BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19830_g1_i3 len=1254 path=[1247:0-152 3350:153-557 3755:558-711
1959:712-747 2844:748-1253]

Length=1254
                                                                      Score     E

gb|KHN02295.1|  Expansin-A16                                            228   9e-68   
emb|CDX80810.1|  BnaC03g00640D                                          227   9e-68   
ref|XP_009130690.1|  PREDICTED: expansin-A9-like                        227   2e-67   
ref|XP_003553565.1|  PREDICTED: expansin-A16-like                       228   2e-67   
ref|XP_006398690.1|  hypothetical protein EUTSA_v10014430mg             226   2e-67   
ref|XP_003609913.1|  Expansin                                           225   1e-66   
ref|XP_008343537.1|  PREDICTED: expansin-A4-like                        223   4e-66   
ref|XP_010558331.1|  PREDICTED: expansin-A9                             223   8e-66   
ref|XP_009122794.1|  PREDICTED: expansin-A9                             222   8e-66   
ref|XP_002870966.1|  ATEXPA9                                            222   1e-65   
emb|CDY10456.1|  BnaCnng03570D                                          222   1e-65   
ref|XP_010490643.1|  PREDICTED: expansin-A9                             221   3e-65   
ref|XP_010423881.1|  PREDICTED: expansin-A9-like                        221   4e-65   
ref|XP_010452058.1|  PREDICTED: expansin-A9-like                        220   6e-65   
ref|NP_195846.1|  expansin A9                                           219   1e-64   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48101.1|  BnaC02g03580D                                          219   1e-64   
ref|NP_001288956.1|  expansin-A9-like precursor                         219   1e-64   
emb|CDY04847.1|  BnaAnng00290D                                          219   1e-64   
ref|XP_009380637.1|  PREDICTED: expansin-A4                             219   1e-64   
ref|XP_009343581.1|  PREDICTED: expansin-A4-like                        219   2e-64   
ref|XP_009357738.1|  PREDICTED: expansin-A4-like                        219   2e-64   
ref|XP_008371813.1|  PREDICTED: expansin-A4-like                        219   2e-64   
dbj|BAJ10398.1|  alpha-expansin                                         218   5e-64   
gb|KFK24708.1|  hypothetical protein AALP_AA8G014300                    217   6e-64   
dbj|BAC67194.1|  expansin                                               217   7e-64   Pyrus communis
ref|NP_001234085.1|  expansin precursor                                 216   1e-63   
gb|KEH39447.1|  expansin A10                                            216   1e-63   
gb|KHG02505.1|  Expansin-A2                                             216   1e-63   
ref|XP_006288496.1|  hypothetical protein CARUB_v10001761mg             216   1e-63   
ref|XP_006294843.1|  hypothetical protein CARUB_v10023894mg             216   2e-63   
ref|XP_006411198.1|  hypothetical protein EUTSA_v10017119mg             216   2e-63   
dbj|BAC67193.1|  expansin                                               216   2e-63   Pyrus communis
ref|XP_009399925.1|  PREDICTED: expansin-A15-like                       215   3e-63   
ref|XP_002266243.1|  PREDICTED: expansin-A4                             216   3e-63   Vitis vinifera
gb|AEN70869.1|  alpha-expansin 1                                        216   3e-63   
gb|AEQ55271.1|  expansin                                                216   3e-63   
emb|CDY20467.1|  BnaC04g05770D                                          215   3e-63   
ref|NP_181500.1|  expansin A4                                           215   3e-63   Arabidopsis thaliana [mouse-ear cress]
emb|CAN73461.1|  hypothetical protein VITISV_033906                     216   4e-63   Vitis vinifera
ref|XP_002456550.1|  hypothetical protein SORBIDRAFT_03g038290          215   4e-63   Sorghum bicolor [broomcorn]
ref|XP_004300427.1|  PREDICTED: expansin-A4-like                        215   4e-63   
ref|NP_001105040.1|  alpha expansin1 precursor                          215   4e-63   Zea mays [maize]
ref|XP_009143296.1|  PREDICTED: expansin-A4-like                        215   5e-63   
emb|CDY24952.1|  BnaC03g22200D                                          215   5e-63   
gb|AEN70881.1|  alpha-expansin 1                                        215   6e-63   
gb|ABD48785.1|  alpha-expansin 1                                        215   6e-63   Gossypium hirsutum [American cotton]
emb|CDY07642.1|  BnaA03g18690D                                          215   6e-63   
ref|XP_010534508.1|  PREDICTED: expansin-A4                             215   6e-63   
emb|CDY07024.1|  BnaA04g22910D                                          215   6e-63   
ref|XP_002283358.1|  PREDICTED: expansin-A4                             215   6e-63   Vitis vinifera
gb|AAM22625.1|AF428178_1  expansin 11 precursor                         215   6e-63   Rumex palustris
emb|CDM84787.1|  unnamed protein product                                214   6e-63   
emb|CBI30173.3|  unnamed protein product                                217   7e-63   
ref|XP_009141827.1|  PREDICTED: expansin-A4-like                        214   7e-63   
gb|AAM46997.1|AF512539_1  alpha-expansin precursor                      214   8e-63   Gossypium hirsutum [American cotton]
gb|AEU08407.1|  expansin 2                                              214   8e-63   
gb|AEN70875.1|  alpha-expansin 1                                        214   8e-63   
emb|CDY69611.1|  BnaCnng64440D                                          214   9e-63   
gb|KHG15821.1|  Expansin-A4 -like protein                               214   9e-63   
gb|AAM22624.1|AF428177_1  expansin 10 precursor                         214   9e-63   Rumex palustris
ref|XP_006341021.1|  PREDICTED: expansin-A3                             214   9e-63   
ref|NP_001288961.1|  expansin-A4 precursor                              214   9e-63   
ref|XP_010505648.1|  PREDICTED: expansin-A4                             214   9e-63   
gb|AEN70885.1|  alpha-expansin 1                                        214   1e-62   
ref|XP_002881669.1|  ATEXPA4                                            214   1e-62   
ref|XP_002878036.1|  ATEXPA16                                           214   1e-62   
gb|AEN70867.1|  alpha-expansin 1                                        214   1e-62   
gb|AEN70868.1|  alpha-expansin 1                                        214   1e-62   
gb|ADY68810.1|  alpha-expansin 1                                        214   1e-62   
ref|XP_011048141.1|  PREDICTED: expansin-A15-like                       214   1e-62   
gb|AEN70870.1|  alpha-expansin 1                                        214   1e-62   
gb|ABL86680.1|  EXA1                                                    214   1e-62   Gossypium barbadense [Egyptian cotton]
ref|XP_009404081.1|  PREDICTED: expansin-A15                            214   1e-62   
ref|NP_001288852.1|  expansin-A3 precursor                              214   1e-62   
ref|XP_008387765.1|  PREDICTED: expansin-A4-like                        214   1e-62   
ref|XP_010276443.1|  PREDICTED: expansin-A15-like                       213   1e-62   
emb|CDX74942.1|  BnaA05g06880D                                          214   1e-62   
ref|XP_011013147.1|  PREDICTED: expansin-A1                             213   1e-62   
ref|XP_009341751.1|  PREDICTED: expansin-A4-like                        214   1e-62   
gb|AEN70883.1|  alpha-expansin 1                                        214   2e-62   
gb|ABL86681.1|  EX4                                                     214   2e-62   Gossypium barbadense [Egyptian cotton]
gb|AEN70871.1|  alpha-expansin 1                                        214   2e-62   
gb|AAQ08016.1|  expansin                                                213   2e-62   Melilotus albus
ref|XP_009409019.1|  PREDICTED: expansin-A4-like                        213   2e-62   
gb|AAM62937.1|  Alpha-expansin 4 precursor (At-EXP4) (AtEx4) (Ath...    213   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517323.1|  PREDICTED: expansin-A4-like                        213   2e-62   
ref|XP_004970396.1|  PREDICTED: expansin-A2-like                        213   2e-62   
ref|XP_009631918.1|  PREDICTED: expansin-A4-like                        213   2e-62   
ref|NP_001150534.1|  alpha-expansin 6 precursor                         213   3e-62   Zea mays [maize]
ref|NP_191109.1|  expansin A16                                          213   3e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CDM84777.1|  unnamed protein product                                213   3e-62   
ref|XP_002533097.1|  Alpha-expansin 4 precursor, putative               213   3e-62   Ricinus communis
gb|AAM22626.1|AF428179_1  expansin 12 precursor                         213   3e-62   Rumex palustris
gb|AFZ78605.1|  expansin protein                                        213   3e-62   
ref|XP_004302749.1|  PREDICTED: expansin-A4-like                        213   3e-62   
emb|CAH18933.1|  expansin                                               213   3e-62   Pyrus communis
ref|XP_009760985.1|  PREDICTED: expansin-A10-like                       212   3e-62   
dbj|BAE06067.1|  expansin                                               213   3e-62   Sagittaria pygmaea
ref|XP_007027486.1|  Alpha-expansin 3 precursor                         214   3e-62   
ref|XP_010921302.1|  PREDICTED: expansin-A10-like                       213   3e-62   
gb|AAR82850.1|  expansin-2                                              213   3e-62   Petunia x hybrida [garden petunia]
ref|NP_001288942.1|  expansin-A16 precursor                             213   4e-62   
ref|NP_001234081.1|  expansin A4 precursor                              213   4e-62   
ref|XP_009788740.1|  PREDICTED: expansin-A3-like                        213   4e-62   
gb|AAO92741.1|  expansin                                                213   4e-62   Gossypium hirsutum [American cotton]
gb|AAC39512.1|  expansin                                                213   4e-62   Gossypium hirsutum [American cotton]
gb|ACT67493.1|  expansin A1                                             213   4e-62   Raphanus sativus
ref|XP_010508990.1|  PREDICTED: expansin-A4-like                        212   5e-62   
dbj|BAH36862.1|  alpha expansin                                         212   5e-62   Rosa hybrid cultivar
gb|AEN70887.1|  alpha-expansin 1                                        212   6e-62   
ref|XP_006445551.1|  hypothetical protein CICLE_v10017738mg             212   6e-62   
ref|XP_007141864.1|  hypothetical protein PHAVU_008G232200g             212   6e-62   
gb|ACD37706.1|  alpha expansin                                          212   6e-62   Gossypium hirsutum [American cotton]
gb|ABO32366.1|  expansin                                                212   6e-62   Litchi chinensis [litchi]
gb|KEH22886.1|  expansin-A1-like protein                                212   7e-62   
gb|AAR82849.1|  expansin-1                                              212   7e-62   Petunia x hybrida [garden petunia]
ref|XP_008233635.1|  PREDICTED: expansin-A4-like                        212   8e-62   
ref|XP_007205740.1|  hypothetical protein PRUPE_ppa010180mg             212   8e-62   
ref|XP_010938009.1|  PREDICTED: expansin-A2-like                        212   8e-62   
ref|XP_002463623.1|  hypothetical protein SORBIDRAFT_01g003120          212   8e-62   Sorghum bicolor [broomcorn]
gb|EYU41589.1|  hypothetical protein MIMGU_mgv1a026815mg                212   8e-62   
ref|XP_007016396.1|  Expansin A4, ALPHA 1.6,EXPA4                       211   1e-61   
ref|XP_004240235.1|  PREDICTED: expansin-A8-like                        211   1e-61   
ref|XP_004304289.1|  PREDICTED: expansin-A15-like                       211   1e-61   
gb|ABN09939.1|  expansin A4                                             211   1e-61   Musa acuminata [banana]
ref|XP_006338442.1|  PREDICTED: expansin-A10-like                       212   1e-61   
gb|ACJ48968.2|  expansin                                                211   1e-61   Breonia chinensis
ref|XP_010670609.1|  PREDICTED: expansin-A4                             211   1e-61   
gb|AGF90535.1|  alpha-expansin 1                                        211   1e-61   
gb|AAP48989.1|  expansin                                                211   1e-61   Sambucus nigra
gb|ABN09940.1|  expansin A5                                             211   1e-61   Musa acuminata [banana]
ref|XP_009409119.1|  PREDICTED: expansin-A10-like                       211   1e-61   
ref|XP_010043542.1|  PREDICTED: expansin-A4-like                        211   1e-61   
ref|XP_003564501.1|  PREDICTED: expansin-A2                             211   1e-61   
ref|XP_007150329.1|  hypothetical protein PHAVU_005G144500g             211   1e-61   
ref|XP_009589509.1|  PREDICTED: expansin-A10-like                       211   1e-61   
gb|ACF87150.1|  unknown                                                 211   1e-61   Zea mays [maize]
emb|CDY40233.1|  BnaA09g35150D                                          211   1e-61   
ref|XP_009398502.1|  PREDICTED: expansin-A7-like                        211   1e-61   
ref|XP_010532011.1|  PREDICTED: expansin-A4-like                        211   1e-61   
ref|XP_011089478.1|  PREDICTED: expansin-A6                             211   2e-61   
gb|AAK48848.1|AF350939_1  expansin                                      211   2e-61   Prunus cerasus [pie cherry]
ref|XP_009804397.1|  PREDICTED: expansin-A10                            211   2e-61   
ref|XP_010257730.1|  PREDICTED: expansin-A15-like                       211   2e-61   
emb|CAN73252.1|  hypothetical protein VITISV_027049                     211   2e-61   Vitis vinifera
ref|XP_008797331.1|  PREDICTED: expansin-A15-like                       211   2e-61   
gb|KFK36856.1|  hypothetical protein AALP_AA4G180600                    211   2e-61   
emb|CDY31742.1|  BnaA04g16780D                                          211   2e-61   
ref|XP_004143121.1|  PREDICTED: expansin-A4-like                        211   2e-61   
ref|XP_009409516.1|  PREDICTED: expansin-A6-like                        211   2e-61   
ref|XP_003538409.1|  PREDICTED: expansin-A6                             211   2e-61   
ref|XP_003552923.2|  PREDICTED: expansin-A3-like                        211   2e-61   
gb|KEH35551.1|  expansin A10                                            211   2e-61   
ref|XP_002297611.1|  expansin S1 precursor family protein               210   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_008802710.1|  PREDICTED: expansin-A4                             211   2e-61   
gb|KDP22771.1|  hypothetical protein JCGZ_00358                         210   2e-61   
gb|AAM47000.1|AF512542_1  alpha-expansin precursor                      211   2e-61   Gossypium hirsutum [American cotton]
ref|XP_010528418.1|  PREDICTED: expansin-A3                             211   2e-61   
ref|XP_006291698.1|  hypothetical protein CARUB_v10017862mg             211   2e-61   
gb|KHG18125.1|  Expansin-A10 -like protein                              210   2e-61   
gb|ABN09942.1|  expansin A5                                             210   2e-61   Musa acuminata [banana]
ref|XP_010031088.1|  PREDICTED: expansin-A8-like                        210   2e-61   
dbj|BAK05504.1|  predicted protein                                      210   3e-61   
gb|ADY68811.1|  alpha-expansin 1                                        211   3e-61   
gb|AAY43797.1|  expansin                                                211   3e-61   Gossypium hirsutum [American cotton]
ref|XP_008461679.1|  PREDICTED: expansin-A4                             211   3e-61   
ref|XP_009381075.1|  PREDICTED: expansin-A7-like                        211   3e-61   
ref|XP_004981242.1|  PREDICTED: expansin-A7-like                        211   3e-61   
gb|KHG12430.1|  Expansin-A4 -like protein                               211   3e-61   
ref|NP_001044656.1|  Os01g0823100                                       210   3e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008223717.1|  PREDICTED: expansin-A4                             210   3e-61   
ref|XP_004961745.1|  PREDICTED: expansin-A4-like                        210   3e-61   
ref|XP_002315218.1|  alpha-expansin 9 precursor family protein          210   3e-61   Populus trichocarpa [western balsam poplar]
gb|AAD47901.1|AF085330_1  expansin                                      210   3e-61   Pinus taeda
ref|XP_007027012.1|  Expansin A4, ALPHA 1.6,EXPA4                       210   3e-61   
ref|NP_001288899.1|  expansin-A6 precursor                              210   3e-61   
gb|ABO32367.1|  expansin                                                210   4e-61   Litchi chinensis [litchi]
emb|CDX77222.1|  BnaC04g40170D                                          210   4e-61   
ref|XP_003537990.1|  PREDICTED: expansin-A4-like                        210   4e-61   
ref|XP_007218834.1|  hypothetical protein PRUPE_ppa010198mg             210   4e-61   
emb|CDP19176.1|  unnamed protein product                                210   4e-61   
ref|XP_011034337.1|  PREDICTED: expansin-A10-like                       209   4e-61   
ref|XP_007162798.1|  hypothetical protein PHAVU_001G181600g             211   4e-61   
gb|ABB59694.1|  alpha-expansin 2                                        210   4e-61   Gossypium hirsutum [American cotton]
ref|XP_004517307.1|  PREDICTED: expansin-A9-like                        211   4e-61   
ref|XP_009406842.1|  PREDICTED: expansin-A15-like                       209   4e-61   
emb|CDP09064.1|  unnamed protein product                                210   4e-61   
ref|XP_006409928.1|  hypothetical protein EUTSA_v10017116mg             210   4e-61   
ref|XP_007205748.1|  hypothetical protein PRUPE_ppa010226mg             210   5e-61   
ref|XP_010690765.1|  PREDICTED: expansin-A4                             210   5e-61   
ref|XP_008464122.1|  PREDICTED: expansin-A4                             210   5e-61   
ref|XP_006435913.1|  hypothetical protein CICLE_v10032524mg             209   5e-61   
dbj|BAN09211.1|  alpha expansin                                         209   6e-61   
gb|KDP44940.1|  hypothetical protein JCGZ_01440                         209   6e-61   
gb|ABR18394.1|  unknown                                                 209   6e-61   Picea sitchensis
ref|XP_006440617.1|  hypothetical protein CICLE_v10021897mg             209   6e-61   
gb|AFB77223.1|  expansin 1                                              209   6e-61   
ref|XP_002441263.1|  hypothetical protein SORBIDRAFT_09g023440          209   6e-61   Sorghum bicolor [broomcorn]
ref|XP_010415602.1|  PREDICTED: expansin-A1-like                        209   7e-61   
gb|ABM66452.1|  expansin                                                209   7e-61   Vicia faba [broad bean]
ref|XP_011075523.1|  PREDICTED: expansin-A10                            209   7e-61   
ref|XP_010521846.1|  PREDICTED: expansin-A6                             209   7e-61   
ref|XP_008782645.1|  PREDICTED: expansin-A2-like                        209   7e-61   
gb|KEH35550.1|  expansin A10                                            209   7e-61   
ref|XP_011098644.1|  PREDICTED: expansin-A10                            209   7e-61   
ref|NP_001289251.1|  expansin-A4-like precursor                         209   7e-61   
gb|AFK38068.1|  unknown                                                 209   8e-61   
ref|XP_002283530.1|  PREDICTED: expansin-A4                             209   8e-61   Vitis vinifera
ref|XP_004486999.1|  PREDICTED: expansin-A6-like                        209   8e-61   
gb|AEN70914.1|  expansin                                                209   8e-61   
gb|AEN70891.1|  expansin                                                209   8e-61   
ref|XP_002298353.1|  alpha-expansin 1 family protein                    209   8e-61   Populus trichocarpa [western balsam poplar]
ref|XP_010505357.1|  PREDICTED: expansin-A3-like                        209   9e-61   
ref|XP_008354429.1|  PREDICTED: expansin-A4-like                        209   9e-61   
gb|AGU13763.1|  expansin                                                209   9e-61   
ref|XP_007046062.1|  Expansin A1, ALPHA 1.2,EXPA1                       214   9e-61   
gb|AAT94292.1|  alpha-expansin EXPA2                                    209   1e-60   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001242978.1|  expansin-A4-like precursor                         209   1e-60   
ref|XP_004147685.1|  PREDICTED: expansin-A4-like                        209   1e-60   
ref|XP_011035307.1|  PREDICTED: expansin-A6                             209   1e-60   
gb|AEN70901.1|  expansin                                                209   1e-60   
gb|EPS58017.1|  hypothetical protein M569_16799                         209   1e-60   
gb|ADC35365.1|  alpha-expansin 2                                        209   1e-60   Coffea arabica [arabica coffee]
gb|AFK41150.1|  unknown                                                 209   1e-60   
ref|XP_009761115.1|  PREDICTED: expansin-A6-like                        209   1e-60   
ref|XP_010517036.1|  PREDICTED: expansin-A3                             209   1e-60   
gb|ADY68814.1|  expansin                                                209   1e-60   
ref|XP_009780854.1|  PREDICTED: expansin-A4-like                        209   1e-60   
ref|XP_010922313.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A4-...    209   1e-60   
gb|AAF35902.1|AF230333_1  expansin 3                                    208   1e-60   Zinnia violacea [garden zinnia]
ref|XP_010066900.1|  PREDICTED: expansin-A1                             208   1e-60   
ref|XP_002881524.1|  ATEXPA3                                            209   1e-60   
dbj|BAJ99188.1|  predicted protein                                      208   1e-60   
gb|AEQ55276.1|  expansin                                                208   1e-60   
gb|AEQ55274.1|  expansin                                                208   1e-60   
ref|XP_002319704.2|  expansin S1 precursor family protein               208   2e-60   Populus trichocarpa [western balsam poplar]
emb|CDP06606.1|  unnamed protein product                                208   2e-60   
ref|XP_008240857.1|  PREDICTED: expansin-A6-like                        208   2e-60   
ref|NP_181300.1|  expansin-A3                                           209   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010111142.1|  hypothetical protein L484_010756                   208   2e-60   
ref|XP_010106493.1|  hypothetical protein L484_025251                   208   2e-60   
ref|XP_003518007.1|  PREDICTED: expansin-A1-like                        208   2e-60   
ref|XP_002881024.1|  ATEXPA6                                            208   2e-60   
gb|AAC96081.1|  alpha-expansin precursor                                208   2e-60   Nicotiana tabacum [American tobacco]
gb|ABR17119.1|  unknown                                                 208   2e-60   Picea sitchensis
ref|XP_010470942.1|  PREDICTED: expansin-A1-like                        208   2e-60   
gb|AFK34543.1|  unknown                                                 208   2e-60   
gb|ADC35364.1|  alpha-expansin 1                                        208   2e-60   Coffea arabica [arabica coffee]
gb|ADY68818.1|  expansin                                                208   2e-60   
gb|AAW88315.1|  expansin EXPA11                                         208   2e-60   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001055842.1|  Os05g0477600                                       208   2e-60   Oryza sativa Japonica Group [Japonica rice]
gb|KDP20458.1|  hypothetical protein JCGZ_05303                         208   2e-60   
ref|XP_008457477.1|  PREDICTED: expansin-A4-like                        208   2e-60   
ref|XP_006488339.1|  PREDICTED: expansin-A4-like                        208   2e-60   
ref|XP_006480833.1|  PREDICTED: expansin-A4-like                        208   2e-60   
gb|AAR09168.1|  alpha-expansin 1                                        208   2e-60   Populus tremula x Populus tremuloides
gb|ACA05166.1|  expansin 3                                              208   2e-60   Dimocarpus longan [longan]
ref|XP_006429095.1|  hypothetical protein CICLE_v10012518mg             208   2e-60   
ref|XP_006365348.1|  PREDICTED: expansin-A8-like                        208   2e-60   
ref|XP_002312253.1|  expansin 4 family protein                          208   2e-60   Populus trichocarpa [western balsam poplar]
ref|XP_009364387.1|  PREDICTED: expansin-A4                             208   2e-60   
ref|NP_001051731.1|  Os03g0822000                                       208   2e-60   Oryza sativa Japonica Group [Japonica rice]
gb|AFZ78606.1|  expansin protein                                        208   2e-60   
ref|XP_006477470.1|  PREDICTED: expansin-A1-like                        209   2e-60   
gb|AFQ21787.1|  EXP4 protein                                            207   2e-60   
gb|AAB81662.1|  expansin                                                207   2e-60   Oryza sativa Indica Group [Indian rice]
ref|XP_011070988.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A10...    207   2e-60   
gb|KHG20113.1|  Expansin-A4 -like protein                               208   2e-60   
ref|XP_006424843.1|  hypothetical protein CICLE_v10029094mg             208   2e-60   
emb|CAA59470.1|  orf                                                    208   3e-60   Pisum sativum [garden pea]
ref|XP_010917068.1|  PREDICTED: expansin-A10-like                       207   3e-60   
ref|XP_008367551.1|  PREDICTED: expansin-A1-like                        207   3e-60   
gb|AEN70907.1|  expansin                                                208   3e-60   
ref|NP_001288907.1|  expansin-A15-like precursor                        207   3e-60   
ref|XP_004154408.1|  PREDICTED: expansin-A4-like                        208   3e-60   
dbj|BAH36863.1|  alpha expansin                                         207   3e-60   Rosa hybrid cultivar
gb|KHN48407.1|  Expansin-A8                                             207   3e-60   
gb|ACN94264.1|  expansin                                                208   3e-60   Rehmannia glutinosa [Chinese foxglove]
ref|XP_011094866.1|  PREDICTED: expansin-A6                             208   3e-60   
ref|XP_011095130.1|  PREDICTED: expansin-A4-like                        208   3e-60   
gb|ADY68815.1|  expansin                                                207   3e-60   
gb|KFK32246.1|  hypothetical protein AALP_AA6G217100                    207   3e-60   
gb|KFK36651.1|  alpha-expansin 4                                        207   3e-60   
ref|XP_006294816.1|  hypothetical protein CARUB_v10023867mg             208   3e-60   
ref|XP_004490713.1|  PREDICTED: expansin-A8-like                        207   3e-60   
ref|XP_008780525.1|  PREDICTED: expansin-A15-like isoform X2            207   3e-60   
ref|XP_006410954.1|  hypothetical protein EUTSA_v10017095mg             208   3e-60   
ref|XP_010067412.1|  PREDICTED: expansin-A4                             209   3e-60   
emb|CDX76090.1|  BnaA04g03540D                                          207   4e-60   
ref|XP_009139160.1|  PREDICTED: expansin-A16-like                       207   4e-60   
gb|AFK39658.1|  unknown                                                 207   4e-60   
ref|XP_008777004.1|  PREDICTED: expansin-A4-like                        207   4e-60   
gb|AFK38404.1|  unknown                                                 207   4e-60   
ref|XP_006435550.1|  hypothetical protein CICLE_v10032484mg             207   4e-60   
emb|CDP02244.1|  unnamed protein product                                207   4e-60   
ref|XP_003544219.1|  PREDICTED: expansin-A6-like                        207   4e-60   
gb|AEQ55270.1|  expansin                                                207   4e-60   
ref|NP_001275780.1|  expansin 2 precursor                               207   4e-60   
emb|CAA04385.1|  Expansin                                               207   4e-60   
ref|NP_001242219.1|  uncharacterized protein LOC100777044 precursor     207   4e-60   
gb|ACJ85313.1|  unknown                                                 207   4e-60   
ref|XP_006302737.1|  hypothetical protein CARUB_v10020849mg             207   5e-60   
ref|XP_009587747.1|  PREDICTED: expansin-A3-like                        207   5e-60   
ref|XP_007009225.1|  Expansin A4, ALPHA 1.6,EXPA4                       207   5e-60   
gb|ADY68817.1|  expansin                                                207   5e-60   
gb|EYU18981.1|  hypothetical protein MIMGU_mgv1a012125mg                207   5e-60   
ref|XP_003527088.1|  PREDICTED: expansin-A15-like                       207   5e-60   
ref|XP_007158645.1|  hypothetical protein PHAVU_002G170300g             209   5e-60   
ref|XP_003616026.1|  Expansin                                           207   5e-60   
ref|XP_009388613.1|  PREDICTED: expansin-A7                             207   5e-60   
ref|XP_010264435.1|  PREDICTED: expansin-A4                             207   5e-60   
ref|XP_007205762.1|  hypothetical protein PRUPE_ppa010314mg             207   5e-60   
ref|XP_010937609.1|  PREDICTED: expansin-A4                             207   6e-60   
ref|XP_010511994.1|  PREDICTED: expansin-A1                             207   6e-60   
ref|XP_011031225.1|  PREDICTED: expansin-A4-like                        207   6e-60   
ref|XP_006644922.1|  PREDICTED: expansin-A2-like                        207   6e-60   
emb|CDP13911.1|  unnamed protein product                                206   6e-60   
gb|ACK43222.1|  expansin 2                                              207   6e-60   
ref|NP_001265970.1|  expansin-A8-like precursor                         207   6e-60   
ref|XP_006654542.1|  PREDICTED: expansin-A4-like                        206   6e-60   
ref|XP_010258310.1|  PREDICTED: expansin-A1 isoform X1                  207   7e-60   
ref|XP_010044491.1|  PREDICTED: expansin-A1-like                        206   7e-60   
gb|KFK34799.1|  hypothetical protein AALP_AA5G194700                    207   7e-60   
ref|XP_010554612.1|  PREDICTED: expansin-A4                             207   7e-60   
gb|ABM54492.1|  expansin 2                                              207   7e-60   
ref|XP_002312101.1|  alpha-expansin 9 precursor family protein          207   7e-60   
emb|CDP12277.1|  unnamed protein product                                206   7e-60   
ref|NP_001234881.1|  expansin9 precursor                                207   7e-60   
ref|XP_003607738.1|  Expansin                                           207   7e-60   
ref|XP_011019014.1|  PREDICTED: expansin-A8-like                        206   7e-60   
gb|KHG30766.1|  Expansin-A4 -like protein                               207   7e-60   
ref|XP_010427324.1|  PREDICTED: expansin-A16-like                       207   8e-60   
gb|AAC33529.1|  expansin                                                206   8e-60   
emb|CDY47883.1|  BnaA07g14280D                                          207   8e-60   
ref|XP_009419260.1|  PREDICTED: expansin-A7-like                        207   8e-60   
gb|EYU35820.1|  hypothetical protein MIMGU_mgv1a012373mg                206   8e-60   
ref|XP_003616412.1|  Expansin                                           206   8e-60   
ref|XP_009389577.1|  PREDICTED: expansin-A10-like                       206   8e-60   
ref|NP_001284471.1|  expansin-A4 precursor                              206   9e-60   
ref|XP_008242138.1|  PREDICTED: expansin-A8-like                        206   9e-60   
ref|XP_006291657.1|  hypothetical protein CARUB_v10017813mg             207   9e-60   
ref|NP_001240136.1|  expansin-A1-like precursor                         206   9e-60   
ref|XP_010920576.1|  PREDICTED: expansin-A4-like                        206   9e-60   
gb|AEQ55275.1|  expansin                                                206   9e-60   
gb|AAM12782.1|  putative expansin                                       206   9e-60   
ref|XP_006391003.1|  hypothetical protein EUTSA_v10019043mg             206   9e-60   
ref|XP_010032826.1|  PREDICTED: expansin-A10-like                       206   9e-60   
ref|XP_008798561.1|  PREDICTED: expansin-A8-like                        206   9e-60   
gb|ACA05165.1|  expansin 2                                              206   9e-60   
gb|AAT11859.2|  expansin 1                                              206   1e-59   
ref|XP_007017076.1|  Expansin A8, ALPHA 1.11,EXPA8                      206   1e-59   
ref|XP_008799850.1|  PREDICTED: expansin-A6-like                        206   1e-59   
ref|XP_003613849.1|  Expansin                                           206   1e-59   
ref|XP_002309181.2|  hypothetical protein POPTR_0006s10850g             206   1e-59   
gb|KHG29956.1|  Expansin-A4 -like protein                               206   1e-59   
ref|XP_003543517.1|  PREDICTED: expansin-A4                             206   1e-59   
ref|XP_010033123.1|  PREDICTED: expansin-A4                             206   1e-59   
gb|KHG01029.1|  Expansin-A15 -like protein                              206   1e-59   
ref|NP_178409.2|  expansin A15                                          206   1e-59   
gb|AEN70893.1|  expansin                                                206   1e-59   
gb|AAC32927.1|  putative expansin                                       206   1e-59   
ref|XP_002525458.1|  Alpha-expansin 15 precursor, putative              206   1e-59   
gb|KDP30638.1|  hypothetical protein JCGZ_16203                         206   1e-59   
gb|AFZ78600.1|  expansin protein                                        206   1e-59   
ref|XP_011042710.1|  PREDICTED: expansin-A4-like                        206   1e-59   
ref|XP_010258311.1|  PREDICTED: expansin-A1 isoform X2                  206   1e-59   
ref|XP_003529476.1|  PREDICTED: expansin-A15-like                       206   1e-59   
ref|XP_006403453.1|  hypothetical protein EUTSA_v10010989mg             206   1e-59   
ref|XP_010910535.1|  PREDICTED: expansin-A1-like                        206   1e-59   
ref|XP_010256907.1|  PREDICTED: expansin-A4                             206   1e-59   
ref|XP_011027216.1|  PREDICTED: expansin-A4                             206   2e-59   
ref|XP_008357089.1|  PREDICTED: expansin-A6                             206   2e-59   
emb|CDY45181.1|  BnaA06g33850D                                          206   2e-59   
ref|XP_010528352.1|  PREDICTED: expansin-A5                             205   2e-59   
ref|XP_008808309.1|  PREDICTED: expansin-A2-like                        206   2e-59   
gb|AAG13982.1|AF297521_1  expansin 1                                    206   2e-59   
gb|AFK44569.1|  unknown                                                 206   2e-59   
gb|AEN70895.1|  expansin                                                206   2e-59   
ref|XP_008384848.1|  PREDICTED: expansin-A4                             206   2e-59   
ref|XP_010460264.1|  PREDICTED: expansin-A10-like                       206   2e-59   
ref|XP_002532867.1|  Alpha-expansin 8 precursor, putative               205   2e-59   
ref|XP_002876856.1|  ATEXPA15                                           206   2e-59   
ref|XP_010931278.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A7        206   2e-59   
ref|XP_003519349.1|  PREDICTED: expansin-A4-like                        206   2e-59   
ref|XP_010504408.1|  PREDICTED: expansin-A16-like                       206   2e-59   
ref|XP_003523015.1|  PREDICTED: expansin-A15-like                       205   2e-59   
gb|AAM46998.1|AF512540_1  alpha-expansin precursor                      206   2e-59   
ref|XP_010425091.1|  PREDICTED: expansin-A15-like                       206   2e-59   
gb|AEN70900.1|  expansin                                                206   2e-59   
gb|ACO07292.1|  expansin 10                                             206   2e-59   
gb|AAB40634.1|  expansin                                                204   2e-59   
ref|XP_009410516.1|  PREDICTED: expansin-A4-like                        205   2e-59   
ref|XP_009124371.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A6        206   2e-59   
ref|XP_002313434.1|  alpha-expansin 1 family protein                    206   2e-59   
gb|AAW88314.1|  expansin EXPA10                                         205   2e-59   
ref|XP_009594513.1|  PREDICTED: expansin-A4-like                        205   2e-59   
ref|XP_010257816.1|  PREDICTED: expansin-A1                             205   2e-59   
dbj|BAC67192.1|  expansin                                               205   2e-59   
emb|CDY02943.1|  BnaC04g25430D                                          206   2e-59   
gb|AAR27327.1|  expansin EXPA1                                          205   2e-59   
gb|KDP35637.1|  hypothetical protein JCGZ_09075                         205   2e-59   
gb|AGF90536.1|  expansin 2                                              205   2e-59   
ref|XP_002523388.1|  Alpha-expansin 1 precursor, putative               205   2e-59   
ref|XP_009597793.1|  PREDICTED: expansin-A6-like                        205   2e-59   
ref|XP_004142066.1|  PREDICTED: expansin-A4-like                        205   2e-59   
gb|AAW88316.1|  expansin EXPA12                                         205   2e-59   
ref|XP_009360325.1|  PREDICTED: expansin-A1                             205   2e-59   
gb|AAV85475.1|  expansin                                                205   2e-59   
ref|XP_007157607.1|  hypothetical protein PHAVU_002G083600g             205   3e-59   
gb|ABK25460.1|  unknown                                                 205   3e-59   
ref|XP_002522457.1|  Alpha-expansin 1 precursor, putative               205   3e-59   
gb|KEH34458.1|  expansin A10                                            205   3e-59   
ref|XP_010937180.1|  PREDICTED: expansin-A10-like                       205   3e-59   
gb|ACB45302.1|  expansin EXPA11                                         205   3e-59   
ref|XP_009387743.1|  PREDICTED: expansin-A2-like                        205   3e-59   
emb|CBI16120.3|  unnamed protein product                                206   3e-59   
emb|CAC06433.1|  expansin                                               205   3e-59   
dbj|BAE06066.1|  expansin                                               205   3e-59   
dbj|BAO57279.1|  alpha-expansin                                         205   3e-59   
gb|KHN18562.1|  Expansin-A15                                            205   3e-59   
ref|XP_010516124.1|  PREDICTED: expansin-A16                            205   3e-59   
ref|XP_008389456.1|  PREDICTED: expansin-A10                            205   3e-59   
gb|AAB40635.1|  expansin                                                204   3e-59   
gb|ACM90160.1|  expansin 2                                              205   3e-59   
ref|XP_008802577.1|  PREDICTED: expansin-A10-like                       205   3e-59   
ref|XP_006395739.1|  hypothetical protein EUTSA_v10004804mg             205   3e-59   
ref|XP_002309061.1|  expansin family protein                            205   3e-59   
ref|XP_010502317.1|  PREDICTED: expansin-A15                            205   3e-59   
gb|KCW65541.1|  hypothetical protein EUGRSUZ_G02938                     205   3e-59   
gb|KCW52314.1|  hypothetical protein EUGRSUZ_J01729                     206   3e-59   
gb|AAF35901.1|AF230332_1  expansin 2                                    204   3e-59   
ref|XP_010103644.1|  hypothetical protein L484_011237                   205   3e-59   
ref|XP_006846223.1|  hypothetical protein AMTR_s00012p00230920          205   3e-59   
ref|XP_009353647.1|  PREDICTED: expansin-A6-like                        205   3e-59   
ref|XP_010536806.1|  PREDICTED: expansin-A14                            205   3e-59   
ref|XP_010651411.1|  PREDICTED: expansin-A10                            204   3e-59   
ref|XP_010093601.1|  hypothetical protein L484_006489                   205   3e-59   
ref|XP_008784594.1|  PREDICTED: expansin-A4-like                        205   3e-59   
ref|XP_009122138.1|  PREDICTED: expansin-A2                             205   3e-59   
ref|XP_006650810.1|  PREDICTED: expansin-A7-like                        205   3e-59   
gb|AAL31477.1|AF319472_1  alpha-expansin 6 precursor                    205   4e-59   
ref|XP_009613959.1|  PREDICTED: expansin-A6-like                        205   4e-59   
ref|XP_007099524.1|  Expansin A8, ALPHA 1.11,EXPA8                      205   4e-59   
emb|CDX70161.1|  BnaA10g25100D                                          205   4e-59   
ref|XP_008230781.1|  PREDICTED: expansin-A15                            204   4e-59   
gb|ACK43223.1|  alpha-expansin                                          204   4e-59   
ref|XP_011077214.1|  PREDICTED: expansin-A6-like                        205   4e-59   
ref|XP_009349313.1|  PREDICTED: expansin-A6-like                        205   4e-59   
ref|XP_009629442.1|  PREDICTED: expansin-A10-like                       204   4e-59   
gb|ABK93541.1|  unknown                                                 205   4e-59   
gb|AAM22621.1|  expansin 7 precursor                                    204   4e-59   
gb|AAB38074.1|  expansin Os-EXPA2                                       204   4e-59   
ref|XP_010922733.1|  PREDICTED: expansin-A2-like                        204   4e-59   
gb|KHG24991.1|  Expansin-A4 -like protein                               205   4e-59   
gb|AEQ55290.1|  expansin                                                205   4e-59   
gb|KEH30169.1|  expansin A10                                            204   4e-59   
ref|XP_009374380.1|  PREDICTED: expansin-A4-like                        204   5e-59   
gb|EPS66901.1|  hypothetical protein M569_07876                         203   5e-59   
ref|XP_006443365.1|  hypothetical protein CICLE_v10021887mg             204   5e-59   
ref|XP_009622932.1|  PREDICTED: expansin-A8-like                        204   5e-59   
ref|XP_008812336.1|  PREDICTED: expansin-A16-like                       206   5e-59   
ref|XP_004492358.1|  PREDICTED: expansin-A6-like                        204   5e-59   
gb|EYU28773.1|  hypothetical protein MIMGU_mgv1a012521mg                204   5e-59   
ref|XP_009129104.1|  PREDICTED: expansin-A15                            204   5e-59   
gb|ACK36943.1|  expansin                                                204   5e-59   
gb|ABA62612.1|  expansin                                                204   5e-59   
ref|XP_006366709.1|  PREDICTED: expansin-A10-like                       204   5e-59   
ref|XP_008783801.1|  PREDICTED: expansin-A10                            204   5e-59   
ref|XP_010921134.1|  PREDICTED: expansin-A2-like isoform X1             204   6e-59   
gb|AAL87025.1|  cell wall protein Exp1 precursor                        204   6e-59   
ref|XP_008648280.1|  PREDICTED: alpha-expansin 5 isoform X1             204   6e-59   
ref|XP_009765412.1|  PREDICTED: expansin-A10                            204   6e-59   
gb|AAG13983.1|AF297522_1  expansin 2                                    204   6e-59   
ref|XP_004297292.1|  PREDICTED: expansin-A1-like                        204   6e-59   
ref|XP_009776279.1|  PREDICTED: expansin-A8-like isoform X1             204   6e-59   
ref|XP_010043148.1|  PREDICTED: expansin-A4-like                        204   7e-59   
ref|XP_009384320.1|  PREDICTED: expansin-A2-like                        204   7e-59   
ref|XP_011076589.1|  PREDICTED: expansin-A4-like                        204   7e-59   
ref|NP_001266116.1|  expansin-A15-like precursor                        204   7e-59   
gb|AEQ55277.1|  expansin                                                204   7e-59   
gb|AEQ55281.1|  expansin                                                204   7e-59   
ref|XP_006600699.1|  PREDICTED: expansin-A15-like isoform X2            204   7e-59   
gb|KDP41217.1|  hypothetical protein JCGZ_15624                         204   7e-59   
gb|KDP31268.1|  hypothetical protein JCGZ_11644                         204   7e-59   
gb|ACZ57921.1|  expansin protein 1                                      204   8e-59   
gb|ACF84785.1|  unknown                                                 204   8e-59   
ref|XP_003552173.1|  PREDICTED: expansin-A4                             204   8e-59   
emb|CDY24897.1|  BnaC03g22750D                                          204   8e-59   
gb|ABC55453.1|  expansin protein                                        204   9e-59   
gb|ADN03964.1|  EXP1                                                    204   9e-59   
ref|XP_009767600.1|  PREDICTED: expansin-A15-like                       204   9e-59   
ref|XP_003552064.1|  PREDICTED: expansin-A4                             204   9e-59   
ref|XP_008458865.1|  PREDICTED: expansin-A4                             204   9e-59   
gb|ACG46282.1|  alpha-expansin 6 precursor                              204   9e-59   
emb|CDP00110.1|  unnamed protein product                                204   9e-59   
ref|XP_003544930.1|  PREDICTED: expansin-A8                             204   9e-59   
ref|XP_007215892.1|  hypothetical protein PRUPE_ppa010654mg             203   1e-58   
ref|NP_001238053.1|  uncharacterized protein LOC100527059 precursor     203   1e-58   
ref|XP_003549683.2|  PREDICTED: expansin-A15-like isoform X1            204   1e-58   
ref|XP_010525408.1|  PREDICTED: expansin-A8                             204   1e-58   



