protein [Arabidopsis thaliana]
 gb|AAM63290.1| expansin precursor-like protein [Arabidopsis thaliana]
 gb|AED90451.1| expansin A9 [Arabidopsis thaliana]
Length=258

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 181/272 (67%), Gaps = 24/272 (9%)
 Frame = +2

Query  83   MISKKYL*LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--  256
            M +K    ++V+++TA  A              +P V+ G     W++AHATFYG  +  
Sbjct  1    MAAKVITFMAVMVVTAFTANA-----------KIPGVYTGGP---WINAHATFYGEADAS  46

Query  257  GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVT  433
            GT+GGACG    + + Y   T ALS ALFNN  SCG+C+E+KC+N  G C      I++T
Sbjct  47   GTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGSCFELKCINDPGWCLPGNPSILIT  106

Query  434  ATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGER  595
            AT+ CP      + +G WC PP+ HFDL+MP +L IA+YKAG+VPV YRR+PC +KGG R
Sbjct  107  ATNFCPPNFNQASDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIR  166

Query  596  FTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNF  775
            FT++G ++FNLV V+NV G+GDV KV V      +W+ L RNWG+ W++NA+L G+SL+F
Sbjct  167  FTINGFKYFNLVLVTNVAGAGDVIKVSVKGS-NTQWLDLSRNWGQNWQSNALLVGQSLSF  225

Query  776  RVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
            RV T+DG++ TS N+AP +WQ+GQT+ G+N R
Sbjct  226  RVKTSDGRSSTSNNIAPSNWQFGQTYSGKNFR  257



>ref|XP_006288496.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
 gb|EOA21394.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
Length=258

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 130/260 (50%), Positives = 176/260 (68%), Gaps = 16/260 (6%)
 Frame = +2

Query  128  AAMATELQASIL---LIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQ  289
            AA    L A +L     V   +P V+ G     W++AHATFYG  +  GT+GGACG    
Sbjct  2    AAKVITLMAVMLATAFTVHARIPGVYTGGP---WVNAHATFYGGADASGTMGGACGYGNL  58

Query  290  FKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------  451
            + + Y   T ALS ALFNN  SCG+C+E+KC+N  G C      I++TAT+ CP      
Sbjct  59   YSQGYGVNTAALSTALFNNGLSCGSCFELKCINDPGWCLPGNPSILITATNFCPPNFAQA  118

Query  452  TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLV  631
            + +G WC PP+ HFDL+MP +L IA+YKAG+VPV YRR+PC +KGG RFT++G +FFNLV
Sbjct  119  SDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKFFNLV  178

Query  632  TVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTS  811
             V+NV G+GDV KV V      +W+ L RNWG+ W++NA+L G+SL+FRV T+DG++ TS
Sbjct  179  LVTNVAGAGDVRKVSVKGT-NTQWLDLSRNWGQNWQSNAVLVGQSLSFRVKTSDGRSSTS  237

Query  812  QNVAPKSWQYGQTFEGRNCR  871
             N+AP +WQ+GQT+ G+N R
Sbjct  238  NNIAPSNWQFGQTYSGKNFR  257



>ref|XP_003553565.1| PREDICTED: expansin-A16-like [Glycine max]
Length=287

 Score =   242 bits (618),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 168/226 (74%), Gaps = 13/226 (6%)
 Frame = +2

Query  218  WLDAHATFYGPPEGTIGGACGLEQF-KETYSPYttalsaalfnnaasCGACYEIKCVNST  394
            W  A+ATFY    GT GGACG +   K+ Y   T ALS+ LF +  +CGACYEIKCVNST
Sbjct  63   WRQAYATFYEGGSGTFGGACGYDDVVKDGYGLDTAALSSVLFKHGEACGACYEIKCVNST  122

Query  395  GQCKTPQKPIIVTATDLCPTG------DGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVF  556
              CK P+  + VTAT+LCP        +G WC PP+ HFDL+ PAYL+IA+YKAG+VPV 
Sbjct  123  QWCK-PKPSVFVTATNLCPPNYSQPGDNGGWCNPPRQHFDLAKPAYLKIAQYKAGIVPVQ  181

Query  557  YRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEK---WVPLKRNWG  727
            YRRVPC ++GG RFT++G+ +FNLV V NVGG+GD+++V+V  +G++K   W  LKRNWG
Sbjct  182  YRRVPCKKQGGIRFTITGNPYFNLVKVWNVGGAGDITEVQV--KGDKKLINWTNLKRNWG  239

Query  728  EKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRN  865
            EKWETNAML G++L FRV  +DG+  TS +VAPK+WQ+GQTFEG+N
Sbjct  240  EKWETNAMLVGETLTFRVKASDGRYSTSSSVAPKNWQFGQTFEGKN  285



>ref|XP_009122794.1| PREDICTED: expansin-A9 [Brassica rapa]
 emb|CDY40344.1| BnaA10g27240D [Brassica napus]
Length=258

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 178/264 (67%), Gaps = 21/264 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            ++++++ A +AT + A I        P V+ G     W++AHATFYG  +  GT+GGACG
Sbjct  6    MTLMVVAALVATTVNARI--------PGVYTGGP---WVNAHATFYGEADASGTMGGACG  54

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+E+KCVN  G C      I++TAT+ CP  
Sbjct  55   YGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPN  114

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                + +G WC PP+ HFDL+MP +L IA+Y+AG+VPV YRRVPC +KGG RFT++G ++
Sbjct  115  FAQASDNGGWCNPPREHFDLAMPMFLTIAKYRAGIVPVSYRRVPCRKKGGIRFTINGSKY  174

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV V+NV G+G+V  V V       W+ L RNWG+ W++NA+L G+SL+FRV T+DG+
Sbjct  175  FNLVLVTNVAGAGNVQMVSVKGS-NTAWLGLSRNWGQNWQSNAILVGQSLSFRVKTSDGR  233

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
            + TS N+ P +WQ+GQTF G+N R
Sbjct  234  SSTSNNIVPSNWQFGQTFSGKNFR  257



>ref|XP_008343537.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/255 (50%), Positives = 173/255 (68%), Gaps = 13/255 (5%)
 Frame = +2

Query  134  MATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETY  304
            +A+ +  +  ++V   +P V+ G +   W DAHATFYG  +  GT+GGACG    + + Y
Sbjct  10   IASLMALASTIVVEARIPGVYTGGA---WQDAHATFYGGSDASGTMGGACGYGNLYSQGY  66

Query  305  SPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGK  466
               T ALS ALFNN  SCGAC+E+KC N    CK+    I VTAT+ CP      + DG 
Sbjct  67   GVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDDGG  126

Query  467  WCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNV  646
            WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++GH++FNLV + NV
Sbjct  127  WCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHNV  186

Query  647  GGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAP  826
             G+GD+ KV V       W+ L RNWG+ W++NA+L G+SL+FRVT +D +  TS N+ P
Sbjct  187  AGAGDIVKVYVKGT-NTPWMSLSRNWGQNWQSNAILVGQSLSFRVTASDRRTSTSWNIVP  245

Query  827  KSWQYGQTFEGRNCR  871
             +WQ+GQTF G+N R
Sbjct  246  SNWQFGQTFTGKNFR  260



>gb|KFK24708.1| hypothetical protein AALP_AA8G014300 [Arabis alpina]
Length=258

 Score =   239 bits (610),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 166/239 (69%), Gaps = 13/239 (5%)
 Frame = +2

Query  182  LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaa  352
            +P V+ G     W++AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  
Sbjct  23   IPGVYTGGP---WINAHATFYGEADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  353  sCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAY  514
            SCGAC+E+KCVN  G C      I++TAT+ CP      + +G WC PP+ HFDL+MP +
Sbjct  80   SCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFNQASDNGGWCNPPREHFDLAMPMF  139

Query  515  LQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGE  694
            L IA+YKAG+VPV YRR+PC +KGG RFT++GH+FFNLV V+NV G+GDV KV V     
Sbjct  140  LTIAKYKAGIVPVSYRRIPCRKKGGVRFTINGHKFFNLVLVTNVAGAGDVVKVSVKGT-N  198

Query  695  EKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
              W+ L RNWG+ W++NA+L G+SL+FRV  +DG++ TS  + P +WQ+GQTF G+N R
Sbjct  199  TAWLDLSRNWGQNWQSNAVLVGQSLSFRVKASDGRSSTSNYIVPSNWQFGQTFSGKNFR  257



>emb|CDY10456.1| BnaCnng03570D [Brassica napus]
Length=258

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 177/264 (67%), Gaps = 21/264 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            ++++++ A +AT + A I        P V+ G     W++AHATFYG  +  GT+GGACG
Sbjct  6    MTLMVVAALVATTVNARI--------PGVYTGGP---WVNAHATFYGEADASGTMGGACG  54

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+E+KCVN  G C      I++TAT+ CP  
Sbjct  55   YGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPN  114

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                + +G WC PP+ HFDL+MP +L IA+Y+AG+VPV YRRVPC +KGG RFT++G ++
Sbjct  115  FAQASDNGGWCNPPREHFDLAMPMFLTIAKYRAGIVPVSYRRVPCRKKGGVRFTINGSKY  174

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV V+NV G+G+V  V V       W+ L RNWG+ W++NA+L G+SL+FRV  +DG+
Sbjct  175  FNLVLVTNVAGAGNVQMVSVKGS-NTGWLGLSRNWGQNWQSNAILVGQSLSFRVRASDGR  233

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
            + TS N+ P +WQ+GQTF G+N R
Sbjct  234  SSTSNNIVPSNWQFGQTFSGKNFR  257



>ref|NP_001150534.1| alpha-expansin 6 precursor [Zea mays]
 gb|ACG39445.1| alpha-expansin 6 precursor [Zea mays]
Length=263

 Score =   239 bits (609),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 175/266 (66%), Gaps = 22/266 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            L +++ TA M +   A I        P V+GG    GW  AHATFYG  +  GT+GGACG
Sbjct  8    LLLVVATAMMFSPAAARI--------PGVYGGG---GWQSAHATFYGGSDASGTMGGACG  56

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQ--CKTPQKPIIVTATDLCP  451
                + + Y     ALS ALFN   SCGAC+EIKC +  G   C+     I+VTAT+ CP
Sbjct  57   YGNLYSQGYGVNNAALSTALFNQGLSCGACFEIKCEDQPGWRWCRPGSPSILVTATNFCP  116

Query  452  ------TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGH  613
                  + DG WC PP+ HFDL+MP +L IAEY+AG+VPV YRRVPC + GG RFT++G 
Sbjct  117  PNYALPSDDGGWCNPPRPHFDLAMPMFLHIAEYRAGIVPVTYRRVPCRKSGGVRFTINGF  176

Query  614  QFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTND  793
            ++FNLV ++NV G+GDV +  V A G  +W+P+ RNWG+ W+++A+L G++L+FRVT +D
Sbjct  177  RYFNLVLITNVAGAGDVVRASVKASGAGEWMPMSRNWGQNWQSSAILVGQALSFRVTGSD  236

Query  794  GKAVTSQNVAPKSWQYGQTFEGRNCR  871
             +  TS N AP+ W++GQTFEG+N R
Sbjct  237  RRTSTSWNAAPRDWRFGQTFEGKNFR  262



>gb|EYU41589.1| hypothetical protein MIMGU_mgv1a026815mg [Erythranthe guttata]
Length=257

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/261 (52%), Positives = 172/261 (66%), Gaps = 19/261 (7%)
 Frame = +2

Query  122  ITAAMATELQASILLIVLCALPCVFGGDSAHG---------WLDAHATFYGPPEG--TIG  268
            + A +   L +S++++VL       G  SAH          W DAHATFYG  +G  T+G
Sbjct  1    MAAILQGMLASSLMILVL------VGPTSAHSHGPDFKVGPWKDAHATFYGGADGSGTMG  54

Query  269  GACGLEQF-KETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKT-PQKPIIVTATD  442
            GACG +   KE Y   TTALS+ALFN+  +CG+CYEI+C      CK      I VTAT+
Sbjct  55   GACGYDDLVKEGYGFNTTALSSALFNDGKACGSCYEIRCAKGNKWCKPGASSSIFVTATN  114

Query  443  LCPTGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFF  622
             CP G    C  P  HFDLS PAYLQIAEYKAG+VPV YRRVPC ++GG + T++G+ +F
Sbjct  115  FCPPGGTGCCNSPNEHFDLSQPAYLQIAEYKAGIVPVQYRRVPCKKRGGVKLTITGNPYF  174

Query  623  NLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKA  802
            NLVTV+NVGG+GDV+ VEV+   +  W  L RNWG+KWETNA L G  L F+VTT+DGK 
Sbjct  175  NLVTVTNVGGAGDVTNVEVSGGKDLPWTKLSRNWGQKWETNAKLVGHDLTFKVTTSDGKT  234

Query  803  VTSQNVAPKSWQYGQTFEGRN  865
            V  Q V P++WQ+ QT+EG+N
Sbjct  235  VILQKVVPQNWQFSQTYEGQN  255



>gb|ACF87150.1| unknown [Zea mays]
 gb|AFW67135.1| alpha-expansin 6 [Zea mays]
Length=265

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 166/241 (69%), Gaps = 14/241 (6%)
 Frame = +2

Query  182  LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGLEQ-FKETYSPYttalsaalfnnaa  352
            +P V+GG    GW  AHATFYG  +  GT+GGACG    + + Y     ALS ALFN   
Sbjct  27   IPGVYGGG---GWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNQGL  83

Query  353  sCGACYEIKCVNSTGQ--CKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMP  508
            SCGAC+EIKC +  G   C+     I+VTAT+ CP      + DG WC PP+ HFDL+MP
Sbjct  84   SCGACFEIKCEDQPGWRWCRPGSPSILVTATNFCPPNYALPSDDGGWCNPPRPHFDLAMP  143

Query  509  AYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAE  688
             +L IAEY+AG+VPV YRRVPC + GG RFT++G ++FNLV ++NV G+GDV +  V A 
Sbjct  144  MFLHIAEYRAGIVPVTYRRVPCRKSGGVRFTINGFRYFNLVLITNVAGAGDVVRASVKAS  203

Query  689  GEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNC  868
            G  +W+P+ RNWG+ W+++A+L G++L+FRVT +D +  TS N AP+ W++GQTFEG+N 
Sbjct  204  GTGEWMPMSRNWGQNWQSSAILVGQALSFRVTGSDRRTSTSWNAAPRDWRFGQTFEGKNF  263

Query  869  R  871
            R
Sbjct  264  R  264



>ref|XP_003527088.1| PREDICTED: expansin-A15-like [Glycine max]
Length=249

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 157/228 (69%), Gaps = 12/228 (5%)
 Frame = +2

Query  206  SAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEI  376
            S +GW+DAHATFYG     GT+GGACG    + + Y   T ALS ALFNN  SCGAC+EI
Sbjct  22   SGYGWMDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEI  81

Query  377  KCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHFDLSMPAYLQIAEYKA  538
            +CVN    C    + +IVTAT+ CP  +      G WC PP  HFDLS P + QIA+YKA
Sbjct  82   RCVNDQRWCLP--RSVIVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPIFQQIAQYKA  139

Query  539  GVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKR  718
            G+VPV YRRVPC+++GG RFT++GH +FNLV +SNVGG GDV  V +       W P+ R
Sbjct  140  GIVPVAYRRVPCLKRGGIRFTINGHSYFNLVLISNVGGVGDVHAVSIKGS-RTNWQPMTR  198

Query  719  NWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGR  862
            NWG+ W++NA L+G+SL+F+VT +DG+ V S NVAP SW +GQTF G 
Sbjct  199  NWGQNWQSNAYLNGQSLSFKVTASDGRTVVSNNVAPSSWSFGQTFNGH  246



>ref|XP_009343581.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 172/255 (67%), Gaps = 13/255 (5%)
 Frame = +2

Query  134  MATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETY  304
            +A+ +  +  ++V   +P V+ G +   W  AHATFYG  +  GT+GGACG    + + Y
Sbjct  10   IASLMALASTIVVEARIPGVYTGGA---WQGAHATFYGGSDASGTMGGACGYGNLYSQGY  66

Query  305  SPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGK  466
               T ALS ALFNN  SCGAC+EIKC N    CK+    I VTAT+ CP      + +G 
Sbjct  67   GVNTAALSTALFNNGLSCGACFEIKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDNGG  126

Query  467  WCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNV  646
            WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++GH++FNLV + NV
Sbjct  127  WCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHNV  186

Query  647  GGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAP  826
             G+GD+ KV V       W+ L RNWG+ W++NA+L G+SL+FRVT +D +  TS N+ P
Sbjct  187  AGAGDIVKVYVKGT-NTPWMSLSRNWGQNWQSNAILVGQSLSFRVTASDRRTSTSWNIVP  245

Query  827  KSWQYGQTFEGRNCR  871
             +WQ+GQTF G+N R
Sbjct  246  SNWQFGQTFTGKNFR  260



>ref|XP_011013147.1| PREDICTED: expansin-A1 [Populus euphratica]
Length=249

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 126/249 (51%), Positives = 162/249 (65%), Gaps = 12/249 (5%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYtta  322
            A I L+   A+     G    GW++AHATFYG     GT+GGACG    + + Y   T A
Sbjct  4    AGIFLVGFLAMVSSVNGYGGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAA  63

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQ  484
            LS ALFNN  SCG+CYEI+CVN    C      I++TAT+ CP  +      G WC PPQ
Sbjct  64   LSTALFNNGLSCGSCYEIRCVNDPKWCL--PGSIVITATNFCPPNNALPNNAGGWCNPPQ  121

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDLS P +  IA+Y+AG+VPV YRRVPC R+GG RFT++GH +FNLV ++NVGG+GDV
Sbjct  122  HHFDLSQPVFQHIAQYRAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDV  181

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
              V +       W P+ RNWG+ W++N  L+G+SL+F+VTT+DG+ V S NVAP SW +G
Sbjct  182  HSVSIKGS-RTGWQPMSRNWGQNWQSNNYLNGQSLSFKVTTSDGRTVVSYNVAPSSWSFG  240

Query  845  QTFEGRNCR  871
            QTF G   R
Sbjct  241  QTFSGAQFR  249



>ref|XP_006291698.1| hypothetical protein CARUB_v10017862mg [Capsella rubella]
 gb|EOA24596.1| hypothetical protein CARUB_v10017862mg [Capsella rubella]
Length=260

 Score =   236 bits (603),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 125/263 (48%), Positives = 176/263 (67%), Gaps = 15/263 (6%)
 Frame = +2

Query  116  LIITAAMATELQASILLIVL--CALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL  283
            + IT+ +   +    LL+ L    +P V+ G S   WL AHATFYG     GT+GGACG 
Sbjct  1    MAITSLILLTIIPLFLLLSLTHAGIPGVYSGSS---WLTAHATFYGGNDASGTMGGACGY  57

Query  284  -EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP---  451
             + + + Y   T ALS ALFN+  SCGAC+E+KCVN    C      + VTAT+ CP   
Sbjct  58   GDLYSQGYGTNTAALSTALFNSGQSCGACFEVKCVNDPKWCHPGSPSVFVTATNFCPPNL  117

Query  452  ---TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFF  622
               + +G WC PP+AHFDL+MP +L+IA+Y+AG+VP+ YRRV C + GG RFT++GH++F
Sbjct  118  AQPSDNGGWCNPPRAHFDLAMPVFLKIAQYRAGIVPISYRRVACKKSGGIRFTINGHRYF  177

Query  623  NLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKA  802
            NLV ++NV G+GD+ K  V +  +  W+ L RNWG+ W++NA+L G+SL+FRVT++D + 
Sbjct  178  NLVLITNVAGAGDIVKASVKSS-KSGWMGLTRNWGQNWQSNAVLVGQSLSFRVTSSDRRT  236

Query  803  VTSQNVAPKSWQYGQTFEGRNCR  871
             TS N+ P +WQ+GQTF G+N R
Sbjct  237  STSWNIVPSNWQFGQTFVGKNFR  259



>gb|AAR82849.1| expansin-1 [Petunia x hybrida]
Length=260

 Score =   236 bits (603),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 127/256 (50%), Positives = 170/256 (66%), Gaps = 13/256 (5%)
 Frame = +2

Query  131  AMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKET  301
            A  T L   +LL V   +P V+ G +   W  AHATFYG  +  GT+GGACG    + + 
Sbjct  8    ACVTSLVLLMLLTVEARIPGVYSGGA---WQSAHATFYGGSDASGTMGGACGYGNLYSQG  64

Query  302  YSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDG  463
            Y     ALS ALFNN  SCGAC+EIKC      C +    I +TAT+ CP        +G
Sbjct  65   YGVNNGALSTALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNYALPNDNG  124

Query  464  KWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSN  643
             WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNLV V+N
Sbjct  125  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTN  184

Query  644  VGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVA  823
            V G+GD+ +V V    +  W+ L RNWG+ W+TNA+L+G+SL+FRVT +D ++ TS N+A
Sbjct  185  VAGAGDIVRVRVKGS-KTNWITLSRNWGQNWQTNAVLTGQSLSFRVTASDRRSSTSWNIA  243

Query  824  PKSWQYGQTFEGRNCR  871
            P  WQ+GQTF G+N R
Sbjct  244  PAHWQFGQTFMGKNFR  259



>gb|AAK48848.1|AF350939_1 expansin [Prunus cerasus]
Length=260

 Score =   236 bits (603),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 178/264 (67%), Gaps = 14/264 (5%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            + V+ ++A +A+ L  S++ +    +P V+ GD+   W  AHATFYG  +  GT+GGACG
Sbjct  1    MGVVSVSACLAS-LLISVMWVAEARIPGVYTGDA---WEAAHATFYGGSDASGTMGGACG  56

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC N    C +    I +TAT+ CP  
Sbjct  57   YGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPN  116

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  117  FAQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  176

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV VSNV G+GD+ +V V    +  W+ + RNWG+ W++NA+L G+SL+FRV  +D +
Sbjct  177  FNLVLVSNVAGAGDIVRVSVKGS-KTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRR  235

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P +WQ+GQTF G+N R
Sbjct  236  TSTSWNIVPANWQFGQTFTGKNFR  259



>gb|AEU08407.1| expansin 2 [Prunus salicina]
Length=260

 Score =   236 bits (602),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 177/264 (67%), Gaps = 14/264 (5%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            + V+ ++A +A+ L  S++ +    +P V+ G +   W  AHATFYG  +  GT+GGACG
Sbjct  1    MGVVSVSACLAS-LLISLMWVAEARIPGVYSGGA---WEAAHATFYGGSDASGTMGGACG  56

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC N    C +    I +TAT+ CP  
Sbjct  57   YGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPN  116

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                + DG WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  117  FAQPSDDGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  176

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV VSNV G+GD+ +V V    +  W+ + RNWG+ W++NA+L G+SL+FRV  +D +
Sbjct  177  FNLVLVSNVAGAGDIVRVSVKGS-KTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRR  235

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS NV P +WQ+GQTF G+N R
Sbjct  236  TSTSWNVVPANWQFGQTFTGKNFR  259



>gb|KHG15821.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 175/264 (66%), Gaps = 19/264 (7%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            LSVL   + +      S L +V   +P VF G +   W  AHATFYG  +  GT+GGACG
Sbjct  10   LSVLCFASLL------SFLAVVNARIPGVFTGGA---WESAHATFYGGSDASGTMGGACG  60

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC N    C +    II+TAT+ CP  
Sbjct  61   YGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPN  120

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                  +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  121  YALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRY  180

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV V+NV G+GD+ KV+V       W+ + RNWG+ W++NA+L G++L+FRVT +D +
Sbjct  181  FNLVLVTNVAGAGDIVKVKVKGT-NTNWMSMSRNWGQNWQSNAVLVGQALSFRVTGSDRR  239

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS NVAP +WQ+GQTF G+N R
Sbjct  240  TSTSLNVAPANWQFGQTFTGKNFR  263



>gb|AFK38404.1| unknown [Lotus japonicus]
Length=248

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 165/246 (67%), Gaps = 14/246 (6%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSA--HGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYtta  322
             L ++L  + CV  G  A   GW+DAHATFYG     GT+GGACG    + E Y   T A
Sbjct  3    FLGLLLVGILCVGSGAYAASDGWMDAHATFYGGGDASGTMGGACGYGNLYSEGYGTETAA  62

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQ  484
            LS ALFNN  SCGACYEIKCV+    C T    I+VTAT+ CP  +      G WC PP 
Sbjct  63   LSTALFNNGLSCGACYEIKCVSHQKWCLT--GSIMVTATNFCPPNNALPNDAGGWCNPPL  120

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDLS PA+ QIA+YKAG+VPV YRRVPC +KGG  FT++GH +FNLV ++NVGGSGDV
Sbjct  121  QHFDLSQPAFQQIAQYKAGIVPVAYRRVPCQKKGGISFTINGHSYFNLVLITNVGGSGDV  180

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
              V +       W P+ RNWG+ W++NA L+G+SL+F+VTT+DG+ + S +V P +W +G
Sbjct  181  QAVSIKGS-RTDWQPMSRNWGQNWQSNANLNGQSLSFKVTTSDGRTLVSNDVVPDNWSFG  239

Query  845  QTFEGR  862
            QTF G+
Sbjct  240  QTFTGQ  245



>ref|XP_002533097.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
 gb|EEF29289.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
Length=259

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/260 (49%), Positives = 172/260 (66%), Gaps = 18/260 (7%)
 Frame = +2

Query  134  MATELQASILLIVLCA-----LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQ  289
            M + +   ILL++L       +P V+ G S   W  AHATFYG  +  GT+GGACG    
Sbjct  3    MGSVISGVILLVMLMGASEARIPGVYTGGS---WQSAHATFYGGSDASGTMGGACGYGNL  59

Query  290  FKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------  451
            + + Y   T ALS ALFNN  SCGAC+EIKC N    C +    I++TAT+ CP      
Sbjct  60   YSQGYGVNTAALSTALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNFALP  119

Query  452  TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLV  631
              +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNLV
Sbjct  120  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLV  179

Query  632  TVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTS  811
             +SNV G+GD+ KV V       W+ + RNWG+ W++NA+L G+SL+FRVT +D +  TS
Sbjct  180  LISNVAGAGDIVKVSVKGS-RTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  812  QNVAPKSWQYGQTFEGRNCR  871
             N+ P +WQ+GQTF G+N R
Sbjct  239  WNIVPANWQFGQTFTGKNFR  258



>ref|XP_009380637.1| PREDICTED: expansin-A4 [Musa acuminata subsp. malaccensis]
Length=262

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 170/263 (65%), Gaps = 13/263 (5%)
 Frame = +2

Query  110  SVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL  283
            S+    AA    + AS  L+    +P V+ G     W  AHATFYG  +  GT+GGACG 
Sbjct  3    SICSAVAATVALVLASSALLADARIPGVYTGGQ---WQSAHATFYGGSDASGTMGGACGY  59

Query  284  -EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP---  451
               + + Y   T ALS ALFN+  SCGAC+EIKC +    CK     I +TAT+ CP   
Sbjct  60   GNLYSQGYGVETAALSTALFNDGLSCGACFEIKCADDPRWCKGGSPSIFITATNFCPPNY  119

Query  452  ---TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFF  622
               + DG WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC + GG RFT++G Q+F
Sbjct  120  ALPSDDGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFQYF  179

Query  623  NLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKA  802
            NLV ++NV G+GD+ +  V       W+P+ RNWG+ W++NA L G+SL+FRVT +D + 
Sbjct  180  NLVLITNVAGAGDIIRATVKGS-RTGWMPMSRNWGQNWQSNAALVGQSLSFRVTGSDHRT  238

Query  803  VTSQNVAPKSWQYGQTFEGRNCR  871
             TS N+AP +WQ+GQTF G+N R
Sbjct  239  STSWNIAPATWQFGQTFSGKNFR  261



>ref|XP_003523015.1| PREDICTED: expansin-A15-like [Glycine max]
 gb|KHN01875.1| Expansin-A15 [Glycine soja]
Length=248

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 163/244 (67%), Gaps = 13/244 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttals  328
            +L++   +L   F   S +GW+DAHATFYG     GT+GGACG    + + Y   T ALS
Sbjct  6    LLMVGFLSLGS-FVSASGYGWMDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALS  64

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAH  490
             ALFNN  SCGAC+EIKCVN    C    + +IVTAT+ CP  +      G WC PP  H
Sbjct  65   TALFNNGLSCGACFEIKCVNDQRWCLP--RSVIVTATNFCPPNNALPNNAGGWCNPPLHH  122

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDLS P + QIA+YKAG+VPV YRRVPC ++ G RFT++GH +FNLV +SNVGG+GDV  
Sbjct  123  FDLSQPIFQQIAQYKAGIVPVAYRRVPCRKREGIRFTINGHSYFNLVLISNVGGAGDVHA  182

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
            V +       W P+ RNWG+ W++NA L+G+SL+F+VTT+DG  V S NVAP SW +GQT
Sbjct  183  VSIKGS-RTNWQPMTRNWGQNWQSNAYLNGQSLSFKVTTSDGHTVVSNNVAPSSWSFGQT  241

Query  851  FEGR  862
            F G 
Sbjct  242  FNGH  245



>emb|CDY48101.1| BnaC02g03580D [Brassica napus]
Length=261

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 166/239 (69%), Gaps = 13/239 (5%)
 Frame = +2

Query  182  LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGLEQ-FKETYSPYttalsaalfnnaa  352
            +P V+ G     W++AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  
Sbjct  26   IPGVYTGGP---WVNAHATFYGEADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  82

Query  353  sCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAY  514
            SCGAC+E+KCVN  G C      I++TAT+ CP      + +G WC PP+ HFDL+MP +
Sbjct  83   SCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAMPMF  142

Query  515  LQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGE  694
            L IA+Y+AG+VPV YRRVPC +KGG RFT++G ++FNLV V+NV G+G+V  V V     
Sbjct  143  LTIAKYRAGIVPVSYRRVPCRKKGGMRFTINGSKYFNLVLVTNVAGAGNVQMVSVKGS-N  201

Query  695  EKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
              W+ L RNWG+ W++NA+L G+SL+FRV T+DG++ TS N+ P +WQ+GQTF G+N R
Sbjct  202  TGWLGLSRNWGQNWQSNAILVGQSLSFRVKTSDGRSSTSNNIVPSNWQFGQTFSGKNFR  260



>ref|NP_001288956.1| expansin-A9-like precursor [Brassica rapa]
 gb|AGM16351.1| alpha-expansin protein 9 [Brassica rapa]
Length=261

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 167/243 (69%), Gaps = 13/243 (5%)
 Frame = +2

Query  170  VLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGLEQ-FKETYSPYttalsaalf  340
            V   +P V+ G     W++AHATFYG  +  GT+GGACG    + + Y   T ALS ALF
Sbjct  22   VKARIPGVYTGGP---WVNAHATFYGEADASGTMGGACGYGNLYSQGYGVNTAALSTALF  78

Query  341  nnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLS  502
            NN  SCGAC+E+KCVN  G C      I++TAT+ CP      + +G WC PP+ HFDL+
Sbjct  79   NNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASDNGGWCNPPREHFDLA  138

Query  503  MPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVN  682
            MP +L IA+Y+AG+VPV YRRVPC +KGG RFT++G ++FNLV V+NV G+G+V  V V 
Sbjct  139  MPMFLTIAKYRAGIVPVSYRRVPCRKKGGMRFTINGSKYFNLVLVTNVAGAGNVQMVSVK  198

Query  683  AEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGR  862
                  W+ L RNWG+ W++NA+L G+SL+FRV T+DG++ TS N+ P +WQ+GQTF G+
Sbjct  199  GS-NTGWLGLSRNWGQNWQSNAILVGQSLSFRVKTSDGRSSTSNNIVPSNWQFGQTFSGK  257

Query  863  NCR  871
            N R
Sbjct  258  NFR  260



>emb|CDY04847.1| BnaAnng00290D [Brassica napus]
Length=261

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 166/239 (69%), Gaps = 13/239 (5%)
 Frame = +2

Query  182  LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGLEQ-FKETYSPYttalsaalfnnaa  352
            +P V+ G     W++AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  
Sbjct  26   IPGVYTGGP---WVNAHATFYGEADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  82

Query  353  sCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAY  514
            SCGAC+E+KCVN  G C      I++TAT+ CP      + +G WC PP+ HFDL+MP +
Sbjct  83   SCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAMPMF  142

Query  515  LQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGE  694
            L IA+Y+AG+VPV YRRVPC +KGG RFT++G ++FNLV V+NV G+G+V  V V     
Sbjct  143  LTIAKYRAGIVPVSYRRVPCRKKGGMRFTINGSKYFNLVLVTNVAGAGNVQMVSVKGS-N  201

Query  695  EKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
              W+ L RNWG+ W++NA+L G+SL+FRV T+DG++ TS N+ P +WQ+GQTF G+N R
Sbjct  202  TGWLGLSRNWGQNWQSNAILVGQSLSFRVKTSDGRSSTSNNIVPSNWQFGQTFSGKNFR  260



>emb|CDY07024.1| BnaA04g22910D [Brassica napus]
Length=258

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 173/264 (66%), Gaps = 21/264 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            L+VL  T  + T   A I        P V+ G +   W  AHATFYG  +  GT+GGACG
Sbjct  6    LAVLFTTFVLFTLTDAKI--------PGVYSGGA---WQTAHATFYGGSDASGTMGGACG  54

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFN+  SCGAC+E+KC N    C +    I++TAT+ CP  
Sbjct  55   YGNLYSQGYGTNTAALSTALFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPN  114

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                + +G WC PP+AHFDL+MP +L+IA+Y+AG+VPV YRRVPC ++GG RFT++GH++
Sbjct  115  FAQASDNGGWCNPPRAHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRY  174

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV ++NV G+GD+ +  V       W+ L RNWG+ W++NA+L G+SL+FRVT +D +
Sbjct  175  FNLVLITNVAGAGDIVRTSVKGS-RTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRR  233

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P +WQ+GQTF G+N R
Sbjct  234  TSTSWNIVPSNWQFGQTFVGKNFR  257



>gb|AEN70870.1| alpha-expansin 1 [Gossypium turneri]
Length=258

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/258 (48%), Positives = 174/258 (67%), Gaps = 19/258 (7%)
 Frame = +2

Query  134  MATELQAS----ILLIVLCALPCVFGGDSAH---GWLDAHATFYGPPE--GTIGGACGL-  283
            MAT+   S    +   +      +F GD+     GW +AHATFYG  +  GT+GGACG  
Sbjct  1    MATKTMMSQIFPLFFFLFSVCNSIFLGDNGDENGGWQNAHATFYGGADATGTMGGACGYG  60

Query  284  EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP----  451
              + + Y   T ALS ALFNN  SCGACYE++C N    C +  + I VTAT+ CP    
Sbjct  61   NLYSQGYGTSTAALSTALFNNGLSCGACYELRCNNDPQWCIS--RTITVTATNFCPPNYA  118

Query  452  --TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFN  625
              + +G WC PP+ HFDL+ PA+LQIAEY+AG+VPV +RRV C++KGG R+TM+GH +FN
Sbjct  119  LSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFN  178

Query  626  LVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAV  805
            +V ++NVGG+GD++ V V    +  W+P+ RNWG+ W++NA L+G+SL+F+VT +DG+ +
Sbjct  179  MVLITNVGGAGDITSVSVKGS-KTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTI  237

Query  806  TSQNVAPKSWQYGQTFEG  859
            T+ NV P  WQ+GQTFEG
Sbjct  238  TNYNVVPAGWQFGQTFEG  255



>ref|NP_001234085.1| expansin precursor [Solanum lycopersicum]
 gb|AAD13633.1| expansin precursor [Solanum lycopersicum]
Length=239

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/245 (54%), Positives = 166/245 (68%), Gaps = 13/245 (5%)
 Frame = +2

Query  155  SILLIVLCALPCVFGGDSAHG---WLDAHATFYG--PPEGTIGGACGLEQFKET-YSPYt  316
            ++L I+L  +  +F   SAHG   W++AHATFYG     GT+GGACG      T Y   T
Sbjct  2    ALLAILLMGISLMF--QSAHGYGGWINAHATFYGGGDASGTMGGACGYGNLYSTGYGTNT  59

Query  317  talsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGDGKWCAPPQAHFD  496
             ALS ALFNN  SCGAC+++ CVN+ GQ   P   I VTAT+ CP   G WC PP+ HFD
Sbjct  60   AALSTALFNNGLSCGACFQLMCVNA-GQYCLP-GIITVTATNFCP--PGGWCDPPRPHFD  115

Query  497  LSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVE  676
            LS P +L+IA+Y+AG+VPV YRRVPC R GG RFT++GH +FNLV V+NVGGSGDV  V 
Sbjct  116  LSQPIFLRIAQYRAGIVPVAYRRVPCRRSGGIRFTINGHSYFNLVLVTNVGGSGDVHSVY  175

Query  677  VNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFE  856
            +      +W P+ RNWG+ W+ NA L+G+SL+F+VTT DG+ V S N AP SW +GQTF 
Sbjct  176  IKGS-RTQWQPMSRNWGQNWQNNAYLNGQSLSFKVTTGDGRTVVSYNAAPSSWSFGQTFS  234

Query  857  GRNCR  871
            G   R
Sbjct  235  GGQFR  239



>ref|XP_008371813.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 176/262 (67%), Gaps = 17/262 (6%)
 Frame = +2

Query  113  VLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-  283
            +L I + MA  L ++I  +V   +P V+ G +   W DAHATFYG  +  GT+GGACG  
Sbjct  7    LLCIVSLMA--LASTI--VVDARIPGVYTGGA---WQDAHATFYGGSDASGTMGGACGYG  59

Query  284  EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP----  451
              + + Y   T ALS ALFN+  SCGAC+E+KC N    CK+    I VTAT+ CP    
Sbjct  60   NLYSQGYGVNTAALSTALFNSGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFA  119

Query  452  --TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFN  625
              + DG WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++GH++FN
Sbjct  120  QPSDDGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFN  179