>gb|KHN02295.1| Expansin-A16 [Glycine soja]
Length=279

 Score =   228 bits (581),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 152/235 (65%), Gaps = 16/235 (7%)
 Frame = +2

Query  191  VFGDGNSGWSEAHATFYGPPEGTVGGACGLQNQ-KDTYAPYTTALSAALFKNAESCGACY  367
            VFG G   W +A+ATFY    GT GGACG  +  KD Y   T ALS+ LFK+ E+CGACY
Sbjct  49   VFGPGP--WRQAYATFYEGGSGTFGGACGYDDVVKDGYGLDTAALSSVLFKHGEACGACY  106

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCPTG------DGKWCTPPRAHFDLSMPAYLKIGEYK  529
             ++CVN+T  CK +  + VTAT+LCP        +G WC PPR HFDL+ PAYLKI +YK
Sbjct  107  EIKCVNSTQWCKPKPSVFVTATNLCPPNYSQPGDNGGWCNPPRQHFDLAKPAYLKIAQYK  166

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKK---  700
            AG + VQY +VPC ++GG RFTI G+ YFNL        +   +    E    G+KK   
Sbjct  167  AGIVPVQYRRVPCKKQGGIRFTITGNPYFNL----VKVWNVGGAGDITEVQVKGDKKLIN  222

Query  701  WVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKN  865
            W  LKRNWGEKWETNA L G+ L F+V   DG+  TS  VAPK+WQ+GQTFEGKN
Sbjct  223  WTNLKRNWGEKWETNAMLVGETLTFRVKASDGRYSTSSSVAPKNWQFGQTFEGKN  277



>emb|CDX80810.1| BnaC03g00640D [Brassica napus]
Length=261

 Score =   227 bits (579),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 169/265 (64%), Gaps = 15/265 (6%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGL  280
            + V ++TA     + A +L  V   +P V+  G   W  AHATFYG  +  GT+GGACG 
Sbjct  1    MVVKVMTAMAIMVVAALTLTTVNAKIPGVYTGGP--WVNAHATFYGEADASGTMGGACGY  58

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF N  SCGAC+ L+CVN+ G C   NP I++TAT+ CP   
Sbjct  59   GNLYSQGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNF  118

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
               + +G WC PPR HFDL+MP +L I +YKAG + V Y ++PC +KGG RFTI G +YF
Sbjct  119  AQASDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGMRFTINGSKYF  178

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV V+NV G+G+V  V V+ +  G   W+ L RNWG+ W++NA L G++L F+V T DG
Sbjct  179  NLVLVTNVAGAGNVQMVSVKGSNTG---WLGLSRNWGQNWQSNAILVGQSLSFRVKTSDG  235

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            ++ TS  + P +WQ+GQTF GKN R
Sbjct  236  RSSTSNNIVPSNWQFGQTFSGKNFR  260



>ref|XP_009130690.1| PREDICTED: expansin-A9-like [Brassica rapa]
 emb|CDY55128.1| BnaA03g55050D [Brassica napus]
Length=261

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/261 (48%), Positives = 168/261 (64%), Gaps = 15/261 (6%)
 Frame = +2

Query  119  IITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            ++TA     + A +L  V   +P V+  G   W  AHATFYG  +  GT+GGACG  N  
Sbjct  5    LMTAMAIMVVAALTLTTVNAKIPGVYTGGP--WVNAHATFYGEADASGTMGGACGYGNLY  62

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCGAC+ L+CVN+ G C   NP I++TAT+ CP      +
Sbjct  63   SQGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQAS  122

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR HFDL+MP +L I +YKAG + V Y ++PC +KGG RFTI G +YFNLV 
Sbjct  123  DNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGMRFTINGSKYFNLVL  182

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            V+NV G+G+V  V V+ +  G   W+ L RNWG+ W++NA L G++L F+V T DG++ T
Sbjct  183  VTNVAGAGNVQMVSVKGSNTG---WLGLSRNWGQNWQSNAILVGQSLSFRVKTSDGRSST  239

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S+ + P +WQ+GQTF GKN R
Sbjct  240  SKNIVPSNWQFGQTFSGKNFR  260



>ref|XP_003553565.1| PREDICTED: expansin-A16-like [Glycine max]
Length=287

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 152/235 (65%), Gaps = 16/235 (7%)
 Frame = +2

Query  191  VFGDGNSGWSEAHATFYGPPEGTVGGACGLQNQ-KDTYAPYTTALSAALFKNAESCGACY  367
            VFG G   W +A+ATFY    GT GGACG  +  KD Y   T ALS+ LFK+ E+CGACY
Sbjct  57   VFGPGP--WRQAYATFYEGGSGTFGGACGYDDVVKDGYGLDTAALSSVLFKHGEACGACY  114

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCPTG------DGKWCTPPRAHFDLSMPAYLKIGEYK  529
             ++CVN+T  CK +  + VTAT+LCP        +G WC PPR HFDL+ PAYLKI +YK
Sbjct  115  EIKCVNSTQWCKPKPSVFVTATNLCPPNYSQPGDNGGWCNPPRQHFDLAKPAYLKIAQYK  174

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKK---  700
            AG + VQY +VPC ++GG RFTI G+ YFNL        +   +    E    G+KK   
Sbjct  175  AGIVPVQYRRVPCKKQGGIRFTITGNPYFNL----VKVWNVGGAGDITEVQVKGDKKLIN  230

Query  701  WVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKN  865
            W  LKRNWGEKWETNA L G+ L F+V   DG+  TS  VAPK+WQ+GQTFEGKN
Sbjct  231  WTNLKRNWGEKWETNAMLVGETLTFRVKASDGRYSTSSSVAPKNWQFGQTFEGKN  285



>ref|XP_006398690.1| hypothetical protein EUTSA_v10014430mg [Eutrema salsugineum]
 gb|ESQ40143.1| hypothetical protein EUTSA_v10014430mg [Eutrema salsugineum]
Length=261

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 173/273 (63%), Gaps = 23/273 (8%)
 Frame = +2

Query  83   MISKKYL*LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--G  256
            M +K    ++V+++ A  AT + A         +P V+  G   W  AHATFYG  +  G
Sbjct  1    MAAKVITVMAVMVVAALTATTVSAK--------IPGVYTGGP--WVNAHATFYGEADASG  50

Query  257  TVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTA  430
            T+GGACG  N     Y   T ALS ALF N  SCGAC+ L+CVN+ G C   NP I++TA
Sbjct  51   TMGGACGYGNLYSQGYGVNTAALSTALFNNGVSCGACFELKCVNDPGWCLPGNPSILITA  110

Query  431  TDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERF  592
            T+ CP      + +G WC PPR HFDL+MP +L I +Y+AG + V Y ++PC +KGG RF
Sbjct  111  TNFCPPNFAQASDNGGWCNPPREHFDLAMPMFLSIAKYRAGIVPVSYRRIPCRKKGGMRF  170

Query  593  TIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALD  772
            TI G +YFNLV V+NV G+G+V  V V+ +     +W+ L RNWG+ W++NA L G++L 
Sbjct  171  TINGSKYFNLVLVTNVAGAGNVVSVSVKGS---NTQWMVLSRNWGQNWQSNAILVGQSLS  227

Query  773  FKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            F+V T DG++ TS+ + P +WQ+GQTF GKN R
Sbjct  228  FRVRTSDGRSSTSKNIVPSNWQFGQTFSGKNFR  260



>ref|XP_003609913.1| Expansin [Medicago truncatula]
 gb|AES92110.1| expansin A1 [Medicago truncatula]
Length=284

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 146/228 (64%), Gaps = 14/228 (6%)
 Frame = +2

Query  215  WSEAHATFYGPPEGTVGGACGLQNQ-KDTYAPYTTALSAALFKNAESCGACYALRCVNNT  391
            W +AHATFY    GT GGACG ++  KD Y   T A+S  LF    +CGACY +RCV++ 
Sbjct  61   WKKAHATFYEGGSGTFGGACGYEDVVKDGYGLDTAAVSTVLFNKGLACGACYEIRCVDSP  120

Query  392  GQCKT-QNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQ  550
              CK  Q  I VTATDLCP      + +G WC PPR HFDL+ PAYLKI EYKAG I VQ
Sbjct  121  QGCKPGQASIKVTATDLCPPNFAQSSENGGWCNPPREHFDLAKPAYLKIAEYKAGIIPVQ  180

Query  551  YSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKK--WVPLKRNW  724
            Y +VPC R+GG  FTI G+ YFNL        +   +   V+    GE K  W  LKRNW
Sbjct  181  YRRVPCKRQGGIHFTITGNPYFNL----IKVANVGGAGDVVKVQVKGEDKLTWTDLKRNW  236

Query  725  GEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNS  868
            GEKWET A L+G+ L FKVTT DG+ +TS ++ PK WQ+GQTF GKN+
Sbjct  237  GEKWETGAMLTGETLTFKVTTSDGRCITSERITPKGWQFGQTFVGKNA  284



>ref|XP_008343537.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 164/256 (64%), Gaps = 15/256 (6%)
 Frame = +2

Query  134  MATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYA  304
            +A+ +  AS ++V   +P V+  G   W +AHATFYG  +  GT+GGACG  N     Y 
Sbjct  10   IASLMALASTIVVEARIPGVYTGG--AWQDAHATFYGGSDASGTMGGACGYGNLYSQGYG  67

Query  305  PYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKW  463
              T ALS ALF N  SCGAC+ L+C N    CK+ +P I VTAT+ CP      + DG W
Sbjct  68   VNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDDGGW  127

Query  464  CTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvg  643
            C PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI GH+YFNLV + NV 
Sbjct  128  CNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHNVA  187

Query  644  gsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVA  823
            G+GD+ KV V+        W+ L RNWG+ W++NA L G++L F+VT  D +  TS  + 
Sbjct  188  GAGDIVKVYVKGT---NTPWMSLSRNWGQNWQSNAILVGQSLSFRVTASDRRTSTSWNIV  244

Query  824  PKSWQYGQTFEGKNSR  871
            P +WQ+GQTF GKN R
Sbjct  245  PSNWQFGQTFTGKNFR  260



>ref|XP_010558331.1| PREDICTED: expansin-A9 [Tarenaya hassleriana]
Length=268

 Score =   223 bits (567),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 131/274 (48%), Positives = 174/274 (64%), Gaps = 19/274 (7%)
 Frame = +2

Query  83   MISKKYL*LSVLI-ITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--  253
            M S+ Y  L  L+ +  A+     AA    V   +P V+  G   W +AHATFYG  +  
Sbjct  1    MASESYRVLMKLVAVVPAVTASFLAAE---VDAKIPGVYSGGP--WIDAHATFYGGADAS  55

Query  254  GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVT  427
            GT+GGACG  N     Y   T ALS ALF N  SCGAC+ L+C+++   C   NP I++T
Sbjct  56   GTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCIDDPRWCLPGNPSILIT  115

Query  428  ATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGER  589
            AT+ CP      + +G WC PPR HFDL+MP +LK+ +YKAG + V Y +VPC +KGG R
Sbjct  116  ATNFCPPNFAQASDNGGWCNPPREHFDLAMPMFLKLAQYKAGIVPVSYRRVPCRKKGGIR  175

Query  590  FTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKAL  769
            FTI G +YFNLV V+NV G+GDV KV V+       +W+ + RNWG+ W++NA L G+AL
Sbjct  176  FTINGFKYFNLVLVTNVAGAGDVVKVSVKGT---NTEWITMSRNWGQNWQSNAVLVGQAL  232

Query  770  DFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
             F+VTT DG++  S+ +AP SWQ+GQTF GKN R
Sbjct  233  SFRVTTSDGRSSASKNIAPPSWQFGQTFSGKNFR  266



>ref|XP_009122794.1| PREDICTED: expansin-A9 [Brassica rapa]
 emb|CDY40344.1| BnaA10g27240D [Brassica napus]
Length=258

 Score =   222 bits (566),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 124/265 (47%), Positives = 169/265 (64%), Gaps = 23/265 (9%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGL  280
            ++++++ A +AT + A         +P V+  G   W  AHATFYG  +  GT+GGACG 
Sbjct  6    MTLMVVAALVATTVNAR--------IPGVYTGGP--WVNAHATFYGEADASGTMGGACGY  55

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF N  SCGAC+ L+CVN+ G C   NP I++TAT+ CP   
Sbjct  56   GNLYSQGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNF  115

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
               + +G WC PPR HFDL+MP +L I +Y+AG + V Y +VPC +KGG RFTI G +YF
Sbjct  116  AQASDNGGWCNPPREHFDLAMPMFLTIAKYRAGIVPVSYRRVPCRKKGGIRFTINGSKYF  175

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV V+NV G+G+V  V V+ +      W+ L RNWG+ W++NA L G++L F+V T DG
Sbjct  176  NLVLVTNVAGAGNVQMVSVKGS---NTAWLGLSRNWGQNWQSNAILVGQSLSFRVKTSDG  232

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            ++ TS  + P +WQ+GQTF GKN R
Sbjct  233  RSSTSNNIVPSNWQFGQTFSGKNFR  257



>ref|XP_002870966.1| ATEXPA9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47225.1| ATEXPA9 [Arabidopsis lyrata subsp. lyrata]
Length=258

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 169/265 (64%), Gaps = 26/265 (10%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGL  280
            ++V+++TA             V   +P V+  G   W  AHATFYG  +  GT+GGACG 
Sbjct  9    MAVMVVTA-----------FTVNAKIPGVYTGG--PWINAHATFYGEADASGTMGGACGY  55

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF N  SCG+CY L+CVN+ G C   NP I+VTAT+ CP   
Sbjct  56   GNLYSQGYGVNTAALSTALFNNGLSCGSCYELKCVNDPGWCLPGNPSILVTATNFCPPNF  115

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
               + DG WC PPR HFDL+MP +L I +YKAG + V Y ++PC +KGG RFTI G +YF
Sbjct  116  NQASDDGGWCNPPREHFDLAMPMFLTIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKYF  175

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV V+NV G+GDV+KV V+       +W+ L RNWG+ W++NA L G++L F+V T DG
Sbjct  176  NLVLVTNVAGAGDVNKVSVKGT---NTQWLDLSRNWGQNWQSNAVLIGQSLSFRVKTSDG  232

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            ++ TS  +AP +WQ+GQT+ GKN R
Sbjct  233  RSSTSNNIAPSNWQFGQTYSGKNFR  257



>emb|CDY10456.1| BnaCnng03570D [Brassica napus]
Length=258

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/265 (47%), Positives = 169/265 (64%), Gaps = 23/265 (9%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGL  280
            ++++++ A +AT + A         +P V+  G   W  AHATFYG  +  GT+GGACG 
Sbjct  6    MTLMVVAALVATTVNAR--------IPGVYTGGP--WVNAHATFYGEADASGTMGGACGY  55

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF N  SCGAC+ L+CVN+ G C   NP I++TAT+ CP   
Sbjct  56   GNLYSQGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNF  115

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
               + +G WC PPR HFDL+MP +L I +Y+AG + V Y +VPC +KGG RFTI G +YF
Sbjct  116  AQASDNGGWCNPPREHFDLAMPMFLTIAKYRAGIVPVSYRRVPCRKKGGVRFTINGSKYF  175

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV V+NV G+G+V  V V+ +  G   W+ L RNWG+ W++NA L G++L F+V   DG
Sbjct  176  NLVLVTNVAGAGNVQMVSVKGSNTG---WLGLSRNWGQNWQSNAILVGQSLSFRVRASDG  232

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            ++ TS  + P +WQ+GQTF GKN R
Sbjct  233  RSSTSNNIVPSNWQFGQTFSGKNFR  257



>ref|XP_010490643.1| PREDICTED: expansin-A9 [Camelina sativa]
Length=258

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 172/273 (63%), Gaps = 26/273 (10%)
 Frame = +2

Query  83   MISKKYL*LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--G  256
            M +K    ++V+++TA             V   +P V+  G   W+ AHATFYG  +  G
Sbjct  1    MAAKVLTLMAVMVVTA-----------FTVNAKIPGVYNGGP--WTNAHATFYGEADASG  47

Query  257  TVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTA  430
            T+GGACG  N     Y   T ALS ALF N  SCG+C+ L+CVN+ G C   NP I++TA
Sbjct  48   TMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITA  107

Query  431  TDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERF  592
            T+ CP      + +G WC PPR HFDL+MP +L I +YKAG + V Y ++PC +KGG RF
Sbjct  108  TNFCPPNFAQASDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRF  167

Query  593  TIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALD  772
            TI G ++FNLV V+NV G+GDV KV V+       +W+ L RNWG+ W++NA L G++L 
Sbjct  168  TINGFKFFNLVLVTNVAGAGDVRKVSVKGT---NTQWLDLSRNWGQNWQSNAVLVGQSLS  224

Query  773  FKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            F+V T DG++ TS  VAP +WQ+GQT+ GKN R
Sbjct  225  FRVKTSDGRSSTSNNVAPSNWQFGQTYSGKNFR  257



>ref|XP_010423881.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 172/273 (63%), Gaps = 26/273 (10%)
 Frame = +2

Query  83   MISKKYL*LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--G  256
            M +K    ++V+++TA           L V   +P V+  G   W  AHATFYG  +  G
Sbjct  1    MAAKVLTLMAVMVVTA-----------LTVNAKIPGVYNGGP--WVNAHATFYGGADASG  47

Query  257  TVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTA  430
            T+GGACG  N     Y   T ALS ALF N  SCG+C+ L+CVN+ G C   NP I++TA
Sbjct  48   TMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITA  107

Query  431  TDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERF  592
            T+ CP      + +G WC PPR HFDL+MP +L I +YKAG + V Y ++PC +KGG RF
Sbjct  108  TNFCPPNFAQASDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRF  167

Query  593  TIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALD  772
            TI G ++FNLV V+NV G+GDV KV V+       +W+ L RNWG+ W++NA L G++L 
Sbjct  168  TINGFKFFNLVLVTNVAGAGDVRKVSVKGT---NTQWLDLSRNWGQNWQSNAVLVGQSLS  224

Query  773  FKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            F+V T DG++ TS  +AP +WQ+GQT+ GKN R
Sbjct  225  FRVKTSDGRSSTSNNIAPSNWQFGQTYSGKNFR  257



>ref|XP_010452058.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 168/263 (64%), Gaps = 20/263 (8%)
 Frame = +2

Query  113  VLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN  286
            VL + A M      A+ L V   +P V+  G   W  AHATFYG  +  GT+GGACG  N
Sbjct  5    VLTLMAVMV-----ATALTVNAKIPGVYNGGP--WINAHATFYGGADASGTMGGACGYGN  57

Query  287  -QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP-----  445
                 Y   T ALS ALF N  SCG+C+ L+CVN+ G C   NP I++TAT+ CP     
Sbjct  58   LYSQGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNFAQ  117

Query  446  -TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNL  622
             + +G WC PPR HFDL+MP +L I +YKAG + V Y ++PC +KGG RFTI G ++FNL
Sbjct  118  ASDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKFFNL  177

Query  623  vtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKA  802
            V V+NV G+GDV KV V+       +W+ L RNWG+ W++NA L G++L F+V T DG++
Sbjct  178  VLVTNVAGAGDVRKVSVKGT---NTQWLDLSRNWGQNWQSNAVLVGQSLSFRVKTSDGRS  234

Query  803  VTSRKVAPKSWQYGQTFEGKNSR  871
             TS  +AP +WQ+GQT+ GKN R
Sbjct  235  STSNNIAPSNWQFGQTYSGKNFR  257



>ref|NP_195846.1| expansin A9 [Arabidopsis thaliana]
 sp|Q9LZ99.1|EXPA9_ARATH RecName: Full=Expansin-A9; Short=AtEXPA9; AltName: Full=Alpha-expansin-9; 
Short=At-EXP9; Short=AtEx9; AltName: Full=Ath-ExpAlpha-1.10; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB85531.1| expansin precursor-like protein [Arabidopsis thaliana]
 gb|AAK96777.1| expansin precursor-like protein [Arabidopsis thaliana]
 gb|AAL47389.1| expansin precursor-like protein [Arabidopsis thaliana]
 gb|AAM63290.1| expansin precursor-like protein [Arabidopsis thaliana]
 gb|AED90451.1| expansin A9 [Arabidopsis thaliana]
Length=258

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 172/273 (63%), Gaps = 26/273 (10%)
 Frame = +2

Query  83   MISKKYL*LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--G  256
            M +K    ++V+++TA  A              +P V+  G   W  AHATFYG  +  G
Sbjct  1    MAAKVITFMAVMVVTAFTANA-----------KIPGVYTGGP--WINAHATFYGEADASG  47