Query  626  LVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAV  805
            LV + NV G+GD+ K  V       W+ L RNWG+ W++N++L G+SL+FRVT +D +  
Sbjct  180  LVLIHNVAGAGDIVKAYVKGT-NTPWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTS  238

Query  806  TSQNVAPKSWQYGQTFEGRNCR  871
            TS N+ P +WQ+GQTF G+N R
Sbjct  239  TSWNIVPSNWQFGQTFTGKNFR  260



>gb|AAR82850.1| expansin-2 [Petunia x hybrida]
Length=262

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 173/259 (67%), Gaps = 17/259 (7%)
 Frame = +2

Query  134  MATELQASILLIVL--CALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKE  298
            MAT + A + LI L    +P V+ G S   W  AHATFYG  +  GT+GGACG    + +
Sbjct  7    MATYILALLFLISLVEARIPGVYSGGS---WQTAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  299  TYSPYttalsaalfnnaasCGACYEIKCVNST--GQCKTPQKPIIVTATDLCP------T  454
             Y   T ALS ALFNN  SCGAC+E+KC N      C      I++TAT+ CP       
Sbjct  64   GYGVNTAALSTALFNNGLSCGACFELKCTNDPHWKWCLPGNPSILITATNFCPPNYAKPN  123

Query  455  GDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVT  634
             +G WC PP++HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFTM+G ++FNLV 
Sbjct  124  DNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGIRFTMNGFRYFNLVL  183

Query  635  VSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQ  814
            + NV G+GD+ KV V    +  W+PL RNWG+ W+TN++L+G+SL+FRV  +D +  TS 
Sbjct  184  IPNVAGAGDIIKVWVKGT-KTNWIPLSRNWGQNWQTNSILTGQSLSFRVKASDHRTSTSW  242

Query  815  NVAPKSWQYGQTFEGRNCR  871
            N+AP  WQ+GQTF G+N R
Sbjct  243  NIAPSHWQFGQTFNGKNFR  261



>ref|XP_007205740.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
 dbj|BAC66787.1| expansin [Prunus persica]
 gb|EMJ06939.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
Length=260

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 177/264 (67%), Gaps = 14/264 (5%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            + V+ ++A +A+ L  S++ +    +P V+ G +   W  AHATFYG  +  GT+GGACG
Sbjct  1    MGVVSVSACLAS-LLISLMWVAEARIPGVYSGGA---WEAAHATFYGGSDASGTMGGACG  56

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC N    C +    I +TAT+ CP  
Sbjct  57   YGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPN  116

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  117  FAQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  176

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV VSNV G+GD+ +V V    +  W+ + RNWG+ W++NA+L G+SL+FRV  +D +
Sbjct  177  FNLVLVSNVAGAGDIVRVSVKGS-KTSWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRR  235

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS NV P +WQ+GQTF G+N R
Sbjct  236  TSTSWNVVPANWQFGQTFTGKNFR  259



>ref|XP_010521846.1| PREDICTED: expansin-A6 [Tarenaya hassleriana]
Length=259

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 173/260 (67%), Gaps = 13/260 (5%)
 Frame = +2

Query  119  IITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQ  289
            +I+      +  S+ L+    +P V+GG +   W +AHATFYG  +  GT+GGACG    
Sbjct  3    MISLVFVLTILVSLTLMSEARIPGVYGGGA---WQNAHATFYGGSDASGTMGGACGYGNL  59

Query  290  FKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------  451
            + + Y   T ALS ALFNN   CGAC+EIKC +    C +    I +TAT+ CP      
Sbjct  60   YSQGYGVNTAALSTALFNNGFRCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALP  119

Query  452  TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLV  631
            + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNLV
Sbjct  120  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLV  179

Query  632  TVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTS  811
             V+NV G+GDV +V V       W+ + RNWG+ W++N++L G+SL+FRVT +D ++ TS
Sbjct  180  LVTNVAGAGDVVRVSVKGS-RTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRSSTS  238

Query  812  QNVAPKSWQYGQTFEGRNCR  871
             N+AP  WQ+GQTF G+N R
Sbjct  239  WNIAPSHWQFGQTFVGKNFR  258



>ref|XP_008240857.1| PREDICTED: expansin-A6-like [Prunus mume]
Length=258

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 167/249 (67%), Gaps = 10/249 (4%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYtta  322
            AS+L + + A   + G D+   W  AHATFYG  +  GT+GGACG    + E Y   T A
Sbjct  10   ASLLSLFMAANARIRGFDTGGPWEGAHATFYGGSDASGTMGGACGYGNLYSEGYGVNTAA  69

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQ  484
            LS ALFNN  SCGAC+EIKC +    C      I +TAT+ CP        DG WC PP+
Sbjct  70   LSTALFNNGLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNYALPNDDGGWCNPPR  129

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDL+MP +LQIAEYKAG+VPV +RRVPC ++GG RFT++G ++FNLV ++NV G+GD+
Sbjct  130  THFDLAMPMFLQIAEYKAGIVPVSFRRVPCRKEGGVRFTINGFRYFNLVLITNVAGAGDI  189

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
             +V V     E W+P+ RNWG+ W++NA L G++L+FRVT +D +  TS NVAP  WQ+G
Sbjct  190  VRVSVKGANTE-WMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSWNVAPGHWQFG  248

Query  845  QTFEGRNCR  871
            QTF G+N R
Sbjct  249  QTFSGKNFR  257



>ref|XP_009765412.1| PREDICTED: expansin-A10 [Nicotiana sylvestris]
Length=249

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 162/243 (67%), Gaps = 12/243 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttals  328
            I L+ L A+     G+   GW++AHATFYG     GT+GGACG    + + Y   T ALS
Sbjct  6    IFLVGLLAIVSSANGNDGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALS  65

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAH  490
             ALFNN  SCG+CYEIKCVN    C      I+VTAT+ CP      +  G WC PP  H
Sbjct  66   TALFNNGLSCGSCYEIKCVNEHKWCL--PGSILVTATNFCPPNNALSSNAGGWCNPPLHH  123

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDLS P +  IA+Y+AG+VPV YRRVPC RKGG RFT++GH +FNLV V+NVGG+GDV  
Sbjct  124  FDLSQPTFQHIAQYRAGIVPVAYRRVPCRRKGGIRFTINGHSYFNLVLVTNVGGAGDVHA  183

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
            V +      +W  + RNWG+ W++N  L+G+SL+F+VTT+DGK+V S NVAP SW +GQT
Sbjct  184  VAIKGS-RTQWQSMSRNWGQNWQSNNYLNGQSLSFKVTTSDGKSVVSYNVAPASWSFGQT  242

Query  851  FEG  859
            + G
Sbjct  243  YTG  245



>gb|AEN70883.1| alpha-expansin 1 [Gossypium armourianum]
 gb|AEN70884.1| alpha-expansin 1 [Gossypium harknessii]
Length=258

 Score =   234 bits (597),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/258 (48%), Positives = 173/258 (67%), Gaps = 19/258 (7%)
 Frame = +2

Query  134  MATELQAS----ILLIVLCALPCVFGGDSAH---GWLDAHATFYGPPE--GTIGGACGL-  283
            MAT+   S    +   +      +F GD+     GW  AHATFYG  +  GT+GGACG  
Sbjct  1    MATKTMMSQIFPLFFFLFSVCNSIFLGDNGDENGGWQTAHATFYGGADATGTMGGACGYG  60

Query  284  EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP----  451
              + + Y   T ALS ALFNN  SCGACYE++C N    C +  + I VTAT+ CP    
Sbjct  61   NLYSQGYGTSTAALSTALFNNGLSCGACYELRCNNDPQWCIS--RTITVTATNFCPPNYA  118

Query  452  --TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFN  625
              + +G WC PP+ HFDL+ PA+LQIAEY+AG+VPV +RRV C++KGG R+TM+GH +FN
Sbjct  119  LSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFN  178

Query  626  LVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAV  805
            +V ++NVGG+GD++ V V    +  W+P+ RNWG+ W++NA L+G+SL+F+VT +DG+ +
Sbjct  179  MVLITNVGGAGDITSVSVKGS-KTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTI  237

Query  806  TSQNVAPKSWQYGQTFEG  859
            T+ NV P  WQ+GQTFEG
Sbjct  238  TNYNVVPAGWQFGQTFEG  255



>ref|XP_006440617.1| hypothetical protein CICLE_v10021897mg [Citrus clementina]
 gb|ESR53857.1| hypothetical protein CICLE_v10021897mg [Citrus clementina]
 gb|KDO55537.1| hypothetical protein CISIN_1g025919mg [Citrus sinensis]
Length=246

 Score =   234 bits (596),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 153/225 (68%), Gaps = 12/225 (5%)
 Frame = +2

Query  212  HGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKC  382
             GW DAHATFYG     GT+GGACG    + E Y   T ALS ALFNN  SCGAC+EIKC
Sbjct  21   QGWTDAHATFYGGGDASGTMGGACGYGNLYSEGYGTNTAALSTALFNNGMSCGACFEIKC  80

Query  383  VNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHFDLSMPAYLQIAEYKAGV  544
            VN    C+     I VTAT+ CP  +      G WC PPQ HFDLS P + QIA+YKAG+
Sbjct  81   VNDPRWCRP--GSIFVTATNFCPPNNALPNNAGGWCNPPQQHFDLSQPVFEQIAQYKAGI  138

Query  545  VPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNW  724
            VPV YRRVPC RKGG RFT++GH +FNLV ++NVGG+GDV  V +       W P+ RNW
Sbjct  139  VPVSYRRVPCSRKGGIRFTINGHSYFNLVLITNVGGAGDVRAVSIKGS-RTDWQPMSRNW  197

Query  725  GEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
            G+ W++N+ L+G+SL+F+VTT+DG  V S NVAP  W +GQTF G
Sbjct  198  GQNWQSNSYLNGQSLSFKVTTSDGHTVVSNNVAPAGWSFGQTFSG  242



>gb|AGF90535.1| alpha-expansin 1 [Ammopiptanthus nanus]
Length=248

 Score =   233 bits (595),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 165/246 (67%), Gaps = 14/246 (6%)
 Frame = +2

Query  155  SILLIVLCALPCVFGGDSAH--GWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYtt  319
            +++ ++L A   +F    A+  GW +AHATFYG     GT+GGACG    + + Y   T 
Sbjct  2    ALIGLLLVAFLTMFSSAHAYAEGWTNAHATFYGGGDASGTMGGACGYGNLYGQGYGTNTA  61

Query  320  alsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGDG------KWCAPP  481
            A+S ALFNN  SCG+CYEI+CVN    C      I+VTAT+ CP  +G       WC PP
Sbjct  62   AVSTALFNNGLSCGSCYEIRCVNDNKWCL--PGSIVVTATNFCPPNNGLPNNAGGWCNPP  119

Query  482  QAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGD  661
            Q HFDLS P +L+IA+YKAG+VPV YRRVPC RKGG RFT++GH +FNLV ++NVGG+GD
Sbjct  120  QQHFDLSQPVFLRIAQYKAGIVPVSYRRVPCRRKGGIRFTINGHSYFNLVLITNVGGAGD  179

Query  662  VSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQY  841
            V  V V       W+P+ RNWG+ W++N  L+G+SL+F+VTT+DG  V S NVAP  W +
Sbjct  180  VHAVAVKGS-RTGWMPMSRNWGQNWQSNNYLNGQSLSFKVTTSDGHTVVSYNVAPAGWNF  238

Query  842  GQTFEG  859
            GQT+ G
Sbjct  239  GQTYTG  244



>emb|CDY40233.1| BnaA09g35150D [Brassica napus]
Length=260

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 168/247 (68%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttals  328
            +L +   A+P V+ G S   W  AHATFYG  +  GT+GGACG    + + Y   T ALS
Sbjct  17   LLSLTNAAIPGVYSGGS---WQTAHATFYGGDDASGTMGGACGYGNLYSQGYGTNTAALS  73

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAH  490
             ALF++  +CGAC+EIKCVN    C +    + VTAT+ CP      + +G WC PP+AH
Sbjct  74   TALFSSGLTCGACFEIKCVNDPKWCHSGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRAH  133

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDL+MP +L+IAEY+AG+VP+ YRRV C + GG RFT++GH++FNLV ++NV G+GD+ +
Sbjct  134  FDLAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIVR  193

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
              V    +  W+ L RNWG+ W++N +L G+SL+FRVTT+D +  TS N+ P +WQ+GQT
Sbjct  194  TSVKGS-KTGWMGLTRNWGQNWQSNTVLVGQSLSFRVTTSDRRTSTSWNIVPSNWQFGQT  252

Query  851  FEGRNCR  871
            F G+N R
Sbjct  253  FVGKNFR  259



>ref|NP_178409.2| expansin A15 [Arabidopsis thaliana]
 sp|O80622.2|EXP15_ARATH RecName: Full=Expansin-A15; Short=AtEXPA15; AltName: Full=Alpha-expansin-15; 
Short=At-EXP15; Short=AtEx15; AltName: Full=Ath-ExpAlpha-1.3; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL59989.1| putative expansin protein [Arabidopsis thaliana]
 gb|AAM51417.1| putative expansin protein [Arabidopsis thaliana]
 gb|AAS76673.1| alpha-expansin 15 [Arabidopsis thaliana]
 gb|AAS80168.1| alpha-expansin precursor [Arabidopsis thaliana]
 gb|AEC05663.1| expansin A15 [Arabidopsis thaliana]
Length=253

 Score =   233 bits (595),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 164/247 (66%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttals  328
            I L    A+ C   G  A GW++AHATFYG  +  GT+GGACG    + + Y   T ALS
Sbjct  11   IALFCFAAMVCSVHGYDA-GWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALS  69

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAH  490
             ALFNN  SCGAC+EIKC +    C      IIVTAT+ CP  +      G WC PP  H
Sbjct  70   TALFNNGLSCGACFEIKCQSDGAWCLP--GAIIVTATNFCPPNNALPNNAGGWCNPPLHH  127

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDLS P + +IA+YKAGVVPV YRRVPCMR+GG RFT++GH +FNLV V+NVGG+GDV  
Sbjct  128  FDLSQPVFQRIAQYKAGVVPVSYRRVPCMRRGGIRFTINGHSYFNLVLVTNVGGAGDVHS  187

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
            V V      +W  + RNWG+ W++N +L+G++L+F+VT +DG+ V S N+AP SW +GQT
Sbjct  188  VAVKGS-RTRWQQMSRNWGQNWQSNNLLNGQALSFKVTASDGRTVVSNNIAPASWSFGQT  246

Query  851  FEGRNCR  871
            F GR  R
Sbjct  247  FTGRQFR  253



>ref|XP_009760985.1| PREDICTED: expansin-A10-like [Nicotiana sylvestris]
Length=240

 Score =   233 bits (594),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 165/246 (67%), Gaps = 14/246 (6%)
 Frame = +2

Query  155  SILLIVLCALPCVFGGDSAHG----WLDAHATFYG--PPEGTIGGACGLEQFKET-YSPY  313
            +IL+++   +  +F   S HG    W++AHATFYG     GT+GGACG      T Y   
Sbjct  2    AILVLLFMGISLMF--QSVHGYYGGWINAHATFYGGGDASGTMGGACGYGNLYSTGYGTN  59

Query  314  ttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGDGKWCAPPQAHF  493
            T ALS ALFNN  SCGAC++++CVN+   C      I VTAT+ CP   G WC PP  HF
Sbjct  60   TAALSTALFNNGLSCGACFQLRCVNARQYCL--PGTITVTATNFCP--PGGWCDPPNHHF  115

Query  494  DLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKV  673
            DLS P YL+IA+Y++G+VPV YRRVPC R+GG RFT++GH +FNLV V+NVGG+GDV  +
Sbjct  116  DLSQPVYLRIAQYRSGIVPVAYRRVPCRRRGGIRFTINGHSYFNLVLVTNVGGAGDVRSL  175

Query  674  EVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTF  853
             +      +W P+ RNWG+ W+ NA L+G+SL+F+VTT+DG+ V S N AP SW +GQTF
Sbjct  176  YIKGS-RTQWQPMSRNWGQNWQNNAYLNGQSLSFKVTTSDGRTVVSYNAAPHSWSFGQTF  234

Query  854  EGRNCR  871
             G   R
Sbjct  235  TGGQFR  240



>gb|KEH35551.1| expansin A10 [Medicago truncatula]
Length=253

 Score =   233 bits (595),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 126/254 (50%), Positives = 170/254 (67%), Gaps = 13/254 (5%)
 Frame = +2

Query  128  AAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKE  298
            A +AT   +++  ++   L   FG D   GW +AHATFYG     GT+GGACG    + +
Sbjct  2    AIVATSFISTLFFVLSLCLKGTFG-DYGGGWENAHATFYGGGDASGTMGGACGYGNLYSQ  60

Query  299  TYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGD  460
             Y   T ALS ALFNN  SCG+CYE+KC +    C      I+VTAT+ CP        +
Sbjct  61   GYGTNTAALSTALFNNGLSCGSCYEMKCNSDPKWCL--PGSILVTATNFCPPNFAESNTN  118

Query  461  GKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVS  640
            G WC PP  HFDL+ PA+LQIA+YKAG+VP+ +RRVPC++KGG RFT++GH +FNLV V+
Sbjct  119  GGWCNPPLQHFDLAEPAFLQIAQYKAGIVPISFRRVPCVKKGGIRFTINGHSYFNLVLVT  178

Query  641  NVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNV  820
            NVGG+GDV  V +    +  W  + RNWG+ W++N  L+G+SL+F+VTT+DG+ +TS NV
Sbjct  179  NVGGAGDVHSVSIKGS-KTGWQAMSRNWGQNWQSNNYLNGQSLSFQVTTSDGRTITSNNV  237

Query  821  APKSWQYGQTFEGR  862
             P +WQ+GQTF GR
Sbjct  238  VPGNWQFGQTFTGR  251



>gb|AAC32927.1| putative expansin [Arabidopsis thaliana]
Length=248

 Score =   233 bits (594),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 164/247 (66%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttals  328
            I L    A+ C   G  A GW++AHATFYG  +  GT+GGACG    + + Y   T ALS
Sbjct  6    IALFCFAAMVCSVHGYDA-GWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALS  64

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAH  490
             ALFNN  SCGAC+EIKC +    C      IIVTAT+ CP  +      G WC PP  H
Sbjct  65   TALFNNGLSCGACFEIKCQSDGAWCLP--GAIIVTATNFCPPNNALPNNAGGWCNPPLHH  122

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDLS P + +IA+YKAGVVPV YRRVPCMR+GG RFT++GH +FNLV V+NVGG+GDV  
Sbjct  123  FDLSQPVFQRIAQYKAGVVPVSYRRVPCMRRGGIRFTINGHSYFNLVLVTNVGGAGDVHS  182

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
            V V      +W  + RNWG+ W++N +L+G++L+F+VT +DG+ V S N+AP SW +GQT
Sbjct  183  VAVKGS-RTRWQQMSRNWGQNWQSNNLLNGQALSFKVTASDGRTVVSNNIAPASWSFGQT  241

Query  851  FEGRNCR  871
            F GR  R
Sbjct  242  FTGRQFR  248



>ref|XP_004300427.1| PREDICTED: expansin-A4-like [Fragaria vesca subsp. vesca]
Length=259

 Score =   233 bits (595),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 128/261 (49%), Positives = 174/261 (67%), Gaps = 18/261 (7%)
 Frame = +2

Query  131  AMATELQASILLIVLCAL-----PCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-E  286
            AMA+    + LLI L ++     P V+ G +   W  AHATFYG  +  GT+GGACG   
Sbjct  2    AMASLACIAALLISLTSITEARIPGVYSGGA---WQGAHATFYGGSDASGTMGGACGYGN  58

Query  287  QFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP-----  451
             + + Y   T ALS ALFNN  SCGAC+EIKC N    C +    I +TAT+ CP     
Sbjct  59   LYSQGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQ  118

Query  452  -TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNL  628
             + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNL
Sbjct  119  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNL  178

Query  629  VTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVT  808
            V VSNV G+GD+ +V V       W+ L RNWG+ W++N++L G+SL+FRVT +D ++ T
Sbjct  179  VLVSNVAGAGDIVRVSVKGS-RTGWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRSST  237

Query  809  SQNVAPKSWQYGQTFEGRNCR  871
            S N+ P +WQ+GQTF G+N R
Sbjct  238  SWNIVPANWQFGQTFTGKNFR  258



>gb|AEN70867.1| alpha-expansin 1 [Gossypium thurberi]
Length=258

 Score =   233 bits (595),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 163/229 (71%), Gaps = 12/229 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GD   GW  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEY  532
            E++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+LQIAEY
Sbjct  90   ELRCNNDPQWCIS--RTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV +RRV C++KGG R+TM+GH +FN+V ++NVGG+GD++ V +    +  W+P+
Sbjct  148  RAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGS-KTGWLPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             RNWG+ W++NA L+G+SL+F+VT +DG+ +T+ NV P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>ref|XP_010534508.1| PREDICTED: expansin-A4 [Tarenaya hassleriana]
Length=261

 Score =   233 bits (595),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 123/257 (48%), Positives = 170/257 (66%), Gaps = 15/257 (6%)
 Frame = +2

Query  134  MATELQASILLIVLC--ALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKE  298
            + T L   +L +      +P ++ G +   W  AHATFYG  +  GT+GGACG    + +
Sbjct  8    LVTALPLFVLFLSFADARIPGIYSGSA---WQSAHATFYGGSDASGTMGGACGYGNLYSQ  64

Query  299  TYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGD  460
             Y   T ALS ALFNN  SCGAC+EIKC N    C +    I +TAT+ CP      + +
Sbjct  65   GYGVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNFAQPSDN  124

Query  461  GKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVS  640
            G WC PP+AHFDL+MP +L+IAEY+AG+VP+ YRRVPC ++GG RFT++GH++FNLV ++
Sbjct  125  GGWCNPPRAHFDLAMPMFLKIAEYRAGIVPISYRRVPCRKRGGIRFTINGHRYFNLVLIT  184

Query  641  NVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNV  820
            NV G+GD+ +  V       W+ L RNWG+ W++NA+L G+SL+FRVT +D +  TS N+
Sbjct  185  NVAGAGDIVRASVKGS-RTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNI  243

Query  821  APKSWQYGQTFEGRNCR  871
             P SWQ+GQTF G+N R
Sbjct  244  VPSSWQFGQTFVGKNFR  260



>gb|ADY68810.1| alpha-expansin 1 [Gossypium herbaceum subsp. africanum]
Length=258

 Score =   233 bits (595),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 162/229 (71%), Gaps = 12/229 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GD   GW  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEY  532
            E++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+LQIAEY
Sbjct  90   ELRCDNDPQWCIS--RTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV +RRV C++KGG R+TM+GH +FN+V ++NVGG+GD++ V +       W+P+
Sbjct  148  RAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGS-RTGWLPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             RNWG+ W++NA L+G+SL+F+VT +DG+ +T+ NV P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEG  255



>ref|XP_009141827.1| PREDICTED: expansin-A4-like [Brassica rapa]
Length=258

 Score =   233 bits (595),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 172/264 (65%), Gaps = 21/264 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            L+VL  T  + T   A I        P V+ G +   W  AHATFYG  +  GT+GGACG
Sbjct  6    LAVLFTTFVLFTLTDAKI--------PGVYSGGA---WQTAHATFYGGSDASGTMGGACG  54

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFN+  SCGAC+E+KC N    C +    I++TAT+ CP  
Sbjct  55   YGNLYSQGYGTNTAALSTALFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPN  114

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                + +G WC PP+AHFDL+MP +L+IA+Y+AG+VPV YRRVPC ++GG RFT++GH++
Sbjct  115  FAQASDNGGWCNPPRAHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRY  174

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNL  ++NV G+GD+ +  V       W+ L RNWG+ W++NA+L G+SL+FRVT +D +
Sbjct  175  FNLFLITNVAGAGDIVRTSVKGS-RTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRR  233

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P +WQ+GQTF G+N R
Sbjct  234  TSTSWNIVPSNWQFGQTFVGKNFR  257



>gb|AEN70868.1| alpha-expansin 1 [Gossypium laxum]
 gb|AEN70888.1| alpha-expansin 1 [Gossypium gossypioides]
 gb|AEN70889.1| alpha-expansin 1 [Gossypium lobatum]
 gb|AEN70890.1| alpha-expansin 1 [Gossypium trilobum]
Length=258

 Score =   233 bits (595),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 163/229 (71%), Gaps = 12/229 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GD   GW  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEY  532
            E++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+LQIAEY
Sbjct  90   ELRCNNDPQWCIS--RTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV +RRV C++KGG R+TM+GH +FN+V ++NVGG+GD++ V +    +  W+P+
Sbjct  148  RAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGS-KTGWLPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             RNWG+ W++NA L+G+SL+F+VT +DG+ +T+ NV P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>gb|KFK34799.1| hypothetical protein AALP_AA5G194700 [Arabis alpina]
Length=260

 Score =   233 bits (595),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 172/256 (67%), Gaps = 18/256 (7%)
 Frame = +2

Query  146  LQASILLIVLCAL-----PCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKET  301
            L  +I L +L +L     P V+ G S   W  AHATFYG  +  GT+GGACG    + + 
Sbjct  8    LLTTIPLFLLLSLTEAGIPGVYSGSS---WQTAHATFYGGDDASGTMGGACGYGNLYSQG  64

Query  302  YSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDG  463
            Y   T ALS ALFN+  +CGAC+EIKCVN    C +    + VTAT+ CP      + +G
Sbjct  65   YGTNTAALSTALFNSGLTCGACFEIKCVNDPKWCHSGAPSVFVTATNFCPPNLAQPSDNG  124

Query  464  KWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSN  643
             WC PP++HFDL+MP +L+IAEY+AG+VP+ YRRV C + GG RFT++GH++FNLV ++N
Sbjct  125  GWCNPPRSHFDLAMPIFLKIAEYRAGIVPISYRRVACKKSGGIRFTINGHRYFNLVLITN  184

Query  644  VGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVA  823
            V G+GD+ K  V    +  W+ L RNWG+ W++N +L G+SL+FRVTT+D ++ TS N+ 
Sbjct  185  VAGAGDIVKTSVKGS-KTSWMSLTRNWGQNWQSNDVLVGQSLSFRVTTSDRRSSTSLNIV  243

Query  824  PKSWQYGQTFEGRNCR  871
            P +WQ+GQTF G+N R
Sbjct  244  PSNWQFGQTFVGKNFR  259



>gb|KHG02505.1| Expansin-A2 [Gossypium arboreum]
Length=257

 Score =   233 bits (595),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 171/257 (67%), Gaps = 18/257 (7%)
 Frame = +2

Query  134  MATE---LQASILLIVLCALPCVF---GGDSAHGWLDAHATFYGPPE--GTIGGACGL-E  286
            MAT+   LQ   L  +      +F    GD   GW  AHATFYG  +  GT+GGACG   
Sbjct  1    MATKTMMLQIFPLFFLFSVCNSIFLGANGDDNGGWQTAHATFYGGADATGTMGGACGYGN  60

Query  287  QFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP-----  451
             + + Y   T ALS ALFNN  SCGACYE++C N    C +  + I VTAT+ CP     
Sbjct  61   LYSQGYGTSTAALSTALFNNGLSCGACYELRCNNDPQWCIS--RTITVTATNFCPPNYAL  118

Query  452  -TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNL  628
             + +G WC PP+ HFDL+ PA+LQIAEY+AG+VPV +RRV C++KGG R+TM+GH +FN+
Sbjct  119  SSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNM  178

Query  629  VTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVT  808
              ++NVGG+GD++ V +       W+P+ RNWG+ W++NA L+G+SL+F+VT +DG+ +T
Sbjct  179  ALITNVGGAGDITSVSIKGS-RTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTIT  237

Query  809  SQNVAPKSWQYGQTFEG  859
            + NV P  WQ+GQTFEG
Sbjct  238  AYNVVPAGWQFGQTFEG  254



>ref|NP_001234881.1| expansin9 precursor [Solanum lycopersicum]
 emb|CAB46492.1| expansin9 [Solanum lycopersicum]
Length=257

 Score =   233 bits (595),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 125/251 (50%), Positives = 168/251 (67%), Gaps = 17/251 (7%)
 Frame = +2

Query  158  ILLIVLCA----LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYt  316
            I+L++L      +P V+ G S   W +AHATFYG  +  GT+GGACG    + + Y    
Sbjct  10   IILVILVGVEGRIPGVYSGGS---WQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNN  66

Query  317  talsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAP  478
             ALS ALFNN  SCGAC+EIKC N    C      I++TAT+ CP        +G WC P
Sbjct  67   AALSTALFNNGLSCGACFEIKCDNQPQWCHPGSPSILITATNFCPPNYALPNDNGGWCNP  126

Query  479  PQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSG  658
            P+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G  +FNL+ V+NV G+G
Sbjct  127  PRTHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFSYFNLILVTNVAGAG  186

Query  659  DVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQ  838
            D++KV V       W+ L RNWG+ W+TN++L G+SL+FRVT +D +  TS N+AP  WQ
Sbjct  187  DITKVMVKGT-RTNWITLSRNWGQNWQTNSVLVGQSLSFRVTASDKRKSTSWNIAPSHWQ  245

Query  839  YGQTFEGRNCR  871
            +GQTF G+N R
Sbjct  246  FGQTFVGKNFR  256



>ref|XP_004970396.1| PREDICTED: expansin-A2-like [Setaria italica]
Length=251

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/254 (50%), Positives = 169/254 (67%), Gaps = 18/254 (7%)
 Frame = +2

Query  134  MATELQASILLIVLCALPCVFGGDSAH---GWLDAHATFYG--PPEGTIGGACGLEQFKE  298
            MAT   A++LL++LC+  C     +A    GW  AHATFYG     GT+GGACG      
Sbjct  1    MAT---ANVLLLLLCSAVCFLARRAAGDYGGWQSAHATFYGGGDASGTMGGACGYGNLYS  57

Query  299  T-YSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TG  457
            T Y   T ALS ALFN+ ASCG C+E++C N+   C      I VTAT+ CP      + 
Sbjct  58   TGYGTNTAALSTALFNDGASCGQCFELRCDNAGASCL--PGTITVTATNFCPPNYGLPSD  115

Query  458  DGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTV  637
            DG WC PP+ HFD++ PA+LQIA+Y+AG+VPV YRRVPC++KGG RFT++GH +FNLV V
Sbjct  116  DGGWCNPPRPHFDMAQPAFLQIAQYRAGIVPVAYRRVPCVKKGGIRFTINGHSYFNLVLV  175

Query  638  SNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQN  817
            +NV G+GDV  V +       W  + RNWG+ W++N++L G++L+F+VT +DG+ VTS N
Sbjct  176  TNVAGAGDVQSVSIKGS-STGWQAMSRNWGQNWQSNSLLDGQALSFKVTASDGRCVTSNN  234

Query  818  VAPKSWQYGQTFEG  859
             AP  W +GQTFEG
Sbjct  235  AAPAGWSFGQTFEG  248



>emb|CDP02244.1| unnamed protein product [Coffea canephora]
Length=242

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 168/241 (70%), Gaps = 15/241 (6%)
 Frame = +2

Query  161  LLIVLCALPCVFGGDSAHG----WLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYtt  319
            LL ++  L  V    SAHG    W++AHATFYG     GT+GGACG    + + Y   TT
Sbjct  7    LLFIVGLLSVV---SSAHGYYGGWMNAHATFYGGGDASGTMGGACGYGNLYSQGYGTATT  63

Query  320  alsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGDGKWCAPPQAHFDL  499
            ALS ALFNN  SCG+CY+I C N+   C   +  I+VTAT+ CP   G WC PP  HFDL
Sbjct  64   ALSTALFNNGLSCGSCYQIVCANAPRWCL--RGSIMVTATNFCP--PGGWCDPPNHHFDL  119

Query  500  SMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEV  679
            S PA+L+IA+Y+AG+VPV YRRVPC R+GG RFT++GH +FNLV V+NVGG+GDV  V +
Sbjct  120  SEPAFLRIAQYRAGIVPVVYRRVPCRRRGGIRFTINGHSYFNLVLVTNVGGAGDVQAVYI  179

Query  680  NAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
                  +W  + RNWG+ W++N+ L+G+SL+F+VTT+DG++V S NVAP SW +GQT+ G
Sbjct  180  KGS-RTRWQQMSRNWGQNWQSNSYLNGQSLSFKVTTSDGRSVVSYNVAPPSWSFGQTYSG  238

Query  860  R  862
            R
Sbjct  239  R  239



>gb|ABL86680.1| EXA1 [Gossypium barbadense]
 gb|ADY68808.1| alpha-expansin 1 [Gossypium barbadense]
 gb|ADY68809.1| alpha-expansin 1 [Gossypium barbadense]
 gb|AEN70872.1| alpha-expansin 1 [Gossypium mustelinum]
 gb|AEN70873.1| alpha-expansin 1 [Gossypium darwinii]
 gb|AEN70874.1| alpha-expansin 1 [Gossypium darwinii]
 gb|AEN70877.1| alpha-expansin 1 [Gossypium barbadense var. brasiliense]
 gb|AEN70878.1| alpha-expansin 1 [Gossypium barbadense var. brasiliense]
 gb|AEN70879.1| alpha-expansin 1 [Gossypium barbadense var. peruvianum]
 gb|AEN70880.1| alpha-expansin 1 [Gossypium barbadense var. peruvianum]
Length=258

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 163/229 (71%), Gaps = 12/229 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GD   GW  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEY  532
            E++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+LQIAEY
Sbjct  90   ELRCNNDPQWCIS--RTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV +RRV C++KGG R+TM+GH +FN+V ++NVGG+GD++ V +    +  W+P+
Sbjct  148  RAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKCS-KTGWLPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             RNWG+ W++NA L+G+SL+F+VT +DG+ +T+ NV P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>gb|ABL86681.1| EX4 [Gossypium barbadense]
Length=262

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 163/229 (71%), Gaps = 12/229 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GD   GW  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEY  532
            E++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+LQIAEY
Sbjct  90   ELRCNNDPQWCIS--RTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV +RRV C++KGG R+TM+GH +FN+V ++NVGG+GD++ V +    +  W+P+
Sbjct  148  RAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKCS-KTGWLPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             RNWG+ W++NA L+G+SL+F+VT +DG+ +T+ NV P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>gb|AAP48989.1| expansin [Sambucus nigra]
Length=256

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 169/259 (65%), Gaps = 13/259 (5%)
 Frame = +2

Query  122  ITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQF  292
            ++ A    L  S+  +V   +P  +GG +   W  AHATFYG  +  GT+GGACG    +
Sbjct  1    MSLACIASLVISLFSVVEARIPGNYGGGA---WESAHATFYGGSDASGTMGGACGYGNLY  57

Query  293  KETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------T  454
             + Y   T ALS ALFN   SCGAC+EIKC N    C +    I+VTAT+ CP       
Sbjct  58   SQGYGVNTAALSTALFNKGESCGACFEIKCANDPNWCHSGSPSIMVTATNFCPPNYALPN  117

Query  455  GDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVT  634
             +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNLV 
Sbjct  118  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKQGGVRFTINGFRYFNLVL  177

Query  635  VSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQ  814
            +SNV G+GD+ +V V       W+ + RNWG+ W++N +L G+SL+FRVT +D +  TS 
Sbjct  178  ISNVAGAGDIVRVSVKGS-RTGWMSMSRNWGQNWQSNTVLVGQSLSFRVTGSDRRTSTSW  236

Query  815  NVAPKSWQYGQTFEGRNCR  871
            N+ P +WQ+GQTF G+N R
Sbjct  237  NIVPANWQFGQTFTGKNFR  255



>emb|CDX76090.1| BnaA04g03540D [Brassica napus]
Length=260

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 171/265 (65%), Gaps = 25/265 (9%)
 Frame = +2

Query  134  MATELQASILLIVL----------CALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGAC  277
            MAT L  SI L +             +P V+ G S   W  AHATFYG  +  GT+GGAC
Sbjct  1    MATNL--SIFLTIFPLLLLLNPTNAGIPGVYSGSS---WQTAHATFYGGDDASGTMGGAC  55

Query  278  GL-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP-  451
            G    + + Y   T ALS ALFN   +CGAC+EIKCVN    C +    + VTAT+ CP 
Sbjct  56   GYGNLYSQGYGTNTAALSTALFNTGLTCGACFEIKCVNDPKWCHSGSPSVFVTATNFCPP  115

Query  452  -----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQ  616
                 + +G WC PP+AHFDL+MP +L+IAEY+AG+VP+ YRRV C + GG RFT++GH+
Sbjct  116  NLAQPSDNGGWCNPPRAHFDLAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHR  175

Query  617  FFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDG  796
            +FNLV ++NV G+GD+ +  V    +  W+ L RNWG+ W++N +L G+SL+FRVTT+D 
Sbjct  176  YFNLVLITNVAGAGDIVRTSVRGS-KTGWMGLTRNWGQNWQSNTVLVGQSLSFRVTTSDR  234

Query  797  KAVTSQNVAPKSWQYGQTFEGRNCR  871
            +  TS N+ P +WQ+GQTF G+N R
Sbjct  235  RTSTSWNIVPSNWQFGQTFVGKNFR  259



>gb|AEN70885.1| alpha-expansin 1 [Gossypium davidsonii]
 gb|AEN70886.1| alpha-expansin 1 [Gossypium klotzschianum]
Length=258

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 162/229 (71%), Gaps = 12/229 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GD   GW  AHATFYG  +  GT+GGACG    +   Y   T ALS ALFNN  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSHGYGTSTAALSTALFNNGLSCGACY  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEY  532
            E++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+LQIAEY
Sbjct  90   ELRCNNDPQWCIS--RTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV +RRV C++KGG R+TM+GH +FN+V ++NVGG+GD++ V +    +  W+P+
Sbjct  148  RAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGS-KTGWLPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             RNWG+ W++NA L+G+SL+F+VT +DG+ +T+ NV P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>gb|AEN70869.1| alpha-expansin 1 [Gossypium schwendimanii]
Length=258

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 163/229 (71%), Gaps = 12/229 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GD   GW  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEY  532
            E++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+LQIAEY
Sbjct  90   ELRCNNDPQWCIS--QTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV +RRV C++KGG R+TM+GH +FN+V ++NVGG+GD++ V +    +  W+P+
Sbjct  148  RAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGS-KTGWLPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             RNWG+ W++NA L+G+SL+F+VT +DG+ +T+ NV P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>ref|XP_008223717.1| PREDICTED: expansin-A4 [Prunus mume]
Length=260

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 172/261 (66%), Gaps = 13/261 (5%)
 Frame = +2

Query  116  LIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-E  286
            ++  +A    L  S++ +    +P V+ G +   W  AHATFYG  +  GT+GGACG   
Sbjct  3    VVSASACLASLLISLMWVAEARIPGVYSGGA---WEAAHATFYGGSDASGTMGGACGYGN  59

Query  287  QFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP-----  451
             + + Y   T ALS ALFNN  SCGAC+EIKC N    C +    I +TAT+ CP     
Sbjct  60   LYSQGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQ  119

Query  452  -TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNL  628
             + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNL
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNL  179

Query  629  VTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVT  808
            V VSNV G+GD+ +V V    +  W+ + RNWG+ W++NA+L G+SL+FRV  +D +  T
Sbjct  180  VLVSNVAGAGDIVRVSVKGS-KTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRRTST  238

Query  809  SQNVAPKSWQYGQTFEGRNCR  871
            S NV P +WQ+GQTF G+N R
Sbjct  239  SWNVVPANWQFGQTFTGKNFR  259



>gb|AEN70875.1| alpha-expansin 1 [Gossypium tomentosum]
 gb|AEN70876.1| alpha-expansin 1 [Gossypium tomentosum]
Length=258

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 163/229 (71%), Gaps = 12/229 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GD   GW  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEY  532
            E++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+LQIAEY
Sbjct  90   ELRCNNDPQWCIS--RTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV +RRV C++KGG R+TM+GH +FN++ ++NVGG+GD++ V +    +  W+P+
Sbjct  148  RAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMLLITNVGGAGDITSVSIKGS-KTGWLPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             RNWG+ W++NA L+G+SL+F+VT +DG+ +T+ NV P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>gb|AEN70871.1| alpha-expansin 1 [Gossypium mustelinum]
Length=258

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 162/229 (71%), Gaps = 12/229 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GD   GW  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEY  532
            E++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+LQIAEY
Sbjct  90   ELRCNNDPQWCIS--RTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV +RRV C++KGG R+TM+GH +FN+V ++NVGG+GD++ V +       W+P+
Sbjct  148  RAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNVVLITNVGGAGDITSVSIKGS-RTGWLPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             RNWG+ W++NA L+G+SL+F+VT +DG+ +T+ NV P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEG  255



>ref|XP_006477470.1| PREDICTED: expansin-A1-like [Citrus sinensis]
Length=283

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 153/225 (68%), Gaps = 12/225 (5%)
 Frame = +2

Query  212  HGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKC  382
             GW DAHATFYG     GT+GGACG    + E Y   T ALS ALFNN  SCGAC+EIKC
Sbjct  58   QGWTDAHATFYGGGDASGTMGGACGYGNLYSEGYGTNTAALSTALFNNGMSCGACFEIKC  117

Query  383  VNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHFDLSMPAYLQIAEYKAGV  544
            VN    C+     I VTAT+ CP  +      G WC PPQ HFDLS P + QIA+YKAG+
Sbjct  118  VNDPRWCRP--GSIFVTATNFCPPNNALPNNAGGWCNPPQQHFDLSQPVFEQIAQYKAGI  175

Query  545  VPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNW  724
            VPV YRRVPC RKGG RFT++GH +FNLV ++NVGG+GDV  V +       W P+ RNW
Sbjct  176  VPVSYRRVPCSRKGGIRFTINGHSYFNLVLITNVGGAGDVRAVSIKGS-RTDWQPMSRNW  234

Query  725  GEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
            G+ W++N+ L+G+SL+F+VTT+DG  V S NVAP  W +GQTF G
Sbjct  235  GQNWQSNSYLNGQSLSFKVTTSDGHTVVSNNVAPAGWSFGQTFSG  279



>ref|NP_191109.1| expansin A16 [Arabidopsis thaliana]
 sp|Q9M2S9.1|EXP16_ARATH RecName: Full=Expansin-A16; Short=AtEXPA16; AltName: Full=Alpha-expansin-16; 
Short=At-EXP16; Short=AtEx16; AltName: Full=Ath-ExpAlpha-1.7; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB75908.1| expansin-like protein [Arabidopsis thaliana]
 dbj|BAD43638.1| expansin-like protein [Arabidopsis thaliana]
 gb|AEE79393.1| expansin A16 [Arabidopsis thaliana]
Length=260

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 167/247 (68%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttals  328
            +L      +P VF G S   W  AHATFYG     GT+GGACG    + + Y   T ALS
Sbjct  17   LLSFTDAGIPRVFSGGS---WQTAHATFYGGNDASGTMGGACGYGNLYSQGYGTNTAALS  73

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAH  490
             +LFN+  SCGAC+EIKCVN    C      + VTAT+ CP      + +G WC PP++H
Sbjct  74   TSLFNSGQSCGACFEIKCVNDPKWCHPGNPSVFVTATNFCPPNLAQPSDNGGWCNPPRSH  133

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDL+MP +L+IAEY+AG+VP+ YRRV C + GG RFT++GH++FNLV ++NV G+GD+++
Sbjct  134  FDLAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIAR  193

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
              V    +  W+ L RNWG+ W++NA+L G+SL+FRVT++D +  TS N+AP +WQ+GQT
Sbjct  194  TSVKGS-KTGWMSLTRNWGQNWQSNAVLVGQSLSFRVTSSDRRTSTSWNIAPSNWQFGQT  252

Query  851  FEGRNCR  871
            F G+N R
Sbjct  253  FVGKNFR  259



>ref|XP_009357738.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
 ref|XP_009357739.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 176/262 (67%), Gaps = 17/262 (6%)
 Frame = +2

Query  113  VLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-  283
            +L I + MA  L ++I  +V   +P V+ G +   W DAHATFYG  +  GT+GGACG  
Sbjct  7    LLCIVSLMA--LASTI--VVDARIPGVYTGGA---WQDAHATFYGGSDASGTMGGACGYG  59

Query  284  EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP----  451
              + + Y   T ALS ALFNN  SCGAC+E+KC N    CK+    I VTAT+ CP    
Sbjct  60   NLYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFA  119

Query  452  --TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFN  625
              + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++GH++FN
Sbjct  120  QPSDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFN  179

Query  626  LVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAV  805
            LV + NV G+GD+ K  V       W+ L RNWG+ W++N++L G+SL+FRVT +D +  
Sbjct  180  LVLIHNVAGAGDIVKAYVKGT-NTPWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTS  238

Query  806  TSQNVAPKSWQYGQTFEGRNCR  871
            TS N+ P +WQ+GQTF G+N R
Sbjct  239  TSWNIVPSNWQFGQTFTGKNFR  260



>dbj|BAC67194.1| expansin [Pyrus communis]
Length=261

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 176/262 (67%), Gaps = 17/262 (6%)
 Frame = +2

Query  113  VLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-  283
            +L I + MA  L ++I  +V   +P V+ G +   W DAHATFYG  +  GT+GGACG  
Sbjct  7    LLCIVSLMA--LASTI--VVDARIPGVYTGAA---WQDAHATFYGGSDASGTMGGACGYG  59

Query  284  EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP----  451
              + + Y   T ALS ALFNN  SCGAC+E+KC N    CK+    I VTAT+ CP    
Sbjct  60   NLYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFA  119

Query  452  --TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFN  625
              + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++GH++FN
Sbjct  120  QPSDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFN  179

Query  626  LVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAV  805
            LV + NV G+GD+ K  V       W+ L RNWG+ W++N++L G+SL+FRVT +D +  
Sbjct  180  LVLIHNVAGAGDIVKAYVKGT-NTPWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTS  238

Query  806  TSQNVAPKSWQYGQTFEGRNCR  871
            TS N+ P +WQ+GQTF G+N R
Sbjct  239  TSWNIVPSNWQFGQTFTGKNFR  260



>dbj|BAC67193.1| expansin [Pyrus communis]
Length=258

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 167/255 (65%), Gaps = 13/255 (5%)
 Frame = +2

Query  134  MATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETY  304
            +      S+ +     +P V+ G S   W  AHATFYG     GT+GGACG    + + Y
Sbjct  7    LYIAFMLSLFMAANARIPGVYTGGS---WEGAHATFYGGNDASGTMGGACGYGNLYSQGY  63

Query  305  SPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGK  466
               T ALS ALFNN  SCGAC+EIKC +    C      I+VTAT+ CP      + DG 
Sbjct  64   GVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSDDGG  123

Query  467  WCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNV  646
            WC PP+ HFDL+MP +L+IAEYKAG+VPV YRRVPC ++GG RFT++G ++FNLV ++NV
Sbjct  124  WCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLITNV  183

Query  647  GGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAP  826
             G+GD+ +V V   G   W+P+ RNWG+ W++NA L G++L+FRVT +D +  TS NVAP
Sbjct  184  AGAGDIVRVSVKG-GNTGWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSHNVAP  242

Query  827  KSWQYGQTFEGRNCR  871
              WQ+GQTF G+N R
Sbjct  243  ADWQFGQTFTGKNFR  257



>gb|AEN70891.1| expansin [Gossypium thurberi]
Length=259

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 172/264 (65%), Gaps = 21/264 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            +SVLI  ++M    +A I        P V+ G +   W +AHATFYG  +  GT+GGACG
Sbjct  7    ISVLIFISSMWMMGEARI--------PGVYSGGA---WQNAHATFYGGADASGTMGGACG  55

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC +    C +    I +TAT+ CP  
Sbjct  56   YGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPN  115

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                  +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  116  YALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  175

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV +SNV G+GD+ KV V       W+ + RNWG+ W++NA+L G+SL+FRVT +D +
Sbjct  176  FNLVLISNVAGAGDIVKVSVKGS-RTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRR  234

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P  WQ+GQTF G+N R
Sbjct  235  TSTSWNIVPSHWQFGQTFTGKNFR  258



>dbj|BAJ10398.1| alpha-expansin [Dianthus caryophyllus]
Length=252

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/245 (51%), Positives = 164/245 (67%), Gaps = 14/245 (6%)
 Frame = +2

Query  158  ILLIVLCALPCVFG--GDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYtta  322
            I  IVL    C+ G  GD   GW  AHATFYG     GT+GGACG    + + Y   T A
Sbjct  8    ISTIVLILFTCLHGAYGDYGGGWTSAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAA  67

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQ  484
            LS ALFNN  SCGACY+++C      C      I+VTAT+ CP        +G WC PP 
Sbjct  68   LSTALFNNGLSCGACYQLQCSGDPKWCL--PGSIMVTATNFCPPNPSLPNDNGGWCNPPL  125

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDL+ P++L+IA+Y+AG+VPV +RRVPC RKGG RFT++GH +FNLV V+NVGG+GDV
Sbjct  126  QHFDLAEPSFLRIAQYRAGIVPVSFRRVPCARKGGVRFTINGHSYFNLVLVTNVGGAGDV  185

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
              V +       W P+ RNWG+ W++N  ++G+SL+F+VTT+DG+ +TS NVAP +WQ+G
Sbjct  186  HAVSIKGS-RTGWQPMSRNWGQNWQSNGYMNGQSLSFQVTTSDGRTITSNNVAPSNWQFG  244

Query  845  QTFEG  859
            QTFEG
Sbjct  245  QTFEG  249



>ref|XP_008777004.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=258

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 164/249 (66%), Gaps = 10/249 (4%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYtta  322
            AS+L  +  A   + G  +   W  AHATFYG  +  GT+GGACG    + + Y   T A
Sbjct  10   ASVLAFLSPAAARILGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAA  69

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQ  484
            LS ALFN   SCGAC+EIKC +    C      I +TAT+ CP      + +G WC PP+
Sbjct  70   LSTALFNEGQSCGACFEIKCADDPSWCHRGSPSIFITATNFCPPNYALPSDNGGWCNPPR  129

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDL+MP +L+IAEY+AG+VPV YRRVPC + GG RFT++G Q+FNLV ++NV G+GD+
Sbjct  130  PHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFQYFNLVLITNVAGAGDI  189

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
             +V V       W+PL RNWG+ W++NA+L G+SL+FRVT +D +  TS NV P +WQ+G
Sbjct  190  VRVSVKGS-RTGWMPLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTATSWNVVPANWQFG  248

Query  845  QTFEGRNCR  871
            QTF G+N R
Sbjct  249  QTFAGKNFR  257



>gb|AEN70914.1| expansin [Gossypium trilobum]
Length=259

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 172/264 (65%), Gaps = 21/264 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            +SVLI  ++M    +A I        P V+ G +   W +AHATFYG  +  GT+GGACG
Sbjct  7    ISVLIFISSMWMMGEARI--------PGVYSGGA---WQNAHATFYGGADASGTMGGACG  55

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC +    C +    I +TAT+ CP  
Sbjct  56   YGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPN  115

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                  +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  116  FALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  175

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV +SNV G+GD+ KV V       W+ + RNWG+ W++NA+L G+SL+FRVT +D +
Sbjct  176  FNLVLISNVAGAGDIVKVSVKGS-RTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRR  234

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P  WQ+GQTF G+N R
Sbjct  235  TSTSWNIVPSHWQFGQTFTGKNFR  258



>gb|AFB77223.1| expansin 1 [Betula platyphylla]
Length=258

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 173/264 (66%), Gaps = 19/264 (7%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACG  280
            L V  I + MA      +L +V   +P V+ G +   W  AHATFYG     GT+GGACG
Sbjct  4    LCVACIVSLMA------LLTLVDAKIPGVYSGGA---WQSAHATFYGGNDASGTMGGACG  54

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC N    C +    I++TAT+ CP  
Sbjct  55   YGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSILITATNFCPPN  114

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  115  YALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRY  174

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV ++NV G+GD+ KV V     E W+ L RNWG+ W++N +L+G+SL+FRVT +D +
Sbjct  175  FNLVLITNVAGAGDIVKVSVKGSKTE-WMSLSRNWGQNWQSNVVLAGQSLSFRVTGSDRR  233

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P  WQ+GQTF G+N R
Sbjct  234  TSTSWNIVPSDWQFGQTFTGKNFR  257



>gb|ADY68814.1| expansin [Gossypium barbadense]
 gb|ADY68816.1| expansin [Gossypium herbaceum subsp. africanum]
 gb|AEN70897.1| expansin [Gossypium darwinii]
 gb|AEN70899.1| expansin [Gossypium tomentosum]
 gb|AEN70903.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70905.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70909.1| expansin [Gossypium davidsonii]
 gb|AEN70910.1| expansin [Gossypium klotzschianum]
Length=259

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 172/264 (65%), Gaps = 21/264 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            +SVLI  ++M    +A I        P V+ G +   W +AHATFYG  +  GT+GGACG
Sbjct  7    ISVLIFISSMWMMGEARI--------PGVYSGGA---WQNAHATFYGGADASGTMGGACG  55

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC +    C +    I +TAT+ CP  
Sbjct  56   YGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPN  115

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                  +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  116  YALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  175

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV +SNV G+GD+ KV V       W+ + RNWG+ W++NA+L G+SL+FRVT +D +
Sbjct  176  FNLVLISNVAGAGDIVKVSVKGS-RTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRR  234

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P  WQ+GQTF G+N R
Sbjct  235  TSTSWNIVPAHWQFGQTFTGKNFR  258



>ref|XP_007218834.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
 gb|EMJ20033.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
Length=259

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/253 (50%), Positives = 170/253 (67%), Gaps = 13/253 (5%)
 Frame = +2

Query  140  TELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSP  310
              L A    IV   +P V+ G++   W  AHATFYG  +  GT+GGACG    + + Y  
Sbjct  10   VSLIALASTIVEARIPGVYSGEA---WQGAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  311  YttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWC  472
             T ALS ALFNN  SCGAC+EIKC N    C +    I VTAT+ CP        +G WC
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYALPNDNGGWC  126

Query  473  APPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGG  652
             PP++HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNLV ++NV G
Sbjct  127  NPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTVNGFKYFNLVLITNVAG  186

Query  653  SGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKS  832
            +GD+ KV V    +  W+ L RNWG+ W++NA+L+G+SL+FRVT +D +  TS N+ P +
Sbjct  187  AGDIVKVSVKGS-KTGWMSLSRNWGQNWQSNAVLAGQSLSFRVTGSDRRTSTSWNIVPAN  245

Query  833  WQYGQTFEGRNCR  871
            WQ+GQTF G+N R
Sbjct  246  WQFGQTFTGKNFR  258



>ref|XP_010505648.1| PREDICTED: expansin-A4 [Camelina sativa]
Length=257

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/261 (48%), Positives = 174/261 (67%), Gaps = 20/261 (8%)
 Frame = +2

Query  134  MATELQASILLIVLCAL-----PCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQ  289
            MA +L       VL +L     P V+ G S   W +AHATFYG  +  GT+GGACG    
Sbjct  1    MAIKLAILFTTFVLFSLADARIPGVYSGSS---WQNAHATFYGGSDASGTMGGACGYGNL  57

Query  290  FKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------  451
            + + Y   T ALS ALFNN  SCGAC+E+KC N    C +    I++TAT+ CP      
Sbjct  58   YSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQP  117

Query  452  TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLV  631
            + +G WC PP+ HFDL+MP +L+IA+Y+AG+VPV YRRVPC ++GG RFT++GH++FNL+
Sbjct  118  SDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLI  177

Query  632  TVSNVGGSGDVSKVEVNAEGEEK-WVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVT  808
             ++NV G+GD+  V  N +G    W+ L RNWG+ W++NA+L G+SL+FRVT +D +  T
Sbjct  178  LITNVAGAGDI--VRANVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTST  235

Query  809  SQNVAPKSWQYGQTFEGRNCR  871
            S N+ P +WQ+GQTF G+N R
Sbjct  236  SWNMVPSNWQFGQTFVGKNFR  256



>gb|ABM66452.1| expansin [Vicia faba]
Length=254

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 169/252 (67%), Gaps = 16/252 (6%)
 Frame = +2

Query  143  ELQASILLIVLCALPCVFGGDSAHG----WLDAHATFYG--PPEGTIGGACGL-EQFKET  301
            E + SI +++L AL       S  G    W  AHATFYG     GT+GGACG    + + 
Sbjct  3    EQEFSISMMILFALFISLNMLSVEGDYGGWESAHATFYGGGDASGTMGGACGYGNLYSQG  62

Query  302  YSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDG  463
            Y   T ALS ALFNN  SCG+CYE++C +    CK     IIVTAT+ CP        DG
Sbjct  63   YGTNTAALSTALFNNGLSCGSCYEMRCNDDPRWCKP--GSIIVTATNFCPPNPAQANNDG  120

Query  464  KWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSN  643
             WC PP  HFD++ PA+LQIAEY+AG+VPV +RRVPC +KGG RFT++GH +F+LV V+N
Sbjct  121  GWCNPPLQHFDMAEPAFLQIAEYRAGIVPVSFRRVPCFKKGGVRFTINGHSYFDLVLVTN  180

Query  644  VGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVA  823
            VGG+GDV  + +       W P+ RNWG+ W++N+ L+G+SL+F+VTT+DG+ +TS NVA
Sbjct  181  VGGAGDVHSISIKGS-RTSWQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTITSYNVA  239

Query  824  PKSWQYGQTFEG  859
            P +WQ+GQTF+G
Sbjct  240  PANWQFGQTFQG  251



>ref|XP_009589509.1| PREDICTED: expansin-A10-like [Nicotiana tomentosiformis]
Length=240

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/246 (51%), Positives = 165/246 (67%), Gaps = 14/246 (6%)
 Frame = +2

Query  155  SILLIVLCALPCVFGGDSAHG----WLDAHATFYG--PPEGTIGGACGL-EQFKETYSPY  313
            +IL+++   +  +F   S HG    W++AHATFYG     GT+GGACG    +   Y   
Sbjct  2    AILILLFMGISLMF--QSVHGYYGGWINAHATFYGGGDASGTMGGACGYGNLYSSGYGTN  59

Query  314  ttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGDGKWCAPPQAHF  493
            T ALS ALFNN  SCGAC++++CVN+   C      I VTAT+ CP   G WC PP  HF
Sbjct  60   TAALSTALFNNGLSCGACFQLRCVNARQYCL--PGTITVTATNFCP--PGGWCDPPNHHF  115

Query  494  DLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKV  673
            DLS P YL+IA+Y++G+VPV YRRVPC R+GG RFT++GH +FNLV V+NVGG+GDV  +
Sbjct  116  DLSEPVYLRIAQYRSGIVPVAYRRVPCRRRGGIRFTINGHSYFNLVLVTNVGGAGDVRSL  175

Query  674  EVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTF  853
             +      +W P+ RNWG+ W+ NA L+G+SL+F+VTT+DG+ V S N AP SW +GQTF
Sbjct  176  YIKGS-RTQWQPMSRNWGQNWQNNAYLNGQSLSFKVTTSDGRTVVSYNAAPHSWSFGQTF  234

Query  854  EGRNCR  871
             G   R
Sbjct  235  TGGQFR  240



>gb|EPS66901.1| hypothetical protein M569_07876, partial [Genlisea aurea]
Length=222

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 160/219 (73%), Gaps = 6/219 (3%)
 Frame = +2

Query  218  WLDAHATFYGPPEG--TIGGACGLEQ-FKETYSPYttalsaalfnnaasCGACYEIKCVN  388
            W +A ATFYG P+G  TIGGACG E   ++ +   T ALSAALF +A +CG+CYEI+C  
Sbjct  6    WKEAKATFYGAPDGSGTIGGACGYEDDMRDAFGVRTAALSAALFKDAQACGSCYEIRCAQ  65

Query  389  STGQCKTPQKPIIVTATDLCPTGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRV  568
                C+ P + + VTAT+LCP+G   WC+ P  HFD+S PA+LQIA+Y+AGVVPV YRRV
Sbjct  66   GNDGCRQPAETVQVTATNLCPSGG--WCSYPNEHFDMSQPAFLQIAKYEAGVVPVQYRRV  123

Query  569  PCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNA  748
            PC + GG RF ++G+  FNLVT++NVGG+GDV+KVEV    +  W  LKRNWGEKWE ++
Sbjct  124  PCKKNGGIRFKITGNPNFNLVTITNVGGAGDVTKVEVRTV-DLPWTELKRNWGEKWEIDS  182

Query  749  MLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRN  865
             L G+ L FR+TT+DG  +T + VAP +WQ+GQT+E RN
Sbjct  183  QLLGRRLTFRITTSDGGRLTLRRVAPVNWQFGQTYETRN  221



>ref|NP_001288942.1| expansin-A16 precursor [Brassica rapa]
 gb|AGM16358.1| alpha-expansin protein 16 [Brassica rapa]
Length=260

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/247 (49%), Positives = 167/247 (68%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttals  328
             L +   A+P V+ G S   W  AHATFYG  +  GT+GGACG    + + Y   T ALS
Sbjct  17   FLSLTNAAIPGVYSGGS---WQTAHATFYGGDDASGTMGGACGYGNLYSQGYGTNTAALS  73

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAH  490
             ALFNN  +CGAC+EIKCVN    C +    + VTAT+ CP      + +G WC PP+AH
Sbjct  74   TALFNNGLTCGACFEIKCVNDPKWCHSGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRAH  133

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDL+MP +L+IAEY+AG+VP+ YRRV C + GG RFT++GH++FNLV ++NV G+GD+ +
Sbjct  134  FDLAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIVR  193

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
              V    +  W+ L RNWG+ W++N +L G+SL+FRVTT+D +  TS N+ P +WQ+GQT
Sbjct  194  TSVKGS-KTGWMGLTRNWGQNWQSNTVLVGQSLSFRVTTSDRRTSTSWNIVPSNWQFGQT  252

Query  851  FEGRNCR  871
            F G+N R
Sbjct  253  FVGKNFR  259



>gb|AEN70881.1| alpha-expansin 1 [Gossypium hirsutum subsp. latifolium]
Length=258

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 162/229 (71%), Gaps = 12/229 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GD   GW  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEY  532
            E++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+L+IAEY
Sbjct  90   ELRCNNDPQWCIS--RTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLRIAEY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV +RRV C++KGG R+TM+GH +FN+V ++NVGG+GD++ V +       W+P+
Sbjct  148  RAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGS-RTGWLPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             RNWG+ W++NA L+G+SL+F+VT +DG+ +T+ NV P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEG  255



>ref|XP_006366709.1| PREDICTED: expansin-A10-like [Solanum tuberosum]
Length=241

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 162/237 (68%), Gaps = 8/237 (3%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttals  328
            I L+   A+     G     W++AHATFYG     GT+GGACG    + + Y   T ALS
Sbjct  6    IFLVCFLAIASFVKGYGKGKWINAHATFYGGGDASGTMGGACGYGNLYNQGYGTKTAALS  65

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGDGKWCAPPQAHFDLSMP  508
             ALFNN  SCG+CYEIKCVN    C +    I VTAT+LCP G   WC PP  HFDLS P
Sbjct  66   TALFNNGLSCGSCYEIKCVNEHKWCLS--GSIKVTATNLCPPGG--WCNPPLHHFDLSQP  121

Query  509  AYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAE  688
             +  IA+Y+AG+VP+ YRR+PC RKGG RFT++GH +FNLV V+NVGG+GDV  V +   
Sbjct  122  IFQHIAQYRAGIVPIAYRRIPCRRKGGIRFTINGHSYFNLVLVTNVGGAGDVHAVAIKGS  181

Query  689  GEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             + +W  + RNWG+ W++N++L+G+SL+F+VTT+DG +V S+NVAP SW +GQT+ G
Sbjct  182  -KTQWQSMSRNWGQNWQSNSLLNGQSLSFKVTTSDGHSVVSKNVAPASWSFGQTYTG  237



>gb|ACA05165.1| expansin 2 [Dimocarpus longan]
Length=250

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 162/255 (64%), Gaps = 14/255 (5%)
 Frame = +2

Query  134  MATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETY  304
            M   L   +L+  L  +  V  G S  GW+  HATFYG     GT+GGACG    + + Y
Sbjct  1    MKMALAGLLLVGFLAVVTSVNAGPS--GWISGHATFYGGGDASGTMGGACGYGNLYSQGY  58

Query  305  SPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GK  466
               T ALS ALFN+  SCG+CYEIKCVN    C      I+VTAT+ CP  +      G 
Sbjct  59   GTNTAALSTALFNSGLSCGSCYEIKCVNDARWCL--PGSIVVTATNFCPPNNALPNDAGG  116

Query  467  WCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNV  646
            WC PPQ HFDLS P +  IA+Y+AG+VPV YRRVPC RKGG RFT++GH +FNLV ++NV
Sbjct  117  WCNPPQQHFDLSQPVFQHIAQYRAGIVPVAYRRVPCRRKGGIRFTINGHSYFNLVLITNV  176

Query  647  GGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAP  826
            GG+GDV  V +       W  + RNWG+ W++N +L+G+SL+F+VTT+DG+ V S NVAP
Sbjct  177  GGAGDVHAVSIKGS-RTGWQAMSRNWGQNWQSNTLLNGQSLSFKVTTSDGRTVVSNNVAP  235

Query  827  KSWQYGQTFEGRNCR  871
              W +GQT+ G   R
Sbjct  236  AGWSFGQTYSGAQFR  250



>gb|AFK38068.1| unknown [Medicago truncatula]
Length=253

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/254 (50%), Positives = 169/254 (67%), Gaps = 13/254 (5%)
 Frame = +2

Query  128  AAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKE  298
            A +AT   +++  ++   L   FG D   GW +AHATFYG     GT+GGACG    + +
Sbjct  2    AIVATSFISTLFFVLSLCLKGTFG-DYGGGWENAHATFYGGGDASGTMGGACGYGNLYSQ  60

Query  299  TYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGD  460
             Y   T ALS ALFNN  SCG+CYE+KC +    C      I+VTAT+ CP        +
Sbjct  61   GYGTNTAALSTALFNNGLSCGSCYEMKCNSDPKWCL--PGSILVTATNFCPPNFAESNTN  118

Query  461  GKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVS  640
            G WC PP  HFDL+ PA+LQIA+YKAG+VP+  RRVPC++KGG RFT++GH +FNLV V+
Sbjct  119  GGWCNPPLQHFDLAEPAFLQIAQYKAGIVPISIRRVPCVKKGGIRFTINGHSYFNLVLVT  178

Query  641  NVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNV  820
            NVGG+GDV  V +    +  W  + RNWG+ W++N  L+G+SL+F+VTT+DG+ +TS NV
Sbjct  179  NVGGAGDVHSVSIKGS-KTGWQAMSRNWGQNWQSNNYLNGQSLSFQVTTSDGRTITSNNV  237

Query  821  APKSWQYGQTFEGR  862
             P +WQ+GQTF GR
Sbjct  238  VPGNWQFGQTFTGR  251



>gb|AAM22625.1|AF428178_1 expansin 11 precursor [Rumex palustris]
Length=258

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 171/257 (67%), Gaps = 10/257 (4%)
 Frame = +2

Query  128  AAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKE  298
            AA++  L    +L    A   + G  S  GW  AHATFYG  +  GT+GGACG    + +
Sbjct  2    AALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYSQ  61

Query  299  TYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGD  460
             Y   T ALS ALFNN  SCGAC+EIKC +    C      I++TAT+ CP      + +
Sbjct  62   GYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCHPGSPSILITATNFCPPNFAEPSDN  121

Query  461  GKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVS  640
            G WC PP+ HFDL+MP +L+IAEY+AG+VPV +RRVPC ++GG RFT++G ++FNLV ++
Sbjct  122  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTVNGFRYFNLVLIT  181

Query  641  NVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNV  820
            NV G+GD+ +V +       W+P+ RNWG+ W++NA+L G+SL+FRVT +D +  TS NV
Sbjct  182  NVAGAGDIVRVSIKGS-RSDWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRKSTSWNV  240

Query  821  APKSWQYGQTFEGRNCR  871
            AP SWQ+GQTF G+N R
Sbjct  241  APASWQFGQTFTGKNFR  257



>ref|XP_009629442.1| PREDICTED: expansin-A10-like [Nicotiana tomentosiformis]
Length=249

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 160/243 (66%), Gaps = 12/243 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttals  328
            I L+ L A+     G+   GW++AHATFYG     GT+GGACG    +   Y   T ALS
Sbjct  6    IFLVGLLAIASSANGNGGEGWINAHATFYGGGDASGTMGGACGYGNLYSHGYGTNTAALS  65

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAH  490
             ALFNN  SCG+CYEIKCVN    C      I+VTAT+ CP      +  G WC PP  H
Sbjct  66   TALFNNGLSCGSCYEIKCVNEHKWCL--PGSILVTATNFCPPNNALSSNAGGWCNPPLHH  123

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDLS P +  IA+Y+AG+VPV YRRVPC R+GG RFT++GH +FNLV V+NVGG+GDV  
Sbjct  124  FDLSQPTFQHIAQYRAGIVPVAYRRVPCRRRGGIRFTINGHSYFNLVLVTNVGGAGDVHA  183

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
            V +      +W  + RNWG+ W++N  L+G+ L+F+VTT+DGK+V S NVAP SW +GQT
Sbjct  184  VAIKGS-RTQWQSMSRNWGQNWQSNNYLNGQILSFKVTTSDGKSVVSYNVAPASWSFGQT  242

Query  851  FEG  859
            + G
Sbjct  243  YTG  245



>ref|XP_002878036.1| ATEXPA16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54295.1| ATEXPA16 [Arabidopsis lyrata subsp. lyrata]
Length=260

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/247 (49%), Positives = 166/247 (67%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttals  328
            +L      +P V+ G S   W  AHATFYG     GT+GGACG    + + Y   T ALS
Sbjct  17   LLSFTDAGIPGVYSGGS---WQTAHATFYGGNDASGTMGGACGYGNLYSQGYGTNTAALS  73

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAH  490
             ALFN+  SCGAC+EIKCVN    C      + VTAT+ CP      + +G WC PP++H
Sbjct  74   TALFNSGQSCGACFEIKCVNDPKWCHPGNPSVFVTATNFCPPNLAQPSDNGGWCNPPRSH  133

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDL+MP +L+IAEY+AG+VP+ YRRV C + GG RFT++GH++FNLV ++NV G+GD+ +
Sbjct  134  FDLAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDILR  193

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
              V    +  W+ L RNWG+ W++NA+L G+SL+FRVTT+D +  TS N+AP +WQ+GQT
Sbjct  194  TSVKGS-KTGWMSLTRNWGQNWQSNAVLVGQSLSFRVTTSDRRTSTSWNIAPSNWQFGQT  252

Query  851  FEGRNCR  871
            F G+N R
Sbjct  253  FVGKNFR  259



>gb|ABD48785.1| alpha-expansin 1 [Gossypium hirsutum]
 gb|ACD37707.1| alpha expansin [Gossypium hirsutum]
 gb|ADY68812.1| alpha-expansin 1 [Gossypium hirsutum]
Length=258

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 162/229 (71%), Gaps = 12/229 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GD   GW  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEY  532
            E++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+L+IAEY
Sbjct  90   ELRCNNDPQWCIS--RTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLRIAEY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV +RRV C++KGG R+TM+GH +FN+V ++NVGG+GD++ V +       W+P+
Sbjct  148  RAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGS-RTGWLPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             RNWG+ W++NA L+G+SL+F+VT +DG+ +T+ NV P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEG  255



>ref|XP_007027486.1| Alpha-expansin 3 precursor [Theobroma cacao]
 gb|EOY07988.1| Alpha-expansin 3 precursor [Theobroma cacao]
Length=295

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 163/227 (72%), Gaps = 9/227 (4%)
 Frame = +2

Query  218  WLDAHATFYGPPEGTIGGACGLEQF-KETYSPYttalsaalfnnaasCGACYEIKCVNST  394
            W   HATFY    GT GGACG E   K  Y   T ALSAALFNN   CGAC+EIKCV+S+
Sbjct  66   WKQGHATFYEGGSGTFGGACGYEDVVKMGYGLNTAALSAALFNNGQKCGACFEIKCVDSS  125

Query  395  GQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVF  556
              CK  Q  +IVTATD CP      + +G WC PP+AHFDL+ PA+ QIAEY+ G+VPV 
Sbjct  126  EWCKPGQPSLIVTATDSCPPNYDLPSDNGGWCNPPRAHFDLAKPAFGQIAEYQGGIVPVQ  185

Query  557  YRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEV-NAEGEEKWVPLKRNWGEK  733
            YRRVPC ++GG RFT++G+ +FNLV+V NVGG+GDV  V V   + ++ W+PLKRNWG+K
Sbjct  186  YRRVPCKKQGGIRFTVTGNPYFNLVSVWNVGGAGDVISVHVLKGDNKQTWIPLKRNWGQK  245

Query  734  WETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG-RNCR  871
            WET+A L G+ L+FRV T+DGK  TS +VAPK+WQ+ QTF G +N R
Sbjct  246  WETDAKLVGEDLSFRVRTSDGKTSTSWHVAPKNWQFDQTFLGSKNFR  292



>emb|CDY24952.1| BnaC03g22200D [Brassica napus]
Length=258

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 119/239 (50%), Positives = 165/239 (69%), Gaps = 13/239 (5%)
 Frame = +2

Query  182  LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaa  352
            +P V+ G +   W +AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  
Sbjct  23   IPGVYSGGA---WQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGM  79

Query  353  sCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAY  514
            SCGAC+E+KC N    C +    I++TAT+ CP      + +G WC PP+ HFDL+MP +
Sbjct  80   SCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAMPVF  139

Query  515  LQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGE  694
            L+IA+Y+AG+VPV YRRVPC ++GG RFT++GHQ+FNLV ++NV G+GD+ +  V     
Sbjct  140  LKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHQYFNLVLITNVAGAGDIVRTSVKGS-R  198

Query  695  EKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
              W+ L RNWG+ W++NA+L G+SL+FRVT +D +  TS N+ P +WQ+GQTF G+N R
Sbjct  199  TGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFVGKNFR  257



>ref|XP_006411198.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
 gb|ESQ52651.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
Length=258

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 167/247 (68%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttals  328
             L I    +P V+ G +   W  AHATFYG  +  GT+GGACG    + + Y   T ALS
Sbjct  15   FLNIADAKIPGVYSGGA---WQTAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALS  71

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAH  490
             ALFNN  SCGAC+E+KC N    C +    I++TAT+ CP      + +G WC PP+AH
Sbjct  72   TALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPRAH  131

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDL+MP +L+IA+Y+AG+VPV YRRVPC ++GG RFT++GH++FNLV ++NV G+GD+ +
Sbjct  132  FDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVR  191

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
              V       W+ L RNWG+ W++NA+L G+SL+FRVT +D +  TS N+ P +WQ+GQT
Sbjct  192  TSVKGS-RTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQT  250

Query  851  FEGRNCR  871
            F G+N R
Sbjct  251  FVGKNFR  257



>gb|KHG28809.1| Expansin-A5 -like protein [Gossypium arboreum]
Length=255

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 154/221 (70%), Gaps = 6/221 (3%)
 Frame = +2

Query  218  WLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCVN  388
            W++AHATFYG     GT+GGACG    + + Y   T ALS ALFNN  SCGACYEI+CVN
Sbjct  37   WINAHATFYGGGDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACYEIRCVN  96

Query  389  STGQCKTPQKPIIVTATDLCPTGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRV  568
                C      I+VTAT+ CP G   WC PP  HFDLS P +L IA+YKAG+VPV YRRV
Sbjct  97   DPQWCLPGSGSIVVTATNFCPPGG--WCDPPNHHFDLSQPIFLHIAQYKAGIVPVVYRRV  154