Query  257  TVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTA  430
            T+GGACG  N     Y   T ALS ALF N  SCG+C+ L+C+N+ G C   NP I++TA
Sbjct  48   TMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGSCFELKCINDPGWCLPGNPSILITA  107

Query  431  TDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERF  592
            T+ CP      + +G WC PPR HFDL+MP +L I +YKAG + V Y ++PC +KGG RF
Sbjct  108  TNFCPPNFNQASDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRF  167

Query  593  TIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALD  772
            TI G +YFNLV V+NV G+GDV KV V+ +     +W+ L RNWG+ W++NA L G++L 
Sbjct  168  TINGFKYFNLVLVTNVAGAGDVIKVSVKGS---NTQWLDLSRNWGQNWQSNALLVGQSLS  224

Query  773  FKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            F+V T DG++ TS  +AP +WQ+GQT+ GKN R
Sbjct  225  FRVKTSDGRSSTSNNIAPSNWQFGQTYSGKNFR  257



>emb|CDY48101.1| BnaC02g03580D [Brassica napus]
Length=261

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 153/229 (67%), Gaps = 13/229 (6%)
 Frame = +2

Query  215  WSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVN  385
            W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGAC+ L+CVN
Sbjct  35   WVNAHATFYGEADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCVN  94

Query  386  NTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIH  544
            + G C   NP I++TAT+ CP      + +G WC PPR HFDL+MP +L I +Y+AG + 
Sbjct  95   DPGWCLPGNPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAMPMFLTIAKYRAGIVP  154

Query  545  VQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNW  724
            V Y +VPC +KGG RFTI G +YFNLV V+NV G+G+V  V V+ +  G   W+ L RNW
Sbjct  155  VSYRRVPCRKKGGMRFTINGSKYFNLVLVTNVAGAGNVQMVSVKGSNTG---WLGLSRNW  211

Query  725  GEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            G+ W++NA L G++L F+V T DG++ TS  + P +WQ+GQTF GKN R
Sbjct  212  GQNWQSNAILVGQSLSFRVKTSDGRSSTSNNIVPSNWQFGQTFSGKNFR  260



>ref|NP_001288956.1| expansin-A9-like precursor [Brassica rapa]
 gb|AGM16351.1| alpha-expansin protein 9 [Brassica rapa]
Length=261

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 158/240 (66%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  S
Sbjct  26   IPGVYTGGP--WVNAHATFYGEADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLS  83

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ L+CVN+ G C   NP I++TAT+ CP      + +G WC PPR HFDL+MP +L
Sbjct  84   CGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAMPMFL  143

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
             I +Y+AG + V Y +VPC +KGG RFTI G +YFNLV V+NV G+G+V  V V+ +  G
Sbjct  144  TIAKYRAGIVPVSYRRVPCRKKGGMRFTINGSKYFNLVLVTNVAGAGNVQMVSVKGSNTG  203

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
               W+ L RNWG+ W++NA L G++L F+V T DG++ TS  + P +WQ+GQTF GKN R
Sbjct  204  ---WLGLSRNWGQNWQSNAILVGQSLSFRVKTSDGRSSTSNNIVPSNWQFGQTFSGKNFR  260



>emb|CDY04847.1| BnaAnng00290D [Brassica napus]
Length=261

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 158/240 (66%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  S
Sbjct  26   IPGVYTGGP--WVNAHATFYGEADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLS  83

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ L+CVN+ G C   NP I++TAT+ CP      + +G WC PPR HFDL+MP +L
Sbjct  84   CGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAMPMFL  143

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
             I +Y+AG + V Y +VPC +KGG RFTI G +YFNLV V+NV G+G+V  V V+ +  G
Sbjct  144  TIAKYRAGIVPVSYRRVPCRKKGGMRFTINGSKYFNLVLVTNVAGAGNVQMVSVKGSNTG  203

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
               W+ L RNWG+ W++NA L G++L F+V T DG++ TS  + P +WQ+GQTF GKN R
Sbjct  204  ---WLGLSRNWGQNWQSNAILVGQSLSFRVKTSDGRSSTSNNIVPSNWQFGQTFSGKNFR  260



>ref|XP_009380637.1| PREDICTED: expansin-A4 [Musa acuminata subsp. malaccensis]
Length=262

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 166/264 (63%), Gaps = 15/264 (6%)
 Frame = +2

Query  110  SVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQ  283
            S+    AA    + A+S L+    +P V+  G   W  AHATFYG  +  GT+GGACG  
Sbjct  3    SICSAVAATVALVLASSALLADARIPGVYTGGQ--WQSAHATFYGGSDASGTMGGACGYG  60

Query  284  N-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP----  445
            N     Y   T ALS ALF +  SCGAC+ ++C ++   CK  +P I +TAT+ CP    
Sbjct  61   NLYSQGYGVETAALSTALFNDGLSCGACFEIKCADDPRWCKGGSPSIFITATNFCPPNYA  120

Query  446  --TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFN  619
              + DG WC PPR HFDL+MP +LKI EY+AG + V Y +VPC + GG RFTI G +YFN
Sbjct  121  LPSDDGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFQYFN  180

Query  620  LvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGK  799
            LV ++NV G+GD+ +  V+ +  G   W+P+ RNWG+ W++NA L G++L F+VT  D +
Sbjct  181  LVLITNVAGAGDIIRATVKGSRTG---WMPMSRNWGQNWQSNAALVGQSLSFRVTGSDHR  237

Query  800  AVTSRKVAPKSWQYGQTFEGKNSR  871
              TS  +AP +WQ+GQTF GKN R
Sbjct  238  TSTSWNIAPATWQFGQTFSGKNFR  261



>ref|XP_009343581.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 163/256 (64%), Gaps = 15/256 (6%)
 Frame = +2

Query  134  MATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYA  304
            +A+ +  AS ++V   +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y 
Sbjct  10   IASLMALASTIVVEARIPGVYTGG--AWQGAHATFYGGSDASGTMGGACGYGNLYSQGYG  67

Query  305  PYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKW  463
              T ALS ALF N  SCGAC+ ++C N    CK+ +P I VTAT+ CP      + +G W
Sbjct  68   VNTAALSTALFNNGLSCGACFEIKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDNGGW  127

Query  464  CTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvg  643
            C PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI GH+YFNLV + NV 
Sbjct  128  CNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHNVA  187

Query  644  gsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVA  823
            G+GD+ KV V+        W+ L RNWG+ W++NA L G++L F+VT  D +  TS  + 
Sbjct  188  GAGDIVKVYVKGT---NTPWMSLSRNWGQNWQSNAILVGQSLSFRVTASDRRTSTSWNIV  244

Query  824  PKSWQYGQTFEGKNSR  871
            P +WQ+GQTF GKN R
Sbjct  245  PSNWQFGQTFTGKNFR  260



>ref|XP_009357738.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
 ref|XP_009357739.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/263 (48%), Positives = 165/263 (63%), Gaps = 19/263 (7%)
 Frame = +2

Query  113  VLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN  286
            +L I + MA     AS ++V   +P V+  G   W +AHATFYG  +  GT+GGACG  N
Sbjct  7    LLCIVSLMAL----ASTIVVDARIPGVYTGG--AWQDAHATFYGGSDASGTMGGACGYGN  60

Query  287  -QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP-----  445
                 Y   T ALS ALF N  SCGAC+ L+C N    CK+ +P I VTAT+ CP     
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  446  -TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNL  622
             + +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI GH+YFNL
Sbjct  121  PSDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNL  180

Query  623  vtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKA  802
            V + NV G+GD+ K  V+        W+ L RNWG+ W++N+ L G++L F+VT  D + 
Sbjct  181  VLIHNVAGAGDIVKAYVKGT---NTPWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRT  237

Query  803  VTSRKVAPKSWQYGQTFEGKNSR  871
             TS  + P +WQ+GQTF GKN R
Sbjct  238  STSWNIVPSNWQFGQTFTGKNFR  260



>ref|XP_008371813.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/263 (48%), Positives = 165/263 (63%), Gaps = 19/263 (7%)
 Frame = +2

Query  113  VLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN  286
            +L I + MA     AS ++V   +P V+  G   W +AHATFYG  +  GT+GGACG  N
Sbjct  7    LLCIVSLMAL----ASTIVVDARIPGVYTGG--AWQDAHATFYGGSDASGTMGGACGYGN  60

Query  287  -QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP-----  445
                 Y   T ALS ALF +  SCGAC+ L+C N    CK+ +P I VTAT+ CP     
Sbjct  61   LYSQGYGVNTAALSTALFNSGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  446  -TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNL  622
             + DG WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI GH+YFNL
Sbjct  121  PSDDGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNL  180

Query  623  vtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKA  802
            V + NV G+GD+ K  V+        W+ L RNWG+ W++N+ L G++L F+VT  D + 
Sbjct  181  VLIHNVAGAGDIVKAYVKGT---NTPWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRT  237

Query  803  VTSRKVAPKSWQYGQTFEGKNSR  871
             TS  + P +WQ+GQTF GKN R
Sbjct  238  STSWNIVPSNWQFGQTFTGKNFR  260



>dbj|BAJ10398.1| alpha-expansin [Dianthus caryophyllus]
Length=252

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 163/252 (65%), Gaps = 13/252 (5%)
 Frame = +2

Query  131  AMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTY  301
            A +  L +  +LI+   L   +GD   GW+ AHATFYG  +  GT+GGACG  N     Y
Sbjct  2    APSLTLISTIVLILFTCLHGAYGDYGGGWTSAHATFYGGGDASGTMGGACGYGNLYSQGY  61

Query  302  APYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKW  463
               T ALS ALF N  SCGACY L+C  +   C     I+VTAT+ CP        +G W
Sbjct  62   GTSTAALSTALFNNGLSCGACYQLQCSGDPKWC-LPGSIMVTATNFCPPNPSLPNDNGGW  120

Query  464  CTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvg  643
            C PP  HFDL+ P++L+I +Y+AG + V + +VPC+RKGG RFTI GH YFNLV V+NVG
Sbjct  121  CNPPLQHFDLAEPSFLRIAQYRAGIVPVSFRRVPCARKGGVRFTINGHSYFNLVLVTNVG  180

Query  644  gsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVA  823
            G+GDV  V ++ +  G   W P+ RNWG+ W++N  ++G++L F+VTT DG+ +TS  VA
Sbjct  181  GAGDVHAVSIKGSRTG---WQPMSRNWGQNWQSNGYMNGQSLSFQVTTSDGRTITSNNVA  237

Query  824  PKSWQYGQTFEG  859
            P +WQ+GQTFEG
Sbjct  238  PSNWQFGQTFEG  249



>gb|KFK24708.1| hypothetical protein AALP_AA8G014300 [Arabis alpina]
Length=258

 Score =   217 bits (553),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 152/229 (66%), Gaps = 13/229 (6%)
 Frame = +2

Query  215  WSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVN  385
            W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGAC+ L+CVN
Sbjct  32   WINAHATFYGEADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCVN  91

Query  386  NTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIH  544
            + G C   NP I++TAT+ CP      + +G WC PPR HFDL+MP +L I +YKAG + 
Sbjct  92   DPGWCLPGNPSILITATNFCPPNFNQASDNGGWCNPPREHFDLAMPMFLTIAKYKAGIVP  151

Query  545  VQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNW  724
            V Y ++PC +KGG RFTI GH++FNLV V+NV G+GDV KV V+        W+ L RNW
Sbjct  152  VSYRRIPCRKKGGVRFTINGHKFFNLVLVTNVAGAGDVVKVSVKGT---NTAWLDLSRNW  208

Query  725  GEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            G+ W++NA L G++L F+V   DG++ TS  + P +WQ+GQTF GKN R
Sbjct  209  GQNWQSNAVLVGQSLSFRVKASDGRSSTSNYIVPSNWQFGQTFSGKNFR  257



>dbj|BAC67194.1| expansin [Pyrus communis]
Length=261

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 165/263 (63%), Gaps = 19/263 (7%)
 Frame = +2

Query  113  VLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN  286
            +L I + MA     AS ++V   +P V+    + W +AHATFYG  +  GT+GGACG  N
Sbjct  7    LLCIVSLMAL----ASTIVVDARIPGVYTG--AAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  287  -QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP-----  445
                 Y   T ALS ALF N  SCGAC+ L+C N    CK+ +P I VTAT+ CP     
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  446  -TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNL  622
             + +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI GH+YFNL
Sbjct  121  PSDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNL  180

Query  623  vtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKA  802
            V + NV G+GD+ K  V+        W+ L RNWG+ W++N+ L G++L F+VT  D + 
Sbjct  181  VLIHNVAGAGDIVKAYVKGT---NTPWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRT  237

Query  803  VTSRKVAPKSWQYGQTFEGKNSR  871
             TS  + P +WQ+GQTF GKN R
Sbjct  238  STSWNIVPSNWQFGQTFTGKNFR  260



>ref|NP_001234085.1| expansin precursor [Solanum lycopersicum]
 gb|AAD13633.1| expansin precursor [Solanum lycopersicum]
Length=239

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 154/244 (63%), Gaps = 11/244 (5%)
 Frame = +2

Query  155  ASLLIVLCALPCVF--GDGNSGWSEAHATFYGPPE--GTVGGACGLQNQKDT-YAPYTTA  319
            A L I+L  +  +F    G  GW  AHATFYG  +  GT+GGACG  N   T Y   T A
Sbjct  2    ALLAILLMGISLMFQSAHGYGGWINAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAA  61

Query  320  LSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTGDGKWCTPPRAHFDLSM  499
            LS ALF N  SCGAC+ L CVN  GQ      I VTAT+ CP   G WC PPR HFDLS 
Sbjct  62   LSTALFNNGLSCGACFQLMCVN-AGQYCLPGIITVTATNFCP--PGGWCDPPRPHFDLSQ  118

Query  500  PAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdved  679
            P +L+I +Y+AG + V Y +VPC R GG RFTI GH YFNLV V+NVGGSGDV  V ++ 
Sbjct  119  PIFLRIAQYRAGIVPVAYRRVPCRRSGGIRFTINGHSYFNLVLVTNVGGSGDVHSVYIKG  178

Query  680  NADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            +     +W P+ RNWG+ W+ NA L+G++L FKVTT DG+ V S   AP SW +GQTF G
Sbjct  179  S---RTQWQPMSRNWGQNWQNNAYLNGQSLSFKVTTGDGRTVVSYNAAPSSWSFGQTFSG  235

Query  860  KNSR  871
               R
Sbjct  236  GQFR  239



>gb|KEH39447.1| expansin A10 [Medicago truncatula]
Length=260

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 165/262 (63%), Gaps = 15/262 (6%)
 Frame = +2

Query  116  LIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-  286
            ++    + T + + ++ +V   +P V+  G   W  AHATFYG  +  GT+GGACG  N 
Sbjct  3    MVSMVYVVTLIMSLTMWMVDARIPGVYNGG--AWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  287  QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------  445
                Y   T ALS ALF N  SCG+C+ L+C N+   C + +P I +TAT+ CP      
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFAQP  120

Query  446  TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLv  625
            + +G WC PPR HFDL+MP +LKI EY+AG + V + +VPC ++GG RFTI G  YFNLV
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTINGFRYFNLV  180

Query  626  tvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAV  805
             +SNV G+GD+ +  V+    G   W+P+ RNWG+ W++N+ L G+AL F+VT  D +  
Sbjct  181  LISNVAGAGDIVRTYVKGTQTG---WMPMSRNWGQNWQSNSVLVGQALSFRVTGSDRRTS  237

Query  806  TSRKVAPKSWQYGQTFEGKNSR  871
            TS  +AP +WQ+GQTF GKN R
Sbjct  238  TSWNIAPHNWQFGQTFTGKNFR  259



>gb|KHG02505.1| Expansin-A2 [Gossypium arboreum]
Length=257

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 164/258 (64%), Gaps = 20/258 (8%)
 Frame = +2

Query  134  MATE---LQAASLLIVLCALPCVF----GDGNSGWSEAHATFYGPPE--GTVGGACGLQN  286
            MAT+   LQ   L  +      +F    GD N GW  AHATFYG  +  GT+GGACG  N
Sbjct  1    MATKTMMLQIFPLFFLFSVCNSIFLGANGDDNGGWQTAHATFYGGADATGTMGGACGYGN  60

Query  287  -QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------  445
                 Y   T ALS ALF N  SCGACY LRC N+   C ++  I VTAT+ CP      
Sbjct  61   LYSQGYGTSTAALSTALFNNGLSCGACYELRCNNDPQWCISRT-ITVTATNFCPPNYALS  119

Query  446  TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLv  625
            + +G WC PPR HFDL+ PA+L+I EY+AG + V + +V C +KGG R+T+ GH YFN+ 
Sbjct  120  SDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMA  179

Query  626  tvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAV  805
             ++NVGG+GD++ V ++ +  G   W+P+ RNWG+ W++NA L+G++L FKVT  DG+ +
Sbjct  180  LITNVGGAGDITSVSIKGSRTG---WLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTI  236

Query  806  TSRKVAPKSWQYGQTFEG  859
            T+  V P  WQ+GQTFEG
Sbjct  237  TAYNVVPAGWQFGQTFEG  254



>ref|XP_006288496.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
 gb|EOA21394.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
Length=258

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 124/260 (48%), Positives = 166/260 (64%), Gaps = 17/260 (7%)
 Frame = +2

Query  122  ITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QK  292
            +   MA  L  A+   V   +P V+  G   W  AHATFYG  +  GT+GGACG  N   
Sbjct  5    VITLMAVML--ATAFTVHARIPGVYTGGP--WVNAHATFYGGADASGTMGGACGYGNLYS  60

Query  293  DTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TG  451
              Y   T ALS ALF N  SCG+C+ L+C+N+ G C   NP I++TAT+ CP      + 
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFELKCINDPGWCLPGNPSILITATNFCPPNFAQASD  120

Query  452  DGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtv  631
            +G WC PPR HFDL+MP +L I +YKAG + V Y ++PC +KGG RFTI G ++FNLV V
Sbjct  121  NGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKFFNLVLV  180

Query  632  snvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTS  811
            +NV G+GDV KV V+       +W+ L RNWG+ W++NA L G++L F+V T DG++ TS
Sbjct  181  TNVAGAGDVRKVSVKGT---NTQWLDLSRNWGQNWQSNAVLVGQSLSFRVKTSDGRSSTS  237

Query  812  RKVAPKSWQYGQTFEGKNSR  871
              +AP +WQ+GQT+ GKN R
Sbjct  238  NNIAPSNWQFGQTYSGKNFR  257



>ref|XP_006294843.1| hypothetical protein CARUB_v10023894mg [Capsella rubella]
 gb|EOA27741.1| hypothetical protein CARUB_v10023894mg [Capsella rubella]
Length=257

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 155/262 (59%), Gaps = 22/262 (8%)
 Frame = +2

Query  134  MATELQAASLLIVLCAL-----PCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            MA +L       VL +L     P V+  G   W  AHATFYG  +  GT+GGACG  N  
Sbjct  1    MAIKLAILFTTFVLFSLADARIPGVYSGG--AWQNAHATFYGGSDASGTMGGACGYGNLY  58

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCGAC+ L+C N+   C + +P I++TAT+ CP      +
Sbjct  59   SQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPS  118

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR HFDL+MP +LKI +Y+AG + V Y +VPC ++GG RFTI GH YFNL  
Sbjct  119  DNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNL--  176

Query  629  vsnvggsgdvskvdvedNADGEKK-WVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAV  805
               +  +   +   V  N  G +  W+ L RNWG+ W++NA L G+AL F+VT  D +  
Sbjct  177  --ILITNVAGAGDIVRANVKGSRTGWMSLSRNWGQNWQSNAVLVGQALSFRVTGSDRRTS  234

Query  806  TSRKVAPKSWQYGQTFEGKNSR  871
            TS  + P +WQ+GQTF GKN R
Sbjct  235  TSWNMVPSNWQFGQTFVGKNFR  256



>ref|XP_006411198.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
 gb|ESQ52651.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
Length=258

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 159/247 (64%), Gaps = 15/247 (6%)
 Frame = +2

Query  161  LLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAA  331
            L I    +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS A
Sbjct  16   LNIADAKIPGVYSGG--AWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  73

Query  332  LFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFD  490
            LF N  SCGAC+ L+C N+   C + +P I++TAT+ CP      + +G WC PPRAHFD
Sbjct  74   LFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPRAHFD  133

Query  491  LSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvd  670
            L+MP +LKI +Y+AG + V Y +VPC ++GG RFTI GH YFNLV ++NV G+GD+ +  
Sbjct  134  LAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTS  193

Query  671  vedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQT  850
            V+ +  G   W+ L RNWG+ W++NA L G++L F+VT  D +  TS  + P +WQ+GQT
Sbjct  194  VKGSRTG---WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQT  250

Query  851  FEGKNSR  871
            F GKN R
Sbjct  251  FVGKNFR  257



>dbj|BAC67193.1| expansin [Pyrus communis]
Length=258

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 164/265 (62%), Gaps = 21/265 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGL  280
            L VL I A M +   AA+  I     P V+  G+  W  AHATFYG     GT+GGACG 
Sbjct  4    LRVLYI-AFMLSLFMAANARI-----PGVYTGGS--WEGAHATFYGGNDASGTMGGACGY  55

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF N  SCGAC+ ++C ++   C   NP I+VTAT+ CP   
Sbjct  56   GNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNF  115

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
               + DG WC PPR HFDL+MP +LKI EYKAG + V Y +VPC ++GG RFTI G  YF
Sbjct  116  AQPSDDGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYF  175

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV ++NV G+GD+ +V V+    G   W+P+ RNWG+ W++NA L G+ L F+VT  D 
Sbjct  176  NLVLITNVAGAGDIVRVSVK---GGNTGWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDR  232

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  TS  VAP  WQ+GQTF GKN R
Sbjct  233  RTSTSHNVAPADWQFGQTFTGKNFR  257



>ref|XP_009399925.1| PREDICTED: expansin-A15-like [Musa acuminata subsp. malaccensis]
Length=247

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/243 (51%), Positives = 160/243 (66%), Gaps = 16/243 (7%)
 Frame = +2

Query  167  IVLCALPCVFGDG---NSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSA  328
            + L AL  +FG     + GWS AHATFYG  +  GT+GGACG  N     Y   T ALS 
Sbjct  6    LSLFALLIMFGAARGYSGGWSSAHATFYGGSDASGTMGGACGYGNLYSQGYGTDTAALST  65

Query  329  ALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFD  490
            ALF N +SCGAC+ + C ++ G C  Q  IIVTAT+ CP      + +G WC PPR HFD
Sbjct  66   ALFNNGQSCGACFEIMCGSDNGWC-LQGSIIVTATNFCPPNNALPSDNGGWCNPPRQHFD  124

Query  491  LSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvd  670
            LS P + +I +YKAG + VQY +VPC++KGG RFTI GH YFNLV ++NVGG+GDV  V 
Sbjct  125  LSQPVFQRIAQYKAGIVPVQYRRVPCAKKGGIRFTINGHSYFNLVLITNVGGAGDVVAVS  184

Query  671  vedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQT  850
            ++ +  G   W P+ RNWG+ W++N+ L G++L F VTT DG +VTS  VAP +W +GQT
Sbjct  185  IKGSRTG---WQPMSRNWGQNWQSNSCLDGQSLSFTVTTSDGHSVTSANVAPPNWSFGQT  241

Query  851  FEG  859
            + G
Sbjct  242  YSG  244



>ref|XP_002266243.1| PREDICTED: expansin-A4 [Vitis vinifera]
Length=272

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 147/222 (66%), Gaps = 7/222 (3%)
 Frame = +2

Query  215  WSEAHATFYGPPEG--TVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVN  385
            W  AHATFYG  +   T+GGACG  +  K  Y   T ALS  LF   ++CGAC+ ++CV+
Sbjct  51   WHNAHATFYGGADASQTMGGACGYGDLHKQGYGVQTAALSTVLFNGGQACGACFEIKCVD  110

Query  386  NTGQCKT-QNPIIVTATDLCP-TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSK  559
            +   CK  Q  ++VTAT+LCP + +G WC PPR HFDLS PA+L+I EYKAG + VQY +
Sbjct  111  DPQGCKRGQASLMVTATNLCPPSSNGGWCNPPREHFDLSQPAFLQIAEYKAGIVPVQYRR  170

Query  560  VPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWE  739
            VPC +KGG RFTI+G+ YFNL  V      G      V+   D + KW  LKRNWG+ WE
Sbjct  171  VPCKKKGGIRFTISGNPYFNL--VFIWNVGGAGDITSVQVKGDRKLKWTTLKRNWGQNWE  228

Query  740  TNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKN  865
            T+A L G++L F+V   DG+  TS  +APK+WQ+GQTFEGKN
Sbjct  229  TDAMLVGESLTFRVRVSDGRYSTSWHIAPKNWQFGQTFEGKN  270



>gb|AEN70869.1| alpha-expansin 1 [Gossypium schwendimanii]
Length=258

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 155/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C +Q  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISQT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSKTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  DG+ +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>gb|AEQ55271.1| expansin [Breonia chinensis]
 gb|AEQ55286.1| expansin [Breonia chinensis]
Length=258

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 156/247 (63%), Gaps = 15/247 (6%)
 Frame = +2

Query  161  LLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAA  331
            L +V   +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS A
Sbjct  16   LTVVNARIPGVYSGGP--WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTGALSTA  73

Query  332  LFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFD  490
            LF N  SCGAC+ L+C N    C   NP I +TAT+ CP        +G WC PPR HFD
Sbjct  74   LFNNGLSCGACFELKCANAPKWCLPGNPSIFITATNFCPPNFALPNDNGGWCNPPRPHFD  133

Query  491  LSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvd  670
            L+MP +LKI EY+AG + V Y +VPC ++GG RFT+ G  YFNL+ ++NV G+G+V +  
Sbjct  134  LAMPMFLKIAEYRAGIVPVNYRRVPCRKRGGIRFTVNGFRYFNLILITNVAGAGNVIRAS  193

Query  671  vedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQT  850
            V+       +W+PL RNWG+ W++NA L G+AL F+VT  DG+  TS  VAP +WQ+GQT
Sbjct  194  VKGT---RTQWLPLSRNWGQNWQSNAQLIGQALSFRVTASDGRTSTSWNVAPPNWQFGQT  250

Query  851  FEGKNSR  871
            F GKN R
Sbjct  251  FLGKNFR  257



>emb|CDY20467.1| BnaC04g05770D [Brassica napus]
Length=256

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/240 (49%), Positives = 157/240 (65%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  S
Sbjct  21   IPGVYSGG--AWETAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMS  78

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ L+C N+   C + +P I++TAT+ CP      + +G WC PPRAHFDL+MP +L
Sbjct  79   CGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFDLAMPVFL  138

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
            KI +Y+AG + V Y +VPC ++GG RFTI GH YFNLV ++NV G+GD+ +  V+ +  G
Sbjct  139  KIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKGSRTG  198

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
               W+ L RNWG+ W++NA L G++L F+VT  D +  TS  + P +WQ+GQTF GKN R
Sbjct  199  ---WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFVGKNFR  255



>ref|NP_181500.1| expansin A4 [Arabidopsis thaliana]
 sp|O48818.1|EXPA4_ARATH RecName: Full=Expansin-A4; Short=AtEXPA4; AltName: Full=Alpha-expansin-4; 
Short=At-EXP4; Short=AtEx4; AltName: Full=Ath-ExpAlpha-1.6; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK95263.1|AF410277_1 At2g39700/F17A14.7 [Arabidopsis thaliana]
 gb|AAB97125.1| putative expansin [Arabidopsis thaliana]
 gb|AAL32761.1| putative expansin [Arabidopsis thaliana]
 gb|AAM13337.1| putative expansin [Arabidopsis thaliana]
 gb|AEC09708.1| expansin A4 [Arabidopsis thaliana]
Length=257

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/261 (47%), Positives = 163/261 (62%), Gaps = 20/261 (8%)
 Frame = +2

Query  134  MATELQAASLLIVLCAL-----PCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            MA +L       VL +L     P ++  G   W  AHATFYG  +  GT+GGACG  N  
Sbjct  1    MAIKLAILFTTFVLFSLADARIPGIYSGG--AWQNAHATFYGGSDASGTMGGACGYGNLY  58

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCGAC+ L+C N+   C + +P I++TAT+ CP      +
Sbjct  59   SQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPS  118

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR HFDL+MP +LKI +Y+AG + V Y +VPC ++GG RFTI GH YFNLV 
Sbjct  119  DNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVL  178

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            ++NV G+GD+ +  V+ +  G   W+ L RNWG+ W++NA L G+AL F+VT  D +  T
Sbjct  179  ITNVAGAGDIVRASVKGSRTG---WMSLSRNWGQNWQSNAVLVGQALSFRVTGSDRRTST  235

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  + P +WQ+GQTF GKN R
Sbjct  236  SWNMVPSNWQFGQTFVGKNFR  256



>emb|CAN73461.1| hypothetical protein VITISV_033906 [Vitis vinifera]
Length=272

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 147/222 (66%), Gaps = 7/222 (3%)
 Frame = +2

Query  215  WSEAHATFYGPPEG--TVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVN  385
            W  AHATFYG  +   T+GGACG  +  K  Y   T ALS  LF   ++CGAC+ ++CV+
Sbjct  51   WHNAHATFYGGADASQTMGGACGYGDLHKQGYGVQTAALSTVLFNGGQACGACFEIKCVD  110

Query  386  NTGQCKT-QNPIIVTATDLCP-TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSK  559
            +   CK  Q  ++VTAT+LCP + +G WC PPR HFDLS PA+L+I EYKAG + VQY +
Sbjct  111  DPQGCKRGQASLMVTATNLCPPSSNGGWCNPPREHFDLSQPAFLQIAEYKAGIVPVQYRR  170

Query  560  VPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWE  739
            VPC +KGG RFTI+G+ YFNL  V      G      V+   D + KW  LKRNWG+ WE
Sbjct  171  VPCKKKGGIRFTISGNPYFNL--VFIWNVGGAGDITSVQVKGDRKLKWTTLKRNWGQNWE  228

Query  740  TNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKN  865
            T+A L G++L F+V   DG+  TS  +APK+WQ+GQTFEGKN
Sbjct  229  TDAMLVGESLTFRVRXSDGRYSTSWHIAPKNWQFGQTFEGKN  270



>ref|XP_002456550.1| hypothetical protein SORBIDRAFT_03g038290 [Sorghum bicolor]
 gb|EES01670.1| hypothetical protein SORBIDRAFT_03g038290 [Sorghum bicolor]
Length=252

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 150/225 (67%), Gaps = 13/225 (6%)
 Frame = +2

Query  212  GWSEAHATFYG--PPEGTVGGACGLQNQKDT-YAPYTTALSAALFKNAESCGACYALRCV  382
            GW  AHATFYG     GT+GGACG  N   T Y   T ALS ALF +  +CG+CY LRC 
Sbjct  29   GWQSAHATFYGGGDASGTMGGACGYGNMYSTGYGTNTAALSTALFNDGAACGSCYELRC-  87

Query  383  NNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIH  544
            +N GQ      I VTAT+ CP      + DG WC PPR HFD++ PA+L+I +Y+AG + 
Sbjct  88   DNDGQSCLPGTITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAQPAFLQIAQYRAGIVP  147

Query  545  VQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNW  724
            V Y +VPC +KGG RFTI GH YFNLV V+NV G+GDV  V ++ ++ G   W P+ RNW
Sbjct  148  VAYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVQSVSIKGSSTG---WQPMSRNW  204

Query  725  GEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            G+ W++N+ L G++L F+VT  DG+ VTS  VAP  WQ+GQTFEG
Sbjct  205  GQNWQSNSLLDGQSLSFQVTASDGRTVTSNGVAPAGWQFGQTFEG  249



>ref|XP_004300427.1| PREDICTED: expansin-A4-like [Fragaria vesca subsp. vesca]
Length=259

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 125/262 (48%), Positives = 167/262 (64%), Gaps = 20/262 (8%)
 Frame = +2