Query  569  PCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNA  748
             C R+GG RFT++GH +FNLV V+NVGG+GDV  V +      KW  + RNWG+ W++N+
Sbjct  155  WCKRRGGIRFTINGHSYFNLVLVTNVGGAGDVRSVAIKGS-RTKWQLMSRNWGQNWQSNS  213

Query  749  MLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
             L+G+SL+F VTT+DG+AV S NVAP SW +GQT+ GR  R
Sbjct  214  YLNGQSLSFVVTTSDGRAVVSYNVAPSSWSFGQTYIGRQFR  254



>gb|ADY68818.1| expansin [Gossypium hirsutum]
Length=259

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 172/264 (65%), Gaps = 21/264 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            +SVLI  ++M    +A I        P V+ G +   W +AHATFYG  +  GT+GGACG
Sbjct  7    ISVLIFISSMWMMGEARI--------PGVYSGGA---WQNAHATFYGGADASGTMGGACG  55

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC +    C +    I +TAT+ CP  
Sbjct  56   YGNLYGQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPN  115

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                  +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  116  YALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  175

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV +SNV G+GD+ KV V       W+ + RNWG+ W++NA+L G+SL+FRVT +D +
Sbjct  176  FNLVLISNVAGAGDIVKVSVKGS-RTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRR  234

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P  WQ+GQTF G+N R
Sbjct  235  TSTSWNIVPAHWQFGQTFTGKNFR  258



>ref|XP_003554526.2| PREDICTED: expansin-A15-like isoform X1 [Glycine max]
 ref|XP_006603872.1| PREDICTED: expansin-A15-like isoform X2 [Glycine max]
 gb|KHN45513.1| Expansin-A15 [Glycine soja]
Length=250

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 162/241 (67%), Gaps = 8/241 (3%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttals  328
             LL  L  +    G  S  GW +AHATFYG  +  GT+GGACG    + + Y   T ALS
Sbjct  14   FLLGCLSMISYANGYVSNGGWTNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALS  73

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGDGKWCAPPQAHFDLSMP  508
             ALFNN  SCG+CY+IKC N    C   +  I+VTAT+ CP   G WC PP  HFDLS P
Sbjct  74   TALFNNGLSCGSCYQIKCANDPQWCL--RGTIVVTATNFCP--PGGWCDPPNHHFDLSQP  129

Query  509  AYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAE  688
             + QIA+Y+AG+VPV YRRV CMR+GG RFT++GH +FNLV V+NVGG+GDV  V +   
Sbjct  130  VFQQIAQYRAGIVPVVYRRVRCMRRGGIRFTINGHSYFNLVLVTNVGGAGDVHSVAIKGS  189

Query  689  GEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNC  868
               +W P+ RNWG+ W++N+ L+G+SL+F VTT+DG++V S N AP SW +GQT+ GR  
Sbjct  190  -RTRWQPMSRNWGQNWQSNSYLNGQSLSFLVTTSDGRSVLSYNAAPPSWSFGQTYTGRQF  248

Query  869  R  871
            R
Sbjct  249  R  249



>ref|XP_010321849.1| PREDICTED: expansin-A10-like [Solanum lycopersicum]
Length=241

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/240 (51%), Positives = 162/240 (68%), Gaps = 8/240 (3%)
 Frame = +2

Query  149  QASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYtt  319
            Q  I L+   A+     G     W++AHATFYG     GT+GGACG    + + Y   T 
Sbjct  3    QIVIFLVCFLAIASFVKGSGKGKWINAHATFYGGGDASGTMGGACGYGNLYNQGYGTKTA  62

Query  320  alsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGDGKWCAPPQAHFDL  499
            ALS ALFNN  SCG+CYEIKCVN    C +    I VTAT+ CP G   WC PP  HFDL
Sbjct  63   ALSTALFNNGLSCGSCYEIKCVNEHKWCLS--GSIKVTATNFCPPGG--WCNPPLHHFDL  118

Query  500  SMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEV  679
            S P +  IA+Y+AG+VP+ YRR+PC RKGG RFT++GH +FNLV V+NVGG+GDV  V +
Sbjct  119  SQPIFQHIAQYRAGIVPIAYRRIPCRRKGGIRFTINGHSYFNLVLVTNVGGAGDVHAVAI  178

Query  680  NAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
                + +W  + RNWG+ W++N++L+G+SL+F+VTT+DG +V S+NVAP SW +GQT+ G
Sbjct  179  KGS-KTQWQSMSRNWGQNWQSNSLLNGQSLSFKVTTSDGYSVVSKNVAPPSWSFGQTYTG  237



>emb|CDY45181.1| BnaA06g33850D [Brassica napus]
Length=248

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 163/247 (66%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttals  328
            I L+   A+     G  A GW++AHATFYG  +  GT+GGACG    + + Y   T ALS
Sbjct  6    IFLLGFAAMASSVHGYDA-GWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALS  64

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAH  490
             ALFNN  SCGAC+EIKC +    C      I+VTAT+ CP  +      G WC PP  H
Sbjct  65   TALFNNGLSCGACFEIKCQSDGAWCL--PGAIVVTATNFCPPNNALPNTAGGWCNPPLHH  122

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDLS P + +IA YKAGVVPV YRRVPC R+GG RFT++GH +FNLV V+NVGG+GDV  
Sbjct  123  FDLSQPIFQRIAHYKAGVVPVSYRRVPCKRRGGIRFTINGHSYFNLVLVTNVGGAGDVRS  182

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
            V V      KW P+ RNWG+ W++N +L+G++L+F+VT +DG+ V S NVAP SW +GQT
Sbjct  183  VAVKGS-RTKWQPMSRNWGQNWQSNNLLNGQALSFKVTASDGQTVVSNNVAPASWSFGQT  241

Query  851  FEGRNCR  871
            F GR  R
Sbjct  242  FTGRQFR  248



>ref|XP_009139160.1| PREDICTED: expansin-A16-like [Brassica rapa]
Length=260

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 171/265 (65%), Gaps = 25/265 (9%)
 Frame = +2

Query  134  MATELQASILLIVL----------CALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGAC  277
            MAT L  SI L +             +P V+ G S   W  AHATFYG  +  GT+GGAC
Sbjct  1    MATNL--SIFLTIFPLLLLLNPTNAWIPGVYSGSS---WQTAHATFYGGDDASGTMGGAC  55

Query  278  GL-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP-  451
            G    + + Y   T ALS ALFN   +CGAC+EIKCVN    C +    + VTAT+ CP 
Sbjct  56   GYGNLYSQGYGTNTAALSTALFNTGLTCGACFEIKCVNDPKWCHSGSPSVFVTATNFCPP  115

Query  452  -----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQ  616
                 + +G WC PP+AHFDL+MP +L+IAEY+AG+VP+ YRRV C + GG RFT++GH+
Sbjct  116  NLAQPSDNGGWCNPPRAHFDLAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHR  175

Query  617  FFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDG  796
            +FNLV ++NV G+GD+ +  V    +  W+ L RNWG+ W++N +L G+SL+FRVTT+D 
Sbjct  176  YFNLVLITNVAGAGDIVRTSVRGS-KTGWMGLTRNWGQNWQSNTVLVGQSLSFRVTTSDR  234

Query  797  KAVTSQNVAPKSWQYGQTFEGRNCR  871
            +  TS N+ P +WQ+GQTF G+N R
Sbjct  235  RTSTSWNIVPSNWQFGQTFVGKNFR  259



>ref|XP_010921302.1| PREDICTED: expansin-A10-like [Elaeis guineensis]
Length=247

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 165/245 (67%), Gaps = 14/245 (6%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHG--WLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYtta  322
             + + L +L  +FG    +G  W DAHATFYG     GT+GGACG    + + Y   T A
Sbjct  3    FIALSLVSLLTIFGAVHGYGGGWSDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAA  62

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQ  484
            LS ALFN+  SCGAC+EIKC N    C      IIVTAT+ CP        +G WC PP 
Sbjct  63   LSTALFNSGLSCGACFEIKCSNDGSWCLP--GSIIVTATNFCPPNNALPNDNGGWCNPPL  120

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDLS P + +IA+YKAG+VPV YRRVPC++ GG RFT++GH +FNLV +SNVGG+GDV
Sbjct  121  QHFDLSQPVFQRIAQYKAGIVPVQYRRVPCVKNGGIRFTINGHSYFNLVLISNVGGAGDV  180

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
            + V +    +  W P+ RNWG+ W++N+ L+G+SL+F+VTT+DG+ VTS +VAP +W +G
Sbjct  181  TAVSIKGS-QTGWQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVTSMDVAPNNWSFG  239

Query  845  QTFEG  859
            QT+ G
Sbjct  240  QTYSG  244



>gb|AEN70887.1| alpha-expansin 1 [Gossypium aridum]
Length=258

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/228 (52%), Positives = 162/228 (71%), Gaps = 12/228 (5%)
 Frame = +2

Query  203  DSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYE  373
            D   GW  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCGACYE
Sbjct  31   DDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYE  90

Query  374  IKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEYK  535
            ++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+LQIAEY+
Sbjct  91   LRCNNDPQWCIS--RTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYR  148

Query  536  AGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLK  715
            AG+VPV +RRV C++KGG R+TM+GH +FN+V ++NVGG+GD++ V +    +  W+P+ 
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGS-KTGWLPMS  207

Query  716  RNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
            RNWG+ W++NA L+G+SL+F+VT +DG+ +T+ NV P  WQ+GQTFEG
Sbjct  208  RNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>gb|AEN70907.1| expansin [Gossypium armourianum]
Length=259

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 172/264 (65%), Gaps = 21/264 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            +SVLI  ++M    +A I        P V+ G +   W +AHATFYG  +  GT+GGACG
Sbjct  7    ISVLIFISSMWMMGEARI--------PGVYSGGA---WQNAHATFYGGADASGTMGGACG  55

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC +    C +    I +TAT+ CP  
Sbjct  56   YGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPN  115

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                  +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  116  YALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  175

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV +SNV G+GD+ KV V       W+ + RNWG+ W++NA+L G+SL+FRVT +D +
Sbjct  176  FNLVLISNVAGAGDIVKVSVKGS-RTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRR  234

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P  WQ+GQTF G+N R
Sbjct  235  TSTSWNIVPSHWQFGQTFTGKNFR  258



>ref|XP_011070988.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A10-like [Sesamum indicum]
Length=250

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 157/230 (68%), Gaps = 14/230 (6%)
 Frame = +2

Query  215  GWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCV  385
            GW++AHATFYG     GT+GGACG    + + Y   T ALS ALFN+  SCG+CYEIKCV
Sbjct  24   GWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGSCYEIKCV  83

Query  386  NSTGQCKTPQKPIIVTATDLCPTGD--------GKWCAPPQAHFDLSMPAYLQIAEYKAG  541
            N  GQ   P   I+VTAT+ CP  +        G WC PP  HFDLS P +  IA+YKAG
Sbjct  84   ND-GQWCLPGS-IVVTATNFCPPNNALPNNAAGGGWCNPPLHHFDLSQPVFQHIAQYKAG  141

Query  542  VVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRN  721
            +VPV YRRVPC RKGG RFT++GH +FNLV ++NVGG+GDV  V +       W P+ RN
Sbjct  142  IVPVAYRRVPCNRKGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGS-RTGWQPMSRN  200

Query  722  WGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
            WG+ W++N+ L+G+SL+F+VTT+DG+ V S NVAP SW +GQTF G   R
Sbjct  201  WGQNWQSNSYLNGQSLSFKVTTSDGRTVVSYNVAPASWSFGQTFSGAQFR  250



>ref|XP_010256907.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/255 (48%), Positives = 168/255 (66%), Gaps = 13/255 (5%)
 Frame = +2

Query  134  MATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETY  304
            ++  L  S L +V   +P V+ G     W  AHATFYG  +  GT+GGACG    + + Y
Sbjct  9    VSAVLLISFLTLVDARIPGVYTGGP---WQSAHATFYGGSDASGTMGGACGYGNLYSQGY  65

Query  305  SPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGK  466
               T ALS ALFN   SCGAC+EIKC N    C +    I +TAT+ CP        +G 
Sbjct  66   GVNTAALSTALFNAGLSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPNDNGG  125

Query  467  WCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNV  646
            WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNLV ++NV
Sbjct  126  WCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKQGGIRFTINGFRYFNLVLITNV  185

Query  647  GGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAP  826
             G+GD+ KV V    +  W+ + RNWG+ W++NA+L G+SL+FR+T +D +  TS NV P
Sbjct  186  AGAGDIVKVSVKGS-QTGWMSMSRNWGQNWQSNAVLVGQSLSFRITGSDRRTSTSWNVVP  244

Query  827  KSWQYGQTFEGRNCR  871
             +WQ+GQTF G+N R
Sbjct  245  SNWQFGQTFTGKNFR  259



>ref|XP_009409019.1| PREDICTED: expansin-A4-like [Musa acuminata subsp. malaccensis]
Length=257

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 168/260 (65%), Gaps = 18/260 (7%)
 Frame = +2

Query  134  MATELQASILLIVLCA-----LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQ  289
            MA     S+ L+ L A     +P ++ G     W +AHATFYG  +  GT+GGACG    
Sbjct  1    MALASFVSVALLALLAPVTARIPGLYAGGQ---WQNAHATFYGGSDASGTMGGACGYGNL  57

Query  290  FKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------  451
            + + Y   T ALS ALFN   SCGAC+EIKC      C      I +TAT+ CP      
Sbjct  58   YSQGYGVQTAALSTALFNEGQSCGACFEIKCAGDPQWCHGGSPSIFITATNFCPPNYALP  117

Query  452  TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLV  631
            + DG WC PP+ HFDLSMP +L+IAEY+AG+VPV YRRVPC R GG RFT++G ++FNLV
Sbjct  118  SDDGGWCNPPRPHFDLSMPMFLKIAEYRAGIVPVSYRRVPCRRSGGIRFTINGFKYFNLV  177

Query  632  TVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTS  811
             ++NV G+GD+ +  V       W+P+ RNWG+ W++NA+L G+SL+FR+T +D +  TS
Sbjct  178  LITNVAGAGDIVRASVKGS-RTGWMPMSRNWGQNWQSNAVLVGQSLSFRLTGSDRRTSTS  236

Query  812  QNVAPKSWQYGQTFEGRNCR  871
             N+ P +WQ+GQTFEG+N R
Sbjct  237  WNIVPSNWQFGQTFEGKNFR  256



>ref|XP_002881669.1| ATEXPA4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57928.1| ATEXPA4 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 124/260 (48%), Positives = 172/260 (66%), Gaps = 18/260 (7%)
 Frame = +2

Query  134  MATELQASILLIVLCAL-----PCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQ  289
            MA +L       VL +L     P V+ G +   W +AHATFYG  +  GT+GGACG    
Sbjct  1    MAIKLAILFTTFVLFSLADARIPGVYSGSA---WQNAHATFYGGSDASGTMGGACGYGNL  57

Query  290  FKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------  451
            + + Y   T ALS ALFNN  SCGAC+E+KC N    C +    I++TAT+ CP      
Sbjct  58   YSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQP  117

Query  452  TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLV  631
            + +G WC PP+ HFDL+MP +L+IA+Y+AG+VPV YRRVPC ++GG RFT++GH++FNLV
Sbjct  118  SDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLV  177

Query  632  TVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTS  811
             ++NV G+GD+ +  V       W+ L RNWG+ W++NA+L G+SL+FRVT +D +  TS
Sbjct  178  LITNVAGAGDIVRASVKGS-RTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  236

Query  812  QNVAPKSWQYGQTFEGRNCR  871
             N+ P +WQ+GQTF G+N R
Sbjct  237  WNMVPSNWQFGQTFVGKNFR  256



>ref|XP_002876856.1| ATEXPA15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53115.1| ATEXPA15 [Arabidopsis lyrata subsp. lyrata]
Length=253

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 164/247 (66%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttals  328
             +L+    + C   G  A GW++AHATFYG  +  GT+GGACG    + + Y   T ALS
Sbjct  11   FVLVGFAVMVCSVHGYDA-GWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALS  69

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAH  490
             ALFNN  SCGAC+EIKC +    C      IIVTAT+ CP  +      G WC PP  H
Sbjct  70   TALFNNGLSCGACFEIKCQSDGAWCLP--GAIIVTATNFCPPNNALPNNAGGWCNPPLHH  127

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDLS P + +IA+YKAGVVPV YRRVPCMR+GG RFT++GH +FNLV V+NVGG+GDV  
Sbjct  128  FDLSQPIFQRIAQYKAGVVPVSYRRVPCMRRGGIRFTINGHSYFNLVLVTNVGGAGDVHS  187

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
            V V      +W  + RNWG+ W++N +L+G++L+F+VT +DG+ V S N+AP SW +GQT
Sbjct  188  VAVKGS-RTRWQQMSRNWGQNWQSNNLLNGQALSFKVTASDGRTVVSNNIAPASWSFGQT  246

Query  851  FEGRNCR  871
            F GR  R
Sbjct  247  FTGRQFR  253



>ref|XP_009364387.1| PREDICTED: expansin-A4 [Pyrus x bretschneideri]
Length=260

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 176/264 (67%), Gaps = 14/264 (5%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            + V+ ++  +AT L  S++ +    +P V+ G +   W  AHATFYG  +  GT+GGACG
Sbjct  1    MGVVSVSTCIAT-LLISLMWVAEARIPGVYTGGA---WQGAHATFYGGSDASGTMGGACG  56

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC N    C +    I +TAT+ CP  
Sbjct  57   YGNLYSQGYGVNTGALSTALFNNGLSCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPN  116

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  117  FAQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRY  176

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV +SNV G+GD+ +V V       W+ + RNWG+ W++N++L G+SL+FRVT +D +
Sbjct  177  FNLVLISNVAGAGDIVRVSVKGA-RTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRR  235

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P +WQ+GQTF G+N R
Sbjct  236  TSTSWNIVPANWQFGQTFTGKNFR  259



>ref|XP_002312253.1| expansin 4 family protein [Populus trichocarpa]
 gb|EEE89620.1| expansin 4 family protein [Populus trichocarpa]
Length=251

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 126/249 (51%), Positives = 159/249 (64%), Gaps = 12/249 (5%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYtta  322
            A  +L+ L A+     G    GW++A ATFYG     GT+GGACG    + + Y   T A
Sbjct  6    AGFILVGLLAMVSSVNGYGGGGWINARATFYGGGDASGTMGGACGYGNLYSQGYGTNTAA  65

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQ  484
            LS ALFN+  SCG+CYEI+CVN    C      I+VTAT+ CP  +      G WC PPQ
Sbjct  66   LSTALFNSGLSCGSCYEIRCVNDPKWCL--PGSILVTATNFCPPNNALPNNAGGWCNPPQ  123

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDLS P +  IA Y AGVVPV YRRVPC R+GG RFT++GH +FNLV ++NVGG+GDV
Sbjct  124  HHFDLSQPVFQHIARYSAGVVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDV  183

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
              V V       W P+ RNWG+ W++N  L+G+SL+F+VTT+DG+ V S N AP SW +G
Sbjct  184  HAVSVKGS-RTGWQPMSRNWGQNWQSNNYLNGQSLSFKVTTSDGRTVVSYNAAPSSWSFG  242

Query  845  QTFEGRNCR  871
            QTF G   R
Sbjct  243  QTFSGAQFR  251



>ref|XP_004302749.1| PREDICTED: expansin-A4-like [Fragaria vesca subsp. vesca]
Length=260

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 171/249 (69%), Gaps = 13/249 (5%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYtta  322
            AS+L++    +P  + G     W +AHATFYG  +  GT+GGACG    + + Y   T A
Sbjct  15   ASLLMVANARIPGPYTGGP---WQEAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  71

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQ  484
            LS ALFNN  SCGAC+EIKC +    C   +  I VTAT+ CP      + +G WC PP+
Sbjct  72   LSTALFNNGLSCGACFEIKCGDDPRWCTAGKPSIFVTATNFCPPNFAQPSDNGGWCNPPR  131

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDL+MP +L+IAEYKAG+VPV YRRVPC++KGG RFT++GH++FNLV V+NV G+GD+
Sbjct  132  THFDLAMPMFLKIAEYKAGIVPVSYRRVPCVKKGGIRFTINGHKYFNLVLVTNVAGAGDI  191

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
              V V       W+P+ RNWG+ W++N++L G++L+FRV  +D ++ T+ NVAP +WQ+G
Sbjct  192  VSVSVKGT-NTGWMPMSRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTTYNVAPANWQFG  250

Query  845  QTFEGRNCR  871
            QT+ G+N R
Sbjct  251  QTYSGKNFR  259



>gb|KHN18562.1| Expansin-A15 [Glycine soja]
Length=261

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 126/258 (49%), Positives = 169/258 (66%), Gaps = 15/258 (6%)
 Frame = +2

Query  116  LIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-E  286
            ++I   +    + ++  IV  AL     GDS  GW+DAHATFYG     GT+GGACG   
Sbjct  7    ILILGKITFASKVTLYRIVKHALSAY--GDS-DGWMDAHATFYGGGDASGTMGGACGYGN  63

Query  287  QFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD--  460
             + + Y   T ALS ALFNN  SCGAC+EIKCVN    C      ++VTAT+ CP  +  
Sbjct  64   LYSQGYGTNTAALSTALFNNGLSCGACFEIKCVNDQRWCLP--DTVVVTATNFCPPNNAL  121

Query  461  ----GKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNL  628
                G WC PP  HFDLS P + QIA+Y+AG+VPV Y+RVPC ++GG RFT++GH +FNL
Sbjct  122  PNDAGGWCNPPLQHFDLSQPVFQQIAQYRAGIVPVAYKRVPCQKRGGIRFTINGHSYFNL  181

Query  629  VTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVT  808
            V ++NVGG+GDV  V +       W P+ RNWG+ W++N  L+G+SL+F+VTT++G+ + 
Sbjct  182  VLITNVGGAGDVQAVSIKGS-RTNWQPMSRNWGQNWQSNTYLNGQSLSFKVTTSEGRTLV  240

Query  809  SQNVAPKSWQYGQTFEGR  862
            S NVAP SW +GQTF G+
Sbjct  241  SNNVAPDSWSFGQTFTGK  258



>ref|XP_004143121.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004166197.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN47143.1| hypothetical protein Csa_6G190340 [Cucumis sativus]
Length=258

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 169/256 (66%), Gaps = 13/256 (5%)
 Frame = +2

Query  131  AMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKET  301
            ++   L  S  L++   +P V+ G     W  AHATFYG  +  GT+GGACG    + + 
Sbjct  6    SLCIPLLLSFSLLIEARIPGVYSGGP---WQSAHATFYGGSDASGTMGGACGYGNLYSQG  62

Query  302  YSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDG  463
            Y   T ALS ALFN   SCGAC+EIKC N    C +    I++TAT+ CP        +G
Sbjct  63   YGVNTAALSTALFNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYALPNDNG  122

Query  464  KWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSN  643
             WC PP++HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNLV ++N
Sbjct  123  GWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITN  182

Query  644  VGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVA  823
            V G+GD+ +V V       W+ L RNWG+ W++NA+L G++L+FRVT +D +  TS N+A
Sbjct  183  VAGAGDIVRVSVKGT-RTGWMSLTRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNIA  241

Query  824  PKSWQYGQTFEGRNCR  871
            P  WQ+GQTF G+N R
Sbjct  242  PAHWQFGQTFTGKNFR  257



>ref|XP_007150329.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
 gb|ESW22323.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
Length=256

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 124/249 (50%), Positives = 167/249 (67%), Gaps = 13/249 (5%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYtta  322
            ASI+ +V   +P V+ G +   W  AHATFYG  +  GT+GGACG    + + Y   T A
Sbjct  11   ASIMWMVDARIPGVYTGGA---WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  67

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQ  484
            LS ALFNN  SCGAC+EIKC N    C +    I +TAT+ CP        +G WC PP+
Sbjct  68   LSTALFNNGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPR  127

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDL+MP +L+IAEY+AG+VPV YRRV CM+ GG RFT++G ++FNLV +SNV G+GD+
Sbjct  128  PHFDLAMPMFLKIAEYRAGIVPVAYRRVACMKHGGIRFTINGFRYFNLVLISNVAGAGDL  187

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
                V       W+P+ RNWG+ W++NA+L G++L+FRVT +D ++ TS N+AP  WQ+G
Sbjct  188  VHAYVKGT-RSGWMPMSRNWGQNWQSNAVLVGQALSFRVTASDRRSSTSWNIAPPHWQFG  246

Query  845  QTFEGRNCR  871
            QTF G+N R
Sbjct  247  QTFTGKNFR  255



>ref|XP_006403453.1| hypothetical protein EUTSA_v10010989mg, partial [Eutrema salsugineum]
 gb|ESQ44906.1| hypothetical protein EUTSA_v10010989mg, partial [Eutrema salsugineum]
Length=260

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 162/239 (68%), Gaps = 12/239 (5%)
 Frame = +2

Query  182  LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaa  352
            +P V+ G S   W  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFN+  
Sbjct  25   IPGVYSGSS---WQTAHATFYGGDDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGL  81

Query  353  sCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAY  514
            +CGAC+EIKCVN    C +    + VTAT+ CP      + +G WC PP+AHFDL+MP +
Sbjct  82   TCGACFEIKCVNDPKWCHSGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRAHFDLAMPVF  141

Query  515  LQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGE  694
            L+IA+Y+AG+VP+ YRRV C + GG RFT++GH++FNLV ++NV G+GD+ +  V     
Sbjct  142  LKIAQYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIVRASVKGSKS  201

Query  695  EKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
              W+ L RNWG+ W++N +L G+SL+FRVT +D +  TS N+ P +WQ+GQTF G+N R
Sbjct  202  GSWMSLTRNWGQNWQSNDVLVGQSLSFRVTASDRRTSTSWNIVPSNWQFGQTFVGKNFR  260



>gb|ACD37706.1| alpha expansin [Gossypium hirsutum]
 gb|ADY68813.1| alpha-expansin 1 [Gossypium hirsutum]
 gb|AEN70882.1| alpha-expansin 1 [Gossypium hirsutum subsp. latifolium]
Length=258

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 162/229 (71%), Gaps = 12/229 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GD   GW  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEY  532
            E++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+LQIAEY
Sbjct  90   ELRCNNDPQWCIS--RTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV +RRV C++KGG R+TM+GH +FN+V ++NVGG+GD++ V +    +  W+P+
Sbjct  148  RAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGS-KTGWLPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             RNWG+ W++NA L+G+SL+F+VT +D + +T+ NV P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYLNGQSLSFKVTASDSRTITNYNVVPAGWQFGQTFEG  255



>ref|XP_009597793.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/262 (47%), Positives = 172/262 (66%), Gaps = 13/262 (5%)
 Frame = +2

Query  113  VLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-  283
            V +  A +A      +++ V   +P V+ G +   W  AHATFYG  +  GT+GGACG  
Sbjct  2    VFLNVAFIACVFSLMLVVAVESRIPGVYSGGA---WQSAHATFYGGSDASGTMGGACGYG  58

Query  284  EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP----  451
              + + Y     ALS ALFNN  SCGAC+EIKC      C +    I +TAT+ CP    
Sbjct  59   NLYSQGYGVNNGALSTALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNFA  118

Query  452  --TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFN  625
                +G WC PP++HFDL+MP +L+IAEY+AG+VPV YRRVPC +KGG RFT++G ++FN
Sbjct  119  LPNDNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRKKGGIRFTINGFRYFN  178

Query  626  LVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAV  805
            LV V+NV G+GD+ +V V    +  W+ + RNWG+ ++TN++L G+SL+FRVT +D ++ 
Sbjct  179  LVLVTNVAGAGDIVRVYVKGS-KTNWITMSRNWGQNYQTNSVLIGQSLSFRVTASDRRSS  237

Query  806  TSQNVAPKSWQYGQTFEGRNCR  871
            TS N+AP  WQ+GQTF G+N R
Sbjct  238  TSWNIAPAHWQFGQTFSGKNFR  259



>ref|XP_010517323.1| PREDICTED: expansin-A4-like [Camelina sativa]
Length=257

 Score =   231 bits (589),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 126/261 (48%), Positives = 173/261 (66%), Gaps = 20/261 (8%)
 Frame = +2

Query  134  MATELQASILLIVLCAL-----PCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQ  289
            MA +L       VL  L     P V+ G S   W +AHATFYG  +  GT+GGACG    
Sbjct  1    MAIKLAILFTTFVLFNLADARIPGVYSGSS---WQNAHATFYGGSDASGTMGGACGYGNL  57

Query  290  FKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------  451
            + + Y   T ALS ALFNN  SCGAC+E+KC N    C +    I++TAT+ CP      
Sbjct  58   YSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQP  117

Query  452  TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLV  631
            + +G WC PP+ HFDL+MP +L+IA+Y+AG+VPV YRRVPC ++GG RFT++GH++FNL+
Sbjct  118  SDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLI  177

Query  632  TVSNVGGSGDVSKVEVNAEGEEK-WVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVT  808
             ++NV G+GD+  V  N +G    W+ L RNWG+ W++NA+L G+SL+FRVT +D +  T
Sbjct  178  LITNVAGAGDI--VRANVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTST  235

Query  809  SQNVAPKSWQYGQTFEGRNCR  871
            S N+ P +WQ+GQTF G+N R
Sbjct  236  SWNMVPSNWQFGQTFVGKNFR  256



>emb|CDY07642.1| BnaA03g18690D [Brassica napus]
Length=258

 Score =   231 bits (589),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 173/264 (66%), Gaps = 21/264 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            L+VL  T  + T   A I        P V+ G +   W  AHATFYG  +  GT+GGACG
Sbjct  6    LAVLFTTFVLFTLTDAKI--------PGVYSGGA---WQTAHATFYGGSDASGTMGGACG  54

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+E+KC N    C +    I++TAT+ CP  
Sbjct  55   YGNLYSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPN  114

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                + +G WC PP+ HFDL+MP +L+IA+Y+AG+VPV YRRVPC ++GG RFT++GH++
Sbjct  115  FAQASDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRY  174

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV ++NV G+GD+ +  V    +  W+ L RNWG+ W++NA+L G+SL+FRVT +D +
Sbjct  175  FNLVLITNVAGAGDIVRTSVKGS-KTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRR  233

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS ++ P +WQ+GQTF G+N R
Sbjct  234  TSTSWSIVPSNWQFGQTFVGKNFR  257



>gb|ABR17119.1| unknown [Picea sitchensis]
Length=253

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 168/251 (67%), Gaps = 13/251 (5%)
 Frame = +2

Query  137  ATELQASILLIVLCALPCVFGGDSAHG-WLDAHATFYGPPE--GTIGGACGL-EQFKETY  304
            + EL  SI L  L  +  +  G   +G W  AHATFYG  +  GT+GGACG    + + Y
Sbjct  3    SIELVKSIALASLLTIIWLITGAHGYGDWESAHATFYGGSDASGTMGGACGYGNLYSQGY  62

Query  305  SPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGK  466
               T ALS ALFN+  SCGACYE++C +    C      I+VTAT+ CP        DG 
Sbjct  63   GTNTAALSTALFNDGLSCGACYEMQCNDDPQWCL--PGTIMVTATNFCPPNNALPNNDGG  120

Query  467  WCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNV  646
            WC PP  HFD++ P+YL+IA+Y++G+VP+ YRRVPC+RKGG RFT++GH +FNLV ++NV
Sbjct  121  WCNPPLQHFDMAEPSYLKIAKYRSGIVPILYRRVPCLRKGGIRFTVNGHSYFNLVLITNV  180

Query  647  GGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAP  826
            GG+GDV  V +       W P+ RNWG+ W++N+ L+G+SL+F+VTT+DG+ V S N AP
Sbjct  181  GGAGDVHAVSIKGS-RTGWQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVVSYNAAP  239

Query  827  KSWQYGQTFEG  859
             +WQ+GQTFEG
Sbjct  240  SNWQFGQTFEG  250



>ref|XP_004981242.1| PREDICTED: expansin-A7-like [Setaria italica]
Length=262

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 163/241 (68%), Gaps = 15/241 (6%)
 Frame = +2

Query  182  LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGLEQ-FKETYSPYttalsaalfnnaa  352
            +P V+GG +   W  AHATFYG  +  GT+GGACG    + + Y     ALS ALFN   
Sbjct  25   IPGVYGGGA---WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNEGQ  81

Query  353  sCGACYEIKCVNSTGQ--CKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMP  508
            SCGAC+EIKC N  G   C      I+VTAT+ CP      + DG WC PP+ HFDL+MP
Sbjct  82   SCGACFEIKCENQPGWRWCHPGSPSILVTATNFCPPNYALPSDDGGWCNPPRPHFDLAMP  141

Query  509  AYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAE  688
             +L IAEY+AG+VPV YRRVPC + GG RFT++G ++FNLV ++NV G+GD+ +  V   
Sbjct  142  MFLHIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFRYFNLVLITNVAGAGDIVRASVKGS  201

Query  689  GEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNC  868
            G   W+P+ RNWG+ W++NA+L G +L+FRVT +D +  TS N AP++WQ+GQTFEG+N 
Sbjct  202  G-TGWLPMSRNWGQNWQSNAILVGDALSFRVTGSDRRTSTSWNAAPRNWQFGQTFEGKNF  260

Query  869  R  871
            R
Sbjct  261  R  261



>ref|XP_002463623.1| hypothetical protein SORBIDRAFT_01g003120 [Sorghum bicolor]
 gb|EER90621.1| hypothetical protein SORBIDRAFT_01g003120 [Sorghum bicolor]
Length=262

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 164/241 (68%), Gaps = 15/241 (6%)
 Frame = +2

Query  182  LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGLEQ-FKETYSPYttalsaalfnnaa  352
            +P V+GG    GW  AHATFYG  +  GT+GGACG    + + Y     ALS ALFN   
Sbjct  25   IPGVYGGG---GWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNEGL  81

Query  353  sCGACYEIKCVNSTGQ--CKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMP  508
            SCGAC+E+KC N  G   C+     I+VTAT+ CP      + DG WC PP+ HFDL+MP
Sbjct  82   SCGACFELKCENQPGWRWCRPGSPSILVTATNFCPPNYALPSDDGGWCNPPRPHFDLAMP  141

Query  509  AYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAE  688
             +L IAEY+AG+VPV YRRVPC + GG RFT++G ++FNLV ++NV G+GD+ +  V A 
Sbjct  142  MFLHIAEYRAGIVPVSYRRVPCRKSGGVRFTINGFRYFNLVLITNVAGAGDIVRASVKAS  201

Query  689  GEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNC  868
                W+ + RNWG+ W++NA+L G++L+FRVT +D +  TS N AP++WQ+GQTFEG+N 
Sbjct  202  -STGWLTMSRNWGQNWQSNAILVGQALSFRVTGSDRRTSTSWNAAPRNWQFGQTFEGKNF  260

Query  869  R  871
            R
Sbjct  261  R  261



>gb|ADY68815.1| expansin [Gossypium barbadense]
 gb|ADY68819.1| expansin [Gossypium hirsutum]
 gb|AEN70892.1| expansin [Gossypium laxum]
 gb|AEN70894.1| expansin [Gossypium turneri]
 gb|AEN70896.1| expansin [Gossypium mustelinum]
 gb|AEN70898.1| expansin [Gossypium darwinii]
 gb|AEN70902.1| expansin [Gossypium barbadense var. brasiliense]
 gb|AEN70904.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70906.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70908.1| expansin [Gossypium harknessii]
 gb|AEN70911.1| expansin [Gossypium aridum]
 gb|AEN70912.1| expansin [Gossypium gossypioides]
 gb|AEN70913.1| expansin [Gossypium lobatum]
Length=259

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 172/264 (65%), Gaps = 21/264 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            +SVLI  ++M    +A I        P V+ G +   W +AHATFYG  +  GT+GGACG
Sbjct  7    ISVLIFISSMWMMGEARI--------PGVYSGGA---WQNAHATFYGGADASGTMGGACG  55

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC +    C +    I +TAT+ CP  
Sbjct  56   YGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPN  115

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                  +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  116  YALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  175

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV +SNV G+GD+ KV V       W+ + RNWG+ W++NA+L G+SL+FRVT +D +
Sbjct  176  FNLVLISNVAGAGDIVKVSVKGS-RTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRR  234

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P  WQ+GQTF G+N R
Sbjct  235  TSTSWNIVPAHWQFGQTFTGKNFR  258



>ref|XP_007016396.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY34015.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=258

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 170/261 (65%), Gaps = 13/261 (5%)
 Frame = +2

Query  116  LIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-E  286
            + + + +   L  S + +    +P V+ G +   W +AHATFYG  +  GT+GGACG   
Sbjct  1    MAVVSVVCVLLFISSMWMAEAKIPGVYSGGA---WQNAHATFYGGSDASGTMGGACGYGN  57

Query  287  QFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP-----  451
             + + Y   T ALS ALFNN  SCGAC+EIKC N    C +    I +TAT+ CP     
Sbjct  58   LYSQGYGVNTAALSTALFNNGLSCGACFEIKCANDPKWCHSGGPSIFITATNFCPPNYAL  117

Query  452  -TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNL  628
               +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNL
Sbjct  118  PNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNL  177

Query  629  VTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVT  808
            V +SNV G+GD+ KV V       W+ + RNWG+ W++NA+L G+SL+FRVT  D +  T
Sbjct  178  VLISNVAGAGDIVKVSVKGS-RTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGGDRRTST  236

Query  809  SQNVAPKSWQYGQTFEGRNCR  871
            S N+ P +WQ+GQTF G+N R
Sbjct  237  SWNIVPANWQFGQTFAGKNFR  257



>gb|AEN70901.1| expansin [Gossypium barbadense var. brasiliense]
Length=259

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 171/264 (65%), Gaps = 21/264 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            +SVLI  ++M    +A I        P V+ G +   W +AHATFYG  +  GT+GGACG
Sbjct  7    ISVLIFISSMWMMGEARI--------PGVYSGGA---WQNAHATFYGGADASGTMGGACG  55