Query  131  AMATELQAASLLIVLCAL-----PCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-  286
            AMA+    A+LLI L ++     P V+  G   W  AHATFYG  +  GT+GGACG  N 
Sbjct  2    AMASLACIAALLISLTSITEARIPGVYSGG--AWQGAHATFYGGSDASGTMGGACGYGNL  59

Query  287  QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------  445
                Y   T ALS ALF N  SCGAC+ ++C N+   C + +P I +TAT+ CP      
Sbjct  60   YSQGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQP  119

Query  446  TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLv  625
            + +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV
Sbjct  120  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLV  179

Query  626  tvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAV  805
             VSNV G+GD+ +V V+ +  G   W+ L RNWG+ W++N+ L G++L F+VT  D ++ 
Sbjct  180  LVSNVAGAGDIVRVSVKGSRTG---WMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRSS  236

Query  806  TSRKVAPKSWQYGQTFEGKNSR  871
            TS  + P +WQ+GQTF GKN R
Sbjct  237  TSWNIVPANWQFGQTFTGKNFR  258



>ref|NP_001105040.1| alpha expansin1 precursor [Zea mays]
 gb|AAK56119.1|AF332169_1 alpha-expansin 1 [Zea mays]
 gb|ACG30766.1| alpha-expansin 10 precursor [Zea mays]
 gb|ACR38172.1| unknown [Zea mays]
 tpg|DAA57054.1| TPA: alpha expansin1 [Zea mays]
Length=253

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 149/224 (67%), Gaps = 13/224 (6%)
 Frame = +2

Query  215  WSEAHATFYG--PPEGTVGGACGLQNQKDT-YAPYTTALSAALFKNAESCGACYALRCVN  385
            W  AHATFYG     GT+GGACG  N   T Y   T ALS ALF +  +CG+CY LRC N
Sbjct  31   WQSAHATFYGGGDASGTMGGACGYGNMYSTGYGTNTAALSTALFNDGAACGSCYELRCDN  90

Query  386  NTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHV  547
            N GQ      I VTAT+ CP      + DG WC PPR HFD++ PA+L+I +Y+AG + V
Sbjct  91   N-GQSCLPGTITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAQPAFLQIAQYRAGIVPV  149

Query  548  QYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWG  727
             Y +VPC +KGG RFTI GH YFNLV V+NV G+GDV  V ++ ++ G   W P+ RNWG
Sbjct  150  AYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVQSVSIKGSSTG---WQPMSRNWG  206

Query  728  EKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + W++N+ L G++L F+VT  DG+ VTS  VAP  WQ+GQTFEG
Sbjct  207  QNWQSNSLLDGQSLSFQVTASDGRTVTSNGVAPAGWQFGQTFEG  250



>ref|XP_009143296.1| PREDICTED: expansin-A4-like [Brassica rapa]
Length=256

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 117/240 (49%), Positives = 156/240 (65%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  S
Sbjct  21   IPGVYSGG--AWETAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMS  78

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ L+C N+   C + +P I++TAT+ CP      + +G WC PPRAHFDL+MP +L
Sbjct  79   CGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFDLAMPVFL  138

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
            KI +Y+AG + V Y +VPC ++GG RFTI GH YFNLV ++NV G+GD+ +  V+    G
Sbjct  139  KIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKGTRTG  198

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
               W+ L RNWG+ W++NA L G++L F+VT  D +  TS  + P +WQ+GQTF GKN R
Sbjct  199  ---WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFVGKNFR  255



>emb|CDY24952.1| BnaC03g22200D [Brassica napus]
Length=258

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/240 (48%), Positives = 157/240 (65%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  S
Sbjct  23   IPGVYSGG--AWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMS  80

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ L+C N+   C + +P I++TAT+ CP      + +G WC PPR HFDL+MP +L
Sbjct  81   CGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAMPVFL  140

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
            KI +Y+AG + V Y +VPC ++GG RFTI GH+YFNLV ++NV G+GD+ +  V+ +  G
Sbjct  141  KIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHQYFNLVLITNVAGAGDIVRTSVKGSRTG  200

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
               W+ L RNWG+ W++NA L G++L F+VT  D +  TS  + P +WQ+GQTF GKN R
Sbjct  201  ---WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFVGKNFR  257



>gb|AEN70881.1| alpha-expansin 1 [Gossypium hirsutum subsp. latifolium]
Length=258

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 155/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISR-TITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLRIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSRTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  DG+ +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEG  255



>gb|ABD48785.1| alpha-expansin 1 [Gossypium hirsutum]
 gb|ACD37707.1| alpha expansin [Gossypium hirsutum]
 gb|ADY68812.1| alpha-expansin 1 [Gossypium hirsutum]
Length=258

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 155/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLRIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSRTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  DG+ +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEG  255



>emb|CDY07642.1| BnaA03g18690D [Brassica napus]
Length=258

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 164/265 (62%), Gaps = 23/265 (9%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGL  280
            L+VL  T  + T   A         +P V+  G   W  AHATFYG  +  GT+GGACG 
Sbjct  6    LAVLFTTFVLFTLTDAK--------IPGVYSGG--AWQTAHATFYGGSDASGTMGGACGY  55

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF N  SCGAC+ L+C N+   C + +P I++TAT+ CP   
Sbjct  56   GNLYSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNF  115

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
               + +G WC PPR HFDL+MP +LKI +Y+AG + V Y +VPC ++GG RFTI GH YF
Sbjct  116  AQASDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYF  175

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV ++NV G+GD+ +  V+ +  G   W+ L RNWG+ W++NA L G++L F+VT  D 
Sbjct  176  NLVLITNVAGAGDIVRTSVKGSKTG---WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDR  232

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  TS  + P +WQ+GQTF GKN R
Sbjct  233  RTSTSWSIVPSNWQFGQTFVGKNFR  257



>ref|XP_010534508.1| PREDICTED: expansin-A4 [Tarenaya hassleriana]
Length=261

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 152/231 (66%), Gaps = 13/231 (6%)
 Frame = +2

Query  209  SGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRC  379
            S W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGAC+ ++C
Sbjct  33   SAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSCGACFEIKC  92

Query  380  VNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGF  538
             N+   C + +P I +TAT+ CP      + +G WC PPRAHFDL+MP +LKI EY+AG 
Sbjct  93   ANDPQWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRAHFDLAMPMFLKIAEYRAGI  152

Query  539  IHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKR  718
            + + Y +VPC ++GG RFTI GH YFNLV ++NV G+GD+ +  V+ +  G   W+ L R
Sbjct  153  VPISYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRASVKGSRTG---WMSLSR  209

Query  719  NWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            NWG+ W++NA L G++L F+VT  D +  TS  + P SWQ+GQTF GKN R
Sbjct  210  NWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSSWQFGQTFVGKNFR  260



>emb|CDY07024.1| BnaA04g22910D [Brassica napus]
Length=258

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 165/265 (62%), Gaps = 23/265 (9%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGL  280
            L+VL  T  + T   A         +P V+  G   W  AHATFYG  +  GT+GGACG 
Sbjct  6    LAVLFTTFVLFTLTDAK--------IPGVYSGG--AWQTAHATFYGGSDASGTMGGACGY  55

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF +  SCGAC+ L+C N+   C + +P I++TAT+ CP   
Sbjct  56   GNLYSQGYGTNTAALSTALFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNF  115

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
               + +G WC PPRAHFDL+MP +LKI +Y+AG + V Y +VPC ++GG RFTI GH YF
Sbjct  116  AQASDNGGWCNPPRAHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYF  175

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV ++NV G+GD+ +  V+ +  G   W+ L RNWG+ W++NA L G++L F+VT  D 
Sbjct  176  NLVLITNVAGAGDIVRTSVKGSRTG---WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDR  232

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  TS  + P +WQ+GQTF GKN R
Sbjct  233  RTSTSWNIVPSNWQFGQTFVGKNFR  257



>ref|XP_002283358.1| PREDICTED: expansin-A4 [Vitis vinifera]
 emb|CBI31662.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 165/265 (62%), Gaps = 20/265 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGL  280
            L  ++   AMA+ L+     I     P V+  G  GW  AHATFYG  +  GT+GGACG 
Sbjct  3    LVAVVCFVAMASVLKLGEARI-----PGVYTGG--GWQSAHATFYGGSDASGTMGGACGY  55

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF N  SCGAC+ L+C N+   C + +P I++TAT+ CP   
Sbjct  56   GNLYSQGYGVNTAALSTALFNNGLSCGACFELKCANDPEWCHSGSPSILITATNFCPPNY  115

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
               + +G WC PPR HFDL+MP +LKI EY+AG + V + +VPC ++GG RFTI G  YF
Sbjct  116  ALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYF  175

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV ++NV G+GD+ K  V+ +  G   W+ L RNWG+ W++NA L G++L F+VT  D 
Sbjct  176  NLVLITNVAGAGDIVKASVKGSKTG---WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDH  232

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  TS  + P +WQ+GQTF GKN R
Sbjct  233  RTSTSWNIVPSNWQFGQTFSGKNFR  257



>gb|AAM22625.1|AF428178_1 expansin 11 precursor [Rumex palustris]
Length=258

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 166/261 (64%), Gaps = 18/261 (7%)
 Frame = +2

Query  128  AAMATELQAASLLIVLCA---LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            AA++  L   S+L    A   +P V+  G  GW  AHATFYG  +  GT+GGACG  N  
Sbjct  2    AALSALLCIVSVLSFYSADARIPGVYSGG--GWETAHATFYGGSDASGTMGGACGFGNLY  59

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCGAC+ ++C ++   C   +P I++TAT+ CP      +
Sbjct  60   SQGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCHPGSPSILITATNFCPPNFAEPS  119

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR HFDL+MP +LKI EY+AG + V + +VPC ++GG RFT+ G  YFNLV 
Sbjct  120  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTVNGFRYFNLVL  179

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            ++NV G+GD+ +V ++ +      W+P+ RNWG+ W++NA L G++L F+VT  D +  T
Sbjct  180  ITNVAGAGDIVRVSIKGS---RSDWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRKST  236

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  VAP SWQ+GQTF GKN R
Sbjct  237  SWNVAPASWQFGQTFTGKNFR  257



>emb|CDM84787.1| unnamed protein product [Triticum aestivum]
 emb|CDJ26303.1| unnamed protein product [Triticum aestivum]
Length=251

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 157/250 (63%), Gaps = 17/250 (7%)
 Frame = +2

Query  149  QAASLLIVLCALPCVFGDGNSG----WSEAHATFYG--PPEGTVGGACGLQNQKDT-YAP  307
             A +LL++  A  C+     +G    W  AHATFYG     GT+GGACG  N   T Y  
Sbjct  3    SANALLLLFSAAFCLLARRAAGDYGSWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGT  62

Query  308  YTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCT  469
             T ALS ALF +  +CG+CY L+C + +  C     I +TAT+LCP        DG WC 
Sbjct  63   NTAALSTALFNDGAACGSCYELKCQDVSSSC-LPGSITITATNLCPPNYALPNDDGGWCN  121

Query  470  PPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggs  649
            PPRAHFD++ PAYL+IG Y+AG + V Y +VPC +KGG RFTI GH YFNLV V+NV G+
Sbjct  122  PPRAHFDMAEPAYLQIGIYRAGIVAVAYRRVPCVKKGGMRFTINGHSYFNLVLVTNVAGA  181

Query  650  gdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPK  829
            GDV  V ++ ++ G   W  + RNWG+ W++NA L G++L F+VT  DG+ VTS   AP 
Sbjct  182  GDVQSVAIKGSSTG---WQAMARNWGQNWQSNADLDGQSLSFRVTLSDGRTVTSNNAAPA  238

Query  830  SWQYGQTFEG  859
             W +GQTFEG
Sbjct  239  GWSFGQTFEG  248



>emb|CBI30173.3| unnamed protein product [Vitis vinifera]
Length=336

 Score =   217 bits (553),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 148/224 (66%), Gaps = 7/224 (3%)
 Frame = +2

Query  215  WSEAHATFYGPPEG--TVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVN  385
            W  AHATFYG  +   T+GGACG  +  K  Y   T ALS  LF   ++CGAC+ ++CV+
Sbjct  115  WHNAHATFYGGADASQTMGGACGYGDLHKQGYGVQTAALSTVLFNGGQACGACFEIKCVD  174

Query  386  NTGQCKT-QNPIIVTATDLCP-TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSK  559
            +   CK  Q  ++VTAT+LCP + +G WC PPR HFDLS PA+L+I EYKAG + VQY +
Sbjct  175  DPQGCKRGQASLMVTATNLCPPSSNGGWCNPPREHFDLSQPAFLQIAEYKAGIVPVQYRR  234

Query  560  VPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWE  739
            VPC +KGG RFTI+G+ YFNL  V      G      V+   D + KW  LKRNWG+ WE
Sbjct  235  VPCKKKGGIRFTISGNPYFNL--VFIWNVGGAGDITSVQVKGDRKLKWTTLKRNWGQNWE  292

Query  740  TNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            T+A L G++L F+V   DG+  TS  +APK+WQ+GQTFEGKN +
Sbjct  293  TDAMLVGESLTFRVRVSDGRYSTSWHIAPKNWQFGQTFEGKNFK  336



>ref|XP_009141827.1| PREDICTED: expansin-A4-like [Brassica rapa]
Length=258

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 121/265 (46%), Positives = 164/265 (62%), Gaps = 23/265 (9%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGL  280
            L+VL  T  + T   A         +P V+  G   W  AHATFYG  +  GT+GGACG 
Sbjct  6    LAVLFTTFVLFTLTDAK--------IPGVYSGG--AWQTAHATFYGGSDASGTMGGACGY  55

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF +  SCGAC+ L+C N+   C + +P I++TAT+ CP   
Sbjct  56   GNLYSQGYGTNTAALSTALFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNF  115

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
               + +G WC PPRAHFDL+MP +LKI +Y+AG + V Y +VPC ++GG RFTI GH YF
Sbjct  116  AQASDNGGWCNPPRAHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYF  175

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NL  ++NV G+GD+ +  V+ +  G   W+ L RNWG+ W++NA L G++L F+VT  D 
Sbjct  176  NLFLITNVAGAGDIVRTSVKGSRTG---WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDR  232

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  TS  + P +WQ+GQTF GKN R
Sbjct  233  RTSTSWNIVPSNWQFGQTFVGKNFR  257



>gb|AAM46997.1|AF512539_1 alpha-expansin precursor [Gossypium hirsutum]
Length=258

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 154/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLRIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++   ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSESIKGSRTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  DG+ +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEG  255



>gb|AEU08407.1| expansin 2 [Prunus salicina]
Length=260

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 169/266 (64%), Gaps = 18/266 (7%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCA-LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACG  277
            + V+ ++A +A+ L   SL+ V  A +P V+  G   W  AHATFYG  +  GT+GGACG
Sbjct  1    MGVVSVSACLASLL--ISLMWVAEARIPGVYSGG--AWEAAHATFYGGSDASGTMGGACG  56

Query  278  LQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP--  445
              N     Y   T ALS ALF N  SCGAC+ ++C N+   C + +P I +TAT+ CP  
Sbjct  57   YGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPN  116

Query  446  ----TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEY  613
                + DG WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  Y
Sbjct  117  FAQPSDDGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  176

Query  614  FNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQD  793
            FNLV VSNV G+GD+ +V V+ +  G   W+ + RNWG+ W++NA L G++L F+V   D
Sbjct  177  FNLVLVSNVAGAGDIVRVSVKGSKTG---WMSMSRNWGQNWQSNAVLVGQSLSFRVRGSD  233

Query  794  GKAVTSRKVAPKSWQYGQTFEGKNSR  871
             +  TS  V P +WQ+GQTF GKN R
Sbjct  234  RRTSTSWNVVPANWQFGQTFTGKNFR  259



>gb|AEN70875.1| alpha-expansin 1 [Gossypium tomentosum]
 gb|AEN70876.1| alpha-expansin 1 [Gossypium tomentosum]
Length=258

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 155/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISR-TITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN++ ++NVGG+GD++ V ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMLLITNVGGAGDITSVSIKGSKTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  DG+ +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>emb|CDY69611.1| BnaCnng64440D [Brassica napus]
Length=258

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 121/254 (48%), Positives = 161/254 (63%), Gaps = 17/254 (7%)
 Frame = +2

Query  146  LQAASLLIVLC--ALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPY  310
            L  A LL  L    +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   
Sbjct  9    LFTAYLLFNLADARIPGVYSGG--AWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTN  66

Query  311  TTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCT  469
            T ALS ALF N  SCGAC+ L+C N+   C + +P I++TAT+ CP      + +G WC 
Sbjct  67   TAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCN  126

Query  470  PPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggs  649
            PPR HFDL+MP +LKI +Y+AG + V Y +VPC ++GG RFTI GH YFNLV ++NV G+
Sbjct  127  PPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGA  186

Query  650  gdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPK  829
            GD+ +  V+ +  G   W+ L RNWG+ W++NA L G++L F+VT  D +  TS  + P 
Sbjct  187  GDIVRTSVKGSKTG---WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWSIVPS  243

Query  830  SWQYGQTFEGKNSR  871
            +WQ+GQTF GKN R
Sbjct  244  NWQFGQTFVGKNFR  257



>gb|KHG15821.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 164/265 (62%), Gaps = 21/265 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGL  280
            LSVL   + ++       L +V   +P VF  G   W  AHATFYG  +  GT+GGACG 
Sbjct  10   LSVLCFASLLSF------LAVVNARIPGVFTGG--AWESAHATFYGGSDASGTMGGACGY  61

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF N  SCGAC+ ++C N+   C + +P II+TAT+ CP   
Sbjct  62   GNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNY  121

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
                 +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YF
Sbjct  122  ALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYF  181

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV V+NV G+GD+ KV V+        W+ + RNWG+ W++NA L G+AL F+VT  D 
Sbjct  182  NLVLVTNVAGAGDIVKVKVKGT---NTNWMSMSRNWGQNWQSNAVLVGQALSFRVTGSDR  238

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  TS  VAP +WQ+GQTF GKN R
Sbjct  239  RTSTSLNVAPANWQFGQTFTGKNFR  263



>gb|AAM22624.1|AF428177_1 expansin 10 precursor [Rumex palustris]
Length=258

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 165/261 (63%), Gaps = 18/261 (7%)
 Frame = +2

Query  128  AAMATELQAASLLIVLCA---LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            AA++  L   S+L    A   +P V+  G  GW  AHATFYG  +  GT+GGACG  N  
Sbjct  2    AALSALLCIVSVLSFYSADARIPGVYSGG--GWETAHATFYGGSDASGTMGGACGFGNLY  59

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCGAC+ ++C ++   C   NP I++TAT+ CP      +
Sbjct  60   SQGYGVNTAALSTALFNNGMSCGACFEIKCADDPRWCHPGNPSILITATNFCPPNFAEPS  119

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PP  HFDL+MP +LKI EY+AG + V + +VPC ++GG RFT+ G  YFNLV 
Sbjct  120  DNGGWCNPPLPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTVNGFRYFNLVL  179

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            ++NV G+GD+ +V ++ +      W+P+ RNWG+ W++NA L G++L F+VT  D +  T
Sbjct  180  ITNVAGAGDIVRVSIKGS---RSDWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRKST  236

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  VAP SWQ+GQTF GKN R
Sbjct  237  SWNVAPASWQFGQTFTGKNFR  257



>ref|XP_006341021.1| PREDICTED: expansin-A3 [Solanum tuberosum]
Length=263

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 161/264 (61%), Gaps = 19/264 (7%)
 Frame = +2

Query  122  ITAAMATELQAASLLIVLCA----LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQ  283
            + A M   +    LL  L A    +P V+  G   W  AHATFYG  +  GT+GGACG  
Sbjct  4    MAATMMLYITTTILLCFLTAVNARIPGVYTGGP--WQSAHATFYGGSDASGTMGGACGYG  61

Query  284  N-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP----  445
            N     Y     ALS  LF N  SCGAC+ L+C N+   C   NP I VTAT+ CP    
Sbjct  62   NLYSQGYGVNNAALSTVLFNNGLSCGACFELKCDNDGKWCLPGNPSIFVTATNFCPPNFA  121

Query  446  --TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFN  619
                DG WC PPR HFDL+MP +LKIG Y+AG + V Y +VPC ++GG RFTI G  YFN
Sbjct  122  LPNDDGGWCNPPRPHFDLAMPMFLKIGLYRAGIVPVTYRRVPCRKQGGIRFTINGFRYFN  181

Query  620  LvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGK  799
            L+ V+NV G+GD+ KV ++       +W+ + RNWG+ W+TN+PL G+AL  +V   D +
Sbjct  182  LLLVTNVAGAGDIQKVLIKGT---NTQWIAMSRNWGQNWQTNSPLVGQALSIRVKASDHR  238

Query  800  AVTSRKVAPKSWQYGQTFEGKNSR  871
            +VT+  VAP +WQ+GQTFEGKN R
Sbjct  239  SVTNVNVAPSNWQFGQTFEGKNFR  262



>ref|NP_001288961.1| expansin-A4 precursor [Brassica rapa]
 gb|AGM16346.1| alpha-expansin protein 4 [Brassica rapa]
Length=258

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 121/254 (48%), Positives = 161/254 (63%), Gaps = 17/254 (7%)
 Frame = +2

Query  146  LQAASLLIVLC--ALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPY  310
            L  A LL  L    +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   
Sbjct  9    LFTAYLLFNLADARIPGVYSGG--AWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTN  66

Query  311  TTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCT  469
            T ALS ALF N  SCGAC+ L+C N+   C + +P I++TAT+ CP      + +G WC 
Sbjct  67   TAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCN  126

Query  470  PPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggs  649
            PPR HFDL+MP +LKI +Y+AG + V Y +VPC ++GG RFTI GH YFNLV ++NV G+
Sbjct  127  PPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGA  186

Query  650  gdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPK  829
            GD+ +  V+ +  G   W+ L RNWG+ W++NA L G++L F+VT  D +  TS  + P 
Sbjct  187  GDIVRTSVKGSKTG---WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWSIVPS  243

Query  830  SWQYGQTFEGKNSR  871
            +WQ+GQTF GKN R
Sbjct  244  NWQFGQTFVGKNFR  257



>ref|XP_010505648.1| PREDICTED: expansin-A4 [Camelina sativa]
Length=257

 Score =   214 bits (545),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 155/262 (59%), Gaps = 22/262 (8%)
 Frame = +2

Query  134  MATELQAASLLIVLCAL-----PCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            MA +L       VL +L     P V+    S W  AHATFYG  +  GT+GGACG  N  
Sbjct  1    MAIKLAILFTTFVLFSLADARIPGVYSG--SSWQNAHATFYGGSDASGTMGGACGYGNLY  58

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCGAC+ L+C N+   C + +P I++TAT+ CP      +
Sbjct  59   SQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPS  118

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR HFDL+MP +LKI +Y+AG + V Y +VPC ++GG RFTI GH YFNL  
Sbjct  119  DNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNL--  176

Query  629  vsnvggsgdvskvdvedNADGEKK-WVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAV  805
               +  +   +   V  N  G +  W+ L RNWG+ W++NA L G++L F+VT  D +  
Sbjct  177  --ILITNVAGAGDIVRANVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTS  234

Query  806  TSRKVAPKSWQYGQTFEGKNSR  871
            TS  + P +WQ+GQTF GKN R
Sbjct  235  TSWNMVPSNWQFGQTFVGKNFR  256



>gb|AEN70885.1| alpha-expansin 1 [Gossypium davidsonii]
 gb|AEN70886.1| alpha-expansin 1 [Gossypium klotzschianum]
Length=258

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 155/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSHGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISR-TITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSKTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  DG+ +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>ref|XP_002881669.1| ATEXPA4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57928.1| ATEXPA4 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/261 (47%), Positives = 163/261 (62%), Gaps = 20/261 (8%)
 Frame = +2

Query  134  MATELQAASLLIVLCAL-----PCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            MA +L       VL +L     P V+    S W  AHATFYG  +  GT+GGACG  N  
Sbjct  1    MAIKLAILFTTFVLFSLADARIPGVYSG--SAWQNAHATFYGGSDASGTMGGACGYGNLY  58

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCGAC+ L+C N+   C + +P I++TAT+ CP      +
Sbjct  59   SQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPS  118

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR HFDL+MP +LKI +Y+AG + V Y +VPC ++GG RFTI GH YFNLV 
Sbjct  119  DNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVL  178

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            ++NV G+GD+ +  V+ +  G   W+ L RNWG+ W++NA L G++L F+VT  D +  T
Sbjct  179  ITNVAGAGDIVRASVKGSRTG---WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTST  235

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  + P +WQ+GQTF GKN R
Sbjct  236  SWNMVPSNWQFGQTFVGKNFR  256



>ref|XP_002878036.1| ATEXPA16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54295.1| ATEXPA16 [Arabidopsis lyrata subsp. lyrata]
Length=260

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/240 (49%), Positives = 157/240 (65%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+  G+  W  AHATFYG     GT+GGACG  N     Y   T ALS ALF + +S
Sbjct  25   IPGVYSGGS--WQTAHATFYGGNDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGQS  82

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ ++CVN+   C   NP + VTAT+ CP      + +G WC PPR+HFDL+MP +L
Sbjct  83   CGACFEIKCVNDPKWCHPGNPSVFVTATNFCPPNLAQPSDNGGWCNPPRSHFDLAMPVFL  142

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
            KI EY+AG + + Y +V C + GG RFTI GH YFNLV ++NV G+GD+ +  V+ +  G
Sbjct  143  KIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDILRTSVKGSKTG  202

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
               W+ L RNWG+ W++NA L G++L F+VTT D +  TS  +AP +WQ+GQTF GKN R
Sbjct  203  ---WMSLTRNWGQNWQSNAVLVGQSLSFRVTTSDRRTSTSWNIAPSNWQFGQTFVGKNFR  259



>gb|AEN70867.1| alpha-expansin 1 [Gossypium thurberi]
Length=258

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 155/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSKTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  DG+ +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>gb|AEN70868.1| alpha-expansin 1 [Gossypium laxum]
 gb|AEN70888.1| alpha-expansin 1 [Gossypium gossypioides]
 gb|AEN70889.1| alpha-expansin 1 [Gossypium lobatum]
 gb|AEN70890.1| alpha-expansin 1 [Gossypium trilobum]
Length=258

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 155/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSKTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  DG+ +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>gb|ADY68810.1| alpha-expansin 1 [Gossypium herbaceum subsp. africanum]
Length=258

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 155/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCDNDPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSRTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  DG+ +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEG  255



>ref|XP_011048141.1| PREDICTED: expansin-A15-like [Populus euphratica]
Length=247

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 157/244 (64%), Gaps = 14/244 (6%)
 Frame = +2

Query  158  SLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSA  328
            +++I+L  L  V G G +GW+ AHATFYG     GT+GGACG  N     Y   T ALS 
Sbjct  7    TIVILLTMLKIVKGYG-TGWTGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALST  65

Query  329  ALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFD  490
            ALF N  SCGACY ++CVN+   C  +  IIVTAT+ CP        DG WC PP+ HFD
Sbjct  66   ALFNNGLSCGACYEIKCVNDNIWC-LRGSIIVTATNFCPPNNALPNNDGGWCNPPQQHFD  124

Query  491  LSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvd  670
            LS P + KI +YKAG + VQY +V C + GG RFTI GH YFNLV ++NVGG+GDV  V 
Sbjct  125  LSQPVFQKIAQYKAGIVPVQYRRVACRKSGGIRFTINGHSYFNLVLITNVGGAGDVVAVS  184

Query  671  vedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQT  850
            ++     +  W  + RNWG+ W++NA L+ +AL FKVTT DG+ V S  VAP +W +GQT
Sbjct  185  IKGT---KSNWQAMSRNWGQNWQSNAYLNNQALSFKVTTSDGRTVVSNNVAPSNWAFGQT  241

Query  851  FEGK  862
            + G+
Sbjct  242  YTGR  245



>gb|AEN70870.1| alpha-expansin 1 [Gossypium turneri]
Length=258

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 155/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDENGGWQNAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISR-TITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V V+ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSVKGSKTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  DG+ +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>gb|ABL86680.1| EXA1 [Gossypium barbadense]
 gb|ADY68808.1| alpha-expansin 1 [Gossypium barbadense]
 gb|ADY68809.1| alpha-expansin 1 [Gossypium barbadense]
 gb|AEN70872.1| alpha-expansin 1 [Gossypium mustelinum]
 gb|AEN70873.1| alpha-expansin 1 [Gossypium darwinii]
 gb|AEN70874.1| alpha-expansin 1 [Gossypium darwinii]
 gb|AEN70877.1| alpha-expansin 1 [Gossypium barbadense var. brasiliense]
 gb|AEN70878.1| alpha-expansin 1 [Gossypium barbadense var. brasiliense]
 gb|AEN70879.1| alpha-expansin 1 [Gossypium barbadense var. peruvianum]
 gb|AEN70880.1| alpha-expansin 1 [Gossypium barbadense var. peruvianum]
Length=258

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 155/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISR-TITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKCSKTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  DG+ +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>ref|XP_009404081.1| PREDICTED: expansin-A15 [Musa acuminata subsp. malaccensis]
Length=250

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/255 (48%), Positives = 159/255 (62%), Gaps = 14/255 (5%)
 Frame = +2

Query  134  MATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYA  304
            M   L   +++  +  L    G G  GW+ AHATFYG  +  GT+GGACG  N     Y 
Sbjct  1    MRMRLLGLAVIAFVSLLSAAHGYG-GGWTRAHATFYGGSDASGTMGGACGYGNLYSQGYG  59

Query  305  PYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTGD------GKWC  466
              T ALS ALF N  SCGACY L CVN+   C  +  I+VTAT+ CP         G WC
Sbjct  60   TNTAALSTALFNNGLSCGACYELMCVNDHQYC-LRGTIVVTATNFCPPNSALPNDAGGWC  118

Query  467  TPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvgg  646
             PP  HFDLS P +L+I +Y+AG + V Y +VPC ++GG RFTI GH YFNLV ++NVGG
Sbjct  119  NPPLQHFDLSQPVFLRIAQYRAGIVPVAYRRVPCRKRGGIRFTINGHSYFNLVLITNVGG  178

Query  647  sgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAP  826
            +GDV+ V V+ +  G   W  + RNWG+ W++N+ L+G+AL FKVTT DG+++ S  VAP
Sbjct  179  AGDVNAVSVKGSRTG---WQSMSRNWGQNWQSNSYLNGQALSFKVTTGDGRSLVSYNVAP  235

Query  827  KSWQYGQTFEGKNSR  871
             SW +GQTF G   R
Sbjct  236  ASWSFGQTFSGGQFR  250



>ref|NP_001288852.1| expansin-A3 precursor [Brassica rapa]
 gb|AGM16345.1| alpha-expansin protein 3 [Brassica rapa]
 emb|CDX91376.1| BnaC04g07740D [Brassica napus]
Length=263

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 128/257 (50%), Positives = 164/257 (64%), Gaps = 16/257 (6%)
 Frame = +2

Query  134  MATELQAASLLIVLCA-LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTY  301
            M   + A+ +L V  A +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y
Sbjct  11   MWLAVTASLMLTVTNAKIPGVYTGGP--WQNAHATFYGGSDASGTMGGACGYGNLYSQGY  68

Query  302  APYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGK  460
               T ALS ALF N  SCGAC+ L+C ++   C   NP I+VTAT+ CP      + DG 
Sbjct  69   GVNTAALSTALFNNGFSCGACFELKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGG  128

Query  461  WCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnv  640
            WC PPR HFDL+MP +LKIG Y+AG + V Y +VPC + GG RFTI G  YFNLV V+NV
Sbjct  129  WCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKLGGIRFTINGFRYFNLVLVTNV  188

Query  641  ggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKV  820
             G+GD++ V V+ +   +  WV + RNWG+ W++NA L G+AL F+VT  D ++ TS  V
Sbjct  189  AGAGDINGVSVKGS---KTDWVRMSRNWGQNWQSNAVLIGQALSFRVTASDRRSSTSWNV  245

Query  821  APKSWQYGQTFEGKNSR  871
            AP SWQ+GQTF GKN R
Sbjct  246  APPSWQFGQTFSGKNFR  262



>ref|XP_008387765.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=258

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 128/261 (49%), Positives = 161/261 (62%), Gaps = 19/261 (7%)
 Frame = +2

Query  131  AMATELQAASLLIVLCA----LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            A    L  ASLL +  A    +P V+  G   W  AHATFYG  +  GT+GGACG  N  
Sbjct  2    AFLRMLCIASLLSLFMAABARIPGVYTGG--AWEGAHATFYGGSDASGTMGGACGYGNLY  59

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCGAC+ ++C ++   C   NP I VTAT+ CP      +
Sbjct  60   SQGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSIFVTATNFCPPNFAQPS  119

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             DG WC PPR HFDL+MP +LKI EYKAG + V Y +VPC ++GG RFTI G  YFNLV 
Sbjct  120  DDGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVL  179

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            ++NV G+GD+ +V V+    G   W+P+ RNWG+ W++NA L G+ L F+VT  D +  T
Sbjct  180  ITNVAGAGDIVRVSVKGANTG---WMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTST  236

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  VAP  WQ+GQTF GKN R
Sbjct  237  SLNVAPAHWQFGQTFTGKNFR  257



>ref|XP_010276443.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
Length=247

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 158/248 (64%), Gaps = 14/248 (6%)
 Frame = +2

Query  143  ELQAASLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYT  313
            +    SL+++L  L  V G G SGW++AHATFYG     GT+GGACG  N     Y   T
Sbjct  2    DFLGVSLMVLLAMLQTVHGFG-SGWTDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNT  60

Query  314  TALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTGD------GKWCTPP  475
             ALS ALF N  SCGACY ++CVN+   C     II+TAT+ CP  +      G WC PP
Sbjct  61   AALSTALFNNGLSCGACYEIKCVNDPKWC-LPGSIIITATNFCPPNNALPNNAGGWCNPP  119

Query  476  RAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgd  655
              HFDLS P + +I +YKAG + VQY +V C + GG RFTI GH YFNLV ++NVGG+GD
Sbjct  120  LQHFDLSQPVFQRIAQYKAGIVPVQYRRVACEKTGGIRFTINGHSYFNLVLITNVGGAGD  179

Query  656  vskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSW  835
            V  V ++ +  G   W  + RNWG+ W++N+ L+G+AL FKVTT DG+ V S  VAP +W
Sbjct  180  VVAVSIKGSRTG---WQAMSRNWGQNWQSNSYLNGQALSFKVTTSDGQTVVSNNVAPANW  236

Query  836  QYGQTFEG  859
             +GQT+ G
Sbjct  237  AFGQTYSG  244



>emb|CDX74942.1| BnaA05g06880D [Brassica napus]
Length=263

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 164/257 (64%), Gaps = 16/257 (6%)
 Frame = +2

Query  134  MATELQAASLLIVLCA-LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTY  301
            M   + A+ +L V  A +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y
Sbjct  11   MWLAVTASLMLTVTNAKIPGVYTGGP--WQNAHATFYGGSDASGTMGGACGYGNLYSQGY  68

Query  302  APYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGK  460
               T ALS ALF N  SCGAC+ L+C ++   C   NP I+VTAT+ CP      + DG 
Sbjct  69   GVNTAALSTALFNNGFSCGACFELKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGG  128

Query  461  WCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnv  640
            WC PPR HFDL+MP +LKIG Y+AG + V Y +VPC + GG RFTI G  YFNL+ V+NV
Sbjct  129  WCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKLGGIRFTINGFRYFNLILVTNV  188

Query  641  ggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKV  820
             G+GD++ V V+ +   +  WV + RNWG+ W++NA L G+AL F+VT  D ++ TS  V
Sbjct  189  AGAGDINGVSVKGS---KTDWVRMSRNWGQNWQSNAVLIGQALSFRVTASDRRSSTSWNV  245

Query  821  APKSWQYGQTFEGKNSR  871
            AP SWQ+GQTF GKN R
Sbjct  246  APPSWQFGQTFSGKNFR  262



>ref|XP_011013147.1| PREDICTED: expansin-A1 [Populus euphratica]
Length=249

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/251 (49%), Positives = 154/251 (61%), Gaps = 13/251 (5%)
 Frame = +2

Query  146  LQAASLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTT  316
            L    L+  L  +  V G G  GW  AHATFYG     GT+GGACG  N     Y   T 
Sbjct  3    LAGIFLVGFLAMVSSVNGYGGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTA  62

Query  317  ALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTGD------GKWCTPPR  478
            ALS ALF N  SCG+CY +RCVN+   C     I++TAT+ CP  +      G WC PP+
Sbjct  63   ALSTALFNNGLSCGSCYEIRCVNDPKWC-LPGSIVITATNFCPPNNALPNNAGGWCNPPQ  121

Query  479  AHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdv  658
             HFDLS P +  I +Y+AG + V Y +VPC R+GG RFTI GH YFNLV ++NVGG+GDV
Sbjct  122  HHFDLSQPVFQHIAQYRAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDV  181

Query  659  skvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQ  838
              V ++ +  G   W P+ RNWG+ W++N  L+G++L FKVTT DG+ V S  VAP SW 
Sbjct  182  HSVSIKGSRTG---WQPMSRNWGQNWQSNNYLNGQSLSFKVTTSDGRTVVSYNVAPSSWS  238

Query  839  YGQTFEGKNSR  871
            +GQTF G   R
Sbjct  239  FGQTFSGAQFR  249



>ref|XP_009341751.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=258

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 163/265 (62%), Gaps = 21/265 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGL  280
            L VL I A M +   AA+  I     P V+  G   W  AHATFYG     GT+GGACG 
Sbjct  4    LRVLYI-AFMLSLFMAANARI-----PGVYTGGP--WEGAHATFYGGNDASGTMGGACGY  55

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF N  SCGAC+ L+C ++   C   NP I+VTAT+ CP   
Sbjct  56   GNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGDDPRWCHPGNPSILVTATNFCPPNF  115

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
               + DG WC PPR HFDL+MP +LKI EYKAG + V Y +VPC ++GG RFTI G  YF
Sbjct  116  AQPSDDGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYF  175

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV ++NV G+GD+ +V V+    G   W+P+ RNWG+ W++NA L G+ L F+VT  D 
Sbjct  176  NLVLITNVAGAGDIVRVSVKGANTG---WMPMSRNWGQNWQSNADLVGQTLSFRVTGSDR  232

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  TS  VAP  WQ+GQTF GKN R
Sbjct  233  RTSTSHNVAPADWQFGQTFTGKNFR  257



>gb|AEN70883.1| alpha-expansin 1 [Gossypium armourianum]
 gb|AEN70884.1| alpha-expansin 1 [Gossypium harknessii]
Length=258

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 155/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDENGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V V+ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSVKGSKTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  DG+ +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>gb|ABL86681.1| EX4 [Gossypium barbadense]
Length=262

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 155/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISR-TITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKCSKTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  DG+ +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>gb|AEN70871.1| alpha-expansin 1 [Gossypium mustelinum]
Length=258

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 155/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNVVLITNVGGAGDITSVSIKGSRTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  DG+ +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEG  255



>gb|AAQ08016.1| expansin [Melilotus albus]
Length=257

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 160/258 (62%), Gaps = 13/258 (5%)
 Frame = +2

Query  128  AAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDT  298
            A +AT   +    ++   L   +GD   GW  AHATFYG  +  GT+GGACG  N     
Sbjct  2    AIVATSFISILFFVLSLCLKGTYGDYGGGWQNAHATFYGGSDASGTMGGACGYGNLYSQG  61

Query  299  YAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDG  457
            Y   T ALS ALF +  SCGAC+ L+C N+   C   +P I+VTAT+ CP      + +G
Sbjct  62   YGVNTAALSTALFNSGLSCGACFELKCSNDPSWCHPGSPSILVTATNFCPPNFAQPSDNG  121

Query  458  KWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsn  637
             WC PPR HFDL+MP  LKI +Y+AG + V Y +VPC ++GG RF+I G  YFNLV ++N
Sbjct  122  GWCNPPRPHFDLAMPMLLKIAQYRAGIVPVSYRRVPCRKQGGIRFSINGFRYFNLVLITN  181

Query  638  vggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRK  817
            V G+GD+ K  V+ +  G   W+ + RNWG+ W++N+ L G++L F+VT  D +  TS  
Sbjct  182  VAGAGDIVKTSVKGSKTG---WMSMSRNWGQNWQSNSVLVGQSLSFRVTASDKRTSTSLN  238

Query  818  VAPKSWQYGQTFEGKNSR  871
            + P +WQ+GQTF GKN R
Sbjct  239  IVPSNWQFGQTFIGKNFR  256



>ref|XP_009409019.1| PREDICTED: expansin-A4-like [Musa acuminata subsp. malaccensis]
Length=257

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/260 (46%), Positives = 163/260 (63%), Gaps = 18/260 (7%)
 Frame = +2

Query  131  AMATELQAASLLI---VLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QK  292
            A+A+ +  A L +   V   +P ++  G   W  AHATFYG  +  GT+GGACG  N   
Sbjct  2    ALASFVSVALLALLAPVTARIPGLYAGGQ--WQNAHATFYGGSDASGTMGGACGYGNLYS  59

Query  293  DTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TG  451
              Y   T ALS ALF   +SCGAC+ ++C  +   C   +P I +TAT+ CP      + 
Sbjct  60   QGYGVQTAALSTALFNEGQSCGACFEIKCAGDPQWCHGGSPSIFITATNFCPPNYALPSD  119

Query  452  DGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtv  631
            DG WC PPR HFDLSMP +LKI EY+AG + V Y +VPC R GG RFTI G +YFNLV +
Sbjct  120  DGGWCNPPRPHFDLSMPMFLKIAEYRAGIVPVSYRRVPCRRSGGIRFTINGFKYFNLVLI  179

Query  632  snvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTS  811
            +NV G+GD+ +  V+ +  G   W+P+ RNWG+ W++NA L G++L F++T  D +  TS
Sbjct  180  TNVAGAGDIVRASVKGSRTG---WMPMSRNWGQNWQSNAVLVGQSLSFRLTGSDRRTSTS  236

Query  812  RKVAPKSWQYGQTFEGKNSR  871
              + P +WQ+GQTFEGKN R
Sbjct  237  WNIVPSNWQFGQTFEGKNFR  256



>gb|AAM62937.1| Alpha-expansin 4 precursor (At-EXP4) (AtEx4) (Ath-ExpAlpha-1.6) 
[Arabidopsis thaliana]
Length=257

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/261 (47%), Positives = 161/261 (62%), Gaps = 20/261 (8%)
 Frame = +2

Query  134  MATELQAASLLIVLCAL-----PCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            MA +L       VL +L     P ++  G   W  AHATFYG  +  GT+GGACG  N  
Sbjct  1    MAIKLAILFTTFVLFSLADARIPGIYSGG--AWQNAHATFYGGSDASGTMGGACGYGNLY  58

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCGAC+ L+C N+   C + +P I++TAT  CP      +
Sbjct  59   SQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATXFCPPNLAQPS  118

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR HFDL+MP +LKI +Y+AG + V Y  VPC ++GG RFTI GH YFNLV 
Sbjct  119  DNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRSVPCRKRGGIRFTINGHRYFNLVL  178

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            ++NV G+GD+ +  V+ +  G   W+ L RNWG+ W++NA L G+AL F+VT  D +  T
Sbjct  179  ITNVAGAGDIVRASVKXSRTG---WMSLSRNWGQNWQSNAVLVGQALSFRVTGSDRRTST  235

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  + P +WQ+GQTF GKN R
Sbjct  236  SWNMVPSNWQFGQTFVGKNFR  256



>ref|XP_010517323.1| PREDICTED: expansin-A4-like [Camelina sativa]
Length=257

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 154/262 (59%), Gaps = 22/262 (8%)
 Frame = +2

Query  134  MATELQAASLLIVLCAL-----PCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            MA +L       VL  L     P V+    S W  AHATFYG  +  GT+GGACG  N  
Sbjct  1    MAIKLAILFTTFVLFNLADARIPGVYSG--SSWQNAHATFYGGSDASGTMGGACGYGNLY  58

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCGAC+ L+C N+   C + +P I++TAT+ CP      +
Sbjct  59   SQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPS  118

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR HFDL+MP +LKI +Y+AG + V Y +VPC ++GG RFTI GH YFNL  
Sbjct  119  DNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNL--  176

Query  629  vsnvggsgdvskvdvedNADGEKK-WVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAV  805
               +  +   +   V  N  G +  W+ L RNWG+ W++NA L G++L F+VT  D +  
Sbjct  177  --ILITNVAGAGDIVRANVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTS  234

Query  806  TSRKVAPKSWQYGQTFEGKNSR  871
            TS  + P +WQ+GQTF GKN R
Sbjct  235  TSWNMVPSNWQFGQTFVGKNFR  256



>ref|XP_004970396.1| PREDICTED: expansin-A2-like [Setaria italica]
Length=251

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 158/257 (61%), Gaps = 22/257 (9%)
 Frame = +2

Query  134  MATELQAASLLIVLCALPCVF-----GDGNSGWSEAHATFYG--PPEGTVGGACGLQNQK  292
            MAT   A  LL++LC+  C       GD   GW  AHATFYG     GT+GGACG  N  
Sbjct  1    MAT---ANVLLLLLCSAVCFLARRAAGD-YGGWQSAHATFYGGGDASGTMGGACGYGNLY  56

Query  293  DT-YAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TG  451
             T Y   T ALS ALF +  SCG C+ LRC N    C     I VTAT+ CP      + 
Sbjct  57   STGYGTNTAALSTALFNDGASCGQCFELRCDNAGASC-LPGTITVTATNFCPPNYGLPSD  115

Query  452  DGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtv  631
            DG WC PPR HFD++ PA+L+I +Y+AG + V Y +VPC +KGG RFTI GH YFNLV V
Sbjct  116  DGGWCNPPRPHFDMAQPAFLQIAQYRAGIVPVAYRRVPCVKKGGIRFTINGHSYFNLVLV  175

Query  632  snvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTS  811
            +NV G+GDV  V ++ ++ G   W  + RNWG+ W++N+ L G+AL FKVT  DG+ VTS
Sbjct  176  TNVAGAGDVQSVSIKGSSTG---WQAMSRNWGQNWQSNSLLDGQALSFKVTASDGRCVTS  232

Query  812  RKVAPKSWQYGQTFEGK  862
               AP  W +GQTFEG 
Sbjct  233  NNAAPAGWSFGQTFEGS  249



>ref|XP_009631918.1| PREDICTED: expansin-A4-like [Nicotiana tomentosiformis]
Length=265

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 153/232 (66%), Gaps = 14/232 (6%)
 Frame = +2

Query  194  FGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGAC  364
            F D N GW  AHAT YG     GT+GGACG  N     Y   T ALS ALF N  +CGAC
Sbjct  37   FAD-NGGWQSAHATAYGGGDASGTMGGACGYVNLNSQGYGTNTAALSTALFNNGLTCGAC  95

Query  365  YALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEY  526
            Y L+C NN G+      I VTAT+ CP      + +G WC PP  HFDL+ PA+LKI +Y
Sbjct  96   YQLKC-NNDGKRCISGTITVTATNFCPPNPSLPSNNGGWCNPPLQHFDLAQPAFLKIAQY  154

Query  527  KAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWV  706
            KAG + V + +VPC +KGG RFTI GH Y+NLV V+NVGG+GDV  + ++ + +G   W 
Sbjct  155  KAGIVPVSFRRVPCKKKGGIRFTINGHSYYNLVLVTNVGGAGDVHSISIKGSKNG---WT  211

Query  707  PLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGK  862
             + RNWG+ W++N+ L+G++L FKVTT DG+ VTS   AP +WQ+GQTFEG+
Sbjct  212  SMSRNWGQNWQSNSYLNGQSLSFKVTTSDGRTVTSNNAAPANWQFGQTFEGR  263



>ref|NP_001150534.1| alpha-expansin 6 precursor [Zea mays]
 gb|ACG39445.1| alpha-expansin 6 precursor [Zea mays]
Length=263

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 155/265 (58%), Gaps = 23/265 (9%)
 Frame = +2

Query  113  VLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN  286
            +L++  AM     AA +       P V+G G  GW  AHATFYG  +  GT+GGACG  N
Sbjct  9    LLVVATAMMFSPAAARI-------PGVYGGG--GWQSAHATFYGGSDASGTMGGACGYGN  59

Query  287  -QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQ--CKTQNP-IIVTATDLCP---  445
                 Y     ALS ALF    SCGAC+ ++C +  G   C+  +P I+VTAT+ CP   
Sbjct  60   LYSQGYGVNNAALSTALFNQGLSCGACFEIKCEDQPGWRWCRPGSPSILVTATNFCPPNY  119

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
               + DG WC PPR HFDL+MP +L I EY+AG + V Y +VPC + GG RFTI G  YF
Sbjct  120  ALPSDDGGWCNPPRPHFDLAMPMFLHIAEYRAGIVPVTYRRVPCRKSGGVRFTINGFRYF  179

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NL  V     +G    V     A G  +W+P+ RNWG+ W+++A L G+AL F+VT  D 
Sbjct  180  NL--VLITNVAGAGDVVRASVKASGAGEWMPMSRNWGQNWQSSAILVGQALSFRVTGSDR  237

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  TS   AP+ W++GQTFEGKN R
Sbjct  238  RTSTSWNAAPRDWRFGQTFEGKNFR  262



>ref|NP_191109.1| expansin A16 [Arabidopsis thaliana]
 sp|Q9M2S9.1|EXP16_ARATH RecName: Full=Expansin-A16; Short=AtEXPA16; AltName: Full=Alpha-expansin-16; 
Short=At-EXP16; Short=AtEx16; AltName: Full=Ath-ExpAlpha-1.7; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB75908.1| expansin-like protein [Arabidopsis thaliana]
 dbj|BAD43638.1| expansin-like protein [Arabidopsis thaliana]
 gb|AEE79393.1| expansin A16 [Arabidopsis thaliana]
Length=260

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 116/240 (48%), Positives = 158/240 (66%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQNQ-KDTYAPYTTALSAALFKNAES  352
            +P VF  G+  W  AHATFYG     GT+GGACG  N     Y   T ALS +LF + +S
Sbjct  25   IPRVFSGGS--WQTAHATFYGGNDASGTMGGACGYGNLYSQGYGTNTAALSTSLFNSGQS  82

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ ++CVN+   C   NP + VTAT+ CP      + +G WC PPR+HFDL+MP +L
Sbjct  83   CGACFEIKCVNDPKWCHPGNPSVFVTATNFCPPNLAQPSDNGGWCNPPRSHFDLAMPVFL  142

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
            KI EY+AG + + Y +V C + GG RFTI GH YFNLV ++NV G+GD+++  V+ +  G
Sbjct  143  KIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIARTSVKGSKTG  202

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
               W+ L RNWG+ W++NA L G++L F+VT+ D +  TS  +AP +WQ+GQTF GKN R
Sbjct  203  ---WMSLTRNWGQNWQSNAVLVGQSLSFRVTSSDRRTSTSWNIAPSNWQFGQTFVGKNFR  259



>emb|CDM84777.1| unnamed protein product [Triticum aestivum]
Length=251

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 156/250 (62%), Gaps = 17/250 (7%)
 Frame = +2

Query  149  QAASLLIVLCALPCVFGDGNSG----WSEAHATFYG--PPEGTVGGACGLQNQKDT-YAP  307
             A +LL++  A  C      +G    W  AHATFYG     GT+GGACG  N   T Y  
Sbjct  3    SANALLLLFSAAFCFLARRAAGDYGSWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGT  62

Query  308  YTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCT  469
             T ALS ALF +  +CG+CY L+C + +  C     I +TAT+LCP        DG WC 
Sbjct  63   NTAALSTALFNDGAACGSCYELKCQDVSSSC-LPGSITITATNLCPPNYALPNDDGGWCN  121

Query  470  PPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggs  649
            PPRAHFD++ PAYL+IG Y+AG + V Y +VPC +KGG RFTI GH YFNLV V+NV G+
Sbjct  122  PPRAHFDMAEPAYLQIGIYRAGIVAVAYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGA  181

Query  650  gdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPK  829
            GDV  V ++ ++ G   W  + RNWG+ W++NA L G++L F+VT  DG+ VTS   AP 
Sbjct  182  GDVQSVAIKGSSTG---WQAMARNWGQNWQSNADLDGQSLSFRVTLSDGRTVTSNNAAPA  238

Query  830  SWQYGQTFEG  859
             W +GQTFEG
Sbjct  239  GWSFGQTFEG  248



>ref|XP_002533097.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
 gb|EEF29289.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
Length=259

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 164/261 (63%), Gaps = 20/261 (8%)
 Frame = +2

Query  134  MATELQAASLLIVLCA-----LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            M + +    LL++L       +P V+  G+  W  AHATFYG  +  GT+GGACG  N  
Sbjct  3    MGSVISGVILLVMLMGASEARIPGVYTGGS--WQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCGAC+ ++C N+   C + +P I++TAT+ CP       
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNFALPN  120

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV 
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            +SNV G+GD+ KV V+ +  G   W+ + RNWG+ W++NA L G++L F+VT  D +  T
Sbjct  181  ISNVAGAGDIVKVSVKGSRTG---WMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTST  237

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  + P +WQ+GQTF GKN R
Sbjct  238  SWNIVPANWQFGQTFTGKNFR  258



>gb|AAM22626.1|AF428179_1 expansin 12 precursor [Rumex palustris]
Length=258

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/261 (46%), Positives = 165/261 (63%), Gaps = 18/261 (7%)
 Frame = +2

Query  128  AAMATELQAASLLIVLCA---LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            AA++  L   S+L    A   +P V+  G  GW  AHATFYG  +  GT+GGACG  N  
Sbjct  2    AALSALLCIVSVLSFYSADARIPGVYSGG--GWETAHATFYGGSDASGTMGGACGFGNLY  59

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCGAC+ ++C ++   C   +P I++TAT+ CP      +
Sbjct  60   SQGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCHPGSPSILITATNFCPPNFAEPS  119

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR HFDL+MP +LK  EY+AG + V + +VPC ++GG RFT+ G  YFNLV 
Sbjct  120  DNGGWCNPPRPHFDLAMPMFLKFAEYRAGIVPVAFRRVPCRKRGGIRFTVNGFRYFNLVL  179

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            ++NV G+GD+ +V ++ +      W+P+ RNWG+ W++NA L G++L F+VT  D +  T
Sbjct  180  ITNVAGAGDIVRVSIKGS---RSDWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRKST  236

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  VAP SWQ+GQTF GKN R
Sbjct  237  SWNVAPASWQFGQTFTGKNFR  257



>gb|AFZ78605.1| expansin protein [Populus tomentosa]
Length=247

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 122/249 (49%), Positives = 155/249 (62%), Gaps = 14/249 (6%)
 Frame = +2

Query  143  ELQAASLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYT  313
            E    +++I+L  L  V G G +GW+ AHATFYG     GT+GGACG  N     Y   T
Sbjct  2    ECLGYTMVILLTMLKIVKGYG-TGWTGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNT  60

Query  314  TALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPP  475
             ALS ALF N  SCGACY ++CVN+   C  Q  IIVTAT+ CP        DG WC PP
Sbjct  61   AALSTALFNNGLSCGACYEIKCVNDNTWC-LQESIIVTATNFCPPNNALPNNDGGWCNPP  119

Query  476  RAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgd  655
            + HFDLS P + KI +YKAG + VQY +V C + GG RFTI GH YFNLV ++NVGG+GD
Sbjct  120  QQHFDLSQPVFQKIAQYKAGIVPVQYRRVACRKSGGIRFTINGHSYFNLVLITNVGGAGD  179

Query  656  vskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSW  835
            V  V ++        W  + RNWG+ W++N  L+ +AL F+VTT DG+ V S  VAP +W
Sbjct  180  VVAVSIKGTTS---NWQAMSRNWGQNWQSNTYLNNQALSFRVTTSDGRTVVSNNVAPSNW  236

Query  836  QYGQTFEGK  862
             +GQT+ G 
Sbjct  237  AFGQTYTGS  245



>ref|XP_004302749.1| PREDICTED: expansin-A4-like [Fragaria vesca subsp. vesca]
Length=260

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 162/250 (65%), Gaps = 16/250 (6%)
 Frame = +2

Query  155  ASLLIVLCA-LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTAL  322
            ASLL+V  A +P  +  G   W EAHATFYG  +  GT+GGACG  N     Y   T AL
Sbjct  15   ASLLMVANARIPGPYTGGP--WQEAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAAL  72

Query  323  SAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRA  481
            S ALF N  SCGAC+ ++C ++   C    P I VTAT+ CP      + +G WC PPR 
Sbjct  73   STALFNNGLSCGACFEIKCGDDPRWCTAGKPSIFVTATNFCPPNFAQPSDNGGWCNPPRT  132

Query  482  HFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvs  661
            HFDL+MP +LKI EYKAG + V Y +VPC +KGG RFTI GH+YFNLV V+NV G+GD+ 
Sbjct  133  HFDLAMPMFLKIAEYKAGIVPVSYRRVPCVKKGGIRFTINGHKYFNLVLVTNVAGAGDIV  192

Query  662  kvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQY  841
             V V+    G   W+P+ RNWG+ W++N+ L G+AL F+V   D ++ T+  VAP +WQ+
Sbjct  193  SVSVKGTNTG---WMPMSRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTTYNVAPANWQF  249

Query  842  GQTFEGKNSR  871
            GQT+ GKN R
Sbjct  250  GQTYSGKNFR  259



>emb|CAH18933.1| expansin [Pyrus communis]
Length=258

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 163/265 (62%), Gaps = 21/265 (8%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGL  280
            L VL I   ++  ++A +       +P V+  G   W  AHATFYG     GT+GGACG 
Sbjct  4    LRVLYIAFMLSLFMEANA------RIPGVYTGGP--WEGAHATFYGGNDASGTMGGACGY  55

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF N  SCGAC+ ++C ++   C   NP I+VTAT+ CP   
Sbjct  56   GNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNF  115

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
               + DG WC PPR HFDL+MP +LKI EYKAG + V Y +VPC ++GG RFTI G  YF
Sbjct  116  AQPSDDGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYF  175

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV ++NV G+GD+ +V V+    G   W+P+ RNWG+ W++NA L G+ L F+VT  D 
Sbjct  176  NLVLITNVAGAGDIVRVSVKGANTG---WMPMSRNWGQNWQSNADLVGQTLSFRVTGSDR  232

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  TS  VAP  WQ+GQTF GKN R
Sbjct  233  RTSTSHNVAPADWQFGQTFTGKNFR  257



>ref|XP_009760985.1| PREDICTED: expansin-A10-like [Nicotiana sylvestris]
Length=240

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 153/245 (62%), Gaps = 12/245 (5%)
 Frame = +2

Query  155  ASLLIVLCALPCVFGDGNS---GWSEAHATFYG--PPEGTVGGACGLQNQKDT-YAPYTT  316
            A L+++   +  +F   +    GW  AHATFYG     GT+GGACG  N   T Y   T 
Sbjct  2    AILVLLFMGISLMFQSVHGYYGGWINAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTA  61

Query  317  ALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTGDGKWCTPPRAHFDLS  496
            ALS ALF N  SCGAC+ LRCVN    C     I VTAT+ CP   G WC PP  HFDLS
Sbjct  62   ALSTALFNNGLSCGACFQLRCVNARQYC-LPGTITVTATNFCP--PGGWCDPPNHHFDLS  118

Query  497  MPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdve  676
             P YL+I +Y++G + V Y +VPC R+GG RFTI GH YFNLV V+NVGG+GDV  + ++
Sbjct  119  QPVYLRIAQYRSGIVPVAYRRVPCRRRGGIRFTINGHSYFNLVLVTNVGGAGDVRSLYIK  178

Query  677  dNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFE  856
             +     +W P+ RNWG+ W+ NA L+G++L FKVTT DG+ V S   AP SW +GQTF 
Sbjct  179  GS---RTQWQPMSRNWGQNWQNNAYLNGQSLSFKVTTSDGRTVVSYNAAPHSWSFGQTFT  235

Query  857  GKNSR  871
            G   R
Sbjct  236  GGQFR  240



>dbj|BAE06067.1| expansin [Sagittaria pygmaea]
Length=266

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/250 (48%), Positives = 156/250 (62%), Gaps = 15/250 (6%)
 Frame = +2

Query  152  AASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTAL  322
               + IV   +P V+    S W +AHATFYG  +  GT+GGACG  N     Y   T AL
Sbjct  21   VVDVFIVDARVPGVYS--GSEWQQAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAAL  78

Query  323  SAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRA  481
            S ALF    SCGAC+ ++C N+   C    P I +TAT+ CP      + +G WC PPR 
Sbjct  79   STALFNQGLSCGACFEIKCANDPQWCHGGGPSIFITATNFCPPNYALPSDNGGWCNPPRP  138

Query  482  HFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvs  661
            HFDL+MP +LKI +Y+AG + VQY +VPC + GG RFTI GH YFNLV ++NV G+GD+ 
Sbjct  139  HFDLAMPMFLKIAQYRAGIVPVQYRRVPCRKSGGIRFTINGHRYFNLVLITNVAGAGDIV  198

Query  662  kvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQY  841
            +V V+    G   W+P+ RNWG+ W++NA L G+AL F+VT  D +  TS  V P +W +
Sbjct  199  RVSVKGTKTG---WMPMSRNWGQNWQSNAVLVGQALSFRVTGSDHRTSTSWNVVPANWNF  255

Query  842  GQTFEGKNSR  871
            GQTF GKN R
Sbjct  256  GQTFSGKNFR  265



>ref|XP_007027486.1| Alpha-expansin 3 precursor [Theobroma cacao]
 gb|EOY07988.1| Alpha-expansin 3 precursor [Theobroma cacao]
Length=295

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 145/228 (64%), Gaps = 10/228 (4%)
 Frame = +2

Query  215  WSEAHATFYGPPEGTVGGACGLQNQ-KDTYAPYTTALSAALFKNAESCGACYALRCVNNT  391
            W + HATFY    GT GGACG ++  K  Y   T ALSAALF N + CGAC+ ++CV+++
Sbjct  66   WKQGHATFYEGGSGTFGGACGYEDVVKMGYGLNTAALSAALFNNGQKCGACFEIKCVDSS  125

Query  392  GQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQ  550
              CK   P +IVTATD CP      + +G WC PPRAHFDL+ PA+ +I EY+ G + VQ
Sbjct  126  EWCKPGQPSLIVTATDSCPPNYDLPSDNGGWCNPPRAHFDLAKPAFGQIAEYQGGIVPVQ  185

Query  551  YSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGE  730
            Y +VPC ++GG RFT+ G+ YFNL       G             D ++ W+PLKRNWG+
Sbjct  186  YRRVPCKKQGGIRFTVTGNPYFNL-VSVWNVGGAGDVISVHVLKGDNKQTWIPLKRNWGQ  244

Query  731  KWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG-KNSR  871
            KWET+A L G+ L F+V T DGK  TS  VAPK+WQ+ QTF G KN R
Sbjct  245  KWETDAKLVGEDLSFRVRTSDGKTSTSWHVAPKNWQFDQTFLGSKNFR  292



>ref|XP_010921302.1| PREDICTED: expansin-A10-like [Elaeis guineensis]
Length=247

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 159/248 (64%), Gaps = 14/248 (6%)
 Frame = +2

Query  143  ELQAASLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYT  313
            E  A SL+ +L     V G G  GWS+AHATFYG     GT+GGACG  N     Y   T
Sbjct  2    EFIALSLVSLLTIFGAVHGYG-GGWSDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNT  60

Query  314  TALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPP  475
             ALS ALF +  SCGAC+ ++C N+   C     IIVTAT+ CP        +G WC PP
Sbjct  61   AALSTALFNSGLSCGACFEIKCSNDGSWC-LPGSIIVTATNFCPPNNALPNDNGGWCNPP  119