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC +    C +    I +TAT+ CP  
Sbjct  56   YGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPN  115

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                  +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  116  YALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  175

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV +SNV G+GD+ K  V       W+ + RNWG+ W++NA+L G+SL+FRVT +D +
Sbjct  176  FNLVLISNVAGAGDIVKASVKGS-RTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRR  234

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P  WQ+GQTF G+N R
Sbjct  235  TSTSWNIVPAHWQFGQTFTGKNFR  258



>ref|XP_009767600.1| PREDICTED: expansin-A15-like [Nicotiana sylvestris]
Length=248

 Score =   231 bits (588),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 128/248 (52%), Positives = 161/248 (65%), Gaps = 18/248 (7%)
 Frame = +2

Query  155  SILLIVLCALPCVF----GGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPY  313
            SIL I +  L C+F    G D   GW++AHATFYG     GT+GGACG    + + Y   
Sbjct  2    SILWISIVGLFCIFNCVDGND--EGWIEAHATFYGGGDASGTMGGACGYGNLYSQGYGTN  59

Query  314  ttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCA  475
            T ALS A+FNN  SCGAC+EIKCV  +  C      I+VTAT+ CP         G WC 
Sbjct  60   TAALSTAMFNNGLSCGACFEIKCVGDSKSCI--PGSIVVTATNFCPPNYALPNNAGGWCN  117

Query  476  PPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGS  655
            PP  HFDLS P + QIA Y+AG+VPV YRRVPC +KGG RFTM+GH +FNLV V+NVGGS
Sbjct  118  PPLHHFDLSQPIFQQIALYRAGIVPVSYRRVPCQKKGGIRFTMNGHSYFNLVLVTNVGGS  177

Query  656  GDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSW  835
            GDV+ V V       W+P+ RNWG+ W++N+ L G+SL+F+VTT DG+ + S +  P  W
Sbjct  178  GDVNAVSVKGS-RTDWIPMSRNWGQNWQSNSNLDGQSLSFKVTTGDGRTLISDDAIPAGW  236

Query  836  QYGQTFEG  859
             +GQTF G
Sbjct  237  SFGQTFTG  244



>ref|XP_008802710.1| PREDICTED: expansin-A4 [Phoenix dactylifera]
Length=258

 Score =   231 bits (588),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 122/249 (49%), Positives = 166/249 (67%), Gaps = 10/249 (4%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYtta  322
            AS+L  ++ A   + G  S   W  AHATFYG  +  GT+GGACG    + + Y   T A
Sbjct  10   ASLLAFLVPAAARIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVDTAA  69

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQ  484
            LS ALFN+  SCGAC+EIKC +    C +    I +TAT+ CP      + DG WC PP+
Sbjct  70   LSTALFNDGLSCGACFEIKCADEPQWCHSGSPSIFITATNFCPPNYALPSDDGGWCNPPR  129

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDL+MP +L+IAEY+AG+VPV YRRVPC + GG RFT++G ++FNLV ++NV G+GD+
Sbjct  130  PHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFKYFNLVLITNVAGAGDI  189

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
             +  V       W+PL RNWG+ W++NA+L G+SL+FRVT +D +  TS N+ P +WQ+G
Sbjct  190  MRASVKGS-RTGWMPLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPANWQFG  248

Query  845  QTFEGRNCR  871
            QTF G+N R
Sbjct  249  QTFAGKNFR  257



>ref|XP_002283358.1| PREDICTED: expansin-A4 [Vitis vinifera]
 emb|CBI31662.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   231 bits (588),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 172/259 (66%), Gaps = 13/259 (5%)
 Frame = +2

Query  122  ITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQF  292
            + A +     AS+L +    +P V+ G    GW  AHATFYG  +  GT+GGACG    +
Sbjct  3    LVAVVCFVAMASVLKLGEARIPGVYTGG---GWQSAHATFYGGSDASGTMGGACGYGNLY  59

Query  293  KETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------T  454
             + Y   T ALS ALFNN  SCGAC+E+KC N    C +    I++TAT+ CP      +
Sbjct  60   SQGYGVNTAALSTALFNNGLSCGACFELKCANDPEWCHSGSPSILITATNFCPPNYALPS  119

Query  455  GDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVT  634
             +G WC PP+ HFDL+MP +L+IAEY+AG+VPV +RRVPC ++GG RFT++G ++FNLV 
Sbjct  120  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVL  179

Query  635  VSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQ  814
            ++NV G+GD+ K  V    +  W+ L RNWG+ W++NA+L G+SL+FRVT +D +  TS 
Sbjct  180  ITNVAGAGDIVKASVKGS-KTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDHRTSTSW  238

Query  815  NVAPKSWQYGQTFEGRNCR  871
            N+ P +WQ+GQTF G+N R
Sbjct  239  NIVPSNWQFGQTFSGKNFR  257



>ref|XP_002988969.1| hypothetical protein SELMODRAFT_128883 [Selaginella moellendorffii]
 gb|EFJ09998.1| hypothetical protein SELMODRAFT_128883 [Selaginella moellendorffii]
Length=252

 Score =   231 bits (588),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 120/251 (48%), Positives = 161/251 (64%), Gaps = 9/251 (4%)
 Frame = +2

Query  134  MATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGLEQFKET-Y  304
            MA+   +  + + L     V GG    GW DAHATFYG     GT+GGACG        Y
Sbjct  1    MASLSASFKIFMALLLSRVVHGGGYGSGWTDAHATFYGGSNAAGTMGGACGYGNLVSAGY  60

Query  305  SPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP-----TGDGKW  469
               T ALS ALF +  SCGAC+E+KC + +         ++VTAT+ CP     + DG W
Sbjct  61   GTNTAALSTALFQDGLSCGACFEVKCASGSDPKWCLPGSVVVTATNFCPPSSQPSNDGGW  120

Query  470  CAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVG  649
            C  P  HFD++ PA+L+IA+Y AG+VP+ YRRV C R GG RFTM+GH +FNLV ++NVG
Sbjct  121  CNSPLQHFDMAQPAFLKIAQYSAGIVPISYRRVSCSRSGGIRFTMNGHAYFNLVLITNVG  180

Query  650  GSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPK  829
            G+GDV  V +   G + W+P+ RNWG+ W++NA+L G++L+F+VTT+DGK   + NVA  
Sbjct  181  GAGDVHAVSIKGSGTD-WIPMSRNWGQNWQSNALLGGQALSFKVTTSDGKTTIAYNVAGA  239

Query  830  SWQYGQTFEGR  862
            +W YGQTFEG 
Sbjct  240  NWAYGQTFEGE  250



>ref|XP_006291657.1| hypothetical protein CARUB_v10017813mg, partial [Capsella rubella]
 gb|EOA24555.1| hypothetical protein CARUB_v10017813mg, partial [Capsella rubella]
Length=275

 Score =   231 bits (590),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 128/247 (52%), Positives = 164/247 (66%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttals  328
            IL++   A+ C   G  A GW++AHATFYG  +  GT+GGACG    + + Y   T ALS
Sbjct  33   ILVLCFAAMVCSVHGYDA-GWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALS  91

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAH  490
             ALFNN  SCGAC+EIKC +    C      IIVTAT+ CP  +      G WC PP  H
Sbjct  92   TALFNNGLSCGACFEIKCQSDGAWCL--PGAIIVTATNFCPPNNALPNNAGGWCNPPLHH  149

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDLS P + +IA YKAGVVPV YRRVPC R+GG RFT++GH +FNLV V+NVGG+GDV  
Sbjct  150  FDLSQPIFQRIAHYKAGVVPVSYRRVPCKRRGGIRFTINGHSYFNLVLVTNVGGAGDVHS  209

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
            V V      +W  + RNWG+ W++N +L+G++L+F+VT +DG+ V S N+AP SW +GQT
Sbjct  210  VAVKGS-RTRWQQMSRNWGQNWQSNNLLNGQALSFKVTASDGRIVVSNNIAPASWSFGQT  268

Query  851  FEGRNCR  871
            F GR  R
Sbjct  269  FTGRQFR  275



>gb|AAM22624.1|AF428177_1 expansin 10 precursor [Rumex palustris]
Length=258

 Score =   231 bits (588),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 170/257 (66%), Gaps = 10/257 (4%)
 Frame = +2

Query  128  AAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKE  298
            AA++  L    +L    A   + G  S  GW  AHATFYG  +  GT+GGACG    + +
Sbjct  2    AALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYSQ  61

Query  299  TYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGD  460
             Y   T ALS ALFNN  SCGAC+EIKC +    C      I++TAT+ CP      + +
Sbjct  62   GYGVNTAALSTALFNNGMSCGACFEIKCADDPRWCHPGNPSILITATNFCPPNFAEPSDN  121

Query  461  GKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVS  640
            G WC PP  HFDL+MP +L+IAEY+AG+VPV +RRVPC ++GG RFT++G ++FNLV ++
Sbjct  122  GGWCNPPLPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTVNGFRYFNLVLIT  181

Query  641  NVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNV  820
            NV G+GD+ +V +       W+P+ RNWG+ W++NA+L G+SL+FRVT +D +  TS NV
Sbjct  182  NVAGAGDIVRVSIKGS-RSDWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRKSTSWNV  240

Query  821  APKSWQYGQTFEGRNCR  871
            AP SWQ+GQTF G+N R
Sbjct  241  APASWQFGQTFTGKNFR  257



>gb|ABO32366.1| expansin [Litchi chinensis]
Length=253

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 171/257 (67%), Gaps = 16/257 (6%)
 Frame = +2

Query  116  LIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-E  286
            + + A  A  L  S +LI LC L  V+G D   GW   HATFYG     GT+GGACG   
Sbjct  1    MAVAAFSAVSLLFS-MLISLC-LQGVYGDDG--GWQSGHATFYGGGDASGTMGGACGYGN  56

Query  287  QFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP-----  451
             + + Y   T ALS ALFNN  SCG+CYE+KC N    C      +IVTAT+ CP     
Sbjct  57   LYSQGYGTNTAALSTALFNNGLSCGSCYEMKCGNDPKWCLP--GSVIVTATNFCPPNNAL  114

Query  452  -TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNL  628
               +G WC PP  HFD++ PA+LQIA+Y+AG+VP+ +RRVPC++KGG RFT++GH +FNL
Sbjct  115  ANDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCVKKGGIRFTVNGHSYFNL  174

Query  629  VTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVT  808
            V ++NV G+GDV  V +    +  W P+ RNWG+ W++N+ L+G+SL+F+VTT+DGK VT
Sbjct  175  VLITNVAGAGDVHSVSIKGS-KTGWQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGKTVT  233

Query  809  SQNVAPKSWQYGQTFEG  859
            S NV P +WQ+GQTF G
Sbjct  234  SYNVVPDNWQFGQTFTG  250



>gb|ADY68817.1| expansin [Gossypium raimondii]
Length=259

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 172/264 (65%), Gaps = 21/264 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            +SVLI  ++M    +A I        P V+ G +   W +AHATFYG  +  GT+GGACG
Sbjct  7    ISVLIFISSMWMMGEARI--------PGVYSGGA---WQNAHATFYGGADASGTMGGACG  55

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC +    C +    I +TAT+ CP  
Sbjct  56   YGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPN  115

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                  +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  116  YALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  175

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            F+LV +SNV G+GD+ KV V       W+ + RNWG+ W++NA+L G+SL+FRVT +D +
Sbjct  176  FDLVLISNVAGAGDIVKVSVKGS-RTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRR  234

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P  WQ+GQTF G+N R
Sbjct  235  TSTSWNIVPAHWQFGQTFTGKNFR  258



>gb|AFZ78600.1| expansin protein [Populus tomentosa]
Length=249

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 158/249 (63%), Gaps = 12/249 (5%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYtta  322
            A   L+ L A+     G    GW++A ATFYG     GT+GGACG    + + Y   T A
Sbjct  4    AGFFLVGLLAMVSSVNGYGGGGWINARATFYGGGDASGTMGGACGYGNLYSQGYGTNTAA  63

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQ  484
            LS ALFN+  SCG+CYEI+CVN    C      I+VTAT+ CP  +      G WC PPQ
Sbjct  64   LSTALFNSGLSCGSCYEIRCVNDPKWCL--PGSILVTATNFCPPNNALPNNAGGWCNPPQ  121

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDLS P +  IA Y AG+VPV YRRVPC R+GG RFT++GH +FNLV ++NVGG+GDV
Sbjct  122  QHFDLSQPVFQHIARYSAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDV  181

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
              V V       W P+ RNWG+ W++N  L+G+SL+F+VTT+DG+ V S N AP SW +G
Sbjct  182  HAVSVKGS-RTGWQPMSRNWGQNWQSNNYLNGQSLSFKVTTSDGRTVVSYNAAPSSWSFG  240

Query  845  QTFEGRNCR  871
            QTF G   R
Sbjct  241  QTFSGAQFR  249



>ref|XP_010922313.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A4-like [Elaeis guineensis]
Length=258

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/249 (49%), Positives = 166/249 (67%), Gaps = 10/249 (4%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYtta  322
            AS+L  ++ A   + G  S+  W  AHATFYG  +  GT+GGACG    + + Y   T A
Sbjct  10   ASLLAFLVPAAARIPGVYSSGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAA  69

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQ  484
            LS ALFN+  SCGAC+EIKC +    C +    I +TAT+ CP      + DG WC PP 
Sbjct  70   LSTALFNDGMSCGACFEIKCADDPQWCHSGSPSIFITATNFCPPNYALPSDDGGWCNPPX  129

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDL+MP +L+IAEY+AG+VPV YRRVPC + GG RFT++G Q+FNLV ++NV G+GD+
Sbjct  130  PHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFQYFNLVLITNVAGAGDI  189

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
             +  V       W+P+ RNWG+ W++NA+L G+SL+FRVT +D +  TS N+ P +WQ+G
Sbjct  190  VRASVKGS-RTGWMPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPANWQFG  248

Query  845  QTFEGRNCR  871
            QTF G+N R
Sbjct  249  QTFAGKNFR  257



>ref|XP_006488339.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO72838.1| hypothetical protein CISIN_1g046524mg [Citrus sinensis]
Length=259

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/259 (49%), Positives = 172/259 (66%), Gaps = 14/259 (5%)
 Frame = +2

Query  134  MATELQASILLIVLCAL---PCVFGGDSAHG-WLDAHATFYGPPE--GTIGGACGL-EQF  292
            MA    A ++L ++C +        GD + G W  AHATFYG  +  GT+GGACG    +
Sbjct  1    MAVVNWAGVILSLVCLMWVADARLPGDYSGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  293  KETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------T  454
             + Y   T ALS ALFNN  SCGAC+EIKC N    C +    I+VTAT+ CP      +
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPS  120

Query  455  GDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVT  634
             +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC +KGG RFT++G ++FNLV 
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVL  180

Query  635  VSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQ  814
            V+NV G+GD+ +V V       W+ + RNWG+ W++NA+L G+SL+FRV  +D ++ TS 
Sbjct  181  VTNVAGAGDILRVNVKGS-RTGWMSMSRNWGQNWQSNAVLVGQSLSFRVKASDRRSSTSW  239

Query  815  NVAPKSWQYGQTFEGRNCR  871
            N+ P +WQ+GQTF G+N R
Sbjct  240  NIVPANWQFGQTFVGKNFR  258



>ref|XP_010690765.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=258

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/258 (49%), Positives = 169/258 (66%), Gaps = 18/258 (7%)
 Frame = +2

Query  149  QASILLIVLCALPCVF--------GGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFK  295
             ASI+L +  +L  +F        G  S  GW  AHATFYG  +  GT+GGACG    + 
Sbjct  1    MASIILPITLSLFSLFSLIHARYPGVYSRGGWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  296  ETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TG  457
            + Y   T ALS ALFN+  SCGAC+E+KC +    C      I +TAT+ CP      + 
Sbjct  61   QGYGVNTAALSTALFNSGQSCGACFELKCADDPRWCHPGSPSIFITATNFCPPNYALPSD  120

Query  458  DGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTV  637
            +G WC PP+ HFDL+MP +L+IAEY+AG+VPV +RRVPC +KGG RFT++G ++FNLV +
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKKGGIRFTINGFRYFNLVLI  180

Query  638  SNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQN  817
            SNV G+GD+  V V       W+ L RNWG+ W++NA+L G+SL+FRVT +D +  TS N
Sbjct  181  SNVAGAGDLVSVSVKGS-RTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTSLN  239

Query  818  VAPKSWQYGQTFEGRNCR  871
            +AP +WQ+GQTF GRN R
Sbjct  240  IAPSNWQFGQTFIGRNFR  257



>ref|XP_008233635.1| PREDICTED: expansin-A4-like [Prunus mume]
Length=259

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 169/259 (65%), Gaps = 13/259 (5%)
 Frame = +2

Query  122  ITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQF  292
            +T      L A    IV   +P V+ G +   W  AHATFYG  +  GT+GGACG    +
Sbjct  4    MTLLCIVSLIALASTIVEARIPGVYSGGA---WQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  293  KETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------T  454
             + Y   T ALS ALFNN  SCGAC+EIKC N    C +    I VTAT+ CP       
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYALPN  120

Query  455  GDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVT  634
             +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC + GG RFT++G ++FNLV 
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFKYFNLVL  180

Query  635  VSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQ  814
            ++NV G+GD+ KV V    +  W+ L RNWG+ W++NA+L+G+SL+FRVT +D +  TS 
Sbjct  181  ITNVAGAGDIVKVSVKGS-KTGWMSLSRNWGQNWQSNAVLAGQSLSFRVTGSDRRTSTSW  239

Query  815  NVAPKSWQYGQTFEGRNCR  871
            N+ P +WQ+GQTF G+N R
Sbjct  240  NIVPANWQFGQTFTGKNFR  258



>emb|CDY20467.1| BnaC04g05770D [Brassica napus]
Length=256

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/239 (50%), Positives = 165/239 (69%), Gaps = 13/239 (5%)
 Frame = +2

Query  182  LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaa  352
            +P V+ G +   W  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  
Sbjct  21   IPGVYSGGA---WETAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGM  77

Query  353  sCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAY  514
            SCGAC+E+KC N    C +    I++TAT+ CP      + +G WC PP+AHFDL+MP +
Sbjct  78   SCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFDLAMPVF  137

Query  515  LQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGE  694
            L+IA+Y+AG+VPV YRRVPC ++GG RFT++GH++FNLV ++NV G+GD+ +  V     
Sbjct  138  LKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKGS-R  196

Query  695  EKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
              W+ L RNWG+ W++NA+L G+SL+FRVT +D +  TS N+ P +WQ+GQTF G+N R
Sbjct  197  TGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFVGKNFR  255



>gb|KEH35550.1| expansin A10 [Medicago truncatula]
Length=253

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/253 (50%), Positives = 168/253 (66%), Gaps = 13/253 (5%)
 Frame = +2

Query  128  AAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKE  298
            A +AT   + +  ++   L   FG D   GW +AHATFYG     GT+GGACG    + +
Sbjct  2    AIVATSFISILFFVLSLCLRGTFG-DYGGGWENAHATFYGGGDASGTMGGACGYGNLYSQ  60

Query  299  TYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGD  460
             Y   T ALS ALFNN  SCG+CYE+KC +    C      I+VTAT+ CP        +
Sbjct  61   GYGTNTAALSTALFNNGLSCGSCYEMKCNSDPKWCL--PGSILVTATNFCPPNFAESNTN  118

Query  461  GKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVS  640
            G WC PP  HFDL+ PA+LQIA+YKAG+VP+ +RRVPCM+KGG RFT++GH +FNLV V+
Sbjct  119  GGWCNPPLQHFDLAEPAFLQIAQYKAGIVPISFRRVPCMKKGGIRFTINGHSYFNLVLVT  178

Query  641  NVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNV  820
            NVGG+GDV  V +    +  W  + RNWG+ W++N  L+G+SL+F+VTT+DG+ +TS NV
Sbjct  179  NVGGAGDVHSVSIKGS-KTGWQAMSRNWGQNWQSNNYLNGQSLSFQVTTSDGRTITSNNV  237

Query  821  APKSWQYGQTFEG  859
             P +WQ+GQTF G
Sbjct  238  VPGNWQFGQTFTG  250



>ref|XP_006424843.1| hypothetical protein CICLE_v10029094mg [Citrus clementina]
 gb|ESR38083.1| hypothetical protein CICLE_v10029094mg [Citrus clementina]
Length=259

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/259 (49%), Positives = 172/259 (66%), Gaps = 14/259 (5%)
 Frame = +2

Query  134  MATELQASILLIVLCAL---PCVFGGDSAHG-WLDAHATFYGPPE--GTIGGACGL-EQF  292
            MA    A ++L ++C +        GD + G W  AHATFYG  +  GT+GGACG    +
Sbjct  1    MAVVNWAGVILSLVCLMWVADARLPGDYSGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  293  KETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------T  454
             + Y   T ALS ALFNN  SCGAC+EIKC N    C +    I+VTAT+ CP      +
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPS  120

Query  455  GDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVT  634
             +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC +KGG RFT++G ++FNLV 
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVL  180

Query  635  VSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQ  814
            V+NV G+GD+ +V V       W+ + RNWG+ W++NA+L G+SL+FRV  +D ++ TS 
Sbjct  181  VTNVAGAGDILRVNVKGS-RTGWMSMSRNWGQNWQSNAVLIGQSLSFRVKASDRRSSTSW  239

Query  815  NVAPKSWQYGQTFEGRNCR  871
            N+ P +WQ+GQTF G+N R
Sbjct  240  NIVPANWQFGQTFVGKNFR  258



>ref|XP_009780854.1| PREDICTED: expansin-A4-like [Nicotiana sylvestris]
Length=253

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 154/224 (69%), Gaps = 12/224 (5%)
 Frame = +2

Query  215  GWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCV  385
            GW +AHATFYG     GT+GGACG    + + Y   T ALS ALFNN  +CGACYE+ C 
Sbjct  30   GWQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYELTCN  89

Query  386  NSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHFDLSMPAYLQIAEYKAGVV  547
            N    C   Q  IIVTAT+ CP         G WC PP  HFDL+ PA+LQIA+Y+AG+V
Sbjct  90   NDGQSCL--QGSIIVTATNFCPPNPSLPNNNGGWCNPPLQHFDLAQPAFLQIAKYRAGIV  147

Query  548  PVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWG  727
            PV +RRVPC RKGG RFT++GH FFNLV V+NVGG+GDV  V +       W  + RNWG
Sbjct  148  PVSFRRVPCRRKGGVRFTINGHSFFNLVLVTNVGGAGDVQSVSIKGS-NTGWQTMSRNWG  206

Query  728  EKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
            + W+ NA L+G+SL+F+VTT+DG+ +TS N AP +WQ+GQTFEG
Sbjct  207  QNWQNNANLNGQSLSFQVTTSDGRTLTSNNAAPANWQFGQTFEG  250



>ref|XP_011098644.1| PREDICTED: expansin-A10 [Sesamum indicum]
Length=240

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 156/222 (70%), Gaps = 8/222 (4%)
 Frame = +2

Query  215  GWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCV  385
            GW++AHATFYG     GT+GGACG    + + Y   T ALS ALFNN  SCGAC+++ CV
Sbjct  24   GWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFQLVCV  83

Query  386  NSTGQCKTPQKPIIVTATDLCPTGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRR  565
            N    C   +  IIVTAT+ CP   G WC PP  HFDLS P +L+IA+Y+AG+VPV YRR
Sbjct  84   NDPQWCL--RGSIIVTATNFCP--PGGWCDPPNHHFDLSQPVFLRIAQYRAGIVPVLYRR  139

Query  566  VPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETN  745
            VPC R GG RFT++GH +FNLV V+NVGG+GDV  V +       W P+ RNWG+ W++N
Sbjct  140  VPCRRSGGIRFTINGHSYFNLVLVTNVGGAGDVQAVYIKGS-RTAWQPMSRNWGQNWQSN  198

Query  746  AMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
            + L+G+SL+F+VTT+DG++V S NVAP +W +GQTF G   R
Sbjct  199  SYLNGQSLSFKVTTSDGRSVVSYNVAPPNWSFGQTFSGGQFR  240



>ref|XP_002284858.1| PREDICTED: expansin-A1 [Vitis vinifera]
Length=248

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/226 (53%), Positives = 154/226 (68%), Gaps = 12/226 (5%)
 Frame = +2

Query  209  AHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIK  379
            A GW DAHATFYG     GT+GGACG    + + Y   T ALS ALFN+  SCGAC+EI+
Sbjct  22   AGGWTDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACFEIR  81

Query  380  CVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHFDLSMPAYLQIAEYKAG  541
            C N    C++    I VTAT+ CP  +      G WC PPQ HFDLS P + +IAEY+AG
Sbjct  82   CANDPRWCRS--GSITVTATNFCPPNNALPNNAGGWCNPPQQHFDLSQPVFERIAEYRAG  139

Query  542  VVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRN  721
            +VPV YRRVPC++KGG RFTM+GH +FNLV +SNVGG+GDV  V +    +  W P+ RN
Sbjct  140  IVPVSYRRVPCIKKGGIRFTMNGHSYFNLVLISNVGGAGDVHSVSIKGS-KTGWQPMSRN  198

Query  722  WGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
            WG+ W++N+ L+G+SL+F+VT +DG+   S NV P  W +GQTF G
Sbjct  199  WGQNWQSNSYLNGQSLSFKVTLSDGRTAVSNNVVPAGWSFGQTFSG  244



>gb|AAR09170.1| alpha-expansin 3 [Populus tremula x Populus tremuloides]
Length=249

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/249 (50%), Positives = 162/249 (65%), Gaps = 12/249 (5%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYtta  322
            A I L+   A+     G    GW++AHATFYG     GT+GGACG    + + Y   T A
Sbjct  4    AGIFLVGFLAMVSSVYGYGGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAA  63

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQ  484
            LS ALFN+  SCG+C+EI+CVN    C      I++TAT+ CP  +      G WC PPQ
Sbjct  64   LSTALFNSGLSCGSCFEIRCVNDPKWCL--PGSIVITATNFCPPNNALPNNAGGWCNPPQ  121

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDLS P +  IA+Y+AG+VPV YRRVPC R+GG RFT++GH +FNLV ++NVGG+GDV
Sbjct  122  HHFDLSQPVFQHIAQYRAGIVPVSYRRVPCRRRGGIRFTVNGHSYFNLVLITNVGGAGDV  181

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
              V +       W P+ RNWG+ W++N  L+G+SL+F+VTT+DG+ V S NVAP SW +G
Sbjct  182  HSVSIKGS-RTGWQPMSRNWGQNWQSNNYLNGQSLSFKVTTSDGRTVVSYNVAPSSWSFG  240

Query  845  QTFEGRNCR  871
            QTF G   R
Sbjct  241  QTFSGAQFR  249



>gb|ACT67493.1| expansin A1 [Raphanus sativus]
Length=258

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 165/239 (69%), Gaps = 13/239 (5%)
 Frame = +2

Query  182  LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaa  352
            +P V+ G +   W  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFN+  
Sbjct  23   IPGVYSGGA---WQTAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGM  79

Query  353  sCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAY  514
            SCGAC+E+KC N    C +    I++TAT+ CP      + +G WC PP+AHFDL+MP +
Sbjct  80   SCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFDLAMPVF  139

Query  515  LQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGE  694
            L+IA+Y+AG+VPV YRRVPC ++GG RFT++GH++FNLV ++NV G+GD+ +  V     
Sbjct  140  LKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKGS-R  198

Query  695  EKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
              W+ L RNWG+ W++NA+L G+SL+FRVT +D +  TS N+ P +WQ+GQT+ G+N R
Sbjct  199  TGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTYVGKNFR  257



>ref|XP_010043542.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 ref|XP_010043543.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 gb|KCW85556.1| hypothetical protein EUGRSUZ_B02355 [Eucalyptus grandis]
Length=260

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/254 (48%), Positives = 170/254 (67%), Gaps = 13/254 (5%)
 Frame = +2

Query  137  ATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYS  307
            A+ +  S++ +    +P V+ G     W  AHATFYG  +  GT+GGACG    + + Y 
Sbjct  10   ASLISFSLMWLADARIPGVYSGGP---WQTAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  308  PYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKW  469
              T ALS ALFNN  SCGAC+EIKC N    C +    I VTAT+ CP      + +G W
Sbjct  67   VNTAALSTALFNNGLSCGACFEIKCANDPTWCHSGSPSIFVTATNFCPPNFAQPSDNGGW  126

Query  470  CAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVG  649
            C PP+ HFDL+MP +L+IAEY+AG+VPV +RRVPC ++GG RFT++G ++FNLV +SNV 
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLISNVA  186

Query  650  GSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPK  829
            G+GD+ +V V       W+ + RNWG+ W++NA+L+G++L+FRVT +D ++ TS N+ P 
Sbjct  187  GAGDIVRVSVKGA-RTGWMSMSRNWGQNWQSNAVLAGQALSFRVTASDRRSSTSWNMVPA  245

Query  830  SWQYGQTFEGRNCR  871
             WQ+GQTF G+N R
Sbjct  246  GWQFGQTFTGKNFR  259



>ref|XP_009409516.1| PREDICTED: expansin-A6-like [Musa acuminata subsp. malaccensis]
Length=261

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 170/261 (65%), Gaps = 16/261 (6%)
 Frame = +2

Query  116  LIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-E  286
            L +T A+   + AS  L+    +P V+ G     W  AHATFYG  +  GT+GGACG   
Sbjct  7    LAVTVAL---VLASSALLADARIPGVYTGGP---WQTAHATFYGGSDASGTMGGACGYGN  60

Query  287  QFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP-----  451
             + + Y   T ALS AL+N+   CGAC+EIKC +    CK     I +TAT+ CP     
Sbjct  61   LYSQGYGVETAALSTALYNDGLRCGACFEIKCADDPRWCKGGNPSIFITATNFCPPNYAL  120

Query  452  -TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNL  628
             + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV +RRVPC + GG RFT++G Q+FNL
Sbjct  121  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKSGGIRFTINGFQYFNL  180

Query  629  VTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVT  808
            V ++NV G+GD+ +  V       W+ + RNWG+ W++NA+L G+SL+FRVT +D +  T
Sbjct  181  VLITNVAGAGDIVRASVKGT-RSGWIAMSRNWGQNWQSNAVLVGQSLSFRVTGSDHRTST  239

Query  809  SQNVAPKSWQYGQTFEGRNCR  871
            S N+AP SWQ+GQTF G+N R
Sbjct  240  SWNIAPASWQFGQTFSGKNFR  260



>gb|AAM22626.1|AF428179_1 expansin 12 precursor [Rumex palustris]
Length=258

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 170/257 (66%), Gaps = 10/257 (4%)
 Frame = +2

Query  128  AAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKE  298
            AA++  L    +L    A   + G  S  GW  AHATFYG  +  GT+GGACG    + +
Sbjct  2    AALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYSQ  61

Query  299  TYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGD  460
             Y   T ALS ALFNN  SCGAC+EIKC +    C      I++TAT+ CP      + +
Sbjct  62   GYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCHPGSPSILITATNFCPPNFAEPSDN  121

Query  461  GKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVS  640
            G WC PP+ HFDL+MP +L+ AEY+AG+VPV +RRVPC ++GG RFT++G ++FNLV ++
Sbjct  122  GGWCNPPRPHFDLAMPMFLKFAEYRAGIVPVAFRRVPCRKRGGIRFTVNGFRYFNLVLIT  181

Query  641  NVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNV  820
            NV G+GD+ +V +       W+P+ RNWG+ W++NA+L G+SL+FRVT +D +  TS NV
Sbjct  182  NVAGAGDIVRVSIKGS-RSDWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRKSTSWNV  240

Query  821  APKSWQYGQTFEGRNCR  871
            AP SWQ+GQTF G+N R
Sbjct  241  APASWQFGQTFTGKNFR  257



>ref|XP_008357089.1| PREDICTED: expansin-A6 [Malus domestica]
Length=260

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 176/264 (67%), Gaps = 14/264 (5%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            + V+ ++  +AT L  S++ +    +P V+ G +   W  AHATFYG  +  GT+ GACG
Sbjct  1    MGVVSVSTCIAT-LLISLMWVAEARIPGVYTGGA---WQGAHATFYGGSDASGTMXGACG  56

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC N    C +    I +TAT+ CP  
Sbjct  57   YGNLYSQGYGVNTGALSTALFNNGLSCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPN  116

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  117  FAQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRY  176

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV +SNV G+GD+ +V V   G   W+ + RNWG+ W++N++L G+SL+FRVT +D +
Sbjct  177  FNLVLISNVAGAGDIVRVSVKGAG-TGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRR  235

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P +WQ+GQTF G+N R
Sbjct  236  TSTSWNIVPANWQFGQTFTGKNFR  259



>gb|KCW83632.1| hypothetical protein EUGRSUZ_B00524, partial [Eucalyptus grandis]
Length=245

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 153/225 (68%), Gaps = 12/225 (5%)
 Frame = +2

Query  215  GWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCV  385
            GW+DAHATFYG     GT+GGACG    + + Y   T ALS ALFN+  SCGAC+EIKCV
Sbjct  24   GWIDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACFEIKCV  83

Query  386  NSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHFDLSMPAYLQIAEYKAGVV  547
            N    C      I+VTAT+ CP  +      G WC PP  HFDLS P + QIA+Y +G+V
Sbjct  84   NDPRWCNPAS--IVVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQQIAQYSSGIV  141

Query  548  PVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWG  727
            PV YRRVPC +KGG RFT++GH +FNLV ++NVGG+GDV  V +       W P+ RNWG
Sbjct  142  PVAYRRVPCQKKGGIRFTINGHSYFNLVLITNVGGAGDVRSVSIKGS-RTGWQPMSRNWG  200

Query  728  EKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGR  862
            + W++N+ L G+SL+F VTT+DG+ V S NVAP +W +GQTF GR
Sbjct  201  QNWQSNSNLDGQSLSFSVTTSDGRTVVSNNVAPPNWSFGQTFAGR  245



>ref|XP_009143296.1| PREDICTED: expansin-A4-like [Brassica rapa]
Length=256

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/239 (50%), Positives = 165/239 (69%), Gaps = 13/239 (5%)
 Frame = +2

Query  182  LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaa  352
            +P V+ G +   W  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  
Sbjct  21   IPGVYSGGA---WETAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGM  77

Query  353  sCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAY  514
            SCGAC+E+KC N    C +    I++TAT+ CP      + +G WC PP+AHFDL+MP +
Sbjct  78   SCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFDLAMPVF  137

Query  515  LQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGE  694
            L+IA+Y+AG+VPV YRRVPC ++GG RFT++GH++FNLV ++NV G+GD+ +  V     
Sbjct  138  LKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKGT-R  196

Query  695  EKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
              W+ L RNWG+ W++NA+L G+SL+FRVT +D +  TS N+ P +WQ+GQTF G+N R
Sbjct  197  TGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFVGKNFR  255



>ref|XP_008464122.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=258

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 168/256 (66%), Gaps = 13/256 (5%)
 Frame = +2

Query  131  AMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKET  301
            ++   L  S  L++   +P V+ G     W  AHATFYG  +  GT+GGACG    + + 
Sbjct  6    SLCIALLLSFSLLIDARIPGVYSGGP---WQSAHATFYGGADASGTMGGACGYGNLYSQG  62

Query  302  YSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDG  463
            Y   T ALS ALFN   SCGAC+EIKC N    C +    I++TAT+ CP        +G
Sbjct  63   YGVNTAALSTALFNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYALPNDNG  122

Query  464  KWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSN  643
             WC PP++HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNLV ++N
Sbjct  123  GWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITN  182

Query  644  VGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVA  823
            V G+GD+ +V V       W+ L RNWG+ W++NA+L G++L+FRVT +D +  TS N+ 
Sbjct  183  VAGAGDIVRVSVKGT-RTGWMSLTRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNIV  241

Query  824  PKSWQYGQTFEGRNCR  871
            P  WQ+GQTF G+N R
Sbjct  242  PAHWQFGQTFTGKNFR  257



>ref|XP_010030057.1| PREDICTED: expansin-A15-like [Eucalyptus grandis]
Length=248

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 153/225 (68%), Gaps = 12/225 (5%)
 Frame = +2

Query  215  GWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCV  385
            GW+DAHATFYG     GT+GGACG    + + Y   T ALS ALFN+  SCGAC+EIKCV
Sbjct  24   GWIDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACFEIKCV  83

Query  386  NSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHFDLSMPAYLQIAEYKAGVV  547
            N    C      I+VTAT+ CP  +      G WC PP  HFDLS P + QIA+Y +G+V
Sbjct  84   NDPRWCNPAS--IVVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQQIAQYSSGIV  141

Query  548  PVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWG  727
            PV YRRVPC +KGG RFT++GH +FNLV ++NVGG+GDV  V +       W P+ RNWG
Sbjct  142  PVAYRRVPCQKKGGIRFTINGHSYFNLVLITNVGGAGDVRSVSIKGS-RTGWQPMSRNWG  200

Query  728  EKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGR  862
            + W++N+ L G+SL+F VTT+DG+ V S NVAP +W +GQTF GR
Sbjct  201  QNWQSNSNLDGQSLSFSVTTSDGRTVVSNNVAPPNWSFGQTFAGR  245



>gb|AAC96081.1| alpha-expansin precursor [Nicotiana tabacum]
Length=249

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 154/224 (69%), Gaps = 12/224 (5%)
 Frame = +2

Query  215  GWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCV  385
            GW +AHATFYG     GT+GGACG    + + Y   T ALS ALFNN  +CGACYE+ C 
Sbjct  26   GWQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYELTCN  85

Query  386  NSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHFDLSMPAYLQIAEYKAGVV  547
            N    C   Q  IIVTAT+ CP         G WC PP  HFDL+ PA+LQIA+Y+AG+V
Sbjct  86   NDGQSCL--QGSIIVTATNFCPPNPSLPNNNGGWCNPPLQHFDLAQPAFLQIAKYRAGIV  143