Query  476  RAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgd  655
              HFDLS P + +I +YKAG + VQY +VPC + GG RFTI GH YFNLV +SNVGG+GD
Sbjct  120  LQHFDLSQPVFQRIAQYKAGIVPVQYRRVPCVKNGGIRFTINGHSYFNLVLISNVGGAGD  179

Query  656  vskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSW  835
            V+ V ++ +  G   W P+ RNWG+ W++N+ L+G++L F+VTT DG+ VTS  VAP +W
Sbjct  180  VTAVSIKGSQTG---WQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVTSMDVAPNNW  236

Query  836  QYGQTFEG  859
             +GQT+ G
Sbjct  237  SFGQTYSG  244



>gb|AAR82850.1| expansin-2 [Petunia x hybrida]
Length=262

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 125/261 (48%), Positives = 163/261 (62%), Gaps = 19/261 (7%)
 Frame = +2

Query  131  AMATELQAASLLIVLCA--LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKD  295
             MAT + A   LI L    +P V+  G+  W  AHATFYG  +  GT+GGACG  N    
Sbjct  6    VMATYILALLFLISLVEARIPGVYSGGS--WQTAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  296  TYAPYTTALSAALFKNAESCGACYALRCVNNTGQ--CKTQNP-IIVTATDLCP------T  448
             Y   T ALS ALF N  SCGAC+ L+C N+     C   NP I++TAT+ CP       
Sbjct  64   GYGVNTAALSTALFNNGLSCGACFELKCTNDPHWKWCLPGNPSILITATNFCPPNYAKPN  123

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR+HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFT+ G  YFNLV 
Sbjct  124  DNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGIRFTMNGFRYFNLVL  183

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            + NV G+GD+ KV V+     +  W+PL RNWG+ W+TN+ L+G++L F+V   D +  T
Sbjct  184  IPNVAGAGDIIKVWVKGT---KTNWIPLSRNWGQNWQTNSILTGQSLSFRVKASDHRTST  240

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  +AP  WQ+GQTF GKN R
Sbjct  241  SWNIAPSHWQFGQTFNGKNFR  261



>ref|NP_001288942.1| expansin-A16 precursor [Brassica rapa]
 gb|AGM16358.1| alpha-expansin protein 16 [Brassica rapa]
Length=260

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 159/247 (64%), Gaps = 15/247 (6%)
 Frame = +2

Query  161  LLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAA  331
            L +   A+P V+  G+  W  AHATFYG  +  GT+GGACG  N     Y   T ALS A
Sbjct  18   LSLTNAAIPGVYSGGS--WQTAHATFYGGDDASGTMGGACGYGNLYSQGYGTNTAALSTA  75

Query  332  LFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFD  490
            LF N  +CGAC+ ++CVN+   C + +P + VTAT+ CP      + +G WC PPRAHFD
Sbjct  76   LFNNGLTCGACFEIKCVNDPKWCHSGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRAHFD  135

Query  491  LSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvd  670
            L+MP +LKI EY+AG + + Y +V C + GG RFTI GH YFNLV ++NV G+GD+ +  
Sbjct  136  LAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIVRTS  195

Query  671  vedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQT  850
            V+ +  G   W+ L RNWG+ W++N  L G++L F+VTT D +  TS  + P +WQ+GQT
Sbjct  196  VKGSKTG---WMGLTRNWGQNWQSNTVLVGQSLSFRVTTSDRRTSTSWNIVPSNWQFGQT  252

Query  851  FEGKNSR  871
            F GKN R
Sbjct  253  FVGKNFR  259



>ref|NP_001234081.1| expansin A4 precursor [Solanum lycopersicum]
 gb|AAD13632.1| expansin precursor [Solanum lycopersicum]
Length=263

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 161/264 (61%), Gaps = 19/264 (7%)
 Frame = +2

Query  122  ITAAMATELQAASLLIVLCA----LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQ  283
            + A M   +    LL  L A    +P V+  G   W  AHATFYG  +  GT+GGACG  
Sbjct  4    MAANMMLYITITVLLCFLTAVNARIPGVYTGG--PWQTAHATFYGGSDASGTMGGACGYG  61

Query  284  N-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP----  445
            N     Y     ALS  LF N  SCGAC+ L+C N+   C   NP I VTAT+ CP    
Sbjct  62   NLYSQGYGVNNAALSTVLFNNGLSCGACFELKCDNDGKWCLPGNPSIFVTATNFCPPNFA  121

Query  446  --TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFN  619
                DG WC PPR HFDL+MP +LKIG Y+AG + V Y +VPC ++GG RFTI G  YFN
Sbjct  122  LPNDDGGWCNPPRPHFDLAMPMFLKIGLYRAGIVPVTYRRVPCRKQGGIRFTINGFRYFN  181

Query  620  LvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGK  799
            L+ V+NV G+GD+ KV ++       +W+ + RNWG+ W+TN+PL G+AL  +V   D +
Sbjct  182  LLLVTNVAGAGDIQKVLIKGT---NTQWIAMSRNWGQNWQTNSPLVGQALSIRVKASDHR  238

Query  800  AVTSRKVAPKSWQYGQTFEGKNSR  871
            +VT+  VAP +WQ+GQTFEGKN R
Sbjct  239  SVTNVNVAPSNWQFGQTFEGKNFR  262



>ref|XP_009788740.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=259

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/254 (49%), Positives = 160/254 (63%), Gaps = 19/254 (7%)
 Frame = +2

Query  152  AASLLIVLCA----LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPY  310
            AA+LL  L A    +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   
Sbjct  10   AATLLCFLTAVNAKIPGVYTGGP--WQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  67

Query  311  TTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCT  469
              ALS  LF N  SCGAC+ ++CV++   C   NP I VTAT+ CP        DG WC 
Sbjct  68   NAALSTVLFNNGLSCGACFEIKCVDDGKWCLPGNPSIFVTATNFCPPNFALPNDDGGWCN  127

Query  470  PPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggs  649
            PPR HFDL+MP +LKIG+Y+AG + V Y +VPC + GG RFTI G  YFNL+ V+NV G+
Sbjct  128  PPRPHFDLAMPMFLKIGQYRAGIVPVTYRRVPCRKAGGIRFTINGFRYFNLLLVTNVAGA  187

Query  650  gdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPK  829
            GD+ KV ++       +W+ + RNWG+ W+TNA L G+AL  +V   D ++VTS  VAP 
Sbjct  188  GDIQKVLIKGT---NTQWIAMSRNWGQNWQTNAVLVGQALSIRVKASDHRSVTSTNVAPP  244

Query  830  SWQYGQTFEGKNSR  871
            +WQ+GQTFEGKN R
Sbjct  245  NWQFGQTFEGKNFR  258



>gb|AAO92741.1| expansin [Gossypium hirsutum]
Length=258

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 154/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLRIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKVSKTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  D + +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDSRTITNYNVVPAGWQFGQTFEG  255



>gb|AAC39512.1| expansin [Gossypium hirsutum]
Length=258

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 153/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ P +L+I EY+
Sbjct  90   ELRCNNDPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPRFLRIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++ +GG+GD++ V ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITKLGGAGDITSVSIKGSRTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  DG+ +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEG  255



>gb|ACT67493.1| expansin A1 [Raphanus sativus]
Length=258

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 157/240 (65%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF +  S
Sbjct  23   IPGVYSGG--AWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGMS  80

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ L+C N+   C + +P I++TAT+ CP      + +G WC PPRAHFDL+MP +L
Sbjct  81   CGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFDLAMPVFL  140

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
            KI +Y+AG + V Y +VPC ++GG RFTI GH YFNLV ++NV G+GD+ +  V+ +  G
Sbjct  141  KIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKGSRTG  200

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
               W+ L RNWG+ W++NA L G++L F+VT  D +  TS  + P +WQ+GQT+ GKN R
Sbjct  201  ---WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTYVGKNFR  257



>ref|XP_010508990.1| PREDICTED: expansin-A4-like [Camelina sativa]
Length=257

 Score =   212 bits (540),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 116/262 (44%), Positives = 154/262 (59%), Gaps = 22/262 (8%)
 Frame = +2

Query  134  MATELQAASLLIVLCAL-----PCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            MA +L       VL  L     P V+    S W  AHATFYG  +  GT+GGACG  N  
Sbjct  1    MAIKLAILFTTFVLFNLADARIPGVYSG--SSWQNAHATFYGGSDASGTMGGACGYGNLY  58

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCGAC+ L+C N+   C + +P I++TAT+ CP      +
Sbjct  59   SQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPS  118

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR HFDL+MP +LKI +Y+AG + V Y +VPC ++GG RFTI GH YFNL  
Sbjct  119  DNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNL--  176

Query  629  vsnvggsgdvskvdvedNADGEKK-WVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAV  805
               +  +   +   V  N  G +  W+ L RNWG+ W++NA L G++L F+VT  D +  
Sbjct  177  --ILITNVAGAGDIVRANVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTS  234

Query  806  TSRKVAPKSWQYGQTFEGKNSR  871
            T+  + P +WQ+GQTF GKN R
Sbjct  235  TTWNMVPSNWQFGQTFVGKNFR  256



>dbj|BAH36862.1| alpha expansin [Rosa hybrid cultivar]
Length=258

 Score =   212 bits (540),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 162/250 (65%), Gaps = 16/250 (6%)
 Frame = +2

Query  155  ASLLIVLCA-LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTAL  322
            ASLLI+  A +P  +  G   W +AHATFYG  +  GT+GGACG  N     Y   T AL
Sbjct  13   ASLLILANARIPGPYTGGP--WQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAAL  70

Query  323  SAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRA  481
            S ALF N  SCGAC+ +RC ++   C    P I VTAT+ CP      + +G WC PPR 
Sbjct  71   STALFNNGLSCGACFEIRCGDDPRWCTPGKPSIFVTATNFCPPNFAQPSDNGGWCNPPRT  130

Query  482  HFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvs  661
            HFDL+MP +LKI EYKAG + V Y +VPC ++GG RFTI GH+YFNLV ++NV G+GDV 
Sbjct  131  HFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKRGGIRFTINGHKYFNLVLITNVAGAGDVV  190

Query  662  kvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQY  841
             V V+    G   W+P+ RNWG+ W++N+ L G+AL F+V   D ++ T+  VAP +WQ+
Sbjct  191  SVSVKGTNTG---WMPMSRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTTYNVAPANWQF  247

Query  842  GQTFEGKNSR  871
            GQT+ GKN R
Sbjct  248  GQTYSGKNFR  257



>gb|AEN70887.1| alpha-expansin 1 [Gossypium aridum]
Length=258

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 154/229 (67%), Gaps = 13/229 (6%)
 Frame = +2

Query  200  DGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYA  370
            D N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY 
Sbjct  31   DDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYE  90

Query  371  LRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKA  532
            LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+A
Sbjct  91   LRCNNDPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYRA  149

Query  533  GFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPL  712
            G + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V ++ +  G   W+P+
Sbjct  150  GIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSKTG---WLPM  206

Query  713  KRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
             RNWG+ W++NA L+G++L FKVT  DG+ +T+  V P  WQ+GQTFEG
Sbjct  207  SRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEG  255



>ref|XP_006445551.1| hypothetical protein CICLE_v10017738mg [Citrus clementina]
 ref|XP_006488964.1| PREDICTED: expansin-A10-like [Citrus sinensis]
 gb|ESR58791.1| hypothetical protein CICLE_v10017738mg [Citrus clementina]
 gb|KDO54531.1| hypothetical protein CISIN_1g025827mg [Citrus sinensis]
Length=247

 Score =   212 bits (539),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 159/249 (64%), Gaps = 18/249 (7%)
 Frame = +2

Query  155  ASLLIVLCALPCVF----GDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYT  313
            A L  ++ AL  VF    G G +GW+ AHATFYG     GT+GGACG  N     Y   T
Sbjct  2    AILGYIIIALFTVFKAAVGKG-AGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNT  60

Query  314  TALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPP  475
             A+S ALF N  +CGACYA++CVN+   C     IIVTAT+ CP        +G WC PP
Sbjct  61   AAVSTALFNNGLNCGACYAIKCVNDNRWC-LPGSIIVTATNFCPPNFALSNTNGGWCNPP  119

Query  476  RAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgd  655
              HFDLS P +LKI +YKAG + VQY +V C + GG RFTI GH YFNLV ++NVGG+GD
Sbjct  120  LHHFDLSQPVFLKIAQYKAGIVPVQYRRVACKKSGGIRFTINGHSYFNLVLITNVGGAGD  179

Query  656  vskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSW  835
            V  V ++ +  G   W  L RNWG+ W++N+ L+G+AL FKVTT DG+ V S  VAP +W
Sbjct  180  VVAVSIKGSKTG---WQALSRNWGQNWQSNSYLNGQALSFKVTTSDGRTVISNNVAPANW  236

Query  836  QYGQTFEGK  862
             +GQT+ G+
Sbjct  237  NFGQTYTGR  245



>ref|XP_007141864.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
 gb|ESW13858.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
Length=260

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 163/263 (62%), Gaps = 20/263 (8%)
 Frame = +2

Query  128  AAMATELQAASLLIVLCA-----LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN  286
            A+    L   SL+ VL A     +P V+G G   W  AHATFYG  +  GT+GGACG  N
Sbjct  2    ASFQKLLAIVSLVTVLLASAEARIPGVYGGG--AWETAHATFYGGSDASGTMGGACGYGN  59

Query  287  -QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP-----  445
                 Y   T ALS ALF +  SCGAC+ ++C ++   C   +P I+VTAT+ CP     
Sbjct  60   LYSQGYGVNTAALSTALFNSGLSCGACFEIKCADDPSWCHAGSPSILVTATNFCPPNYAL  119

Query  446  -TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNL  622
             + +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNL
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGMRFTINGFRYFNL  179

Query  623  vtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKA  802
            V ++NV G+GDV +  V+    G   W+ + RNWG+ W++NA L G++L F+VT  D + 
Sbjct  180  VLITNVAGAGDVVRTSVKGAKTG---WMSMSRNWGQNWQSNAVLVGQSLSFRVTASDRRT  236

Query  803  VTSRKVAPKSWQYGQTFEGKNSR  871
             TS  + P +WQ+GQTF GKN R
Sbjct  237  STSWNIVPANWQFGQTFTGKNFR  259



>gb|ACD37706.1| alpha expansin [Gossypium hirsutum]
 gb|ADY68813.1| alpha-expansin 1 [Gossypium hirsutum]
 gb|AEN70882.1| alpha-expansin 1 [Gossypium hirsutum subsp. latifolium]
Length=258

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 154/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISR-TITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSKTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  D + +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDSRTITNYNVVPAGWQFGQTFEG  255



>gb|ABO32366.1| expansin [Litchi chinensis]
Length=253

 Score =   212 bits (539),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 120/257 (47%), Positives = 162/257 (63%), Gaps = 15/257 (6%)
 Frame = +2

Query  119  IITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-Q  289
            +  AA +      S+LI LC L  V+GD + GW   HATFYG     GT+GGACG  N  
Sbjct  1    MAVAAFSAVSLLFSMLISLC-LQGVYGD-DGGWQSGHATFYGGGDASGTMGGACGYGNLY  58

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TG  451
               Y   T ALS ALF N  SCG+CY ++C N+   C     +IVTAT+ CP        
Sbjct  59   SQGYGTNTAALSTALFNNGLSCGSCYEMKCGNDPKWC-LPGSVIVTATNFCPPNNALAND  117

Query  452  DGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtv  631
            +G WC PP  HFD++ PA+L+I +Y+AG + + + +VPC +KGG RFT+ GH YFNLV +
Sbjct  118  NGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCVKKGGIRFTVNGHSYFNLVLI  177

Query  632  snvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTS  811
            +NV G+GDV  V ++ +  G   W P+ RNWG+ W++N+ L+G++L F+VTT DGK VTS
Sbjct  178  TNVAGAGDVHSVSIKGSKTG---WQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGKTVTS  234

Query  812  RKVAPKSWQYGQTFEGK  862
              V P +WQ+GQTF G 
Sbjct  235  YNVVPDNWQFGQTFTGS  251



>gb|KEH22886.1| expansin-A1-like protein [Medicago truncatula]
Length=258

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 123/263 (47%), Positives = 162/263 (62%), Gaps = 19/263 (7%)
 Frame = +2

Query  113  VLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN  286
            +L++T A    L AA+       +P V+  G   W+ AHATFYG  +  GT+GGACG  N
Sbjct  4    ILLLTIASLASLFAATT----ARIPGVYSGGP--WTSAHATFYGGSDASGTMGGACGYGN  57

Query  287  -QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP-----  445
                 Y   T ALS ALF N  SCGAC+ L+C  +   C   NP I++TAT+ CP     
Sbjct  58   LYSQGYGVNTAALSTALFNNGLSCGACFELKCDQDPRWCNPGNPSILITATNFCPPNFAQ  117

Query  446  -TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNL  622
             + +G WC PPR HFDL+MP +LKI +Y+AG + V Y +VPC + GG RFTI G  YFNL
Sbjct  118  PSDNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRKAGGIRFTINGFRYFNL  177

Query  623  vtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKA  802
            V V+NV G+GD+ +V V+        W+P+ RNWG+ W++NA   G+AL F+VT  D + 
Sbjct  178  VLVTNVAGAGDIIRVSVKGT---NTAWMPMSRNWGQNWQSNAVFVGQALSFRVTGSDRRT  234

Query  803  VTSRKVAPKSWQYGQTFEGKNSR  871
             TS  +AP  WQ+GQTF GKN R
Sbjct  235  STSMNIAPPHWQFGQTFTGKNFR  257



>gb|AAR82849.1| expansin-1 [Petunia x hybrida]
Length=260

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 160/258 (62%), Gaps = 15/258 (6%)
 Frame = +2

Query  128  AAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDT  298
             A  T L    LL V   +P V+  G   W  AHATFYG  +  GT+GGACG  N     
Sbjct  7    VACVTSLVLLMLLTVEARIPGVYSGG--AWQSAHATFYGGSDASGTMGGACGYGNLYSQG  64

Query  299  YAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDG  457
            Y     ALS ALF N  SCGAC+ ++C  +   C + +P I +TAT+ CP        +G
Sbjct  65   YGVNNGALSTALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNYALPNDNG  124

Query  458  KWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsn  637
             WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV V+N
Sbjct  125  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTN  184

Query  638  vggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRK  817
            V G+GD+ +V V+ +   +  W+ L RNWG+ W+TNA L+G++L F+VT  D ++ TS  
Sbjct  185  VAGAGDIVRVRVKGS---KTNWITLSRNWGQNWQTNAVLTGQSLSFRVTASDRRSSTSWN  241

Query  818  VAPKSWQYGQTFEGKNSR  871
            +AP  WQ+GQTF GKN R
Sbjct  242  IAPAHWQFGQTFMGKNFR  259



>ref|XP_008233635.1| PREDICTED: expansin-A4-like [Prunus mume]
Length=259

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 161/260 (62%), Gaps = 15/260 (6%)
 Frame = +2

Query  122  ITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QK  292
            +T      L A +  IV   +P V+  G   W  AHATFYG  +  GT+GGACG  N   
Sbjct  4    MTLLCIVSLIALASTIVEARIPGVYSGG--AWQGAHATFYGGSDASGTMGGACGYGNLYS  61

Query  293  DTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TG  451
              Y   T ALS ALF N  SCGAC+ ++C N    C + +P I VTAT+ CP        
Sbjct  62   QGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYALPND  121

Query  452  DGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtv  631
            +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC + GG RFTI G +YFNLV +
Sbjct  122  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFKYFNLVLI  181

Query  632  snvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTS  811
            +NV G+GD+ KV V+ +  G   W+ L RNWG+ W++NA L+G++L F+VT  D +  TS
Sbjct  182  TNVAGAGDIVKVSVKGSKTG---WMSLSRNWGQNWQSNAVLAGQSLSFRVTGSDRRTSTS  238

Query  812  RKVAPKSWQYGQTFEGKNSR  871
              + P +WQ+GQTF GKN R
Sbjct  239  WNIVPANWQFGQTFTGKNFR  258



>ref|XP_007205740.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
 dbj|BAC66787.1| expansin [Prunus persica]
 gb|EMJ06939.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
Length=260

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 124/266 (47%), Positives = 169/266 (64%), Gaps = 18/266 (7%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCA-LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACG  277
            + V+ ++A +A+ L   SL+ V  A +P V+  G   W  AHATFYG  +  GT+GGACG
Sbjct  1    MGVVSVSACLASLL--ISLMWVAEARIPGVYSGG--AWEAAHATFYGGSDASGTMGGACG  56

Query  278  LQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP--  445
              N     Y   T ALS ALF N  SCGAC+ ++C N+   C + +P I +TAT+ CP  
Sbjct  57   YGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPN  116

Query  446  ----TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEY  613
                + +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  Y
Sbjct  117  FAQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  176

Query  614  FNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQD  793
            FNLV VSNV G+GD+ +V V+ +   +  W+ + RNWG+ W++NA L G++L F+V   D
Sbjct  177  FNLVLVSNVAGAGDIVRVSVKGS---KTSWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSD  233

Query  794  GKAVTSRKVAPKSWQYGQTFEGKNSR  871
             +  TS  V P +WQ+GQTF GKN R
Sbjct  234  RRTSTSWNVVPANWQFGQTFTGKNFR  259



>ref|XP_010938009.1| PREDICTED: expansin-A2-like [Elaeis guineensis]
Length=256

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 116/229 (51%), Positives = 151/229 (66%), Gaps = 13/229 (6%)
 Frame = +2

Query  203  GNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYAL  373
            G+SGW  AHATFYG     GT+GGACG  N     Y   T ALS ALF N  SCG+CY +
Sbjct  30   GDSGWQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEM  89

Query  374  RCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAG  535
            RC ++   C     IIVTAT+ CP        +G WC PPR HFDL+ PA+L+I +Y+AG
Sbjct  90   RCADDPQWC-LPGSIIVTATNYCPPNYALPNDNGGWCNPPREHFDLAEPAFLQIAQYRAG  148

Query  536  FIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLK  715
             + + Y +VPC +KGG RFTI GH YFNLV ++NV G+GDV  V ++ +  G   W  + 
Sbjct  149  IVPISYRRVPCVKKGGVRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSNTG---WQAMS  205

Query  716  RNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGK  862
            RNWG+ W++N  L+G++L F+VT+ DGK VTS  V P +WQ+GQTFEG+
Sbjct  206  RNWGQNWQSNGYLNGQSLSFQVTSSDGKTVTSYNVVPANWQFGQTFEGE  254



>ref|XP_002463623.1| hypothetical protein SORBIDRAFT_01g003120 [Sorghum bicolor]
 gb|EER90621.1| hypothetical protein SORBIDRAFT_01g003120 [Sorghum bicolor]
Length=262

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 156/242 (64%), Gaps = 17/242 (7%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+G G  GW  AHATFYG  +  GT+GGACG  N     Y     ALS ALF    S
Sbjct  25   IPGVYGGG--GWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNEGLS  82

Query  353  CGACYALRCVNNTGQ--CKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPA  505
            CGAC+ L+C N  G   C+  +P I+VTAT+ CP      + DG WC PPR HFDL+MP 
Sbjct  83   CGACFELKCENQPGWRWCRPGSPSILVTATNFCPPNYALPSDDGGWCNPPRPHFDLAMPM  142

Query  506  YLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNA  685
            +L I EY+AG + V Y +VPC + GG RFTI G  YFNLV ++NV G+GD+ +  V+ ++
Sbjct  143  FLHIAEYRAGIVPVSYRRVPCRKSGGVRFTINGFRYFNLVLITNVAGAGDIVRASVKASS  202

Query  686  DGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKN  865
             G   W+ + RNWG+ W++NA L G+AL F+VT  D +  TS   AP++WQ+GQTFEGKN
Sbjct  203  TG---WLTMSRNWGQNWQSNAILVGQALSFRVTGSDRRTSTSWNAAPRNWQFGQTFEGKN  259

Query  866  SR  871
             R
Sbjct  260  FR  261



>gb|EYU41589.1| hypothetical protein MIMGU_mgv1a026815mg [Erythranthe guttata]
Length=257

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 129/256 (50%), Positives = 166/256 (65%), Gaps = 12/256 (5%)
 Frame = +2

Query  128  AAMATELQAASLLIVLCALPCVFG----DGNSG-WSEAHATFYGPPEG--TVGGACGLQN  286
            AA+   + A+SL+I++   P        D   G W +AHATFYG  +G  T+GGACG  +
Sbjct  2    AAILQGMLASSLMILVLVGPTSAHSHGPDFKVGPWKDAHATFYGGADGSGTMGGACGYDD  61

Query  287  Q-KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCK--TQNPIIVTATDLCPTGDG  457
              K+ Y   TTALS+ALF + ++CG+CY +RC      CK    + I VTAT+ CP G  
Sbjct  62   LVKEGYGFNTTALSSALFNDGKACGSCYEIRCAKGNKWCKPGASSSIFVTATNFCPPGGT  121

Query  458  KWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsn  637
              C  P  HFDLS PAYL+I EYKAG + VQY +VPC ++GG + TI G+ YFNLVTV+N
Sbjct  122  GCCNSPNEHFDLSQPAYLQIAEYKAGIVPVQYRRVPCKKRGGVKLTITGNPYFNLVTVTN  181

Query  638  vggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRK  817
            VGG+GDV+ V+V    D    W  L RNWG+KWETNA L G  L FKVTT DGK V  +K
Sbjct  182  VGGAGDVTNVEVSGGKD--LPWTKLSRNWGQKWETNAKLVGHDLTFKVTTSDGKTVILQK  239

Query  818  VAPKSWQYGQTFEGKN  865
            V P++WQ+ QT+EG+N
Sbjct  240  VVPQNWQFSQTYEGQN  255



>ref|XP_007016396.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY34015.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=258

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 162/262 (62%), Gaps = 15/262 (6%)
 Frame = +2

Query  116  LIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-  286
            + + + +   L  +S+ +    +P V+  G   W  AHATFYG  +  GT+GGACG  N 
Sbjct  1    MAVVSVVCVLLFISSMWMAEAKIPGVYSGG--AWQNAHATFYGGSDASGTMGGACGYGNL  58

Query  287  QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------  445
                Y   T ALS ALF N  SCGAC+ ++C N+   C +  P I +TAT+ CP      
Sbjct  59   YSQGYGVNTAALSTALFNNGLSCGACFEIKCANDPKWCHSGGPSIFITATNFCPPNYALP  118

Query  446  TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLv  625
              +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV
Sbjct  119  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLV  178

Query  626  tvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAV  805
             +SNV G+GD+ KV V+ +  G   W+ + RNWG+ W++NA L G++L F+VT  D +  
Sbjct  179  LISNVAGAGDIVKVSVKGSRTG---WMSMSRNWGQNWQSNAVLVGQSLSFRVTGGDRRTS  235

Query  806  TSRKVAPKSWQYGQTFEGKNSR  871
            TS  + P +WQ+GQTF GKN R
Sbjct  236  TSWNIVPANWQFGQTFAGKNFR  257



>ref|XP_004240235.1| PREDICTED: expansin-A8-like [Solanum lycopersicum]
Length=258

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 158/246 (64%), Gaps = 18/246 (7%)
 Frame = +2

Query  161  LLIVLCALPCV---FGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTAL  322
            LL++  +L C    FGD N GW  AHAT YG     GT+GGACG  N     Y   T AL
Sbjct  15   LLLIFTSL-CFNESFGD-NGGWQSAHATLYGGGDASGTMGGACGYGNLNSQGYGTNTAAL  72

Query  323  SAALFKNAESCGACYALRCVNNTGQ-CKTQNPIIVTATDLCP------TGDGKWCTPPRA  481
            S +LF N  +CGACY L+C NN  + C     I VTAT+ CP        +G WC PP  
Sbjct  73   STSLFNNGLTCGACYKLKCNNNDDKLCLPGTTITVTATNFCPPNPSLSNNNGGWCNPPLQ  132

Query  482  HFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvs  661
            HFDL+ PA+LKI +YKAG + + + +VPC +KGG RFTI GH Y+NL+ V+NVGG+GDV 
Sbjct  133  HFDLAQPAFLKIAQYKAGIVPISFQRVPCMKKGGIRFTINGHSYYNLILVTNVGGAGDVH  192

Query  662  kvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQY  841
             V ++ + +G   W  + RNWG+ W+ NA L+G++L F+VTT DG+ +TS   AP +WQ+
Sbjct  193  SVSIKGSKNG---WQLMSRNWGQNWQNNAYLNGQSLSFQVTTSDGRTITSNNAAPSNWQF  249

Query  842  GQTFEG  859
            GQTFEG
Sbjct  250  GQTFEG  255



>ref|XP_004304289.1| PREDICTED: expansin-A15-like [Fragaria vesca subsp. vesca]
Length=243

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 156/248 (63%), Gaps = 13/248 (5%)
 Frame = +2

Query  149  QAASLLIVLCALPCVFGDGN----SGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAP  307
             AA L I+L     +F   N    SGWS AHATFYG     GT+GGACG  N     Y  
Sbjct  1    MAAFLGILLVGFMSMFSSVNGYYYSGWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGT  60

Query  308  YTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTGDGKWCTPPRAHF  487
             T ALS ALF N  SCGACY LRCVN+   C     I+VTAT+ CP   G WC PP+ HF
Sbjct  61   NTAALSTALFNNGLSCGACYELRCVNDPQWC-LPGTIVVTATNFCP--PGGWCDPPQQHF  117

Query  488  DLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskv  667
            DLS P +LKI +Y+AG + V Y +V C R GG RFTI GH YFNLV V+NVGG+GDV  V
Sbjct  118  DLSQPVFLKIAQYRAGVVPVSYRRVRCRRAGGIRFTINGHSYFNLVLVTNVGGAGDVQSV  177

Query  668  dvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQ  847
             ++ +     +W  + RNWG+ W++N+ L+G++L F VTT DG+ + S  VAP +W +GQ
Sbjct  178  AIKGS---RTRWQMMSRNWGQNWQSNSYLNGQSLSFLVTTSDGRKLVSYNVAPPNWSFGQ  234

Query  848  TFEGKNSR  871
            T+ G+  R
Sbjct  235  TYTGRQYR  242



>gb|ABN09939.1| expansin A4 [Musa acuminata AAA Group]
Length=258

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 155/240 (65%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF   +S
Sbjct  23   IPGVYTGGQ--WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNEGQS  80

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ ++C  +   C   +P I +TAT+ CP      + DG WC PPR HFDL+MPA+L
Sbjct  81   CGACFEIKCAEDPQWCHRGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLAMPAFL  140

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
            KI EY+AG + V + +VPC + GG RFTI G +YFNLV ++NV G+GD+ +  V+ +  G
Sbjct  141  KIAEYRAGIVPVSFRRVPCRKSGGIRFTIHGFKYFNLVLITNVAGAGDIVRASVKGSRTG  200

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
               W+P+ RNWG+ W++NA L G++L F+VT  D +  TS  + P +WQ+GQTFEGKN R
Sbjct  201  ---WMPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSTWQFGQTFEGKNFR  257



>ref|XP_006338442.1| PREDICTED: expansin-A10-like [Solanum tuberosum]
Length=279

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 146/226 (65%), Gaps = 9/226 (4%)
 Frame = +2

Query  203  GNSGWSEAHATFYG--PPEGTVGGACGLQNQKDT-YAPYTTALSAALFKNAESCGACYAL  373
            GN GW  AHATFYG     GT+GGACG  N   T Y   T ALS ALF N  SCG+C+ L
Sbjct  60   GNGGWINAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFNNGLSCGSCFQL  119

Query  374  RCVNNTGQCKTQNPIIVTATDLCPTGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQY  553
             CVN  GQ      I VTAT+ CP G   WC PPR HFDLS P +L+I +Y+AG + V Y
Sbjct  120  MCVN-AGQYCLPGIITVTATNFCPPGG--WCDPPRPHFDLSQPIFLRIAQYRAGIVPVAY  176