Query  548  PVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWG  727
            PV +RRVPC RKGG RFT++GH FFNLV V+NVGG+GDV  V +       W  + RNWG
Sbjct  144  PVSFRRVPCRRKGGVRFTINGHSFFNLVLVTNVGGAGDVQSVSIKGS-NTGWQTMSRNWG  202

Query  728  EKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
            + W+ NA L+G+SL+F+VTT+DG+ +TS N AP +WQ+GQTFEG
Sbjct  203  QNWQNNANLNGQSLSFQVTTSDGRTLTSNNAAPANWQFGQTFEG  246



>dbj|BAH36862.1| alpha expansin [Rosa hybrid cultivar]
Length=258

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 173/250 (69%), Gaps = 15/250 (6%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYtta  322
            AS+L++    +P  + G     W DAHATFYG  +  GT+GGACG    + + Y   T A
Sbjct  13   ASLLILANARIPGPYTGGP---WQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  69

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKP-IIVTATDLCP------TGDGKWCAPP  481
            LS ALFNN  SCGAC+EI+C +    C TP KP I VTAT+ CP      + +G WC PP
Sbjct  70   LSTALFNNGLSCGACFEIRCGDDPRWC-TPGKPSIFVTATNFCPPNFAQPSDNGGWCNPP  128

Query  482  QAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGD  661
            + HFDL+MP +L+IAEYKAG+VPV YRRVPC ++GG RFT++GH++FNLV ++NV G+GD
Sbjct  129  RTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKRGGIRFTINGHKYFNLVLITNVAGAGD  188

Query  662  VSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQY  841
            V  V V       W+P+ RNWG+ W++N++L G++L+FRV  +D ++ T+ NVAP +WQ+
Sbjct  189  VVSVSVKGT-NTGWMPMSRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTTYNVAPANWQF  247

Query  842  GQTFEGRNCR  871
            GQT+ G+N R
Sbjct  248  GQTYSGKNFR  257



>ref|XP_011027216.1| PREDICTED: expansin-A4 [Populus euphratica]
Length=258

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 174/260 (67%), Gaps = 16/260 (6%)
 Frame = +2

Query  128  AAMATELQASILL---IVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQ  289
            A  AT   AS++L   +V   +P V+ G +   W  AHATFYG  +  GT+GGACG    
Sbjct  2    AIRATTCVASLVLFLTLVEARIPGVYTGGA---WQSAHATFYGGSDASGTMGGACGYGNL  58

Query  290  FKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------  451
            + + Y   T ALS ALFN+  SCGAC+EIKC N    C +    I++TAT+ CP      
Sbjct  59   YSQGYGVNTAALSTALFNSGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYALP  118

Query  452  TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLV  631
            + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RF ++GH++FNLV
Sbjct  119  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFQINGHRYFNLV  178

Query  632  TVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTS  811
             ++NV G+GD+ KV V    +  W+ + RNWG+ W++N++L G+SL+FRVT +D +  TS
Sbjct  179  LITNVAGAGDIVKVSVKGS-KTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  237

Query  812  QNVAPKSWQYGQTFEGRNCR  871
             NV P +WQ+ QTF G+N R
Sbjct  238  WNVVPSNWQFSQTFVGKNFR  257



>ref|XP_010508990.1| PREDICTED: expansin-A4-like [Camelina sativa]
Length=257

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/261 (48%), Positives = 173/261 (66%), Gaps = 20/261 (8%)
 Frame = +2

Query  134  MATELQASILLIVLCAL-----PCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQ  289
            MA +L       VL  L     P V+ G S   W +AHATFYG  +  GT+GGACG    
Sbjct  1    MAIKLAILFTTFVLFNLADARIPGVYSGSS---WQNAHATFYGGSDASGTMGGACGYGNL  57

Query  290  FKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------  451
            + + Y   T ALS ALFNN  SCGAC+E+KC N    C +    I++TAT+ CP      
Sbjct  58   YSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQP  117

Query  452  TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLV  631
            + +G WC PP+ HFDL+MP +L+IA+Y+AG+VPV YRRVPC ++GG RFT++GH++FNL+
Sbjct  118  SDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLI  177

Query  632  TVSNVGGSGDVSKVEVNAEGEEK-WVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVT  808
             ++NV G+GD+  V  N +G    W+ L RNWG+ W++NA+L G+SL+FRVT +D +  T
Sbjct  178  LITNVAGAGDI--VRANVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTST  235

Query  809  SQNVAPKSWQYGQTFEGRNCR  871
            + N+ P +WQ+GQTF G+N R
Sbjct  236  TWNMVPSNWQFGQTFVGKNFR  256



>ref|XP_004486999.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/260 (47%), Positives = 170/260 (65%), Gaps = 13/260 (5%)
 Frame = +2

Query  119  IITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQ  289
            ++T      L  S+  +    +P  + G +   W  AHATFYG  +  GT+GGACG    
Sbjct  1    MMTIVYIVSLIMSLTWLAESRIPGNYNGGA---WETAHATFYGGSDASGTMGGACGYGNL  57

Query  290  FKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------  451
            + + Y   T ALS ALFN   SCGAC+EIKC N    C +    I +TAT+ CP      
Sbjct  58   YSQGYGVNTAALSTALFNKGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNYALP  117

Query  452  TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLV  631
              +G WC PP+ HFDL+MP +L+IAEY+AG+VPV +RRVPC ++GG RFT++G ++FNLV
Sbjct  118  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKQGGIRFTVNGFRYFNLV  177

Query  632  TVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTS  811
             +SNV G+GD+ +  V      +W+P+ RNWG+ W++NA+L G+SL+FRVT++D +  TS
Sbjct  178  LISNVAGAGDIVRTYVKGT-RTRWMPMSRNWGQNWQSNAVLVGQSLSFRVTSSDRRTSTS  236

Query  812  QNVAPKSWQYGQTFEGRNCR  871
             N+AP +WQ+GQTF G+N R
Sbjct  237  WNIAPHNWQFGQTFTGKNFR  256



>ref|XP_010425091.1| PREDICTED: expansin-A15-like [Camelina sativa]
Length=253

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 163/247 (66%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttals  328
            ILL+   A+ C   G  A GW++AHATFYG  +  GT+GGACG    + + Y   T ALS
Sbjct  11   ILLLCFAAMVCSVRGYDA-GWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALS  69

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAH  490
             ALFNN  SCGAC+EIKC +    C      I+VTAT+ CP  +      G WC PP  H
Sbjct  70   TALFNNGLSCGACFEIKCQSDGAWCLP--GAIVVTATNFCPPNNALPNNAGGWCNPPLHH  127

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDLS P + +IA YKAGVVPV YRRVPC R+GG RFT++GH +FNLV V+NVGG+GDV  
Sbjct  128  FDLSQPIFQRIAHYKAGVVPVSYRRVPCKRRGGIRFTINGHSYFNLVLVTNVGGAGDVHS  187

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
            V V      +W  + RNWG+ W++N +L+G++L+F+V  +DG+ V S N+AP SW +GQT
Sbjct  188  VAVKGS-RTRWQQMSRNWGQNWQSNNLLNGQALSFKVVASDGRTVVSNNIAPASWSFGQT  246

Query  851  FEGRNCR  871
            F GR  R
Sbjct  247  FTGRQFR  253



>ref|XP_007141864.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
 gb|ESW13858.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
Length=260

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 172/261 (66%), Gaps = 17/261 (7%)
 Frame = +2

Query  116  LIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-E  286
            L+   ++ T L AS        +P V+GG +   W  AHATFYG  +  GT+GGACG   
Sbjct  7    LLAIVSLVTVLLAS----AEARIPGVYGGGA---WETAHATFYGGSDASGTMGGACGYGN  59

Query  287  QFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP-----  451
             + + Y   T ALS ALFN+  SCGAC+EIKC +    C      I+VTAT+ CP     
Sbjct  60   LYSQGYGVNTAALSTALFNSGLSCGACFEIKCADDPSWCHAGSPSILVTATNFCPPNYAL  119

Query  452  -TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNL  628
             + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNL
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGMRFTINGFRYFNL  179

Query  629  VTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVT  808
            V ++NV G+GDV +  V    +  W+ + RNWG+ W++NA+L G+SL+FRVT +D +  T
Sbjct  180  VLITNVAGAGDVVRTSVKGA-KTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTST  238

Query  809  SQNVAPKSWQYGQTFEGRNCR  871
            S N+ P +WQ+GQTF G+N R
Sbjct  239  SWNIVPANWQFGQTFTGKNFR  259



>emb|CAN73252.1| hypothetical protein VITISV_027049 [Vitis vinifera]
Length=247

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/250 (49%), Positives = 169/250 (68%), Gaps = 13/250 (5%)
 Frame = +2

Query  149  QASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYtt  319
             AS+L +    +P V+ G    GW  AHATFYG  +  GT+GGACG    + + Y   T 
Sbjct  1    MASVLKLGEARIPGVYTGG---GWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTA  57

Query  320  alsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPP  481
            ALS ALFNN  SCGAC+E+KC N    C +    I++TAT+ CP      + +G WC PP
Sbjct  58   ALSTALFNNGLSCGACFELKCANDPEWCHSGSPSILITATNFCPPNYALPSDNGGWCNPP  117

Query  482  QAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGD  661
            + HFDL+MP +L+IAEY+AG+VPV +RRVPC ++GG RFT++G ++FNLV ++NV G+GD
Sbjct  118  RPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGD  177

Query  662  VSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQY  841
            + K  V    +  W+ L RNWG+ W++NA+L G+SL+FRVT +D +  TS N+ P +WQ+
Sbjct  178  IVKASVKGS-KTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDHRTSTSWNIVPSNWQF  236

Query  842  GQTFEGRNCR  871
            GQTF G+N R
Sbjct  237  GQTFSGKNFR  246



>ref|XP_010258311.1| PREDICTED: expansin-A1 isoform X2 [Nelumbo nucifera]
Length=250

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 161/247 (65%), Gaps = 12/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttals  328
            +L+  L     V G     GW++AHATFYG     GT+GGACG    + + Y   T ALS
Sbjct  7    LLVGFLSMFLSVHGYGYGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALS  66

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAH  490
             ALFNN  SCGAC+EI+CVN    C      I+VTAT+ CP  +      G WC PPQ H
Sbjct  67   TALFNNGLSCGACFEIRCVNDPKWCLP--GSIVVTATNFCPPNNALPNNAGGWCNPPQHH  124

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDLS P +  IA+Y+AG+VPV YRRVPC ++GG RFT++GH +FNLV ++NVGG+GDV  
Sbjct  125  FDLSQPVFQHIAQYRAGIVPVAYRRVPCRKRGGIRFTINGHSYFNLVLITNVGGAGDVHA  184

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
            V +       W P+ RNWG+ W++N  L+G+SL+F+VTT+DG++V S NVAP  W +GQT
Sbjct  185  VSIKGS-RTGWQPMSRNWGQNWQSNTYLNGQSLSFKVTTSDGRSVVSYNVAPAGWSFGQT  243

Query  851  FEGRNCR  871
            F G   R
Sbjct  244  FSGAQFR  250



>ref|XP_002522457.1| Alpha-expansin 1 precursor, putative [Ricinus communis]
 gb|EEF39949.1| Alpha-expansin 1 precursor, putative [Ricinus communis]
Length=249

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 163/246 (66%), Gaps = 16/246 (7%)
 Frame = +2

Query  161  LLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsa  331
             L ++ ++ C  GG    GW++AHATFYG     GT+GGACG    + + Y   T ALS 
Sbjct  11   FLAMVSSVNCYGGG----GWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALST  66

Query  332  alfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHF  493
            ALFN+  SCG+CYEI+CVN    C      I+VTAT+ CP  +      G WC PPQ HF
Sbjct  67   ALFNSGLSCGSCYEIRCVNDPKWCL--PGSIVVTATNFCPPNNALPNNAGGWCNPPQQHF  124

Query  494  DLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKV  673
            DLS P +  IA+Y+AG+VPV YRRVPC R+GG RFT++GH +FNLV ++NVGG+GDV  V
Sbjct  125  DLSQPVFQHIAQYRAGIVPVAYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHAV  184

Query  674  EVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTF  853
             +       W  + RNWG+ W++N  L+G+SL+F+VTT+DG++V S NVAP SW +GQTF
Sbjct  185  AIKGS-RTGWQAMSRNWGQNWQSNTYLNGQSLSFKVTTSDGRSVVSYNVAPVSWSFGQTF  243

Query  854  EGRNCR  871
             G   R
Sbjct  244  SGAQFR  249



>ref|XP_010258310.1| PREDICTED: expansin-A1 isoform X1 [Nelumbo nucifera]
Length=252

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 161/247 (65%), Gaps = 12/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttals  328
            +L+  L     V G     GW++AHATFYG     GT+GGACG    + + Y   T ALS
Sbjct  9    LLVGFLSMFLSVHGYGYGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALS  68

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAH  490
             ALFNN  SCGAC+EI+CVN    C      I+VTAT+ CP  +      G WC PPQ H
Sbjct  69   TALFNNGLSCGACFEIRCVNDPKWCL--PGSIVVTATNFCPPNNALPNNAGGWCNPPQHH  126

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDLS P +  IA+Y+AG+VPV YRRVPC ++GG RFT++GH +FNLV ++NVGG+GDV  
Sbjct  127  FDLSQPVFQHIAQYRAGIVPVAYRRVPCRKRGGIRFTINGHSYFNLVLITNVGGAGDVHA  186

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
            V +       W P+ RNWG+ W++N  L+G+SL+F+VTT+DG++V S NVAP  W +GQT
Sbjct  187  VSIKGS-RTGWQPMSRNWGQNWQSNTYLNGQSLSFKVTTSDGRSVVSYNVAPAGWSFGQT  245

Query  851  FEGRNCR  871
            F G   R
Sbjct  246  FSGAQFR  252



>ref|XP_007205748.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
 gb|EMJ06947.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
Length=258

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/249 (51%), Positives = 166/249 (67%), Gaps = 10/249 (4%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYtta  322
            AS+L + + A   + G  +   W  AHATFYG  +  GT+GGACG    + E Y   T A
Sbjct  10   ASLLSLFMAANARIPGVYTGGPWEGAHATFYGGSDASGTMGGACGYGNLYSEGYGVNTAA  69

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQ  484
            LS ALFNN  SCGAC+EIKC +    C      I +TAT+ CP        DG WC PP+
Sbjct  70   LSTALFNNGLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNYALPNDDGGWCNPPR  129

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDL+MP +LQIAEYKAG+VPV +RRVPC ++GG RFT++G ++FNLV ++NV G+GD+
Sbjct  130  THFDLAMPMFLQIAEYKAGIVPVSFRRVPCRKEGGVRFTINGFRYFNLVLITNVAGAGDI  189

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
             +V V     E W+P+ RNWG+ W++NA L G++L+FRVT +D +  TS NVAP  WQ+G
Sbjct  190  VRVSVKGANTE-WMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSWNVAPGHWQFG  248

Query  845  QTFEGRNCR  871
            QTF G+N R
Sbjct  249  QTFSGKNFR  257



>gb|AAM47000.1|AF512542_1 alpha-expansin precursor [Gossypium hirsutum]
Length=264

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 165/239 (69%), Gaps = 13/239 (5%)
 Frame = +2

Query  182  LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaa  352
            +P VF G +   W  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  
Sbjct  29   IPGVFTGGA---WESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSPALFNNGL  85

Query  353  sCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAY  514
            SCGAC+EIKC N    C +    II+TAT+ CP        +G WC PP+ HFDL+MP +
Sbjct  86   SCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMF  145

Query  515  LQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGE  694
            L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNLV V+NV G+GD+ KV+V     
Sbjct  146  LKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVKVKGT-N  204

Query  695  EKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
              W+ + RNWG+ W++NA+L G++L+FRVT +D +  TS NVAP +WQ+GQTF G+N R
Sbjct  205  TNWMSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSLNVAPANWQFGQTFTGKNFR  263



>gb|ADY68811.1| alpha-expansin 1 [Gossypium raimondii]
Length=258

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 162/229 (71%), Gaps = 12/229 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GD   GW  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEY  532
            E++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+LQIAEY
Sbjct  90   ELRCNNDPQWCIS--RTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV +RRV C++KGG R+TM+GH +FN+V ++NVGG+GD++ V +    +  W+P+
Sbjct  148  RAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGS-KTGWLPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             RNWG+ W++NA L+G+SL+F+VT +D + +T+ NV P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYLNGQSLSFKVTASDSRTMTNYNVVPPGWQFGQTFEG  255



>ref|XP_002315218.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEF01389.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 171/261 (66%), Gaps = 13/261 (5%)
 Frame = +2

Query  116  LIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-E  286
            + I A +        L +V   +P V+ G +   W  AHATFYG  +  GT+GGACG   
Sbjct  1    MAIRATICVASLVLFLTLVEARIPGVYTGGA---WQSAHATFYGGSDASGTMGGACGYGN  57

Query  287  QFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP-----  451
             + + Y   T ALS ALFNN  SCGAC+EIKC N    C +    I++TAT+ CP     
Sbjct  58   LYSQGYGVNTAALSTALFNNGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYAL  117

Query  452  -TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNL  628
             + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RF ++GH++FNL
Sbjct  118  PSDNGGWCNPPRPHFDLAMPVFLKIAEYRAGIVPVSYRRVPCRKRGGIRFQINGHRYFNL  177

Query  629  VTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVT  808
            V ++NV G+GD+ KV V    +  W+ + RNWG+ W++N++L G+SL+FRVT +D +  T
Sbjct  178  VLITNVAGAGDIVKVSVKGS-KTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTST  236

Query  809  SQNVAPKSWQYGQTFEGRNCR  871
            S NV P +WQ+ QTF G+N R
Sbjct  237  SWNVVPSNWQFSQTFVGKNFR  257



>ref|XP_009594513.1| PREDICTED: expansin-A4-like [Nicotiana tomentosiformis]
Length=253

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 154/224 (69%), Gaps = 12/224 (5%)
 Frame = +2

Query  215  GWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCV  385
            GW +AHATFYG     GT+GGACG    + + Y   T ALS ALFNN  +CGACYE+ C 
Sbjct  30   GWQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYELTCN  89

Query  386  NSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHFDLSMPAYLQIAEYKAGVV  547
            N    C   Q  IIVTAT+ CP         G WC PP  HFDL+ PA++QIA+Y+AG+V
Sbjct  90   NQAQSCL--QGSIIVTATNFCPPNPSLPNNNGGWCNPPLQHFDLAQPAFVQIAKYRAGIV  147

Query  548  PVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWG  727
            PV +RRVPC RKGG RFT++GH FFNLV V+NVGG+GDV  V +       W  + RNWG
Sbjct  148  PVSFRRVPCRRKGGVRFTINGHSFFNLVLVTNVGGAGDVQSVSIKGS-NTGWQTMSRNWG  206

Query  728  EKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
            + W+ NA L+G+SL+F+VTT+DG+ +TS N AP +WQ+GQTFEG
Sbjct  207  QNWQNNANLNGQSLSFQVTTSDGRTLTSNNAAPANWQFGQTFEG  250



>ref|XP_006846223.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
 gb|ERN07898.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
Length=258

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/255 (48%), Positives = 169/255 (66%), Gaps = 13/255 (5%)
 Frame = +2

Query  134  MATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETY  304
            +A  L ASI++     +P V+ G     W  AHATFYG  +  GT+GGACG    + + Y
Sbjct  7    LALALLASIMVPAFARIPGVYSGSD---WESAHATFYGGSDASGTMGGACGYGNLYSQGY  63

Query  305  SPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGK  466
               T ALS ALFN+  SCGAC+EIKC +    C +    I +TAT+ CP      + +G 
Sbjct  64   GVETAALSTALFNSGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPSDNGG  123

Query  467  WCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNV  646
            WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRV C + GG RFT++G ++FNLV +SNV
Sbjct  124  WCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVSCRKPGGIRFTINGFRYFNLVLISNV  183

Query  647  GGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAP  826
             G+GD+ KV V       W+ + RNWG+ W++N++L G++L+FRVT++D +  TS NV P
Sbjct  184  AGAGDIVKVWVKGS-RTGWMSMSRNWGQNWQSNSILVGQALSFRVTSSDRRTSTSWNVVP  242

Query  827  KSWQYGQTFEGRNCR  871
             +WQ+GQTF G+N R
Sbjct  243  ANWQFGQTFTGKNFR  257



>gb|AAY43797.1| expansin [Gossypium hirsutum]
Length=258

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 161/229 (70%), Gaps = 12/229 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GD   GW  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEY  532
            E++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+LQIAEY
Sbjct  90   ELRCNNDPQWCIS--RTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV +RRV C++KGG R+TM+GH +FN+V ++NVGG+GD++ V +    +  W+P+
Sbjct  148  RAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGS-KTGWLPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             RNWG+ W++NA  +G+SL+F+VT +D + +T+ NV P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYFNGQSLSFKVTASDSRTITNYNVVPAGWQFGQTFEG  255



>gb|AAO92741.1| expansin [Gossypium hirsutum]
Length=258

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 162/229 (71%), Gaps = 12/229 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GD   GW  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEY  532
            E++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+L+IAEY
Sbjct  90   ELRCNNDPQWCIS--RTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLRIAEY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV +RRV C++KGG R+TM+GH +FN+V ++NVGG+GD++ V +    +  W+P+
Sbjct  148  RAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKVS-KTGWLPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             RNWG+ W++NA L+G+SL+F+VT +D + +T+ NV P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYLNGQSLSFKVTASDSRTITNYNVVPAGWQFGQTFEG  255



>ref|XP_010528418.1| PREDICTED: expansin-A3 [Tarenaya hassleriana]
Length=264

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/262 (48%), Positives = 170/262 (65%), Gaps = 14/262 (5%)
 Frame = +2

Query  116  LIITAAMATELQASILLIVLCA-LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-  283
              IT  ++  + AS L+    A +P V+ G     W  AHATFYG  +  GT+GGACG  
Sbjct  6    FAITFRLSLAITASFLVASATARIPGVYTGGP---WQSAHATFYGGSDASGTMGGACGYG  62

Query  284  EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP----  451
              + + Y   T ALS ALFNN  SCGAC+EIKC      C      I VTAT+ CP    
Sbjct  63   NLYSQGYGVNTAALSTALFNNGLSCGACFEIKCTEDPKWCNPGNPSIFVTATNFCPPNFA  122

Query  452  --TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFN  625
              + DG WC PP+ HFDL+MP +L+IA+Y+AG+VPV +RRVPC +KGG RFT++G ++FN
Sbjct  123  QPSDDGGWCNPPRQHFDLAMPMFLKIAQYRAGIVPVSFRRVPCRKKGGIRFTINGFRYFN  182

Query  626  LVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAV  805
            LV ++NV G+GDV +  +    +  W+ + RNWG+ W++NA+  G+SL+FRVT +D +  
Sbjct  183  LVLITNVAGAGDVVRASIKGS-KTAWMSMSRNWGQNWQSNAVFVGQSLSFRVTASDRRTS  241

Query  806  TSQNVAPKSWQYGQTFEGRNCR  871
            TS NVAP +WQ+GQTF G+N R
Sbjct  242  TSFNVAPANWQFGQTFSGKNFR  263



>ref|XP_006294843.1| hypothetical protein CARUB_v10023894mg [Capsella rubella]
 gb|EOA27741.1| hypothetical protein CARUB_v10023894mg [Capsella rubella]
Length=257

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 174/261 (67%), Gaps = 20/261 (8%)
 Frame = +2

Query  134  MATELQASILLIVLCAL-----PCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQ  289
            MA +L       VL +L     P V+ G +   W +AHATFYG  +  GT+GGACG    
Sbjct  1    MAIKLAILFTTFVLFSLADARIPGVYSGGA---WQNAHATFYGGSDASGTMGGACGYGNL  57

Query  290  FKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------  451
            + + Y   T ALS ALFNN  SCGAC+E+KC N    C +    I++TAT+ CP      
Sbjct  58   YSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQP  117

Query  452  TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLV  631
            + +G WC PP+ HFDL+MP +L+IA+Y+AG+VPV YRRVPC ++GG RFT++GH++FNL+
Sbjct  118  SDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLI  177

Query  632  TVSNVGGSGDVSKVEVNAEGEEK-WVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVT  808
             ++NV G+GD+  V  N +G    W+ L RNWG+ W++NA+L G++L+FRVT +D +  T
Sbjct  178  LITNVAGAGDI--VRANVKGSRTGWMSLSRNWGQNWQSNAVLVGQALSFRVTGSDRRTST  235

Query  809  SQNVAPKSWQYGQTFEGRNCR  871
            S N+ P +WQ+GQTF G+N R
Sbjct  236  SWNMVPSNWQFGQTFVGKNFR  256



>ref|XP_007162798.1| hypothetical protein PHAVU_001G181600g [Phaseolus vulgaris]
 gb|ESW34792.1| hypothetical protein PHAVU_001G181600g [Phaseolus vulgaris]
Length=273

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 160/224 (71%), Gaps = 8/224 (4%)
 Frame = +2

Query  218  WLDAHATFYGPPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNST  394
            W  AHATFY     T GGACG  +  K+ Y   TTALS+ LF    +CGACYEIKC  S 
Sbjct  48   WKQAHATFYEGGSETFGGACGYGDVVKDGYGLDTTALSSILFKEGQTCGACYEIKCTKSG  107

Query  395  GQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVF  556
              CK  +  I+VTAT+LCP      + +G WC PP+ HFDL+ PAYL+IAEYKAG+VP+ 
Sbjct  108  VGCKAGKSSILVTATNLCPPNYDLPSDNGGWCNPPREHFDLAKPAYLKIAEYKAGIVPIQ  167

Query  557  YRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEK-WVPLKRNWGEK  733
            YRRVPC ++GG RFT++G+ +FNLV+V NVGGSG++++V V  E + K W  LKRNWG+K
Sbjct  168  YRRVPCKKEGGIRFTITGNPYFNLVSVWNVGGSGEITEVLVKGEEKVKNWTNLKRNWGQK  227

Query  734  WETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRN  865
            WE++ ML G++L+FRV  +DG+  TS  +APK W++GQTF G+N
Sbjct  228  WESDEMLVGETLSFRVKASDGRYTTSLRIAPKDWKFGQTFVGKN  271



>ref|XP_011075523.1| PREDICTED: expansin-A10 [Sesamum indicum]
Length=248

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 154/228 (68%), Gaps = 12/228 (5%)
 Frame = +2

Query  215  GWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCV  385
            GW+DAHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCG+CYEI+CV
Sbjct  24   GWIDAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIRCV  83

Query  386  NSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHFDLSMPAYLQIAEYKAGVV  547
            N    C      I+VTAT+ CP  +      G WC PP  HFDLS P +  IA+YKAG+V
Sbjct  84   NERRWCLP--GSIVVTATNFCPPNNALPNNAGGWCNPPLRHFDLSQPVFQHIAQYKAGIV  141

Query  548  PVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWG  727
            PV YRRVPC R+GG RFT++GH +FNLV ++NVGG+GDV  V +       W P+ RNWG
Sbjct  142  PVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGS-RTGWQPMSRNWG  200

Query  728  EKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
            + W+ NA L+G+SL+F+VTT++G+ V S N AP SW YGQTF G   R
Sbjct  201  QNWQNNAYLNGQSLSFKVTTSNGQTVVSYNAAPASWSYGQTFAGAQFR  248



>ref|NP_181500.1| expansin A4 [Arabidopsis thaliana]
 sp|O48818.1|EXPA4_ARATH RecName: Full=Expansin-A4; Short=AtEXPA4; AltName: Full=Alpha-expansin-4; 
Short=At-EXP4; Short=AtEx4; AltName: Full=Ath-ExpAlpha-1.6; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK95263.1|AF410277_1 At2g39700/F17A14.7 [Arabidopsis thaliana]
 gb|AAB97125.1| putative expansin [Arabidopsis thaliana]
 gb|AAL32761.1| putative expansin [Arabidopsis thaliana]
 gb|AAM13337.1| putative expansin [Arabidopsis thaliana]
 gb|AEC09708.1| expansin A4 [Arabidopsis thaliana]
Length=257

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/260 (47%), Positives = 172/260 (66%), Gaps = 18/260 (7%)
 Frame = +2

Query  134  MATELQASILLIVLCAL-----PCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQ  289
            MA +L       VL +L     P ++ G +   W +AHATFYG  +  GT+GGACG    
Sbjct  1    MAIKLAILFTTFVLFSLADARIPGIYSGGA---WQNAHATFYGGSDASGTMGGACGYGNL  57

Query  290  FKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------  451
            + + Y   T ALS ALFNN  SCGAC+E+KC N    C +    I++TAT+ CP      
Sbjct  58   YSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQP  117

Query  452  TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLV  631
            + +G WC PP+ HFDL+MP +L+IA+Y+AG+VPV YRRVPC ++GG RFT++GH++FNLV
Sbjct  118  SDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLV  177

Query  632  TVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTS  811
             ++NV G+GD+ +  V       W+ L RNWG+ W++NA+L G++L+FRVT +D +  TS
Sbjct  178  LITNVAGAGDIVRASVKGS-RTGWMSLSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  236

Query  812  QNVAPKSWQYGQTFEGRNCR  871
             N+ P +WQ+GQTF G+N R
Sbjct  237  WNMVPSNWQFGQTFVGKNFR  256



>ref|NP_001288907.1| expansin-A15-like precursor [Brassica rapa]
 gb|AGM16357.1| alpha-expansin protein 15 [Brassica rapa]
Length=253

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 163/247 (66%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttals  328
            I L+   A+     G  A GW++AHATFYG  +  GT+GGACG    + + Y   T ALS
Sbjct  11   IFLLGFAAMASSVHGYDA-GWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALS  69

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAH  490
             ALFNN  SCGAC+EI+C +    C      I+VTAT+ CP  +      G WC PP  H
Sbjct  70   TALFNNGLSCGACFEIRCQSDGAWCL--PGAIVVTATNFCPPNNALPNTAGGWCNPPLHH  127

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDLS P + +IA YKAGVVPV YRRVPC R+GG RFT++GH +FNLV V+NVGG+GDV  
Sbjct  128  FDLSQPIFQRIAHYKAGVVPVSYRRVPCKRRGGIRFTINGHSYFNLVLVTNVGGAGDVRS  187

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
            + V      KW P+ RNWG+ W++N +L+G++L+F+VT +DG+ V S NVAP SW +GQT
Sbjct  188  MAVKGS-RTKWQPMSRNWGQNWQSNNLLNGQALSFKVTASDGQTVVSNNVAPASWSFGQT  246

Query  851  FEGRNCR  871
            F GR  R
Sbjct  247  FTGRQFR  253



>ref|XP_008387521.1| PREDICTED: expansin-A9-like [Malus domestica]
Length=290

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 157/223 (70%), Gaps = 7/223 (3%)
 Frame = +2

Query  218  WLDAHATFYGPPEGTIGGACGLEQF-KETYSPYttalsaalfnnaasCGACYEIKCVNST  394
            W  AHAT Y    GT GGACG     KE Y   T ALS ALFN   SCGAC+EI+CV+S 
Sbjct  66   WKHAHATCYEGGSGTFGGACGYHDVVKEGYGLKTVALSDALFNKGQSCGACFEIRCVDSP  125

Query  395  GQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVF  556
              CK  Q  + VTAT+ CP      + +G WC  P+ HFD++ P +LQIAEYKAG+VPV 
Sbjct  126  QWCKPGQPVVSVTATNHCPPNYNLPSDNGGWCNSPREHFDIAKPIFLQIAEYKAGIVPVE  185

Query  557  YRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKW  736
            YRRVPC ++GG RFT++G+ +FN V V NVGGSGDV+ VEV  +G+  W PLKR WG++W
Sbjct  186  YRRVPCKKQGGIRFTITGNPYFNEVMVWNVGGSGDVTSVEVKGDGKLPWTPLKRMWGQRW  245

Query  737  ETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRN  865
             T+A L G+SL FRV  +DG+ +TS N+APK+WQ+GQT+EG+N
Sbjct  246  TTDAKLVGESLTFRVGESDGRTITSVNIAPKNWQFGQTYEGKN  288



>ref|NP_001242978.1| expansin-A4-like precursor [Glycine max]
 gb|AEV43316.1| expansin A5a [Glycine max]
Length=259

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 166/248 (67%), Gaps = 13/248 (5%)
 Frame = +2

Query  155  SILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttal  325
            S+  +V   +P V+   SA  W  AHATFYG  +  GT+GGACG    + + Y   T AL
Sbjct  15   SLTCMVQARIPGVY---SAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAAL  71

Query  326  saalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQA  487
            S ALFN+  SCGAC+EIKC N    C +    I +TAT+ CP        +G WC PP+ 
Sbjct  72   STALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRP  131

Query  488  HFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVS  667
            HFDL+MP +L+IAEY+AG+VPV YRRVPC + GG RFT++G ++FNLV +SNV G+GD+ 
Sbjct  132  HFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKHGGIRFTINGFRYFNLVLISNVAGAGDIV  191

Query  668  KVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQ  847
            +  V       W+P+ RNWG+ W++NA+L G++L+FRVT +D +  TS N+AP +WQ+GQ
Sbjct  192  RTYVKGT-RTGWMPMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNIAPPNWQFGQ  250

Query  848  TFEGRNCR  871
            TF G+N R
Sbjct  251  TFTGKNFR  258



>gb|AFZ78605.1| expansin protein [Populus tomentosa]
Length=247

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 159/242 (66%), Gaps = 14/242 (6%)
 Frame = +2

Query  161  LLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsa  331
            ++I+L  L  V G     GW  AHATFYG     GT+GGACG    + + Y   T ALS 
Sbjct  8    MVILLTMLKIVKG--YGTGWTGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALST  65

Query  332  alfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHF  493
            ALFNN  SCGACYEIKCVN    C   Q+ IIVTAT+ CP        DG WC PPQ HF
Sbjct  66   ALFNNGLSCGACYEIKCVNDNTWCL--QESIIVTATNFCPPNNALPNNDGGWCNPPQQHF  123

Query  494  DLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKV  673
            DLS P + +IA+YKAG+VPV YRRV C + GG RFT++GH +FNLV ++NVGG+GDV  V
Sbjct  124  DLSQPVFQKIAQYKAGIVPVQYRRVACRKSGGIRFTINGHSYFNLVLITNVGGAGDVVAV  183

Query  674  EVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTF  853
             +       W  + RNWG+ W++N  L+ ++L+FRVTT+DG+ V S NVAP +W +GQT+
Sbjct  184  SIKGT-TSNWQAMSRNWGQNWQSNTYLNNQALSFRVTTSDGRTVVSNNVAPSNWAFGQTY  242

Query  854  EG  859
             G
Sbjct  243  TG  244



>gb|ABB59694.1| alpha-expansin 2 [Gossypium hirsutum]
Length=252

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/253 (50%), Positives = 169/253 (67%), Gaps = 15/253 (6%)
 Frame = +2

Query  134  MATELQASILLIVLCALPCVFG--GDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKE  298
            MAT   ++  L+ +    C+ G  GD   GW   HATFYG     GT+GGACG    + +
Sbjct  1    MATSAVSATFLLFVFGF-CLRGAFGDYVGGWQGGHATFYGGGDASGTMGGACGYGNLYSQ  59

Query  299  TYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGD  460
             Y   T ALS ALFNN  SCG+CYE++C +    C      I VTAT+ CP        +
Sbjct  60   GYGTNTAALSTALFNNGLSCGSCYEMRCDSDPKWCL--PGSITVTATNFCPPNLALSNDN  117

Query  461  GKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVS  640
            G WC PP  HFDL+ PA+LQIA+Y+AG+VP+ +RRVPCM+KGG RFT++GH +FNLV ++
Sbjct  118  GGWCNPPLQHFDLAEPAFLQIAQYRAGIVPISFRRVPCMKKGGIRFTINGHSYFNLVLIT  177

Query  641  NVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNV  820
            NVGG+GDV  V +    +  W  + RNWG+ W++N+ L+G+SL+F+VTT+DG+ VTS NV
Sbjct  178  NVGGAGDVHSVSIKGS-KTGWQSMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVTSYNV  236

Query  821  APKSWQYGQTFEG  859
            AP +WQ+GQTFEG
Sbjct  237  APGNWQFGQTFEG  249



>gb|KHN26255.1| Expansin-A15 [Glycine soja]
Length=223

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 153/223 (69%), Gaps = 12/223 (5%)
 Frame = +2

Query  221  LDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNS  391
            +DAHATFYG     GT+GGACG    + + Y   T ALS ALFNN  SCGAC+EI+CVN 
Sbjct  1    MDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEIRCVND  60

Query  392  TGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHFDLSMPAYLQIAEYKAGVVPV  553
               C    + +IVTAT+ CP  +      G WC PP  HFDLS P + QIA+YKAG+VPV
Sbjct  61   QRWCLP--RSVIVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPIFQQIAQYKAGIVPV  118

Query  554  FYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEK  733
             YRRVPC+++GG RFT++GH +FNLV +SNVGG GD+  V +       W P+ RNWG+ 
Sbjct  119  AYRRVPCLKRGGIRFTINGHSYFNLVLISNVGGVGDIHAVSIKGS-RTNWQPMTRNWGQN  177

Query  734  WETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGR  862
            W++NA L+G+SL+F+VT +DG+ V S NVAP SW +GQTF G 
Sbjct  178  WQSNAYLNGQSLSFKVTASDGRTVVSNNVAPSSWSFGQTFNGH  220



>ref|XP_010033123.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
 gb|KCW52678.1| hypothetical protein EUGRSUZ_J02048 [Eucalyptus grandis]
Length=263

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 170/266 (64%), Gaps = 20/266 (8%)
 Frame = +2

Query  122  ITAAMATELQASILLIVLCA-------LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGA  274
            + AA    L  + L + L A       +P ++ G     W  AHATFYG  +  GT+GGA
Sbjct  1    MAAARVMALALAFLGVALSATRMAEARIPGIYTGGP---WQSAHATFYGGADASGTMGGA  57

Query  275  CGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP  451
            CG    + + Y   T ALS ALFNN  SCGAC+EIKC N    C +    I VTAT+ CP
Sbjct  58   CGYGNLYSQGYGVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSSSIFVTATNFCP  117

Query  452  ------TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGH  613
                  + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G 
Sbjct  118  PNYAQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGF  177

Query  614  QFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTND  793
            ++FNLV +SNV G+GD+ +V V       W+ + RNWG+ W++N++L G+SL+FRVT +D
Sbjct  178  RYFNLVLISNVAGAGDIVRVSVKGS-RTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSD  236

Query  794  GKAVTSQNVAPKSWQYGQTFEGRNCR  871
             +  TS N+ P  WQ+GQTF G+N R
Sbjct  237  RRTSTSWNIVPAGWQFGQTFTGKNFR  262



>ref|XP_002456550.1| hypothetical protein SORBIDRAFT_03g038290 [Sorghum bicolor]
 gb|EES01670.1| hypothetical protein SORBIDRAFT_03g038290 [Sorghum bicolor]
Length=252

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 161/239 (67%), Gaps = 13/239 (5%)
 Frame = +2

Query  170  VLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGLEQFKET-YSPYttalsaalf  340
              C L     GD   GW  AHATFYG     GT+GGACG      T Y   T ALS ALF
Sbjct  15   TFCFLAHRAAGDYG-GWQSAHATFYGGGDASGTMGGACGYGNMYSTGYGTNTAALSTALF  73

Query  341  nnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLS  502
            N+ A+CG+CYE++C N  GQ   P   I VTAT+ CP      + DG WC PP+ HFD++
Sbjct  74   NDGAACGSCYELRCDND-GQSCLPGT-ITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMA  131

Query  503  MPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVN  682
             PA+LQIA+Y+AG+VPV YRRVPC++KGG RFT++GH +FNLV V+NV G+GDV  V + 
Sbjct  132  QPAFLQIAQYRAGIVPVAYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVQSVSIK  191

Query  683  AEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
                  W P+ RNWG+ W++N++L G+SL+F+VT +DG+ VTS  VAP  WQ+GQTFEG
Sbjct  192  GS-STGWQPMSRNWGQNWQSNSLLDGQSLSFQVTASDGRTVTSNGVAPAGWQFGQTFEG  249



>gb|AEN70895.1| expansin [Gossypium mustelinum]
Length=259

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 171/264 (65%), Gaps = 21/264 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            +SVLI  ++M    +A I        P V+ G +   W +AHATFYG  +  GT+GGACG
Sbjct  7    ISVLIFISSMWMMGEARI--------PGVYSGGA---WQNAHATFYGGADASGTMGGACG  55

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC +    C +    I +TAT+ CP  
Sbjct  56   YGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPN  115

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                  +G WC PP+  FDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  116  YALPNDNGGWCNPPRTRFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  175

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV +SNV G+GD+ KV V       W+ + RNWG+ W++NA+L G+SL+FRVT +D +
Sbjct  176  FNLVLISNVAGAGDIVKVSVKGS-RTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRR  234

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P  WQ+GQTF G+N R
Sbjct  235  TSTSWNIVPAHWQFGQTFTGKNFR  258



>ref|XP_002309181.2| hypothetical protein POPTR_0006s10850g [Populus trichocarpa]
 gb|EEE92704.2| hypothetical protein POPTR_0006s10850g [Populus trichocarpa]
Length=254

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/254 (49%), Positives = 166/254 (65%), Gaps = 15/254 (6%)
 Frame = +2

Query  134  MATE-LQASILLIVLCALPCVFGGDSAH--GWLDAHATFYGPPE--GTIGGACGL-EQFK  295
            MAT+ +Q S+ L +      +F G      GW   HATFYG  +  GT+GGACG    + 
Sbjct  1    MATKAMQFSVFLQLFLVFSLLFHGTCGDRGGWQIGHATFYGGSDASGTMGGACGYGNLYS  60

Query  296  ETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TG  457
            + Y   T ALS ALFNN  SCGAC++I+C N    C +    I VTAT+ CP        
Sbjct  61   QGYGTSTAALSTALFNNGLSCGACFQIRCNNDPKWCHS--STITVTATNFCPPNYALAND  118

Query  458  DGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTV  637
            DG WC PP  HFDL+ PA+L+IA+Y+AG+VPV +RRVPC++KGG RFT++GH +FNLV +
Sbjct  119  DGGWCNPPLQHFDLAQPAFLKIAQYRAGIVPVLFRRVPCVKKGGIRFTINGHSYFNLVLI  178

Query  638  SNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQN  817
            +NV G+GDV  V V       W  + RNWG+ W++N+ L+G+SL+FRVT +DG  VTS N
Sbjct  179  TNVAGAGDVHAVSVKGS-RTGWQTMSRNWGQDWQSNSYLNGQSLSFRVTASDGTTVTSYN  237

Query  818  VAPKSWQYGQTFEG  859
            + P +WQ+GQTFEG
Sbjct  238  IVPANWQFGQTFEG  251



>ref|XP_011089478.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=260

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 172/264 (65%), Gaps = 17/264 (6%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            L+V++  A++ + LQ          +P V+ G    GW  AHATFYG  +  GT+GGACG
Sbjct  4    LAVIVCIASLISVLQPP----AEARIPGVYTGG---GWQTAHATFYGGSDASGTMGGACG  56

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC      C      I VTAT+ CP  
Sbjct  57   YGNLYSQGYGVNTAALSTALFNNGFSCGACFEIKCAMEKQWCHAGSPSIFVTATNFCPPN  116

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                  +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC +KGG RFT++G ++
Sbjct  117  YALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKKGGIRFTINGFRY  176

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV ++NV G+GD+ +V +       W+ + RNWG+ W++NA+L G+SL+FRVT +D +
Sbjct  177  FNLVLITNVAGAGDIVRVSIKGS-RTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRR  235

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+AP +WQ+GQTF G+N R
Sbjct  236  TSTSWNIAPSNWQFGQTFVGKNFR  259



>ref|XP_008387765.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=258

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 166/249 (67%), Gaps = 10/249 (4%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYtta  322
            AS+L + + A   + G  +   W  AHATFYG  +  GT+GGACG    + + Y   T A
Sbjct  10   ASLLSLFMAABARIPGVYTGGAWEGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  69

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQ  484
            LS ALFNN  SCGAC+EIKC +    C      I VTAT+ CP      + DG WC PP+
Sbjct  70   LSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSIFVTATNFCPPNFAQPSDDGGWCNPPR  129

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDL+MP +L+IAEYKAG+VPV YRRVPC ++GG RFT++G ++FNLV ++NV G+GD+
Sbjct  130  THFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLITNVAGAGDI  189

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
             +V V       W+P+ RNWG+ W++NA L G++L+FRVT +D +  TS NVAP  WQ+G
Sbjct  190  VRVSVKGA-NTGWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSLNVAPAHWQFG  248

Query  845  QTFEGRNCR  871
            QTF G+N R
Sbjct  249  QTFTGKNFR  257



>gb|AAM46997.1|AF512539_1 alpha-expansin precursor [Gossypium hirsutum]
Length=258

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 161/229 (70%), Gaps = 12/229 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GD   GW  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEY  532
            E++C N    C +  + I VTAT+ CP      + +G WC PP+ HFDL+ PA+L+IAEY
Sbjct  90   ELRCNNDPQWCIS--RTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLRIAEY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV +RRV C++KGG R+TM+GH +FN+V ++NVGG+GD++   +       W+P+
Sbjct  148  RAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSESIKGS-RTGWLPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
             RNWG+ W++NA L+G+SL+F+VT +DG+ +T+ NV P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEG  255



>ref|XP_010427324.1| PREDICTED: expansin-A16-like [Camelina sativa]
Length=260

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/247 (48%), Positives = 167/247 (68%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttals  328
            +L +    +P V+ G S   W  AHATFYG     GT+GGACG  + + + Y   T ALS
Sbjct  17   LLSLTEAGIPGVYSGSS---WQTAHATFYGGNDASGTMGGACGYGDLYSQGYGTNTAALS  73

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAH  490
             ALFN+  SCGAC+E+KCVN    C      + VTAT+ CP      + +G WC PP+AH
Sbjct  74   TALFNSGQSCGACFEVKCVNDPKWCHPGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRAH  133

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDL+MP++L+IA Y+AG+VP+ YRRV C + GG RFT++GH++FNLV ++NV G+GD+ +
Sbjct  134  FDLAMPSFLKIAAYRAGIVPISYRRVACKKSGGIRFTINGHRYFNLVLITNVAGAGDIVR  193

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
              V    +  W+ L RNWG+ W++N +L G++L+FRVT++D +  TS N+AP +WQ+GQT
Sbjct  194  ASVKGS-KTGWMSLTRNWGQNWQSNDVLVGQTLSFRVTSSDRRTSTSLNIAPSNWQFGQT  252

Query  851  FEGRNCR  871
            F G+N R
Sbjct  253  FVGKNFR  259



>ref|NP_001105040.1| alpha expansin1 precursor [Zea mays]
 gb|AAK56119.1|AF332169_1 alpha-expansin 1 [Zea mays]
 gb|ACG30766.1| alpha-expansin 10 precursor [Zea mays]
 gb|ACR38172.1| unknown [Zea mays]
 tpg|DAA57054.1| TPA: alpha expansin1 [Zea mays]
Length=253

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 161/238 (68%), Gaps = 12/238 (5%)
 Frame = +2

Query  173  LCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGLEQFKET-YSPYttalsaalfn  343
             C+L     G     W  AHATFYG     GT+GGACG      T Y   T ALS ALFN
Sbjct  16   FCSLAHRAAGVDYGSWQSAHATFYGGGDASGTMGGACGYGNMYSTGYGTNTAALSTALFN  75

Query  344  naasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSM  505
            + A+CG+CYE++C N+ GQ   P   I VTAT+ CP      + DG WC PP+ HFD++ 
Sbjct  76   DGAACGSCYELRCDNN-GQSCLPGT-ITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAQ  133

Query  506  PAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNA  685
            PA+LQIA+Y+AG+VPV YRRVPC++KGG RFT++GH +FNLV V+NV G+GDV  V +  
Sbjct  134  PAFLQIAQYRAGIVPVAYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVQSVSIKG  193

Query  686  EGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
                 W P+ RNWG+ W++N++L G+SL+F+VT +DG+ VTS  VAP  WQ+GQTFEG
Sbjct  194  S-STGWQPMSRNWGQNWQSNSLLDGQSLSFQVTASDGRTVTSNGVAPAGWQFGQTFEG  250



>ref|XP_010093601.1| hypothetical protein L484_006489 [Morus notabilis]
 gb|EXB54329.1| hypothetical protein L484_006489 [Morus notabilis]
Length=251

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/252 (49%), Positives = 164/252 (65%), Gaps = 13/252 (5%)
 Frame = +2

Query  134  MATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETY  304
            MA  L   I+ I   ++  +F      GW DAHATFYG     GT+GGACG    + + Y
Sbjct  1    MAANLVVFIMAIGFPSMG-LFAHGYGEGWSDAHATFYGGGDASGTMGGACGYGNLYSQGY  59

Query  305  SPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GK  466
               T ALS ALFNN  SCGAC+EIKCV+    C      ++VTAT+ CP  +      G 
Sbjct  60   GTNTAALSTALFNNGMSCGACFEIKCVSDPKWCLP--GSVVVTATNFCPPNNALPNNAGG  117

Query  467  WCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNV  646
            WC PPQ HFDLS P + QIA+Y+AG+VP+ YRRVPC ++GG RFT++GH +FNLV ++NV
Sbjct  118  WCNPPQQHFDLSQPVFQQIAQYRAGIVPISYRRVPCRKRGGIRFTINGHSYFNLVLITNV  177

Query  647  GGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAP  826
            GG+GDV  V +       W P+ RNWG+ W++N+ L+G+SL+F+VTT+DG+ + S NV P
Sbjct  178  GGAGDVHTVSIKGS-RTGWQPMSRNWGQNWQSNSYLNGQSLSFKVTTSDGRTIVSNNVVP  236

Query  827  KSWQYGQTFEGR  862
              W +GQTF G+
Sbjct  237  AGWSFGQTFTGQ  248



>ref|XP_009761115.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=260

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/247 (50%), Positives = 164/247 (66%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttals  328
             LL V   +P V+ G S   W  AHATFYG  +  GT+GGACG    + + Y     ALS
Sbjct  17   FLLTVEARIPGVYSGGS---WQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALS  73

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAH  490
             ALFNN  SCGAC+EIKC N    C      I++TAT+ CP        +G WC PP+ H
Sbjct  74   TALFNNGLSCGACFEIKCDNQPQWCHAGSPSILITATNFCPPNYALPNDNGGWCNPPRPH  133

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNLV V+NV G+GD+ K
Sbjct  134  FDLAMPMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVK  193

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
            + V       W+ + RNWG+ W+TN++L G++L+FRVT +D +  TS N+AP  WQ+GQT
Sbjct  194  LMVKGS-RTGWITMSRNWGQNWQTNSVLVGQALSFRVTASDRRKSTSWNIAPAHWQFGQT  252

Query  851  FEGRNCR  871
            F G+N R
Sbjct  253  FVGKNFR  259



>ref|XP_011048141.1| PREDICTED: expansin-A15-like [Populus euphratica]
Length=247

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 126/243 (52%), Positives = 161/243 (66%), Gaps = 14/243 (6%)
 Frame = +2

Query  161  LLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsa  331
            ++I+L  L  V G     GW  AHATFYG     GT+GGACG    + + Y   T ALS 
Sbjct  8    IVILLTMLKIVKG--YGTGWTGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALST  65

Query  332  alfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHF  493
            ALFNN  SCGACYEIKCVN    C   +  IIVTAT+ CP        DG WC PPQ HF
Sbjct  66   ALFNNGLSCGACYEIKCVNDNIWCL--RGSIIVTATNFCPPNNALPNNDGGWCNPPQQHF  123

Query  494  DLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKV  673
            DLS P + +IA+YKAG+VPV YRRV C + GG RFT++GH +FNLV ++NVGG+GDV  V
Sbjct  124  DLSQPVFQKIAQYKAGIVPVQYRRVACRKSGGIRFTINGHSYFNLVLITNVGGAGDVVAV  183

Query  674  EVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTF  853
             +    +  W  + RNWG+ W++NA L+ ++L+F+VTT+DG+ V S NVAP +W +GQT+
Sbjct  184  SIKGT-KSNWQAMSRNWGQNWQSNAYLNNQALSFKVTTSDGRTVVSNNVAPSNWAFGQTY  242

Query  854  EGR  862
             GR
Sbjct  243  TGR  245



>ref|XP_007009225.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY18035.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=259

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 165/247 (67%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttals  328
            IL+ V   +P V+ G     W  AHATFYG  +  GT+GGACG    + + Y   T ALS
Sbjct  16   ILVAVEARIPGVYSGAE---WQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  72

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAH  490
             ALFNN  SCGAC+EIKC N    C      I VTAT+ CP      + +G WC PP+ H
Sbjct  73   TALFNNGLSCGACFEIKCANEPQWCHAGSPSIFVTATNFCPPNYALPSDNGGWCNPPRPH  132

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNLV ++NV G+GD+ K
Sbjct  133  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVK  192

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
              V    +  W+ L RNWG+ W++NA+L G+SL+FRVT +D +  TS N+ P +WQ+GQT
Sbjct  193  ASVKGS-KTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQT  251

Query  851  FEGRNCR  871
            F G+N R
Sbjct  252  FTGKNFR  258



>ref|XP_007205762.1| hypothetical protein PRUPE_ppa010314mg [Prunus persica]
 gb|EMJ06961.1| hypothetical protein PRUPE_ppa010314mg [Prunus persica]
Length=254

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 157/224 (70%), Gaps = 12/224 (5%)
 Frame = +2

Query  215  GWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCV  385
            GW  AHATFYG     GT+GGACG    + + Y   T ALS ALFNN  SCG+CYE++C 
Sbjct  31   GWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRCN  90

Query  386  NSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVV  547
            N    C+     IIVTAT+ CP        +G WC PP  HFDL+ PA+LQIA+Y+AG+V
Sbjct  91   NDPRWCRP--GSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  148

Query  548  PVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWG  727
            PV +RRVPCM+KGG RFT++GH +FNLV ++NVGG+GDV  V +       W P+ RNWG
Sbjct  149  PVTFRRVPCMKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGS-RTGWQPMSRNWG  207

Query  728  EKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
            + W++N  L+G+SL+F+VTT+DG+ VTS NVAP +WQ+GQTF G
Sbjct  208  QNWQSNTYLNGQSLSFQVTTSDGRTVTSYNVAPGNWQFGQTFSG  251



>ref|XP_002315043.1| expansin 4 family protein [Populus trichocarpa]
 ref|XP_006378591.1| hypothetical protein POPTR_0010s17440g [Populus trichocarpa]
 gb|ABK96086.1| unknown [Populus trichocarpa]
 gb|EEF01214.1| expansin 4 family protein [Populus trichocarpa]
 gb|ERP56388.1| hypothetical protein POPTR_0010s17440g [Populus trichocarpa]
Length=249

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 161/249 (65%), Gaps = 12/249 (5%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYtta  322
            A I L+   A+     G    GW++AHATFYG     GT+GGACG    + + Y   T A
Sbjct  4    AGIFLVGFLAMVSSVYGYGGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAA  63

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQ  484
            LS ALFN+  SCG+CYEI+CVN    C      I++TAT+ CP  +      G WC PPQ
Sbjct  64   LSTALFNSGLSCGSCYEIRCVNDPKWCL--PGSIVITATNFCPPNNALPNNAGGWCNPPQ  121

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDLS P +  IA+++AG+VPV YRRVPC R+GG RFT++GH +FNLV ++NVGG+GDV
Sbjct  122  HHFDLSQPVFQHIAQFRAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDV  181

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
              V +       W P+ RNWG+ W++N  L+G+SL+F+VTT+DG+ V S N AP SW +G
Sbjct  182  HSVSIKGS-RTGWQPMSRNWGQNWQSNNYLNGQSLSFKVTTSDGRTVVSYNAAPSSWSFG  240

Query  845  QTFEGRNCR  871
            QTF G   R
Sbjct  241  QTFSGAQFR  249



>ref|XP_008367551.1| PREDICTED: expansin-A1-like [Malus domestica]
Length=250

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 160/236 (68%), Gaps = 13/236 (6%)
 Frame = +2

Query  182  LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaa  352
              C +GG    GW+DAHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  
Sbjct  17   FACGYGGGDX-GWVDAHATFYGGGDAXGTMGGACGYGNLYSQGYGTNTAALSTALFNNGL  75

Query  353  sCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHFDLSMPAY  514
            SCGAC+EI+CV+    C      I+VTAT+ CP  D      G WC PPQ HFDL+ P +
Sbjct  76   SCGACFEIRCVSDPKWCLP--GSIMVTATNFCPPNDALPNNAGGWCNPPQHHFDLAQPVF  133

Query  515  LQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGE  694
             QIA+Y+AG+VPV YRRVPC++KGG RFT++GH +FNLV ++NVGG+GDV  V +     
Sbjct  134  QQIAQYRAGIVPVSYRRVPCLKKGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGS-R  192

Query  695  EKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGR  862
              W P+ RNWG+ W++N+ L+G+SL+F+VT +DG+ + S NV P  W +GQTF G+
Sbjct  193  TGWQPMSRNWGQNWQSNSFLNGQSLSFKVTXSDGRTIVSNNVVPAGWSFGQTFSGQ  248



>ref|XP_006435913.1| hypothetical protein CICLE_v10032524mg [Citrus clementina]
 gb|ESR49153.1| hypothetical protein CICLE_v10032524mg [Citrus clementina]
Length=254

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 127/255 (50%), Positives = 167/255 (65%), Gaps = 16/255 (6%)
 Frame = +2

Query  128  AAMATELQASILLIVLCALPCVFG--GDSAHGWLDAHATFYG--PPEGTIGGACGL-EQF  292
            A +A     ++LL VL    C  G  GD   GW   HATFYG     GT+GGACG    +
Sbjct  2    ANIAASSSVALLLFVLNF--CFRGTFGDYGGGWQSGHATFYGGGDASGTMGGACGYGNLY  59

Query  293  KETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------T  454
             + Y   T ALS ALFNN  SCG+CYE+KC N    C      IIVTAT+ CP       
Sbjct  60   SQGYGTNTAALSTALFNNGLSCGSCYEMKCENDPKWCLP--GSIIVTATNFCPPNLALSN  117

Query  455  GDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVT  634
             +G WC PP  HFD++ PA+LQIA+Y+AG+VP+ +RR+PC +KGG RFT++GH +FNLV 
Sbjct  118  DNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVL  177

Query  635  VSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQ  814
            V+NVGG+GDV  V +    +  W  + RNWG+ W++N+ L+G+SL+F+VT +DG+ VTS 
Sbjct  178  VTNVGGAGDVHSVSIKGS-KTGWQAMSRNWGQNWQSNSYLNGQSLSFQVTASDGRTVTSN  236

Query  815  NVAPKSWQYGQTFEG  859
            NV P +WQ+GQTFEG
Sbjct  237  NVVPANWQFGQTFEG  251



>ref|XP_004249536.1| PREDICTED: expansin-A6-like [Solanum lycopersicum]
Length=257

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 122/249 (49%), Positives = 165/249 (66%), Gaps = 11/249 (4%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGLEQFKET-YSPYtta  322
            AS+L  +      V G  +A  W  AHATFYG  +  GT+GGACG      T Y     A
Sbjct  10   ASLLSFLTIVESKVRGVYTAGPWQSAHATFYGGSDASGTMGGACGYGNLYSTGYGVNNAA  69

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQ  484
            LS  LFN+  SCGAC+EIKC +    C      I VT T+ CP        +G WC PP+
Sbjct  70   LSTVLFNSGLSCGACFEIKCTDEK-WCNPGNPSIFVTGTNFCPPNYALPNDNGGWCNPPR  128

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDLSMP +LQIA+Y+AG+VPV YRRVPC ++GG RFT++G  +FN++ V+NV G+GD+
Sbjct  129  PHFDLSMPVFLQIAQYRAGIVPVTYRRVPCKKQGGIRFTINGFNYFNMIIVTNVAGAGDI  188

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
             +V+V      KW+ + RNWG+ W++NAML+G++L+F+V T+D + VTS NVAP +WQ+G
Sbjct  189  QQVQVKGT-NTKWIIMSRNWGQNWQSNAMLTGQALSFKVKTSDHRYVTSYNVAPSNWQFG  247

Query  845  QTFEGRNCR  871
            QT+EG+N R
Sbjct  248  QTYEGKNYR  256



>ref|XP_010532011.1| PREDICTED: expansin-A4-like [Tarenaya hassleriana]
Length=261

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 169/260 (65%), Gaps = 18/260 (7%)
 Frame = +2

Query  143  ELQASILLIVLCALPCVF--------GGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQ  289
            E++  ILL  L      F        G  S   W  AHATFYG     GT+GGACG    
Sbjct  2    EMRQRILLNTLPLFVLFFSFADARIPGVYSGGAWQSAHATFYGGNDASGTMGGACGYGNL  61

Query  290  FKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------  451
            + + Y   T ALS ALFNN  SCGAC+EIKC +    C +    I +TAT+ CP      
Sbjct  62   YSQGYGVNTAALSTALFNNGFSCGACFEIKCADDPQWCHSGSPSIFITATNFCPPNFAQP  121

Query  452  TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLV  631
            + +G WC PP+AHFDL+MP +L++AEY+AG+VPV YRRVPC ++GG RFT++GH++FNLV
Sbjct  122  SDNGGWCNPPRAHFDLAMPMFLKLAEYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLV  181

Query  632  TVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTS  811
             ++NV G+GD+ +  V    +  W+ + RNWG+ W++NA+L+G+SL+FRVT +D ++ TS
Sbjct  182  LITNVAGAGDIVRASVKGS-KTGWMSMSRNWGQNWQSNAVLAGQSLSFRVTGSDRRSSTS  240

Query  812  QNVAPKSWQYGQTFEGRNCR  871
             N+ P  WQ+GQTF G+N R
Sbjct  241  WNIVPSHWQFGQTFVGKNFR  260



>gb|AEN70900.1| expansin [Gossypium tomentosum]
Length=259

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 171/264 (65%), Gaps = 21/264 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            +SVLI  ++M    +A I        P V+ G +   W +AHAT YG  +  GT+GGACG
Sbjct  7    ISVLIFISSMWMMGEARI--------PGVYSGGA---WQNAHATLYGGADASGTMGGACG  55

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC +    C +    I +TAT+ CP  
Sbjct  56   YGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPN  115

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                  +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  116  YALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  175

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV +SNV G+GD+ KV V       W+ + RNWG+ W++NA+L G+SL+FRVT +D +
Sbjct  176  FNLVLISNVAGAGDIVKVSVKGS-RTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRR  234

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P  WQ+GQTF G+N R
Sbjct  235  TSTSWNIVPAHWQFGQTFTGKNFR  258



>emb|CDY69611.1| BnaCnng64440D [Brassica napus]
Length=258

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 173/256 (68%), Gaps = 14/256 (5%)
 Frame = +2

Query  134  MATELQASILLIVLCA-LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKET  301
            +A    A +L  +  A +P V+ G +   W +AHATFYG  +  GT+GGACG    + + 
Sbjct  6    LAILFTAYLLFNLADARIPGVYSGGA---WQNAHATFYGGSDASGTMGGACGYGNLYSQG  62

Query  302  YSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDG  463
            Y   T ALS ALFNN  SCGAC+E+KC N    C +    I++TAT+ CP      + +G
Sbjct  63   YGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNG  122

Query  464  KWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSN  643
             WC PP+ HFDL+MP +L+IA+Y+AG+VPV YRRVPC ++GG RFT++GH++FNLV ++N
Sbjct  123  GWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITN  182

Query  644  VGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVA  823
            V G+GD+ +  V    +  W+ L RNWG+ W++NA+L G+SL+FRVT +D +  TS ++ 
Sbjct  183  VAGAGDIVRTSVKGS-KTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWSIV  241

Query  824  PKSWQYGQTFEGRNCR  871
            P +WQ+GQTF G+N R
Sbjct  242  PSNWQFGQTFVGKNFR  257



>ref|XP_004304289.1| PREDICTED: expansin-A15-like [Fragaria vesca subsp. vesca]
Length=243

 Score =   228 bits (582),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 161/241 (67%), Gaps = 8/241 (3%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttals  328
            ILL+   ++     G    GW +AHATFYG     GT+GGACG    + + Y   T ALS
Sbjct  7    ILLVGFMSMFSSVNGYYYSGWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALS  66

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGDGKWCAPPQAHFDLSMP  508
             ALFNN  SCGACYE++CVN    C      I+VTAT+ CP   G WC PPQ HFDLS P
Sbjct  67   TALFNNGLSCGACYELRCVNDPQWCLP--GTIVVTATNFCP--PGGWCDPPQQHFDLSQP  122

Query  509  AYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAE  688
             +L+IA+Y+AGVVPV YRRV C R GG RFT++GH +FNLV V+NVGG+GDV  V +   
Sbjct  123  VFLKIAQYRAGVVPVSYRRVRCRRAGGIRFTINGHSYFNLVLVTNVGGAGDVQSVAIKGS  182

Query  689  GEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNC  868
               +W  + RNWG+ W++N+ L+G+SL+F VTT+DG+ + S NVAP +W +GQT+ GR  
Sbjct  183  -RTRWQMMSRNWGQNWQSNSYLNGQSLSFLVTTSDGRKLVSYNVAPPNWSFGQTYTGRQY  241

Query  869  R  871
            R
Sbjct  242  R  242



>ref|NP_001288961.1| expansin-A4 precursor [Brassica rapa]
 gb|AGM16346.1| alpha-expansin protein 4 [Brassica rapa]
Length=258

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 173/256 (68%), Gaps = 14/256 (5%)
 Frame = +2

Query  134  MATELQASILLIVLCA-LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKET  301
            +A    A +L  +  A +P V+ G +   W +AHATFYG  +  GT+GGACG    + + 
Sbjct  6    LAILFTAYLLFNLADARIPGVYSGGA---WQNAHATFYGGSDASGTMGGACGYGNLYSQG  62

Query  302  YSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDG  463
            Y   T ALS ALFNN  SCGAC+E+KC N    C +    I++TAT+ CP      + +G
Sbjct  63   YGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNG  122

Query  464  KWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSN  643
             WC PP+ HFDL+MP +L+IA+Y+AG+VPV YRRVPC ++GG RFT++GH++FNLV ++N
Sbjct  123  GWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITN  182

Query  644  VGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVA  823
            V G+GD+ +  V    +  W+ L RNWG+ W++NA+L G+SL+FRVT +D +  TS ++ 
Sbjct  183  VAGAGDIVRTSVKGS-KTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWSIV  241

Query  824  PKSWQYGQTFEGRNCR  871
            P +WQ+GQTF G+N R
Sbjct  242  PSNWQFGQTFVGKNFR  257



>gb|AEQ55274.1| expansin [Breonia chinensis]
 gb|AEQ55289.1| expansin [Breonia chinensis]
Length=256

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 169/250 (68%), Gaps = 14/250 (6%)
 Frame = +2

Query  152  ASILLIVLCA-LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYtt  319
            AS+L +V  A +P V+ G S   W  AHATFYG  +  GT+GGACG    + + Y   T 
Sbjct  10   ASVLALVAEARIPGVYTGGS---WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTG  66

Query  320  alsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPP  481
            ALS ALFN+  SCGAC+E+KC N  G C      I +TAT+ CP        +G WC PP
Sbjct  67   ALSTALFNSGLSCGACFELKCANDPGWCHPGSPSIFITATNFCPPNYALPNDNGGWCNPP  126

Query  482  QAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGD  661
            + HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNLV V+NV G+GD
Sbjct  127  RPHFDLAMPMFLKIAEYRAGIVPVNYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGD  186

Query  662  VSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQY  841
            + +V V       W+ + RNWG+ W+TN++L G+SL+FRVT +D ++ TS N+ P  WQ+
Sbjct  187  IVRVFVKGS-RTGWISMSRNWGQNWQTNSVLVGQSLSFRVTASDRRSSTSWNMVPAHWQF  245

Query  842  GQTFEGRNCR  871
            GQTF G+N R
Sbjct  246  GQTFVGKNFR  255



>ref|XP_010502317.1| PREDICTED: expansin-A15 [Camelina sativa]
Length=253

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 163/247 (66%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttals  328
            IL++   A+ C   G  A GW++AHATFYG  +  GT+GGACG    + + Y   T ALS
Sbjct  11   ILVLCFAAMVCSVHGYDA-GWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALS  69

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAH  490
             ALFNN  SCGAC+EIKC +    C      I+VTAT+ CP  +      G WC PP  H
Sbjct  70   TALFNNGLSCGACFEIKCQSDGAWCLP--GAIVVTATNFCPPNNALPNNAGGWCNPPLHH  127

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDLS P + +IA YKAGVVPV YRRVPC R+GG RFT++GH +FNLV V+NVGG+GDV  
Sbjct  128  FDLSQPIFQRIAHYKAGVVPVSYRRVPCKRRGGIRFTINGHSYFNLVLVTNVGGAGDVHS  187

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
            V V      +W  + RNWG+ W++N +L+G++L+F+V  +DG+ V S N+AP SW +GQT
Sbjct  188  VAVKGS-RTRWQQMSRNWGQNWQSNNLLNGQALSFKVVASDGRTVVSNNIAPASWSFGQT  246

Query  851  FEGRNCR  871
            F GR  R
Sbjct  247  FTGRQFR  253



>dbj|BAC67192.1| expansin [Pyrus communis]
Length=253

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/246 (51%), Positives = 160/246 (65%), Gaps = 15/246 (6%)
 Frame = +2

Query  161  LLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsa  331
            LL +L A    +GG    GW++A ATFYG     GT+GGACG    + + Y   T ALS 
Sbjct  14   LLAMLVASAHAYGGG---GWVNARATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALST  70

Query  332  alfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHF  493
            ALFNN   CG+CYEI+CVN    C      I+VTAT+ CP  +      G WC PPQ HF
Sbjct  71   ALFNNGLGCGSCYEIRCVNDPKWCL--PGSIVVTATNFCPPNNALPNNAGGWCNPPQHHF  128

Query  494  DLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKV  673
            DLS P +  IA+YKAGVVPV YRRVPCMR+GG RFT++GH +FNLV ++NVGG+GDV  V
Sbjct  129  DLSQPVFQHIAQYKAGVVPVSYRRVPCMRRGGIRFTINGHSYFNLVLITNVGGAGDVHSV  188

Query  674  EVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTF  853
             V       W  + RNWG+ W++N+ L+G++L+F+VTT+DG+ V S N AP  W +GQT+
Sbjct  189  SVKGS-RTGWQAMSRNWGQNWQSNSYLNGQALSFKVTTSDGRTVVSYNAAPAGWSFGQTY  247

Query  854  EGRNCR  871
             G   R
Sbjct  248  SGAQLR  253



>dbj|BAH36863.1| alpha expansin [Rosa hybrid cultivar]
Length=242

 Score =   228 bits (582),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 161/241 (67%), Gaps = 8/241 (3%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttals  328
            ILLI   ++     G    GW +AHATFYG     GT+GGACG    + + Y   T ALS
Sbjct  6    ILLIGFVSVLSSVNGYYYAGWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALS  65

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGDGKWCAPPQAHFDLSMP  508
             ALFNN  +CGACYE++CVN    C      I+VTAT+ CP   G WC PPQ HFDLS P
Sbjct  66   TALFNNGLTCGACYELRCVNDPQWCLP--GTIVVTATNFCP--PGGWCDPPQQHFDLSQP  121

Query  509  AYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAE  688
             +L+IA+Y+AGVVPV YRRV C R GG RFT++GH +FNLV V+NVGG+GDV  V +   
Sbjct  122  VFLKIAQYRAGVVPVSYRRVRCRRAGGIRFTVNGHSYFNLVLVTNVGGAGDVQSVAIKGS  181

Query  689  GEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNC  868
               +W  + RNWG+ W++N+ L+G+SL+F VTT+DG+ + S NVAP +W +GQT+ GR  
Sbjct  182  -RTRWQLMSRNWGQNWQSNSYLNGQSLSFLVTTSDGRKLVSYNVAPPNWSFGQTYTGRQY  240

Query  869  R  871
            R
Sbjct  241  R  241



>gb|ACM90160.1| expansin 2 [Pyrus pyrifolia]
Length=251

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 161/242 (67%), Gaps = 16/242 (7%)
 Frame = +2

Query  161  LLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsa  331
            +L +L A    +GG    GW++A ATFYG     GT+GGACG    + + Y   T AL  
Sbjct  14   ILAMLVASAHAYGG----GWVNARATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALDT  69

Query  332  alfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHF  493
            ALFNN   CG+CYEI+CVN    C      I+VTAT+ CP  +      G WC PPQ HF
Sbjct  70   ALFNNGLGCGSCYEIRCVNDPKWCLP--GSIVVTATNFCPPNNALPNNAGGWCNPPQHHF  127

Query  494  DLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKV  673
            DLS P +  IA+YKAGVVPV YRRVPC R+GG RFT++GH +FNLV ++NV G+GDV  V
Sbjct  128  DLSQPIFQHIAQYKAGVVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVAGAGDVHSV  187

Query  674  EVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTF  853
             +       W P+ RNWG+ W++N+ L+G++L+F+VTT+DG+ VTS NVAP +WQ+GQTF
Sbjct  188  SIKGS-RTGWQPMSRNWGQNWQSNSYLNGQALSFQVTTSDGRTVTSYNVAPGNWQFGQTF  246

Query  854  EG  859
             G
Sbjct  247  SG  248



>ref|XP_011031225.1| PREDICTED: expansin-A4-like [Populus euphratica]
Length=258

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 162/239 (68%), Gaps = 13/239 (5%)
 Frame = +2

Query  182  LPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaa  352
            +P V+ G +   W  AHATFYG     GT+GGACG    + + Y   T ALS ALFNN  
Sbjct  23   IPGVYTGAA---WQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  353  sCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAY  514
            SCGAC+EIKC N    C +    I +TAT+ CP      + +G WC PP+ HFDL+MP +
Sbjct  80   SCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  139

Query  515  LQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGE  694
            L+IAEY+AG+VPV YRRVPC + GG RFT++GH++FNLV ++NV G+GD+ KV V     
Sbjct  140  LKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGHRYFNLVLITNVAGAGDIVKVSVKGS-R  198

Query  695  EKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
              W+ + RNWG+ W++N++L G+SL+FRVT +D +  TS NV P +WQ+GQTF G+N R
Sbjct  199  TGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNVVPSNWQFGQTFAGKNFR  257



>emb|CDY02943.1| BnaC04g25430D [Brassica napus]
Length=260

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 160/234 (68%), Gaps = 10/234 (4%)
 Frame = +2

Query  197  GGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaasCGAC  367
            G  S   W  AHATFYG  +  GT+GGACG    + + Y   T ALS ALFN   +CGAC
Sbjct  27   GAYSGSSWQTAHATFYGGDDASGTMGGACGYGNLYSQGYGTNTAALSTALFNTGLTCGAC  86

Query  368  YEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAE  529
            +EIKCVN    C +    + VTAT+ CP      + +G WC PP+AHFDL+MP +L+IA+
Sbjct  87   FEIKCVNDPKWCHSGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRAHFDLAMPVFLRIAQ  146

Query  530  YKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVP  709
            Y+AG+VP+ YRRV C + GG RFT++GH++FNLV ++NV G+GD+++  V    +  W+ 
Sbjct  147  YRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIARASVKGS-KTGWMG  205