Query  554  SKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEK  733
             +VPC R GG RFTI GH YFNLV V+NVGG+GDV  V ++ +     +W P+ RNWG+ 
Sbjct  177  RRVPCRRSGGIRFTINGHSYFNLVLVTNVGGAGDVHSVYIKGS---RTQWQPMSRNWGQN  233

Query  734  WETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            W+ NA L+G++L FKVTT DG+ V S   AP SW +GQTF G   R
Sbjct  234  WQNNAYLNGQSLSFKVTTGDGRTVVSYNAAPSSWSFGQTFSGGQFR  279



>gb|ACJ48968.2| expansin [Breonia chinensis]
 gb|ACT10284.2| expansin [Breonia chinensis]
Length=258

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/262 (46%), Positives = 163/262 (62%), Gaps = 17/262 (6%)
 Frame = +2

Query  122  ITAAMATELQAASLLIVLCA--LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-  286
            + A   T + A SLL+ L    +P V+  G+  W  AHATFYG  +  GT+GGACG  N 
Sbjct  1    MAAMCLTSIVALSLLLTLAEARIPGVYSGGS--WQNAHATFYGGSDASGTMGGACGYGNL  58

Query  287  QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------  445
                Y   T ALS ALF N  SCGAC+ L+C ++   C   +P I +TAT+ CP      
Sbjct  59   YSQGYGVNTAALSTALFNNGLSCGACFELKCADDPQWCHPGSPSIFITATNFCPPNYALP  118

Query  446  TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLv  625
              +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RF I G  YFNLV
Sbjct  119  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFQINGFRYFNLV  178

Query  626  tvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAV  805
             ++NV G+GD+ +  V+ +  G   W+ L RNWG+ W+TN+ L+G++L F+V   D ++ 
Sbjct  179  LITNVAGAGDIVQAWVKGSRTG---WISLSRNWGQNWQTNSVLAGQSLSFRVRASDRRSS  235

Query  806  TSRKVAPKSWQYGQTFEGKNSR  871
            TS  + P +WQ+GQTF GKN R
Sbjct  236  TSWNIVPSNWQFGQTFTGKNFR  257



>ref|XP_010670609.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=253

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/250 (48%), Positives = 161/250 (64%), Gaps = 17/250 (7%)
 Frame = +2

Query  146  LQAASLLIV---LCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAP  307
            + A+SLL     LC L  VFGD   GW+ AHATFYG     GT+GGACG  N     Y  
Sbjct  6    ILASSLLFFAFNLC-LRGVFGDYGGGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGT  64

Query  308  YTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCT  469
             T ALS ALF + +SCG+CY L+C ++   C     II+TAT+ CP        +G WC 
Sbjct  65   NTAALSTALFNSGQSCGSCYELKCNDDPRWC-LPGSIIITATNFCPPNFALSNDNGGWCN  123

Query  470  PPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggs  649
            PP  HFD++ P++LKI +Y+AG + V + +VPC RKGG RFTI GH YFNLV ++NV G+
Sbjct  124  PPLEHFDMAQPSFLKIAQYRAGIVPVSFRRVPCVRKGGIRFTINGHSYFNLVLITNVAGA  183

Query  650  gdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPK  829
            GDV  V ++ +  G   W  + RNWG+ W++NA L+G++L F+VT  DG+ +TS  VA +
Sbjct  184  GDVRSVSIKGSNTG---WQAMSRNWGQNWQSNAYLNGQSLSFQVTASDGRTITSNNVASR  240

Query  830  SWQYGQTFEG  859
             WQ+GQT+EG
Sbjct  241  GWQFGQTYEG  250



>gb|AGF90535.1| alpha-expansin 1 [Ammopiptanthus nanus]
Length=248

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 157/247 (64%), Gaps = 16/247 (6%)
 Frame = +2

Query  155  ASLLIVLCALPCVFGDGNS---GWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTT  316
            A + ++L A   +F   ++   GW+ AHATFYG     GT+GGACG  N     Y   T 
Sbjct  2    ALIGLLLVAFLTMFSSAHAYAEGWTNAHATFYGGGDASGTMGGACGYGNLYGQGYGTNTA  61

Query  317  ALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTGDG------KWCTPPR  478
            A+S ALF N  SCG+CY +RCVN+   C     I+VTAT+ CP  +G       WC PP+
Sbjct  62   AVSTALFNNGLSCGSCYEIRCVNDNKWC-LPGSIVVTATNFCPPNNGLPNNAGGWCNPPQ  120

Query  479  AHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdv  658
             HFDLS P +L+I +YKAG + V Y +VPC RKGG RFTI GH YFNLV ++NVGG+GDV
Sbjct  121  QHFDLSQPVFLRIAQYKAGIVPVSYRRVPCRRKGGIRFTINGHSYFNLVLITNVGGAGDV  180

Query  659  skvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQ  838
              V V+ +  G   W+P+ RNWG+ W++N  L+G++L FKVTT DG  V S  VAP  W 
Sbjct  181  HAVAVKGSRTG---WMPMSRNWGQNWQSNNYLNGQSLSFKVTTSDGHTVVSYNVAPAGWN  237

Query  839  YGQTFEG  859
            +GQT+ G
Sbjct  238  FGQTYTG  244



>gb|AAP48989.1| expansin [Sambucus nigra]
Length=256

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/260 (46%), Positives = 161/260 (62%), Gaps = 15/260 (6%)
 Frame = +2

Query  122  ITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QK  292
            ++ A    L  +   +V   +P  +G G   W  AHATFYG  +  GT+GGACG  N   
Sbjct  1    MSLACIASLVISLFSVVEARIPGNYGGG--AWESAHATFYGGSDASGTMGGACGYGNLYS  58

Query  293  DTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TG  451
              Y   T ALS ALF   ESCGAC+ ++C N+   C + +P I+VTAT+ CP        
Sbjct  59   QGYGVNTAALSTALFNKGESCGACFEIKCANDPNWCHSGSPSIMVTATNFCPPNYALPND  118

Query  452  DGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtv  631
            +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV +
Sbjct  119  NGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKQGGVRFTINGFRYFNLVLI  178

Query  632  snvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTS  811
            SNV G+GD+ +V V+ +  G   W+ + RNWG+ W++N  L G++L F+VT  D +  TS
Sbjct  179  SNVAGAGDIVRVSVKGSRTG---WMSMSRNWGQNWQSNTVLVGQSLSFRVTGSDRRTSTS  235

Query  812  RKVAPKSWQYGQTFEGKNSR  871
              + P +WQ+GQTF GKN R
Sbjct  236  WNIVPANWQFGQTFTGKNFR  255



>gb|ABN09940.1| expansin A5 [Musa acuminata AAA Group]
Length=257

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 154/240 (64%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P ++  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF   +S
Sbjct  22   IPGLYAGGQ--WQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNEGQS  79

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ ++C  +   C   +P I +TAT+ CP      + DG WC PPR HFDLSMP +L
Sbjct  80   CGACFEVKCAGDPQWCHGGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLSMPMFL  139

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
            KI EY+AG + V + +VPC R GG RFTI G EYFNLV ++NV G+GD+ +  V+ +  G
Sbjct  140  KIAEYRAGIVPVSHRRVPCRRSGGIRFTINGFEYFNLVLITNVAGAGDIVRASVKGSRTG  199

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
               W+P+ RNWG+ W++NA L G++L F++T  D +  TS  + P +WQ+GQTFEGKN R
Sbjct  200  ---WMPMSRNWGQNWQSNADLVGQSLSFRLTGSDRRTSTSWNIVPSNWQFGQTFEGKNFR  256



>ref|XP_009409119.1| PREDICTED: expansin-A10-like [Musa acuminata subsp. malaccensis]
Length=250

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 151/248 (61%), Gaps = 18/248 (7%)
 Frame = +2

Query  158  SLLIVLCALPCVFGDGNSG-----WSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYT  313
            SL +VL A   VF           WS AHATFYG  +  GT+GGACG  N     Y   T
Sbjct  3    SLGLVLVAFHSVFSAAYGYGHGGGWSAAHATFYGGSDASGTMGGACGYGNLYSQGYGTNT  62

Query  314  TALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTGD------GKWCTPP  475
             ALS ALF N  SCGACY ++CVN    C     I VTAT+ CP  D      G WC PP
Sbjct  63   AALSTALFDNGLSCGACYEMKCVNEPQWC-LPGSIFVTATNFCPPNDALPNNNGGWCNPP  121

Query  476  RAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgd  655
              HFDLS P +L+I  Y+AG + V Y +VPCSR+GG RFTI GH YFNLV ++NVGG+GD
Sbjct  122  LRHFDLSQPVFLRIARYRAGIVPVAYRRVPCSRRGGIRFTINGHSYFNLVLITNVGGAGD  181

Query  656  vskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSW  835
            V    V+ ++ G   W P+ RNWG+ W++N  L G+AL FKVTT DG +V S  V P +W
Sbjct  182  VHAASVKGSSTG---WHPMSRNWGQNWQSNTYLDGQALSFKVTTSDGVSVVSFNVVPATW  238

Query  836  QYGQTFEG  859
             +GQTF G
Sbjct  239  SFGQTFSG  246



>ref|XP_010043542.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 ref|XP_010043543.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 gb|KCW85556.1| hypothetical protein EUGRSUZ_B02355 [Eucalyptus grandis]
Length=260

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/260 (47%), Positives = 164/260 (63%), Gaps = 16/260 (6%)
 Frame = +2

Query  125  TAAMATELQAASLLIVLCA-LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QK  292
            +   A  L + SL+ +  A +P V+  G   W  AHATFYG  +  GT+GGACG  N   
Sbjct  5    SVVFAASLISFSLMWLADARIPGVYSGGP--WQTAHATFYGGSDASGTMGGACGYGNLYS  62

Query  293  DTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TG  451
              Y   T ALS ALF N  SCGAC+ ++C N+   C + +P I VTAT+ CP      + 
Sbjct  63   QGYGVNTAALSTALFNNGLSCGACFEIKCANDPTWCHSGSPSIFVTATNFCPPNFAQPSD  122

Query  452  DGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtv  631
            +G WC PPR HFDL+MP +LKI EY+AG + V + +VPC ++GG RFTI G  YFNLV +
Sbjct  123  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLI  182

Query  632  snvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTS  811
            SNV G+GD+ +V V+    G   W+ + RNWG+ W++NA L+G+AL F+VT  D ++ TS
Sbjct  183  SNVAGAGDIVRVSVKGARTG---WMSMSRNWGQNWQSNAVLAGQALSFRVTASDRRSSTS  239

Query  812  RKVAPKSWQYGQTFEGKNSR  871
              + P  WQ+GQTF GKN R
Sbjct  240  WNMVPAGWQFGQTFTGKNFR  259



>ref|XP_003564501.1| PREDICTED: expansin-A2 [Brachypodium distachyon]
Length=252

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 148/224 (66%), Gaps = 12/224 (5%)
 Frame = +2

Query  215  WSEAHATFYGPPE--GTVGGACGLQNQKDT-YAPYTTALSAALFKNAESCGACYALRCVN  385
            W  AHATFYG  +  GT+GGACG  N   T Y   T ALS ALF +  +CG+CY L+C N
Sbjct  29   WQSAHATFYGGDDASGTMGGACGYGNLYSTGYGTNTAALSTALFNDGAACGSCYELKCDN  88

Query  386  NTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHV  547
                      I +TAT+LCP        DG WC PPRAHFD++ PAYL+IG Y+AG + V
Sbjct  89   AGPSYCRPGSITITATNLCPPNYALPNDDGGWCNPPRAHFDMAEPAYLQIGVYRAGIVPV  148

Query  548  QYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWG  727
             Y +VPC +KGG RFTI GH YFNLV V+NV G+GDV  V ++ ++ G   W P+ RNWG
Sbjct  149  SYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVQSVSIKGSSTG---WQPMSRNWG  205

Query  728  EKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + W++N+ L G++L F+VT  DG+ +TS  VAP  WQ+GQTFEG
Sbjct  206  QNWQSNSDLDGQSLSFRVTLSDGRTLTSDGVAPAGWQFGQTFEG  249



>ref|XP_007150329.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
 gb|ESW22323.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
Length=256

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 160/259 (62%), Gaps = 16/259 (6%)
 Frame = +2

Query  128  AAMATELQAASLL-IVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKD  295
            A +   L  AS++ +V   +P V+  G   W  AHATFYG  +  GT+GGACG  N    
Sbjct  2    AVLGIALCFASIMWMVDARIPGVYTGG--AWQSAHATFYGGSDASGTMGGACGYGNLYSQ  59

Query  296  TYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGD  454
             Y   T ALS ALF N  SCGAC+ ++C N+   C + +P I +TAT+ CP        +
Sbjct  60   GYGVNTAALSTALFNNGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNYALPNDN  119

Query  455  GKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvs  634
            G WC PPR HFDL+MP +LKI EY+AG + V Y +V C + GG RFTI G  YFNLV +S
Sbjct  120  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVACMKHGGIRFTINGFRYFNLVLIS  179

Query  635  nvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSR  814
            NV G+GD+    V+    G   W+P+ RNWG+ W++NA L G+AL F+VT  D ++ TS 
Sbjct  180  NVAGAGDLVHAYVKGTRSG---WMPMSRNWGQNWQSNAVLVGQALSFRVTASDRRSSTSW  236

Query  815  KVAPKSWQYGQTFEGKNSR  871
             +AP  WQ+GQTF GKN R
Sbjct  237  NIAPPHWQFGQTFTGKNFR  255



>ref|XP_009589509.1| PREDICTED: expansin-A10-like [Nicotiana tomentosiformis]
Length=240

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 153/245 (62%), Gaps = 12/245 (5%)
 Frame = +2

Query  155  ASLLIVLCALPCVFGDGNS---GWSEAHATFYG--PPEGTVGGACGLQNQKDT-YAPYTT  316
            A L+++   +  +F   +    GW  AHATFYG     GT+GGACG  N   + Y   T 
Sbjct  2    AILILLFMGISLMFQSVHGYYGGWINAHATFYGGGDASGTMGGACGYGNLYSSGYGTNTA  61

Query  317  ALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTGDGKWCTPPRAHFDLS  496
            ALS ALF N  SCGAC+ LRCVN    C     I VTAT+ CP   G WC PP  HFDLS
Sbjct  62   ALSTALFNNGLSCGACFQLRCVNARQYC-LPGTITVTATNFCP--PGGWCDPPNHHFDLS  118

Query  497  MPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdve  676
             P YL+I +Y++G + V Y +VPC R+GG RFTI GH YFNLV V+NVGG+GDV  + ++
Sbjct  119  EPVYLRIAQYRSGIVPVAYRRVPCRRRGGIRFTINGHSYFNLVLVTNVGGAGDVRSLYIK  178

Query  677  dNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFE  856
             +     +W P+ RNWG+ W+ NA L+G++L FKVTT DG+ V S   AP SW +GQTF 
Sbjct  179  GS---RTQWQPMSRNWGQNWQNNAYLNGQSLSFKVTTSDGRTVVSYNAAPHSWSFGQTFT  235

Query  857  GKNSR  871
            G   R
Sbjct  236  GGQFR  240



>gb|ACF87150.1| unknown [Zea mays]
 gb|AFW67135.1| alpha-expansin 6 [Zea mays]
Length=265

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 156/242 (64%), Gaps = 16/242 (7%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+G G  GW  AHATFYG  +  GT+GGACG  N     Y     ALS ALF    S
Sbjct  27   IPGVYGGG--GWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNQGLS  84

Query  353  CGACYALRCVNNTGQ--CKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPA  505
            CGAC+ ++C +  G   C+  +P I+VTAT+ CP      + DG WC PPR HFDL+MP 
Sbjct  85   CGACFEIKCEDQPGWRWCRPGSPSILVTATNFCPPNYALPSDDGGWCNPPRPHFDLAMPM  144

Query  506  YLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNA  685
            +L I EY+AG + V Y +VPC + GG RFTI G  YFNLV ++NV G+GDV +  V+ + 
Sbjct  145  FLHIAEYRAGIVPVTYRRVPCRKSGGVRFTINGFRYFNLVLITNVAGAGDVVRASVKASG  204

Query  686  DGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKN  865
             GE  W+P+ RNWG+ W+++A L G+AL F+VT  D +  TS   AP+ W++GQTFEGKN
Sbjct  205  TGE--WMPMSRNWGQNWQSSAILVGQALSFRVTGSDRRTSTSWNAAPRDWRFGQTFEGKN  262

Query  866  SR  871
             R
Sbjct  263  FR  264



>emb|CDY40233.1| BnaA09g35150D [Brassica napus]
Length=260

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 161/249 (65%), Gaps = 17/249 (7%)
 Frame = +2

Query  161  LLIVL--CALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALS  325
            LL+ L   A+P V+  G+  W  AHATFYG  +  GT+GGACG  N     Y   T ALS
Sbjct  16   LLLSLTNAAIPGVYSGGS--WQTAHATFYGGDDASGTMGGACGYGNLYSQGYGTNTAALS  73

Query  326  AALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAH  484
             ALF +  +CGAC+ ++CVN+   C + +P + VTAT+ CP      + +G WC PPRAH
Sbjct  74   TALFSSGLTCGACFEIKCVNDPKWCHSGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRAH  133

Query  485  FDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvsk  664
            FDL+MP +LKI EY+AG + + Y +V C + GG RFTI GH YFNLV ++NV G+GD+ +
Sbjct  134  FDLAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIVR  193

Query  665  vdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYG  844
              V+ +  G   W+ L RNWG+ W++N  L G++L F+VTT D +  TS  + P +WQ+G
Sbjct  194  TSVKGSKTG---WMGLTRNWGQNWQSNTVLVGQSLSFRVTTSDRRTSTSWNIVPSNWQFG  250

Query  845  QTFEGKNSR  871
            QTF GKN R
Sbjct  251  QTFVGKNFR  259



>ref|XP_009398502.1| PREDICTED: expansin-A7-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/240 (48%), Positives = 156/240 (65%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF   +S
Sbjct  23   IPGVYTGGQ--WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNEGQS  80

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ ++C  +   C   +P I +TAT+ CP      + DG WC PPR HFDL+MPA+L
Sbjct  81   CGACFEIKCAEDPQWCHRGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLAMPAFL  140

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
            KI EY+AG + V + +VPC + GG RFTI G +YFNLV ++NV G+GD+ +V V+ +  G
Sbjct  141  KIAEYRAGIVPVSFRRVPCRKSGGIRFTIHGFKYFNLVLITNVAGAGDIVRVSVKGSRTG  200

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
               W+P+ RNWG+ W++NA L G++L F+VT  D +  TS  + P +WQ+GQTFEGKN R
Sbjct  201  ---WMPMSRNWGQNWQSNAVLVGESLSFRVTGSDRRTSTSWNIVPSTWQFGQTFEGKNFR  257



>ref|XP_010532011.1| PREDICTED: expansin-A4-like [Tarenaya hassleriana]
Length=261

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 156/240 (65%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+  G   W  AHATFYG     GT+GGACG  N     Y   T ALS ALF N  S
Sbjct  26   IPGVYSGG--AWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFS  83

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ ++C ++   C + +P I +TAT+ CP      + +G WC PPRAHFDL+MP +L
Sbjct  84   CGACFEIKCADDPQWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRAHFDLAMPMFL  143

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
            K+ EY+AG + V Y +VPC ++GG RFTI GH YFNLV ++NV G+GD+ +  V+ +  G
Sbjct  144  KLAEYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRASVKGSKTG  203

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
               W+ + RNWG+ W++NA L+G++L F+VT  D ++ TS  + P  WQ+GQTF GKN R
Sbjct  204  ---WMSMSRNWGQNWQSNAVLAGQSLSFRVTGSDRRSSTSWNIVPSHWQFGQTFVGKNFR  260



>ref|XP_011089478.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=260

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 165/265 (62%), Gaps = 19/265 (7%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGL  280
            L+V++  A++ + LQ  +       +P V+  G  GW  AHATFYG  +  GT+GGACG 
Sbjct  4    LAVIVCIASLISVLQPPAE----ARIPGVYTGG--GWQTAHATFYGGSDASGTMGGACGY  57

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF N  SCGAC+ ++C      C   +P I VTAT+ CP   
Sbjct  58   GNLYSQGYGVNTAALSTALFNNGFSCGACFEIKCAMEKQWCHAGSPSIFVTATNFCPPNY  117

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
                 +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC +KGG RFTI G  YF
Sbjct  118  ALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKKGGIRFTINGFRYF  177

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV ++NV G+GD+ +V ++ +  G   W+ + RNWG+ W++NA L G++L F+VT  D 
Sbjct  178  NLVLITNVAGAGDIVRVSIKGSRTG---WMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDR  234

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  TS  +AP +WQ+GQTF GKN R
Sbjct  235  RTSTSWNIAPSNWQFGQTFVGKNFR  259



>gb|AAK48848.1|AF350939_1 expansin [Prunus cerasus]
Length=260

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 168/266 (63%), Gaps = 18/266 (7%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVF-GDGNSGWSEAHATFYGPPE--GTVGGACG  277
            + V+ ++A +A+ L +  + +    +P V+ GD    W  AHATFYG  +  GT+GGACG
Sbjct  1    MGVVSVSACLASLLISV-MWVAEARIPGVYTGDA---WEAAHATFYGGSDASGTMGGACG  56

Query  278  LQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP--  445
              N     Y   T ALS ALF N  SCGAC+ ++C N+   C + +P I +TAT+ CP  
Sbjct  57   YGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPN  116

Query  446  ----TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEY  613
                + +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  Y
Sbjct  117  FAQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRY  176

Query  614  FNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQD  793
            FNLV VSNV G+GD+ +V V+ +  G   W+ + RNWG+ W++NA L G++L F+V   D
Sbjct  177  FNLVLVSNVAGAGDIVRVSVKGSKTG---WMSMSRNWGQNWQSNAVLVGQSLSFRVRGSD  233

Query  794  GKAVTSRKVAPKSWQYGQTFEGKNSR  871
             +  TS  + P +WQ+GQTF GKN R
Sbjct  234  RRTSTSWNIVPANWQFGQTFTGKNFR  259



>ref|XP_009804397.1| PREDICTED: expansin-A10 [Nicotiana sylvestris]
Length=266

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/260 (48%), Positives = 163/260 (63%), Gaps = 18/260 (7%)
 Frame = +2

Query  119  IITAAMATELQAASLLIVLCALP-CV---FGDGNSGWSEAHATFYG--PPEGTVGGACGL  280
            I++ A        SL  ++  L  C+   F D N GW  AHAT YG     GT+GGACG 
Sbjct  9    ILSMANYATFSILSLFFIIIFLSFCINESFAD-NGGWQSAHATAYGGGDASGTMGGACGY  67

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP----  445
             N     Y   T ALS ALF N  +CGACY L+C NN G+      I VTAT+ CP    
Sbjct  68   GNLNSQGYGTNTAALSTALFNNGLTCGACYELKC-NNDGKWCISGTITVTATNFCPPNPS  126

Query  446  --TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFN  619
              + +G WC PP  HFDL+ PA+LKI +YKAG + V + +VPC++KGG RFTI GH Y+N
Sbjct  127  LPSNNGGWCNPPLQHFDLAQPAFLKIAQYKAGIVPVSFRRVPCNKKGGIRFTINGHSYYN  186

Query  620  LvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGK  799
            LV V+NVGG+GDV  + ++ + +G   W  + RNWG+ W++N+ L+G++L F+VTT D K
Sbjct  187  LVLVTNVGGAGDVHSISIKGSKNG---WQSMSRNWGQNWQSNSYLNGQSLSFQVTTSDEK  243

Query  800  AVTSRKVAPKSWQYGQTFEG  859
             VTS   AP +WQ+GQTFEG
Sbjct  244  TVTSYNAAPANWQFGQTFEG  263



>ref|XP_010257730.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
 ref|XP_010257731.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
 ref|XP_010257732.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
 ref|XP_010257733.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
Length=247

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 155/243 (64%), Gaps = 14/243 (6%)
 Frame = +2

Query  158  SLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSA  328
            SL+++L  L  V G G SGW++AH TFYG     GT+GGACG  N     Y   T ALS 
Sbjct  7    SLIVLLATLKTVHGYG-SGWTDAHVTFYGGGDASGTMGGACGYGNLYSQGYGTNTAALST  65

Query  329  ALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTGD------GKWCTPPRAHFD  490
            ALF N  SCGACY ++CVN+   C     IIVTAT+ CP  +      G WC PP  HFD
Sbjct  66   ALFNNGLSCGACYEIKCVNDPRWC-LPGSIIVTATNFCPPNNALPNNAGGWCNPPLQHFD  124

Query  491  LSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvd  670
            LS P +  I +YKAG + VQY +V C + GG RFTI GH YFNLV ++NVGG+GDV  V 
Sbjct  125  LSQPVFQHIAQYKAGIVPVQYRRVACRKTGGIRFTINGHSYFNLVLITNVGGAGDVVAVS  184

Query  671  vedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQT  850
            ++ +  G   W  + RNWG+ W++N+ L+G+AL FKVTT DG+ V S  VAP +W +GQT
Sbjct  185  IKGSRTG---WQAMSRNWGQNWQSNSYLNGQALSFKVTTSDGRTVVSNNVAPANWAFGQT  241

Query  851  FEG  859
            + G
Sbjct  242  YSG  244



>emb|CAN73252.1| hypothetical protein VITISV_027049 [Vitis vinifera]
Length=247

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 160/251 (64%), Gaps = 15/251 (6%)
 Frame = +2

Query  149  QAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTA  319
             A+ L +    +P V+  G  GW  AHATFYG  +  GT+GGACG  N     Y   T A
Sbjct  1    MASVLKLGEARIPGVYTGG--GWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  58

Query  320  LSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPR  478
            LS ALF N  SCGAC+ L+C N+   C + +P I++TAT+ CP      + +G WC PPR
Sbjct  59   LSTALFNNGLSCGACFELKCANDPEWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPR  118

Query  479  AHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdv  658
             HFDL+MP +LKI EY+AG + V + +VPC ++GG RFTI G  YFNLV ++NV G+GD+
Sbjct  119  PHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDI  178

Query  659  skvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQ  838
             K  V+ +  G   W+ L RNWG+ W++NA L G++L F+VT  D +  TS  + P +WQ
Sbjct  179  VKASVKGSKTG---WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDHRTSTSWNIVPSNWQ  235

Query  839  YGQTFEGKNSR  871
            +GQTF GKN R
Sbjct  236  FGQTFSGKNFR  246



>ref|XP_008797331.1| PREDICTED: expansin-A15-like [Phoenix dactylifera]
Length=247

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 159/248 (64%), Gaps = 14/248 (6%)
 Frame = +2

Query  143  ELQAASLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYT  313
            E  A SL+ +L     V G G SGWS+AHATFYG     GT+GGACG  N     Y   T
Sbjct  2    EFIALSLVSLLTMFGAVHGYG-SGWSDAHATFYGGGDASGTMGGACGYGNLYSQGYGTDT  60

Query  314  TALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTGD------GKWCTPP  475
             ALS ALF +  SCGAC+ ++C ++   C     IIVTAT+ CP  +      G WC PP
Sbjct  61   AALSTALFNSGLSCGACFEIQCKDDGNWC-LPGSIIVTATNFCPPNNALPNNAGGWCNPP  119

Query  476  RAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgd  655
              HFDLS P + +I +YKAG + VQY +VPC +KGG RFTI GH YFNLV ++NVGG+GD
Sbjct  120  LHHFDLSQPVFQRIAQYKAGIVPVQYRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGD  179

Query  656  vskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSW  835
            V  V ++ +  G   W P+ RNWG+ W++N+ L G++L F+V+T DG+ VTS  VAP +W
Sbjct  180  VVAVSIKGSQTG---WQPMSRNWGQNWQSNSYLDGQSLSFRVSTSDGRTVTSMDVAPHNW  236

Query  836  QYGQTFEG  859
             +GQT+ G
Sbjct  237  SFGQTYAG  244



>gb|KFK36856.1| hypothetical protein AALP_AA4G180600 [Arabis alpina]
Length=257

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 150/229 (66%), Gaps = 13/229 (6%)
 Frame = +2

Query  215  WSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVN  385
            W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGAC+ L+C N
Sbjct  31   WQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMSCGACFELKCAN  90

Query  386  NTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIH  544
            +   C   +P I++TAT+ CP      + +G WC PPR HFDL+MP +LKI +Y+AG + 
Sbjct  91   DPQWCHAGSPSILITATNFCPPNLAQPSDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVP  150

Query  545  VQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNW  724
            V Y +VPC ++GG RFTI GH+YFNLV ++NV G+GD+ +  V+    G   W+ L RNW
Sbjct  151  VSYRRVPCRKRGGIRFTINGHKYFNLVLITNVAGAGDIVRASVKGTKTG---WMSLSRNW  207

Query  725  GEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            G+ W++NA L G++L F+VT  D +  TS  + P +WQ+GQTF GKN R
Sbjct  208  GQNWQSNAVLVGQSLTFRVTGSDRRTSTSWNMVPSNWQFGQTFVGKNFR  256



>emb|CDY31742.1| BnaA04g16780D [Brassica napus]
Length=260

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 164/267 (61%), Gaps = 23/267 (9%)
 Frame = +2

Query  101  L*LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGAC  274
            L L VL I A   T  +A         +P V+  G  GW  AHATFYG  +  GT+GGAC
Sbjct  6    LVLCVLTILADFTTISEAR--------IPGVYSGG--GWETAHATFYGGSDASGTMGGAC  55

Query  275  GLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP-  445
            G  N     Y   T ALS ALF N  SCGAC+ L+C ++   C + +P I VTAT+ CP 
Sbjct  56   GYGNLYSQGYGVNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPP  115

Query  446  -----TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHE  610
                 + +G WC PPR HFDL+MP +LKI EY+AG + V + +VPC ++GG RFTI G  
Sbjct  116  NFAQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFR  175

Query  611  YFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQ  790
            YFNLV V+NV G+G++ ++ V+        W+ + RNWG+ W++N+ L G+AL F+VT  
Sbjct  176  YFNLVLVTNVAGAGNIVRLSVKGT---RTSWMSMSRNWGQNWQSNSVLVGQALSFRVTAS  232

Query  791  DGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            D ++ TS  +AP  WQ+GQTF GKN R
Sbjct  233  DRRSSTSWNIAPAHWQFGQTFMGKNFR  259



>ref|XP_004143121.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004166197.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN47143.1| hypothetical protein Csa_6G190340 [Cucumis sativus]
Length=258

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/257 (46%), Positives = 162/257 (63%), Gaps = 15/257 (6%)
 Frame = +2

Query  131  AMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTY  301
            ++   L  +  L++   +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y
Sbjct  6    SLCIPLLLSFSLLIEARIPGVYSGGP--WQSAHATFYGGSDASGTMGGACGYGNLYSQGY  63

Query  302  APYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGK  460
               T ALS ALF   +SCGAC+ ++C N+   C + +P I++TAT+ CP        +G 
Sbjct  64   GVNTAALSTALFNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYALPNDNGG  123

Query  461  WCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnv  640
            WC PPR+HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV ++NV
Sbjct  124  WCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNV  183

Query  641  ggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKV  820
             G+GD+ +V V+    G   W+ L RNWG+ W++NA L G+AL F+VT  D +  TS  +
Sbjct  184  AGAGDIVRVSVKGTRTG---WMSLTRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNI  240

Query  821  APKSWQYGQTFEGKNSR  871
            AP  WQ+GQTF GKN R
Sbjct  241  APAHWQFGQTFTGKNFR  257



>ref|XP_009409516.1| PREDICTED: expansin-A6-like [Musa acuminata subsp. malaccensis]
Length=261

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 164/262 (63%), Gaps = 18/262 (7%)
 Frame = +2

Query  116  LIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-  286
            L +T A+   + A+S L+    +P V+  G   W  AHATFYG  +  GT+GGACG  N 
Sbjct  7    LAVTVAL---VLASSALLADARIPGVYTGGP--WQTAHATFYGGSDASGTMGGACGYGNL  61