Query  710  LKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
            L RNWG+ W++N +L G+SL+FRVTT+D +  TS N+ P +WQ+GQTF G+N R
Sbjct  206  LTRNWGQNWQSNTVLVGQSLSFRVTTSDRRTSTSWNIVPSNWQFGQTFVGKNFR  259



>dbj|BAE06067.1| expansin [Sagittaria pygmaea]
Length=266

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 164/246 (67%), Gaps = 13/246 (5%)
 Frame = +2

Query  161  LLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsa  331
            + IV   +P V+ G     W  AHATFYG  +  GT+GGACG    + + Y   T ALS 
Sbjct  24   VFIVDARVPGVYSGSE---WQQAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALST  80

Query  332  alfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHF  493
            ALFN   SCGAC+EIKC N    C      I +TAT+ CP      + +G WC PP+ HF
Sbjct  81   ALFNQGLSCGACFEIKCANDPQWCHGGGPSIFITATNFCPPNYALPSDNGGWCNPPRPHF  140

Query  494  DLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKV  673
            DL+MP +L+IA+Y+AG+VPV YRRVPC + GG RFT++GH++FNLV ++NV G+GD+ +V
Sbjct  141  DLAMPMFLKIAQYRAGIVPVQYRRVPCRKSGGIRFTINGHRYFNLVLITNVAGAGDIVRV  200

Query  674  EVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTF  853
             V    +  W+P+ RNWG+ W++NA+L G++L+FRVT +D +  TS NV P +W +GQTF
Sbjct  201  SVKGT-KTGWMPMSRNWGQNWQSNAVLVGQALSFRVTGSDHRTSTSWNVVPANWNFGQTF  259

Query  854  EGRNCR  871
             G+N R
Sbjct  260  SGKNFR  265



>ref|XP_008384848.1| PREDICTED: expansin-A4 [Malus domestica]
Length=260

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 174/264 (66%), Gaps = 14/264 (5%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            + V+ ++ ++A+ L  S++ +    +P V+ G +   W  AHATFYG  +  GT+GGACG
Sbjct  1    MGVVSVSTSIAS-LIISLMWVAEARIPGVYTGGA---WQGAHATFYGGSDASGTMGGACG  56

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+E+KC      C      I +TAT+ CP  
Sbjct  57   YGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCAEDPSWCHAGSPSIFITATNFCPPN  116

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  117  FAQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  176

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV +SNV G+GD+ KV V       W+ + RNWG+ W++N++L G+SL+FRVT +D +
Sbjct  177  FNLVLISNVAGAGDIVKVSVKGA-RTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRR  235

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P  WQ+GQTF G+N R
Sbjct  236  TSTSWNIVPAHWQFGQTFTGKNFR  259



>gb|KDP44940.1| hypothetical protein JCGZ_01440 [Jatropha curcas]
Length=258

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 168/250 (67%), Gaps = 17/250 (7%)
 Frame = +2

Query  161  LLIVL----CALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYtt  319
            LL+VL      +P V+ G S   W  AHATFYG  +  GT+GGACG    + + Y   T 
Sbjct  12   LLLVLKLADARIPGVYSGGS---WESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTA  68

Query  320  alsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPP  481
            ALS ALFNN  SCGAC+EIKC N    C +    I +TAT+ CP      + +G WC PP
Sbjct  69   ALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPP  128

Query  482  QAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGD  661
            + HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNLV ++NV G+GD
Sbjct  129  RPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGD  188

Query  662  VSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQY  841
            + K  V    +  W+ L RNWG+ W++NA+L G+SL+FRVT +D +  TS N+ P +WQ+
Sbjct  189  IVKASVKGS-KTGWMSLSRNWGQNWQSNAILVGQSLSFRVTGSDRRTSTSWNIVPANWQF  247

Query  842  GQTFEGRNCR  871
            GQTF G+N R
Sbjct  248  GQTFTGKNFR  257



>gb|KDP31268.1| hypothetical protein JCGZ_11644 [Jatropha curcas]
Length=248

 Score =   228 bits (582),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 123/247 (50%), Positives = 162/247 (66%), Gaps = 13/247 (5%)
 Frame = +2

Query  146  LQASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYt  316
            L + + L+   +L     GD+  GW++AHATFYG     GT+GGACG    + + Y   T
Sbjct  3    LISGLFLVGFLSLISFVSGDNG-GWVNAHATFYGGGDASGTMGGACGYGNLYNQGYGTNT  61

Query  317  talsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAP  478
             ALS ALFNN  SCGAC+EIKC +    C      I+VTAT+ CP  +      G WC P
Sbjct  62   AALSTALFNNGFSCGACFEIKCTDDPKWCLP--GSIVVTATNFCPPNNALPNNAGGWCNP  119

Query  479  PQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSG  658
            PQ HFDLS P + +IA+Y+AG+VPV YRRVPC R+GG RFT++GH +FNLV ++NVGG+G
Sbjct  120  PQHHFDLSQPIFQRIAQYRAGIVPVSYRRVPCQRRGGIRFTINGHSYFNLVLITNVGGAG  179

Query  659  DVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQ  838
            DV  V V       W P+ RNWG+ W++N+ L+G+ L+F+VTT+DG+ V S NV P  W 
Sbjct  180  DVQAVSVKGS-RTDWQPMSRNWGQNWQSNSYLNGQRLSFKVTTSDGRTVVSNNVVPAGWS  238

Query  839  YGQTFEG  859
            +GQTF G
Sbjct  239  FGQTFTG  245



>ref|XP_010106493.1| hypothetical protein L484_025251 [Morus notabilis]
 gb|EXC10669.1| hypothetical protein L484_025251 [Morus notabilis]
Length=258

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 172/260 (66%), Gaps = 16/260 (6%)
 Frame = +2

Query  128  AAMATELQASILLIVLCA---LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQ  289
            A +     AS+L ++  A   +P V+ G S   W  AHATFYG  +  GT+GGACG    
Sbjct  2    AGLTVTWIASLLSLMWMAEARIPGVYTGGS---WETAHATFYGGSDASGTMGGACGYGNL  58

Query  290  FKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------  451
            + + Y   T ALS ALFNN  SCGAC+EIKC N    C +    I++TAT+ CP      
Sbjct  59   YSQGYGVSTAALSTALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNYALP  118

Query  452  TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLV  631
              +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNLV
Sbjct  119  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLV  178

Query  632  TVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTS  811
             +SNV G+GD+ +  V    +  W+ + RNWG+ W++NA+L G+SL+FRVT +D +  TS
Sbjct  179  LISNVAGAGDIVRTSVKGS-KTGWMLMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  812  QNVAPKSWQYGQTFEGRNCR  871
             N+ P +WQ+GQTF G+N R
Sbjct  238  WNIVPANWQFGQTFTGKNFR  257



>ref|XP_010066900.1| PREDICTED: expansin-A1 [Eucalyptus grandis]
 gb|KCW64943.1| hypothetical protein EUGRSUZ_G02490 [Eucalyptus grandis]
 gb|KCW64944.1| hypothetical protein EUGRSUZ_G02490 [Eucalyptus grandis]
Length=250

 Score =   228 bits (582),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 155/233 (67%), Gaps = 12/233 (5%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYGPPE--GTIGGACGLEQ-FKETYSPYttalsaalfnnaasCGACY  370
            G    GW++AHATFYG  +  GT+GGACG    + + Y   T ALS ALFNN  SCG+C+
Sbjct  21   GSGGGGWINAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCF  80

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHFDLSMPAYLQIAEY  532
            EI+CVN    C      I+VTAT+ CP  +      G WC PPQ HFDLS P +  IA+Y
Sbjct  81   EIRCVNDGKWCL--GGSIVVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHIAQY  138

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV YRRVPC R GG RFT++GH +FNLV V+NVGG+GDV  V V       W  +
Sbjct  139  RAGIVPVAYRRVPCRRSGGIRFTINGHSYFNLVLVTNVGGAGDVHSVAVKGS-RTGWQTM  197

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNCR  871
             RNWG+ W++NA L+G+SL+F+VTT+DG+ V S NVAP  W +GQTF G   R
Sbjct  198  SRNWGQNWQSNANLNGQSLSFKVTTSDGRTVVSNNVAPAGWSFGQTFAGAQFR  250



>gb|KEH39447.1| expansin A10 [Medicago truncatula]
Length=260

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/261 (45%), Positives = 174/261 (67%), Gaps = 13/261 (5%)
 Frame = +2

Query  116  LIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-E  286
            ++    + T + +  + +V   +P V+ G +   W  AHATFYG  +  GT+GGACG   
Sbjct  3    MVSMVYVVTLIMSLTMWMVDARIPGVYNGGA---WQTAHATFYGGSDASGTMGGACGYGN  59

Query  287  QFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP-----  451
             + + Y   T ALS ALFNN  SCG+C+E+KC N    C +    I +TAT+ CP     
Sbjct  60   LYSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFAQ  119

Query  452  -TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNL  628
             + +G WC PP+ HFDL+MP +L+IAEY+AG+VPV +RRVPC ++GG RFT++G ++FNL
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTINGFRYFNL  179

Query  629  VTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVT  808
            V +SNV G+GD+ +  V    +  W+P+ RNWG+ W++N++L G++L+FRVT +D +  T
Sbjct  180  VLISNVAGAGDIVRTYVKGT-QTGWMPMSRNWGQNWQSNSVLVGQALSFRVTGSDRRTST  238

Query  809  SQNVAPKSWQYGQTFEGRNCR  871
            S N+AP +WQ+GQTF G+N R
Sbjct  239  SWNIAPHNWQFGQTFTGKNFR  259



>ref|XP_002298353.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|ABK92494.1| unknown [Populus trichocarpa]
 gb|EEE83158.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 173/256 (68%), Gaps = 20/256 (8%)
 Frame = +2

Query  152  ASILLIVLCAL-------PCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKET  301
            A+ LLI++ +L       P V+ G +   W +AHATFYG  +  GT+GGACG    + + 
Sbjct  10   ATSLLIIMSSLWMAEARIPGVYSGGA---WQNAHATFYGGADASGTMGGACGYGNLYSQG  66

Query  302  YSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDG  463
            Y   T ALS ALFNN  +CG+C+EIKC +    C +    I +TAT+ CP      + +G
Sbjct  67   YGVSTAALSTALFNNGLTCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYALPSDNG  126

Query  464  KWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSN  643
             WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++FNLV +SN
Sbjct  127  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISN  186

Query  644  VGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVA  823
            V G+GD+ +V V    +  W+ + RNWG+ W++NA+L G+SL+FRV  +D ++ TS N+A
Sbjct  187  VAGAGDIVQVSVKGS-KTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTSWNIA  245

Query  824  PKSWQYGQTFEGRNCR  871
            P  WQ+GQTF G+N R
Sbjct  246  PAHWQFGQTFTGKNFR  261



>gb|AAC33529.1| expansin [Prunus armeniaca]
Length=254

 Score =   228 bits (582),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 157/224 (70%), Gaps = 12/224 (5%)
 Frame = +2

Query  215  GWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEIKCV  385
            GW  AHATFYG     GT+GGACG    + + Y   T ALS ALFNN  SCG+CYE++C 
Sbjct  31   GWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRCN  90

Query  386  NSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVV  547
            N    C+     IIVTAT+ CP        +G WC PP  HFDL+ PA+LQIA+Y+AG+V
Sbjct  91   NDPRWCRP--GSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  148

Query  548  PVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWG  727
            PV +RRVPCM+KGG RFT++GH +FNLV ++NVGG+GDV  V +       W P+ RNWG
Sbjct  149  PVTFRRVPCMKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGS-RTGWQPMSRNWG  207

Query  728  EKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
            + W++N  L+G+SL+F+VTT+DG+ VTS NVAP +WQ+GQTF G
Sbjct  208  QNWQSNNYLNGQSLSFQVTTSDGRTVTSYNVAPGNWQFGQTFSG  251



>gb|AEQ55273.1| expansin [Breonia chinensis]
 gb|AEQ55288.1| expansin [Breonia chinensis]
Length=248

 Score =   228 bits (582),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 158/248 (64%), Gaps = 14/248 (6%)
 Frame = +2

Query  143  ELQASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPY  313
            EL   + +  L   P V G D   GW DAHATFYG     GT+GGACG    + + Y   
Sbjct  2    ELLVFLTIGYLSIFPLVHGYD--EGWTDAHATFYGGGDASGTMGGACGYGNLYSQGYGTN  59

Query  314  ttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCA  475
            T ALS ALFNN  SCGAC+EIKCVN    C      I+VTAT+ CP      + +G WC 
Sbjct  60   TAALSTALFNNGLSCGACFEIKCVNDPRGCL--PGSIVVTATNFCPPNNALPSNNGGWCN  117

Query  476  PPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGS  655
            PP  HFDLS P +  IA+Y+AG+VPV YRRVPC +KGG RFT++GH +FNLV ++NVGG+
Sbjct  118  PPLHHFDLSQPVFQHIAQYRAGIVPVSYRRVPCQKKGGIRFTINGHSYFNLVLITNVGGA  177

Query  656  GDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSW  835
            GDV  V +       W P+ RNWG+ W++N+ L G+SL+F+VTT+DG+ V   N  P  W
Sbjct  178  GDVHAVSIKGS-RSDWQPMSRNWGQNWQSNSFLDGQSLSFKVTTSDGRTVVCNNAIPAGW  236

Query  836  QYGQTFEG  859
             +GQTF G
Sbjct  237  SFGQTFTG  244



>gb|AFK48363.1| unknown [Medicago truncatula]
Length=247

 Score =   228 bits (582),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 155/227 (68%), Gaps = 12/227 (5%)
 Frame = +2

Query  206  SAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEI  376
            S  GW++AHATFYG     GT+GGACG    + + Y   T ALS AL N+  SCGAC+EI
Sbjct  21   SNDGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALLNSGLSCGACFEI  80

Query  377  KCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHFDLSMPAYLQIAEYKA  538
            KCVN    C    K I+VTAT+ CP  +      G WC PP  HFDLS P + QIA+YKA
Sbjct  81   KCVNDQKWCLP--KSIVVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQQIAQYKA  138

Query  539  GVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKR  718
            G+VPV Y+RVPC +KGG RFT++GH +FNLV ++NVGG+GDV+ V +    +  W P+ R
Sbjct  139  GIVPVAYKRVPCQKKGGIRFTINGHSYFNLVLITNVGGAGDVTAVSIKGS-KTNWQPMSR  197

Query  719  NWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
            NWG+ W++N+ L G+SL+F+VT++DG+ V + NV P  W +GQTF G
Sbjct  198  NWGQNWQSNSNLDGQSLSFKVTSSDGRTVIANNVVPAGWSFGQTFTG  244



>emb|CDP12277.1| unnamed protein product [Coffea canephora]
Length=248

 Score =   228 bits (582),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 126/248 (51%), Positives = 159/248 (64%), Gaps = 14/248 (6%)
 Frame = +2

Query  143  ELQASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPY  313
            EL   +++  L     V G D   GW DAHATFYG     GT+GGACG    + + Y   
Sbjct  2    ELLGFLIIGCLSISSIVHGYD--EGWTDAHATFYGGGDASGTMGGACGYGNLYSQGYGTN  59

Query  314  ttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCA  475
            T ALS ALFNN  SCGAC+EIKC+N    C      IIVTAT+ CP        DG WC 
Sbjct  60   TAALSTALFNNGLSCGACFEIKCMNDPKACL--PGSIIVTATNFCPPNNALPNNDGGWCN  117

Query  476  PPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGS  655
            PP  HFDLS P + +IA+Y+AG+VPV YRRVPC R+GG RFT++GH +FNLV ++NVGG+
Sbjct  118  PPLQHFDLSQPVFQRIAQYRAGIVPVSYRRVPCERRGGIRFTINGHSYFNLVLITNVGGA  177

Query  656  GDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSW  835
            GDV  V V     + W P+ RNWG+ W++N+ L G+S++F+VTT+DG+ V   N  P  W
Sbjct  178  GDVHAVSVKGSSSD-WQPMSRNWGQNWQSNSFLDGQSISFKVTTSDGRTVVCNNAIPAGW  236

Query  836  QYGQTFEG  859
             YGQTF G
Sbjct  237  SYGQTFTG  244



>ref|XP_011019014.1| PREDICTED: expansin-A8-like [Populus euphratica]
Length=254

 Score =   228 bits (582),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 124/254 (49%), Positives = 167/254 (66%), Gaps = 15/254 (6%)
 Frame = +2

Query  134  MATE-LQASILLIVLCALPCVFGGDSAH--GWLDAHATFYGPPE--GTIGGACGL-EQFK  295
            MAT+ +Q S+ L +      +F G      GW   HATFYG  +  GT+GGACG    + 
Sbjct  1    MATKAMQFSVFLQLFLVFSLLFQGTCGDRGGWQMGHATFYGGSDASGTMGGACGYGNLYS  60

Query  296  ETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TG  457
            + Y   T ALS ALFNN  SCGAC++I+C N    C +    I VTAT+ CP        
Sbjct  61   QGYGTSTAALSTALFNNGLSCGACFQIRCNNDPKWCHS--STITVTATNFCPPNYALSND  118

Query  458  DGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTV  637
            +G WC PP  HFDL+ PA+L+IA+Y+AG+VPV +RRVPC++KGG RFT++GH +FNLV +
Sbjct  119  NGGWCNPPLQHFDLAQPAFLKIAQYRAGIVPVLFRRVPCVKKGGIRFTINGHSYFNLVLI  178

Query  638  SNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQN  817
            +NV G+GDV  V V       W  + RNWG+ W++N+ L+G+SL+FRVT +DG+ VTS N
Sbjct  179  TNVAGAGDVHAVSVKGS-RTGWQAMSRNWGQDWQSNSYLNGQSLSFRVTASDGRTVTSYN  237

Query  818  VAPKSWQYGQTFEG  859
            + P +WQ+GQTFEG
Sbjct  238  IVPANWQFGQTFEG  251



>ref|XP_002514740.1| Alpha-expansin 15 precursor, putative [Ricinus communis]
 gb|EEF47846.1| Alpha-expansin 15 precursor, putative [Ricinus communis]
Length=249

 Score =   228 bits (582),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 123/243 (51%), Positives = 161/243 (66%), Gaps = 14/243 (6%)
 Frame = +2

Query  161  LLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsa  331
            LL  L  +P V+G D   GW +AHATFYG     GT+GGACG    + + Y   T ALS 
Sbjct  8    LLGFLSLVPFVYGYDG--GWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALST  65

Query  332  alfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHF  493
            ALFNN  SCGAC+EIKC +    C      I+VTAT+ CP  +      G WC PPQ HF
Sbjct  66   ALFNNGLSCGACFEIKCTDDPKWCLP--GSIVVTATNFCPPNNALPNNAGGWCNPPQHHF  123

Query  494  DLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKV  673
            DL+ P + +IA+Y++G+VPV YRRVPC ++GG RFT++GH +FNLV ++NVGG+GDV  V
Sbjct  124  DLAQPVFQRIAQYRSGIVPVVYRRVPCQKRGGIRFTINGHSYFNLVLITNVGGAGDVQAV  183

Query  674  EVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTF  853
             +       W P+ RNWG+ W++N+ L G+SL+F+VTT+DGK V S NV P  W +GQTF
Sbjct  184  SIKGS-RSDWQPMSRNWGQNWQSNSYLDGQSLSFKVTTSDGKTVVSNNVVPAGWSFGQTF  242

Query  854  EGR  862
             G+
Sbjct  243  TGQ  245



>emb|CAH18933.1| expansin [Pyrus communis]
Length=258

 Score =   228 bits (582),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 171/264 (65%), Gaps = 19/264 (7%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACG  280
            L VL I   ++  ++A+        +P V+ G     W  AHATFYG     GT+GGACG
Sbjct  4    LRVLYIAFMLSLFMEAN------ARIPGVYTGGP---WEGAHATFYGGNDASGTMGGACG  54

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC +    C      I+VTAT+ CP  
Sbjct  55   YGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPN  114

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                + DG WC PP+ HFDL+MP +L+IAEYKAG+VPV YRRVPC ++GG RFT++G ++
Sbjct  115  FAQPSDDGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRY  174

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV ++NV G+GD+ +V V       W+P+ RNWG+ W++NA L G++L+FRVT +D +
Sbjct  175  FNLVLITNVAGAGDIVRVSVKGA-NTGWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRR  233

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS NVAP  WQ+GQTF G+N R
Sbjct  234  TSTSHNVAPADWQFGQTFTGKNFR  257



>ref|XP_004240235.1| PREDICTED: expansin-A8-like [Solanum lycopersicum]
Length=258

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 164/247 (66%), Gaps = 14/247 (6%)
 Frame = +2

Query  155  SILLIVLCALPCVFG---GDSAHGWLDAHATFYG--PPEGTIGGACGLEQFK-ETYSPYt  316
            SI  ++L      F    GD+  GW  AHAT YG     GT+GGACG      + Y   T
Sbjct  11   SIFHLLLIFTSLCFNESFGDNG-GWQSAHATLYGGGDASGTMGGACGYGNLNSQGYGTNT  69

Query  317  talsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAP  478
             ALS +LFNN  +CGACY++KC N+  +   P   I VTAT+ CP        +G WC P
Sbjct  70   AALSTSLFNNGLTCGACYKLKCNNNDDKLCLPGTTITVTATNFCPPNPSLSNNNGGWCNP  129

Query  479  PQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSG  658
            P  HFDL+ PA+L+IA+YKAG+VP+ ++RVPCM+KGG RFT++GH ++NL+ V+NVGG+G
Sbjct  130  PLQHFDLAQPAFLKIAQYKAGIVPISFQRVPCMKKGGIRFTINGHSYYNLILVTNVGGAG  189

Query  659  DVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQ  838
            DV  V +    +  W  + RNWG+ W+ NA L+G+SL+F+VTT+DG+ +TS N AP +WQ
Sbjct  190  DVHSVSIKGS-KNGWQLMSRNWGQNWQNNAYLNGQSLSFQVTTSDGRTITSNNAAPSNWQ  248

Query  839  YGQTFEG  859
            +GQTFEG
Sbjct  249  FGQTFEG  255



>ref|XP_010516124.1| PREDICTED: expansin-A16 [Camelina sativa]
Length=260

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 166/247 (67%), Gaps = 13/247 (5%)
 Frame = +2

Query  158  ILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttals  328
            +L +    +P V+ G S   W  AHATFYG     GT+GGACG  + + + Y   T ALS
Sbjct  17   LLSLTDAGIPGVYSGSS---WQTAHATFYGGNDASGTMGGACGYGDLYSQGYGTNTAALS  73

Query  329  aalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQAH  490
             ALFN+  SCGAC+E+KCVN    C      + VTAT+ CP      + +G WC PP+AH
Sbjct  74   TALFNSGQSCGACFEVKCVNDPKWCHPGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRAH  133

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDL+MP +L+IA Y+AG+VP+ YRRV C + GG RFT++GH++FNLV ++NV G+GD+ K
Sbjct  134  FDLAMPVFLKIAAYRAGIVPISYRRVACKKSGGIRFTINGHRYFNLVLITNVAGAGDIVK  193

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
              V    +  W+ L RNWG+ W++N +L G++L+FRVT++D +  TS N+AP +WQ+GQT
Sbjct  194  ASVKGS-KTGWMSLTRNWGQNWQSNDVLVGQTLSFRVTSSDRRTSTSWNIAPSNWQFGQT  252

Query  851  FEGRNCR  871
            F G+N R
Sbjct  253  FVGKNFR  259



>gb|AEN70893.1| expansin [Gossypium schwendimanii]
Length=259

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 172/264 (65%), Gaps = 21/264 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            +SVLI  +        SI ++    +P V+ G +   W +AHATFYG  +  GT+GGACG
Sbjct  7    ISVLIFIS--------SIWMMGEARIPGVYSGGA---WQNAHATFYGGADASGTMGGACG  55

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCGAC+EIKC +    C +    I +TAT+ CP  
Sbjct  56   YGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPN  115

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                  +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RFT++G ++
Sbjct  116  YALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  175

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV +SNV G+GD+ KV V       W+ + RNWG+ W++NA+L G+SL+FRVT +D +
Sbjct  176  FNLVLISNVAGAGDIVKVSVKGS-RTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRR  234

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
              TS N+ P  WQ+GQTF G+N R
Sbjct  235  TSTSWNIVPAHWQFGQTFTGKNFR  258



>ref|XP_010931278.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A7 [Elaeis guineensis]
Length=258

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 122/247 (49%), Positives = 164/247 (66%), Gaps = 10/247 (4%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYtta  322
            ASIL     A   + G  +   W  AHATFYG  +  GT+GGACG    + + Y   T A
Sbjct  10   ASILAFFSPAAARIMGVFTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAA  69

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWCAPPQ  484
            LS ALFN+  SCGAC+EIKCV+    C      I +TAT+ CP      + +G WC PP+
Sbjct  70   LSTALFNDGQSCGACFEIKCVDEPQWCHPGSPSIFITATNFCPPNYALPSDNGGWCNPPR  129

Query  485  AHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDV  664
             HFDL+MP +L+IAEY+AG+VPV YRRVPC + GG RFT++G Q+FNLV ++NV G+GD+
Sbjct  130  PHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFQYFNLVLITNVAGAGDI  189

Query  665  SKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYG  844
             +V V       W+P+ RNWG+ W++NA+L G+SL+FRVT +D +  TS N+ P +WQ+G
Sbjct  190  VRVSVKGS-RTGWMPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTTTSWNIVPANWQFG  248

Query  845  QTFEGRN  865
            QTF G+N
Sbjct  249  QTFAGKN  255



>gb|AAF35902.1|AF230333_1 expansin 3 [Zinnia violacea]
Length=242

 Score =   228 bits (581),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 158/240 (66%), Gaps = 10/240 (4%)
 Frame = +2

Query  152  ASILLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYtta  322
            A   L +L  L  + GG    GW +AHATFYG     GT+GGACG    + + Y   T A
Sbjct  5    AIFFLALLSPLHVIAGGG---GWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAA  61

Query  323  lsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP-TGDGKWCAPPQAHFDL  499
            LS ALFN   SCG+CYEI+CVN    C      I+VTAT+ CP   +G WC PP+ HFDL
Sbjct  62   LSTALFNKGLSCGSCYEIRCVNDRQWCLP--ATIVVTATNFCPPNSNGGWCDPPRQHFDL  119

Query  500  SMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEV  679
            S P +  IA+YKAGVVPV YRRVPC R+GG RF ++GH +FNLV ++NVGG+GDV  V +
Sbjct  120  SQPIFQHIAQYKAGVVPVAYRRVPCRRRGGIRFQINGHSYFNLVLITNVGGAGDVHAVAI  179

Query  680  NAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
                   W  + RNWG+ W++N+ L+G+SL+F+VTT+DG+ V S NVAP  W +GQTF G
Sbjct  180  KGS-RTGWQQMSRNWGQNWQSNSYLNGQSLSFKVTTSDGRTVVSYNVAPSRWSFGQTFAG  238



>ref|XP_006600699.1| PREDICTED: expansin-A15-like isoform X2 [Glycine max]
Length=259

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 158/230 (69%), Gaps = 13/230 (6%)
 Frame = +2

Query  200  GDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACY  370
            GDS  GW+DAHATFYG     GT+GGACG    + + Y   T ALS ALFNN  SCGAC+
Sbjct  31   GDS-DGWMDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACF  89

Query  371  EIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHFDLSMPAYLQIAEY  532
            EIKCVN    C      ++VTAT+ CP  +      G WC PP  HFDLS P + QIA+Y
Sbjct  90   EIKCVNDQRWCLP--DTVVVTATNFCPPNNALPNDAGGWCNPPLQHFDLSQPVFQQIAQY  147

Query  533  KAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPL  712
            +AG+VPV Y+RVPC ++GG RFT++GH +FNLV ++NVGG+GDV  V +       W P+
Sbjct  148  RAGIVPVAYKRVPCQKRGGIRFTINGHSYFNLVLITNVGGAGDVQAVSIKGS-RTNWQPM  206

Query  713  KRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGR  862
             RNWG+ W++N  L+G+SL+F+VTT++G+ + S NVAP SW +GQTF G+
Sbjct  207  SRNWGQNWQSNTYLNGQSLSFKVTTSEGRTLVSNNVAPDSWSFGQTFTGK  256



>gb|KEH33311.1| expansin A10 [Medicago truncatula]
Length=247

 Score =   228 bits (581),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 156/227 (69%), Gaps = 12/227 (5%)
 Frame = +2

Query  206  SAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsaalfnnaasCGACYEI  376
            S  GW++AHATFYG     GT+GGACG    + + Y   T ALS ALFN+  SCGAC+EI
Sbjct  21   SNDGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACFEI  80

Query  377  KCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHFDLSMPAYLQIAEYKA  538
            KCVN    C    K I+VTAT+ CP  +      G WC PP  HFDLS P + QIA+YKA
Sbjct  81   KCVNDQKWCLP--KSIVVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQQIAQYKA  138

Query  539  GVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKR  718
            G+VPV Y+RVPC +KGG RFT++GH +FNLV ++NVGG+GDV+ V +    +  W P+ R
Sbjct  139  GIVPVAYKRVPCQKKGGIRFTINGHSYFNLVLITNVGGAGDVTAVSIKGS-KTNWQPMSR  197

Query  719  NWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEG  859
            NWG+ W++N+ L G+SL+F+VT++DG+ V + NV P  W +GQTF G
Sbjct  198  NWGQNWQSNSNLDGQSLSFKVTSSDGRTVIANNVVPAGWSFGQTFTG  244



>ref|NP_001266044.1| expansin-A5-like precursor [Cicer arietinum]
 emb|CAC19183.2| alpha-expansin [Cicer arietinum]
Length=245

 Score =   228 bits (581),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 161/244 (66%), Gaps = 8/244 (3%)
 Frame = +2

Query  143  ELQASILL-IVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSP  310
             L   ILL I L  +  V G      W++AHATFYG  +  GT+GGACG    + + Y  
Sbjct  2    SLLGFILLGIFLYKVSHVKGHGGHVSWINAHATFYGGSDASGTMGGACGYGNLYSQGYGT  61

Query  311  YttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGDGKWCAPPQAH  490
             T ALS ALFNN  SCGACYEIKCVN    C      I+VTAT+ CP G   WC PP  H
Sbjct  62   NTAALSTALFNNGLSCGACYEIKCVNDPQWC-IAGSSIVVTATNFCPPGG--WCDPPNHH  118

Query  491  FDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSK  670
            FDLS P + QIA+YKAG+VPV YRRV C RKGG RFT++GH +FNLV V+NVGG+GDV  
Sbjct  119  FDLSQPIFQQIAQYKAGIVPVAYRRVRCRRKGGIRFTINGHSYFNLVLVTNVGGAGDVHS  178

Query  671  VEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQT  850
            V +      +W  + RNWG+ W++N+ L+G+SL+F VTT++G +V S N AP SW +GQT
Sbjct  179  VAIKGS-RSRWQAMSRNWGQNWQSNSYLNGQSLSFVVTTSNGHSVVSFNAAPSSWSFGQT  237

Query  851  FEGR  862
            + GR
Sbjct  238  YTGR  241



>ref|XP_009360325.1| PREDICTED: expansin-A1 [Pyrus x bretschneideri]
Length=253

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 125/246 (51%), Positives = 160/246 (65%), Gaps = 15/246 (6%)
 Frame = +2

Query  161  LLIVLCALPCVFGGDSAHGWLDAHATFYG--PPEGTIGGACGL-EQFKETYSPYttalsa  331
            LL +L A    +GG    GW++A ATFYG     GT+GGACG    + + Y   T ALS 
Sbjct  14   LLAMLVASAHAYGGG---GWVNARATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALST  70

Query  332  alfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCPTGD------GKWCAPPQAHF  493
            ALFNN   CG+CYEI+CVN    C      I+VTAT+ CP  +      G WC PPQ HF
Sbjct  71   ALFNNGLGCGSCYEIRCVNDPKWCL--PGSIVVTATNFCPPNNALPNNAGGWCNPPQHHF  128

Query  494  DLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKV  673
            DLS P +  IA+YKAGVVPV YRRVPCMR+GG RFT++GH +FNLV ++NVGG+GDV  V
Sbjct  129  DLSQPVFQHIAQYKAGVVPVSYRRVPCMRRGGIRFTINGHSYFNLVLITNVGGAGDVHSV  188

Query  674  EVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTF  853
             V       W  + RNWG+ W++N+ L+G++L+F+VTT+DG+ V S N AP  W +GQT+
Sbjct  189  SVKGS-RTGWQAMSRNWGQNWQSNSYLNGQALSFKVTTSDGRTVVSYNAAPAGWSFGQTY  247

Query  854  EGRNCR  871
             G   R
Sbjct  248  SGAQFR  253



>emb|CDM84787.1| unnamed protein product [Triticum aestivum]
 emb|CDJ26303.1| unnamed protein product [Triticum aestivum]
Length=251

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 161/249 (65%), Gaps = 15/249 (6%)
 Frame = +2

Query  149  QASILLIVLCALPCVFGGDSAH---GWLDAHATFYG--PPEGTIGGACGLEQFKET-YSP  310
             A+ LL++  A  C+    +A     W  AHATFYG     GT+GGACG      T Y  
Sbjct  3    SANALLLLFSAAFCLLARRAAGDYGSWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGT  62

Query  311  YttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP------TGDGKWC  472
             T ALS ALFN+ A+CG+CYE+KC + +  C      I +TAT+LCP        DG WC
Sbjct  63   NTAALSTALFNDGAACGSCYELKCQDVSSSCL--PGSITITATNLCPPNYALPNDDGGWC  120

Query  473  APPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGG  652
             PP+AHFD++ PAYLQI  Y+AG+V V YRRVPC++KGG RFT++GH +FNLV V+NV G
Sbjct  121  NPPRAHFDMAEPAYLQIGIYRAGIVAVAYRRVPCVKKGGMRFTINGHSYFNLVLVTNVAG  180

Query  653  SGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKS  832
            +GDV  V +       W  + RNWG+ W++NA L G+SL+FRVT +DG+ VTS N AP  
Sbjct  181  AGDVQSVAIKGS-STGWQAMARNWGQNWQSNADLDGQSLSFRVTLSDGRTVTSNNAAPAG  239

Query  833  WQYGQTFEG  859
            W +GQTFEG
Sbjct  240  WSFGQTFEG  248



>gb|ADC35365.1| alpha-expansin 2 [Coffea arabica]
Length=258

 Score =   228 bits (582),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 175/264 (66%), Gaps = 16/264 (6%)
 Frame = +2

Query  107  LSVLIITAAMATELQASILLIVLCALPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACG  280
            ++ + +T  +A  L   +L +    +P V+ GDS   W  AHATFYG  +  GT+GGACG
Sbjct  1    MAAMGLTCIVALSL---LLTLTEARIPGVYTGDS---WESAHATFYGGSDASGTMGGACG  54

Query  281  L-EQFKETYSPYttalsaalfnnaasCGACYEIKCVNSTGQCKTPQKPIIVTATDLCP--  451
                + + Y   T ALS ALFNN  SCG+C+E+KC +    C      I++TAT+ CP  
Sbjct  55   YGNLYSQGYGVNTAALSTALFNNGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPN  114

Query  452  ----TGDGKWCAPPQAHFDLSMPAYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQF  619
                  +G WC PP+ HFDL+MP +L+IAEY+AG+VPV YRRVPC ++GG RF ++G ++
Sbjct  115  YALPNDNGGWCNPPRPHFDLAMPMFLRIAEYRAGIVPVSYRRVPCRKQGGIRFQINGFRY  174

Query  620  FNLVTVSNVGGSGDVSKVEVNAEGEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGK  799
            FNLV ++NV G+GD+ +  V    +  W+ L RNWG+ W+TNA+L+G+SL+FRV  +D +
Sbjct  175  FNLVLITNVAGAGDIVQASVKGS-KTGWITLSRNWGQNWQTNAVLAGQSLSFRVRASDRR  233

Query  800  AVTSQNVAPKSWQYGQTFEGRNCR  871
            + TS N+AP +WQ+GQTF G+N R
Sbjct  234  SSTSWNIAPANWQFGQTFTGKNFR  257



>gb|ACG46282.1| alpha-expansin 6 precursor [Zea mays]
Length=269

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 163/241 (68%), Gaps = 12/241 (5%)
 Frame = +2

Query  182  LPCVFGGDSAHGWLDAHATFYGPPE--GTIGGACGL-EQFKETYSPYttalsaalfnnaa  352
            +P V+GG    GW  AHATFYG  +  GT+GGACG    + + Y     ALS ALF+   
Sbjct  29   IPGVYGGGGGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFDEGL  88

Query  353  sCGACYEIKCVNSTGQ--CKTPQKPIIVTATDLCP------TGDGKWCAPPQAHFDLSMP  508
             CGAC+EI+C    G   C+  +  I+VTAT+ CP      + DG WC PP+ HFDL+MP
Sbjct  89   RCGACFEIRCEEQPGWRWCRPGRPSILVTATNFCPPNYALPSDDGGWCNPPRPHFDLAMP  148

Query  509  AYLQIAEYKAGVVPVFYRRVPCMRKGGERFTMSGHQFFNLVTVSNVGGSGDVSKVEVNAE  688
             +L IAEY+AG+VPV YRRVPC + GG RFT++G ++FNLV ++NV G+GDV +  V A 
Sbjct  149  MFLHIAEYRAGIVPVSYRRVPCRKSGGVRFTINGFRYFNLVLITNVAGAGDVVRASVKA-  207

Query  689  GEEKWVPLKRNWGEKWETNAMLSGKSLNFRVTTNDGKAVTSQNVAPKSWQYGQTFEGRNC  868
                W+P+ RNWG+ W++NA+L G++L+FRVT +D +  TS N AP +WQ+GQTFEG+N 
Sbjct  208  ASTGWLPMSRNWGQNWQSNAILVGQALSFRVTASDRRTSTSWNAAPSTWQFGQTFEGKNF  267

Query  869  R  871
            R
Sbjct  268  R  268



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2569280546592