Query  287  QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------  445
                Y   T ALS AL+ +   CGAC+ ++C ++   CK  NP I +TAT+ CP      
Sbjct  62   YSQGYGVETAALSTALYNDGLRCGACFEIKCADDPRWCKGGNPSIFITATNFCPPNYALP  121

Query  446  TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLv  625
            + +G WC PPR HFDL+MP +LKI EY+AG + V + +VPC + GG RFTI G +YFNLV
Sbjct  122  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKSGGIRFTINGFQYFNLV  181

Query  626  tvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAV  805
             ++NV G+GD+ +  V+    G   W+ + RNWG+ W++NA L G++L F+VT  D +  
Sbjct  182  LITNVAGAGDIVRASVKGTRSG---WIAMSRNWGQNWQSNAVLVGQSLSFRVTGSDHRTS  238

Query  806  TSRKVAPKSWQYGQTFEGKNSR  871
            TS  +AP SWQ+GQTF GKN R
Sbjct  239  TSWNIAPASWQFGQTFSGKNFR  260



>ref|XP_003538409.1| PREDICTED: expansin-A6 [Glycine max]
Length=258

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/261 (45%), Positives = 164/261 (63%), Gaps = 19/261 (7%)
 Frame = +2

Query  131  AMATELQAASLLIVLC----ALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            AM   +   SLL+++      +P V+  G   W  AHATFYG  +  GT+GGACG  N  
Sbjct  2    AMLNIIAIVSLLLLMIPSQAKIPGVYSGGP--WQSAHATFYGGSDASGTMGGACGYGNLY  59

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCGAC+ ++C ++   C   NP I VTAT+ CP      +
Sbjct  60   SQGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNYALPS  119

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR HFDL+MP +LKI +Y+AG + V Y +VPC ++GG RFTI G  YFNLV 
Sbjct  120  DNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKEGGMRFTINGFRYFNLVL  179

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            ++NV G+GD+ +  V+ +   + +W+ + RNWG+ W++NA L G++L F+VT  D +  T
Sbjct  180  ITNVAGAGDIMRASVKGS---KTEWMSMSRNWGQNWQSNAVLVGQSLSFRVTGGDRRTST  236

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  + P++WQ+GQTF GKN R
Sbjct  237  SWNIVPRNWQFGQTFAGKNFR  257



>ref|XP_003552923.2| PREDICTED: expansin-A3-like [Glycine max]
Length=262

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/261 (46%), Positives = 163/261 (62%), Gaps = 17/261 (7%)
 Frame = +2

Query  125  TAAMATELQAASLLIVL--CALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            T AM   +   SLL+      +P V+  G   W  AHATFYG  +  GT+GGACG  N  
Sbjct  6    TMAMLNIISILSLLLTQSHAKIPGVYSGGP--WQSAHATFYGGSDASGTMGGACGYGNLY  63

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCGAC+ ++C ++   C   NP I+VTAT+ CP      T
Sbjct  64   SQGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCNPGNPSILVTATNFCPPNYALPT  123

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR HFDL+MP +LKI +Y+AG + V Y +V C ++GG RFTI G  YFNLV 
Sbjct  124  DNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVACRKQGGMRFTINGFRYFNLVL  183

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            ++NV G+GD+ +  V+ +   + +W+ + RNWG+ W++NA L G++L F+VT  D +  T
Sbjct  184  ITNVAGAGDIMRASVKGS---KTEWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTST  240

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  + P++WQ+GQTF GKN R
Sbjct  241  SWNIVPRNWQFGQTFAGKNFR  261



>gb|KEH35551.1| expansin A10 [Medicago truncatula]
Length=253

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/254 (46%), Positives = 159/254 (63%), Gaps = 13/254 (5%)
 Frame = +2

Query  128  AAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDT  298
            A +AT   +    ++   L   FGD   GW  AHATFYG  +  GT+GGACG  N     
Sbjct  2    AIVATSFISTLFFVLSLCLKGTFGDYGGGWENAHATFYGGGDASGTMGGACGYGNLYSQG  61

Query  299  YAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGK  460
            Y   T ALS ALF N  SCG+CY ++C ++   C     I+VTAT+ CP        +G 
Sbjct  62   YGTNTAALSTALFNNGLSCGSCYEMKCNSDPKWC-LPGSILVTATNFCPPNFAESNTNGG  120

Query  461  WCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnv  640
            WC PP  HFDL+ PA+L+I +YKAG + + + +VPC +KGG RFTI GH YFNLV V+NV
Sbjct  121  WCNPPLQHFDLAEPAFLQIAQYKAGIVPISFRRVPCVKKGGIRFTINGHSYFNLVLVTNV  180

Query  641  ggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKV  820
            GG+GDV  V ++ +  G   W  + RNWG+ W++N  L+G++L F+VTT DG+ +TS  V
Sbjct  181  GGAGDVHSVSIKGSKTG---WQAMSRNWGQNWQSNNYLNGQSLSFQVTTSDGRTITSNNV  237

Query  821  APKSWQYGQTFEGK  862
             P +WQ+GQTF G+
Sbjct  238  VPGNWQFGQTFTGR  251



>ref|XP_002297611.1| expansin S1 precursor family protein [Populus trichocarpa]
 gb|EEE82416.1| expansin S1 precursor family protein [Populus trichocarpa]
Length=247

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/249 (49%), Positives = 156/249 (63%), Gaps = 14/249 (6%)
 Frame = +2

Query  143  ELQAASLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYT  313
            E    +++I+L  L  V G G +GW+ AHATFYG     GT+GGACG  N     Y   T
Sbjct  2    ECLGYTIVILLTMLKIVKGYG-TGWTGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNT  60

Query  314  TALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPP  475
             ALS ALF N  SCGACY ++CVN+   C  +  I VTAT+ CP        DG WC PP
Sbjct  61   AALSTALFNNGLSCGACYEIKCVNDNIWC-LRGSITVTATNFCPPNNALPNNDGGWCNPP  119

Query  476  RAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgd  655
            + HFDLS P + KI +YKAG + VQY +V C + GG RFTI GH YFNLV ++NVGG+GD
Sbjct  120  QQHFDLSQPVFQKIAQYKAGIVPVQYRRVACRKSGGIRFTINGHSYFNLVLITNVGGAGD  179

Query  656  vskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSW  835
            V  V ++     +  W  + RNWG+ W++N  L+ +AL FKVTT DG+ V S  VAP +W
Sbjct  180  VVAVSIKGT---KSNWQAMSRNWGQNWQSNTYLNNQALSFKVTTSDGRTVVSNNVAPSNW  236

Query  836  QYGQTFEGK  862
             +GQT+ G+
Sbjct  237  AFGQTYTGR  245



>ref|XP_008802710.1| PREDICTED: expansin-A4 [Phoenix dactylifera]
Length=258

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 162/261 (62%), Gaps = 19/261 (7%)
 Frame = +2

Query  131  AMATELQAASLLIVLCA----LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            A+   +  ASLL  L      +P V+  G   W  AHATFYG  +  GT+GGACG  N  
Sbjct  2    AILRLVALASLLAFLVPAAARIPGVYSGG--AWQSAHATFYGGSDASGTMGGACGYGNLY  59

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF +  SCGAC+ ++C +    C + +P I +TAT+ CP      +
Sbjct  60   SQGYGVDTAALSTALFNDGLSCGACFEIKCADEPQWCHSGSPSIFITATNFCPPNYALPS  119

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             DG WC PPR HFDL+MP +LKI EY+AG + V Y +VPC + GG RFTI G +YFNLV 
Sbjct  120  DDGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFKYFNLVL  179

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            ++NV G+GD+ +  V+ +  G   W+PL RNWG+ W++NA L G++L F+VT  D +  T
Sbjct  180  ITNVAGAGDIMRASVKGSRTG---WMPLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTST  236

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  + P +WQ+GQTF GKN R
Sbjct  237  SWNIVPANWQFGQTFAGKNFR  257



>gb|KDP22771.1| hypothetical protein JCGZ_00358 [Jatropha curcas]
Length=246

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 155/235 (66%), Gaps = 14/235 (6%)
 Frame = +2

Query  185  PCVFGD-GNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            PC  GD G S W  +HATFYG  +  GT+GGACG  N     Y   T ALS ALFKN  S
Sbjct  12   PCTCGDYGASSWQSSHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFKNGLS  71

Query  353  CGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLK  514
            CGAC+ +RC N+   C + N IIVTAT+ CP        +G WC PP  HFDL+ PA+LK
Sbjct  72   CGACFQVRCDNDPKWCLS-NTIIVTATNFCPPNYALSNDNGGWCNPPLQHFDLAEPAFLK  130

Query  515  IGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGE  694
            I +Y+AG + V + +VPC +KGG RFTI GH+YFNLV ++NVGG+GDV  V ++ +  G 
Sbjct  131  IAQYRAGIVPVLFRRVPCVKKGGLRFTINGHDYFNLVLITNVGGAGDVHAVSIKGSKTG-  189

Query  695  KKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
              W  + RNWG+ W++N+ L+G+ L F+VT  DG+ VT   V P +WQ+GQTFEG
Sbjct  190  --WQIMSRNWGQNWQSNSYLNGQTLSFRVTISDGRTVTGYNVVPANWQFGQTFEG  242



>gb|AAM47000.1|AF512542_1 alpha-expansin precursor [Gossypium hirsutum]
Length=264

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 154/240 (64%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P VF  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  S
Sbjct  29   IPGVFTGG--AWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSPALFNNGLS  86

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ ++C N+   C + +P II+TAT+ CP        +G WC PPR HFDL+MP +L
Sbjct  87   CGACFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMFL  146

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
            KI EY+AG + V Y +VPC ++GG RFTI G  YFNLV V+NV G+GD+ KV V+     
Sbjct  147  KIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVKVKGT---  203

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
               W+ + RNWG+ W++NA L G+AL F+VT  D +  TS  VAP +WQ+GQTF GKN R
Sbjct  204  NTNWMSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSLNVAPANWQFGQTFTGKNFR  263



>ref|XP_010528418.1| PREDICTED: expansin-A3 [Tarenaya hassleriana]
Length=264

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/263 (46%), Positives = 162/263 (62%), Gaps = 16/263 (6%)
 Frame = +2

Query  116  LIITAAMATELQAASLLIVLCA-LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN  286
              IT  ++  + A+ L+    A +P V+  G   W  AHATFYG  +  GT+GGACG  N
Sbjct  6    FAITFRLSLAITASFLVASATARIPGVYTGGP--WQSAHATFYGGSDASGTMGGACGYGN  63

Query  287  -QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP-----  445
                 Y   T ALS ALF N  SCGAC+ ++C  +   C   NP I VTAT+ CP     
Sbjct  64   LYSQGYGVNTAALSTALFNNGLSCGACFEIKCTEDPKWCNPGNPSIFVTATNFCPPNFAQ  123

Query  446  -TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNL  622
             + DG WC PPR HFDL+MP +LKI +Y+AG + V + +VPC +KGG RFTI G  YFNL
Sbjct  124  PSDDGGWCNPPRQHFDLAMPMFLKIAQYRAGIVPVSFRRVPCRKKGGIRFTINGFRYFNL  183

Query  623  vtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKA  802
            V ++NV G+GDV +  ++ +   +  W+ + RNWG+ W++NA   G++L F+VT  D + 
Sbjct  184  VLITNVAGAGDVVRASIKGS---KTAWMSMSRNWGQNWQSNAVFVGQSLSFRVTASDRRT  240

Query  803  VTSRKVAPKSWQYGQTFEGKNSR  871
             TS  VAP +WQ+GQTF GKN R
Sbjct  241  STSFNVAPANWQFGQTFSGKNFR  263



>ref|XP_006291698.1| hypothetical protein CARUB_v10017862mg [Capsella rubella]
 gb|EOA24596.1| hypothetical protein CARUB_v10017862mg [Capsella rubella]
Length=260

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 166/264 (63%), Gaps = 17/264 (6%)
 Frame = +2

Query  116  LIITAAMATELQAASLLIVL--CALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQ  283
            + IT+ +   +    LL+ L    +P V+    S W  AHATFYG  +  GT+GGACG  
Sbjct  1    MAITSLILLTIIPLFLLLSLTHAGIPGVYS--GSSWLTAHATFYGGNDASGTMGGACGYG  58

Query  284  N-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP----  445
            +     Y   T ALS ALF + +SCGAC+ ++CVN+   C   +P + VTAT+ CP    
Sbjct  59   DLYSQGYGTNTAALSTALFNSGQSCGACFEVKCVNDPKWCHPGSPSVFVTATNFCPPNLA  118

Query  446  --TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFN  619
              + +G WC PPRAHFDL+MP +LKI +Y+AG + + Y +V C + GG RFTI GH YFN
Sbjct  119  QPSDNGGWCNPPRAHFDLAMPVFLKIAQYRAGIVPISYRRVACKKSGGIRFTINGHRYFN  178

Query  620  LvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGK  799
            LV ++NV G+GD+ K  V+ +  G   W+ L RNWG+ W++NA L G++L F+VT+ D +
Sbjct  179  LVLITNVAGAGDIVKASVKSSKSG---WMGLTRNWGQNWQSNAVLVGQSLSFRVTSSDRR  235

Query  800  AVTSRKVAPKSWQYGQTFEGKNSR  871
              TS  + P +WQ+GQTF GKN R
Sbjct  236  TSTSWNIVPSNWQFGQTFVGKNFR  259



>gb|KHG18125.1| Expansin-A10 -like protein [Gossypium arboreum]
Length=248

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/246 (50%), Positives = 152/246 (62%), Gaps = 14/246 (6%)
 Frame = +2

Query  161  LLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAA  331
            LL +L  +  V G G  GW+ AHATFYG  +  GT+GGACG  N     Y   T ALS A
Sbjct  8    LLGLLSMVSAVHGYG-GGWTNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  66

Query  332  LFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTGD------GKWCTPPRAHFDL  493
            LF N  SCG+CY ++CVN+   C     I+VTAT+ CP  +      G WC PP  HFDL
Sbjct  67   LFNNGLSCGSCYEIKCVNDGKWC-LPGSIVVTATNFCPPNNALPNNAGGWCNPPLQHFDL  125

Query  494  SMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdv  673
            S P +  I +YKAG + V Y +VPC RKGG RFTI GH YFNLV +SNVG +GDV    +
Sbjct  126  SQPVFQHIAQYKAGIVPVSYRRVPCRRKGGIRFTINGHSYFNLVLISNVGDAGDVHAAAI  185

Query  674  edNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTF  853
            + +  G   W P+ RNWG+ W++N  L+G++L FKVTT DG+ V S  VAP  W +GQTF
Sbjct  186  KGSRTG---WQPMSRNWGQNWQSNNYLNGQSLSFKVTTSDGRTVVSYNVAPAGWSFGQTF  242

Query  854  EGKNSR  871
             G   R
Sbjct  243  TGGQFR  248



>gb|ABN09942.1| expansin A5 [Musa acuminata AAA Group]
Length=239

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 152/240 (63%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P ++  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF   +S
Sbjct  4    IPGLYAGGQ--WQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNEGQS  61

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ ++C  +   C   +P I +TAT+ CP      + DG WC PPR HFDLSMP +L
Sbjct  62   CGACFEIKCAGDPQWCHGGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLSMPMFL  121

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
            KI EY+AG + V Y +VPC R GG RFTI G +YFNLV ++NV G+ D+    V+ +  G
Sbjct  122  KIAEYRAGIVPVSYRRVPCRRSGGIRFTINGFKYFNLVLITNVAGASDIVHASVKGSRTG  181

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
               W+P+ RNWG+ W++NA L G++L F++T  D +  TS  + P +WQ+GQTFEGKN R
Sbjct  182  ---WMPMSRNWGQNWQSNAVLVGQSLSFRLTGSDRRTSTSWNIVPSNWQFGQTFEGKNFR  238



>ref|XP_010031088.1| PREDICTED: expansin-A8-like [Eucalyptus grandis]
 gb|KCW50355.1| hypothetical protein EUGRSUZ_J00120 [Eucalyptus grandis]
Length=249

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 158/252 (63%), Gaps = 14/252 (6%)
 Frame = +2

Query  134  MATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYA  304
            MA     +++ +V   L   FGD   GW   HATFYG     GT+GGACG  N     Y 
Sbjct  1    MANFAAISAVALVFLCLKSAFGD-YGGWEGGHATFYGGGDASGTMGGACGYGNLYSQGYG  59

Query  305  PYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWC  466
              T ALS ALF N  SCGACY +RC ++   C     I+VTAT+ CP        +G WC
Sbjct  60   TNTAALSTALFNNGLSCGACYEMRCNDDPRWC-LPGTIMVTATNFCPPNLALSNDNGGWC  118

Query  467  TPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvgg  646
             PP  HFD++ PA+L+I +YKAG + V + +VPC +KGG RFTI GH YFNLV ++NVGG
Sbjct  119  NPPLQHFDMAEPAFLQIAQYKAGIVPVSFRRVPCVKKGGVRFTINGHSYFNLVLITNVGG  178

Query  647  sgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAP  826
            +GDV  V ++ +  G   W  + RNWG+ W++NA ++G+AL F+VTT DG+ VTS   AP
Sbjct  179  AGDVHSVSIKGSRTG---WQAMSRNWGQNWQSNAYMNGQALSFQVTTSDGRTVTSYNAAP  235

Query  827  KSWQYGQTFEGK  862
             +WQ+GQTFEG 
Sbjct  236  ANWQFGQTFEGS  247



>dbj|BAK05504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06342.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=249

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 153/247 (62%), Gaps = 19/247 (8%)
 Frame = +2

Query  158  SLLIVLCALPCVFGDGNSG----WSEAHATFYG--PPEGTVGGACGLQNQKDT-YAPYTT  316
            +LL++  A  C      +G    W  AHATFYG     GT+GGACG  N   T Y   T 
Sbjct  6    ALLLLFSAAFCFLARRAAGDYGSWQTAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTA  65

Query  317  ALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPR  478
            ALS ALF +  +CG+CY L+C    G       I +TAT+LCP        DG WC PPR
Sbjct  66   ALSTALFNDGAACGSCYELKC---QGSSCVPGSITITATNLCPPNYALPNDDGGWCNPPR  122

Query  479  AHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdv  658
            AHFD++ PAYL+IG Y+AG + V Y +VPC +KGG RFTI GH YFNLV V+NV G+GDV
Sbjct  123  AHFDMAEPAYLQIGIYRAGIVPVSYRRVPCVKKGGMRFTINGHSYFNLVLVTNVAGAGDV  182

Query  659  skvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQ  838
              V ++ ++ G   W  + RNWG+ W++NA L G++L F+VT  DG+ VTS   AP  W 
Sbjct  183  QSVSIKGSSSG---WQAMSRNWGQNWQSNADLDGQSLSFRVTLSDGRTVTSNNAAPAGWS  239

Query  839  YGQTFEG  859
            +GQTFEG
Sbjct  240  FGQTFEG  246



>gb|ADY68811.1| alpha-expansin 1 [Gossypium raimondii]
Length=258

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 154/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSKTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA L+G++L FKVT  D + +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYLNGQSLSFKVTASDSRTMTNYNVVPPGWQFGQTFEG  255



>gb|AAY43797.1| expansin [Gossypium hirsutum]
Length=258

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 153/230 (67%), Gaps = 13/230 (6%)
 Frame = +2

Query  197  GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACY  367
            GD N GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCGACY
Sbjct  30   GDDNGGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACY  89

Query  368  ALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYK  529
             LRC N+   C ++  I VTAT+ CP      + +G WC PPR HFDL+ PA+L+I EY+
Sbjct  90   ELRCNNDPQWCISR-TITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYR  148

Query  530  AGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVP  709
            AG + V + +V C +KGG R+T+ GH YFN+V ++NVGG+GD++ V ++ +  G   W+P
Sbjct  149  AGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSKTG---WLP  205

Query  710  LKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + RNWG+ W++NA  +G++L FKVT  D + +T+  V P  WQ+GQTFEG
Sbjct  206  MSRNWGQNWQSNAYFNGQSLSFKVTASDSRTITNYNVVPAGWQFGQTFEG  255



>ref|XP_008461679.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=260

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/244 (48%), Positives = 157/244 (64%), Gaps = 15/244 (6%)
 Frame = +2

Query  170  VLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFK  340
            V   +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF 
Sbjct  21   VHARIPGVYSGGQ--WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  78

Query  341  NAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSM  499
            N  SCGAC+ L+C N+   C + +P I +TAT+ CP      + +G WC PPR HFDL+M
Sbjct  79   NGLSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAM  138

Query  500  PAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdved  679
            P +LKI EY+AG + V Y +VPC +KGG RFTI G  YFNL+ ++NV G+GD+ K  V+ 
Sbjct  139  PMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLILITNVAGAGDIVKASVKG  198

Query  680  NADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            +   + +W+ + RNWG+ W++NA L G++L F+VT+ D +  TS  + P +WQ+GQTF G
Sbjct  199  S---KTEWMSMSRNWGQNWQSNAILVGQSLSFRVTSSDRRTSTSWNIVPSNWQFGQTFTG  255

Query  860  KNSR  871
            KN R
Sbjct  256  KNFR  259



>ref|XP_009381075.1| PREDICTED: expansin-A7-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/240 (48%), Positives = 153/240 (64%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF   +S
Sbjct  23   IPGVYTGGQ--WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFDEGQS  80

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCPTG------DGKWCTPPRAHFDLSMPAYL  511
            CGAC+ ++C ++   C   +P I +TAT+ CP        +G WC PPR HFDLSMP +L
Sbjct  81   CGACFEIKCADDPRWCHPGSPSIFITATNFCPPNYALAPDNGGWCNPPRPHFDLSMPMFL  140

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
            KI EY+AG + V Y +VPC R GG RFTI G +YFNLV ++NV G+GD+ +  V+ +  G
Sbjct  141  KIAEYRAGIVPVSYRRVPCRRSGGIRFTINGFQYFNLVLITNVAGAGDIVRASVKGSRTG  200

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
               W+P+ RNWG+ W++NA L G+ L F+VT  D +  TS  + P +WQ+GQTFEGKN R
Sbjct  201  ---WMPMSRNWGQNWQSNAVLVGQPLSFRVTGSDRRTSTSWNIVPSNWQFGQTFEGKNYR  257



>ref|XP_004981242.1| PREDICTED: expansin-A7-like [Setaria italica]
Length=262

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 154/242 (64%), Gaps = 17/242 (7%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+G G   W  AHATFYG  +  GT+GGACG  N     Y     ALS ALF   +S
Sbjct  25   IPGVYGGG--AWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNEGQS  82

Query  353  CGACYALRCVNNTGQ--CKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPA  505
            CGAC+ ++C N  G   C   +P I+VTAT+ CP      + DG WC PPR HFDL+MP 
Sbjct  83   CGACFEIKCENQPGWRWCHPGSPSILVTATNFCPPNYALPSDDGGWCNPPRPHFDLAMPM  142

Query  506  YLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNA  685
            +L I EY+AG + V Y +VPC + GG RFTI G  YFNLV ++NV G+GD+ +  V+ + 
Sbjct  143  FLHIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFRYFNLVLITNVAGAGDIVRASVKGSG  202

Query  686  DGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKN  865
             G   W+P+ RNWG+ W++NA L G AL F+VT  D +  TS   AP++WQ+GQTFEGKN
Sbjct  203  TG---WLPMSRNWGQNWQSNAILVGDALSFRVTGSDRRTSTSWNAAPRNWQFGQTFEGKN  259

Query  866  SR  871
             R
Sbjct  260  FR  261



>gb|KHG12430.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/266 (46%), Positives = 164/266 (62%), Gaps = 23/266 (9%)
 Frame = +2

Query  134  MATELQAASL-LIVLCALPCVFGDGNS---------GWSEAHATFYGPPE--GTVGGACG  277
            MA +  ++SL L+   +L C+FG  N+          W  AHATFYG  +  GT+GGACG
Sbjct  1    MAVDASSSSLTLLCFASLMCLFGMVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACG  60

Query  278  LQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP--  445
              N     Y   T ALS A+F N  SCGAC+ ++C ++   C   NP I +TAT+ CP  
Sbjct  61   YGNLYSQGYGVNTAALSTAIFNNGLSCGACFEIKCTDDPRWCHPGNPSIFITATNFCPPN  120

Query  446  ----TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEY  613
                + +G WC PPR HFDL+MP +LKI EY+AG + V + +VPC ++GG RFTI G  Y
Sbjct  121  YALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRY  180

Query  614  FNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQD  793
            FNLV V+NV G+G++ KV V+    G   W+ + RNWG+ W++NA L G+ L F+VT  D
Sbjct  181  FNLVLVTNVAGAGNIVKVSVKGTNTG---WLSMSRNWGQNWQSNAVLVGQQLSFRVTGSD  237

Query  794  GKAVTSRKVAPKSWQYGQTFEGKNSR  871
             +  TS  VAP +WQ+GQTF  KN R
Sbjct  238  RRTSTSWNVAPANWQFGQTFTAKNFR  263



>ref|NP_001044656.1| Os01g0823100 [Oryza sativa Japonica Group]
 sp|Q40636.2|EXPA2_ORYSJ RecName: Full=Expansin-A2; AltName: Full=Alpha-expansin-2; AltName: 
Full=OsEXP2; AltName: Full=OsEXPA2; AltName: Full=OsaEXPa1.23; 
AltName: Full=RiExB; AltName: Full=RiExC; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAL24480.1|AF394544_1 alpha-expansin OsEXPA2 [Oryza sativa]
 dbj|BAB86504.1| expansin Os-EXPA2 [Oryza sativa Japonica Group]
 dbj|BAB93180.1| expansin Os-EXPA2 [Oryza sativa Japonica Group]
 dbj|BAF06570.1| Os01g0823100 [Oryza sativa Japonica Group]
 gb|EAY76315.1| hypothetical protein OsI_04249 [Oryza sativa Indica Group]
 gb|EAZ13980.1| hypothetical protein OsJ_03905 [Oryza sativa Japonica Group]
Length=251

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 153/252 (61%), Gaps = 14/252 (6%)
 Frame = +2

Query  134  MATELQAASLLI-VLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQNQKDT-Y  301
            MA+   A  LL    C L          W  AHATFYG     GT+GGACG  N   T Y
Sbjct  1    MASRSSALLLLFSAFCFLARRAAADYGSWQSAHATFYGGGDASGTMGGACGYGNLYSTGY  60

Query  302  APYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKW  463
               T ALS  LF +  +CG+CY LRC +N GQ      + VTAT+LCP        DG W
Sbjct  61   GTNTAALSTVLFNDGAACGSCYELRC-DNDGQWCLPGSVTVTATNLCPPNYALPNDDGGW  119

Query  464  CTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvg  643
            C PPR HFD++ PA+L+IG Y+AG + V Y +VPC +KGG RFTI GH YFNLV V+NV 
Sbjct  120  CNPPRPHFDMAEPAFLQIGVYRAGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVA  179

Query  644  gsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVA  823
            G GDV  V ++ ++ G   W P+ RNWG+ W++N+ L G++L F+V   DG+ VTS  V 
Sbjct  180  GPGDVQSVSIKGSSTG---WQPMSRNWGQNWQSNSYLDGQSLSFQVAVSDGRTVTSNNVV  236

Query  824  PKSWQYGQTFEG  859
            P  WQ+GQTFEG
Sbjct  237  PAGWQFGQTFEG  248



>ref|XP_008223717.1| PREDICTED: expansin-A4 [Prunus mume]
Length=260

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 160/254 (63%), Gaps = 20/254 (8%)
 Frame = +2

Query  155  ASLLIVL-----CALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPY  310
            ASLLI L       +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   
Sbjct  11   ASLLISLMWVAEARIPGVYSGG--AWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  311  TTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCT  469
            T ALS ALF N  SCGAC+ ++C N+   C + +P I +TAT+ CP      + +G WC 
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  128

Query  470  PPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggs  649
            PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV VSNV G+
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVSNVAGA  188

Query  650  gdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPK  829
            GD+ +V V+ +  G   W+ + RNWG+ W++NA L G++L F+V   D +  TS  V P 
Sbjct  189  GDIVRVSVKGSKTG---WMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRRTSTSWNVVPA  245

Query  830  SWQYGQTFEGKNSR  871
            +WQ+GQTF GKN R
Sbjct  246  NWQFGQTFTGKNFR  259



>ref|XP_004961745.1| PREDICTED: expansin-A4-like [Setaria italica]
Length=248

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 147/229 (64%), Gaps = 13/229 (6%)
 Frame = +2

Query  203  GNSGWSEAHATFYGPPE--GTVGGACGLQNQKDT-YAPYTTALSAALFKNAESCGACYAL  373
            G  GW  AHATFYG  +  GT+GGACG  N   + Y   T ALS ALF +  +CG+CY L
Sbjct  22   GYGGWQSAHATFYGGGDASGTMGGACGYGNLYSSGYGTNTAALSTALFNDGAACGSCYEL  81

Query  374  RCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAG  535
            RC N  G C     I VTAT+ CP      + DG WC PPR HFD++ PA+L I +Y+AG
Sbjct  82   RCQNAGGSC-LPGSITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAG  140

Query  536  FIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLK  715
             + V + +VPC +KGG RFTI GH YFNLV V+NV G+GDV  V +  +  G   W P+ 
Sbjct  141  IVPVAFRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVRSVSIRGSRTG---WQPMS  197

Query  716  RNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGK  862
            RNWG+ W++NA L  +AL F+VT  DG+ VTS   AP  WQ+GQTFEG+
Sbjct  198  RNWGQNWQSNAFLDRQALSFQVTASDGRTVTSTNAAPAGWQFGQTFEGR  246



>ref|XP_002315218.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEF01389.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 162/262 (62%), Gaps = 15/262 (6%)
 Frame = +2

Query  116  LIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-  286
            + I A +        L +V   +P V+  G   W  AHATFYG  +  GT+GGACG  N 
Sbjct  1    MAIRATICVASLVLFLTLVEARIPGVYTGG--AWQSAHATFYGGSDASGTMGGACGYGNL  58

Query  287  QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------  445
                Y   T ALS ALF N  SCGAC+ ++C N+   C + +P I++TAT+ CP      
Sbjct  59   YSQGYGVNTAALSTALFNNGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYALP  118

Query  446  TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLv  625
            + +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RF I GH YFNLV
Sbjct  119  SDNGGWCNPPRPHFDLAMPVFLKIAEYRAGIVPVSYRRVPCRKRGGIRFQINGHRYFNLV  178

Query  626  tvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAV  805
             ++NV G+GD+ KV V+ +  G   W+ + RNWG+ W++N+ L G++L F+VT  D +  
Sbjct  179  LITNVAGAGDIVKVSVKGSKTG---WMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTS  235

Query  806  TSRKVAPKSWQYGQTFEGKNSR  871
            TS  V P +WQ+ QTF GKN R
Sbjct  236  TSWNVVPSNWQFSQTFVGKNFR  257



>gb|AAD47901.1|AF085330_1 expansin [Pinus taeda]
Length=253

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/252 (48%), Positives = 159/252 (63%), Gaps = 15/252 (6%)
 Frame = +2

Query  134  MATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYA  304
            +   +  ASLL  +  L    G G  GW  AHATFYG  +  GT+GGACG  N     Y 
Sbjct  6    LVKSIALASLLTFIWLLTGAHGYG--GWESAHATFYGGSDASGTMGGACGYGNLYSQGYG  63

Query  305  PYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWC  466
              T ALS ALF +  SCGACY +RC N+  Q      + VTAT+ CP        +G WC
Sbjct  64   TNTAALSTALFNDGLSCGACYEMRC-NDDPQWCLPGTVTVTATNFCPPNNALPNDNGGWC  122

Query  467  TPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvgg  646
             PP  HFD++ PA+LKI +Y+ G + + Y++VPC RKGG RFT+ GH YFNLV ++NVGG
Sbjct  123  NPPLQHFDMAEPAFLKIAKYRGGIVPILYTRVPCLRKGGIRFTVNGHSYFNLVLITNVGG  182

Query  647  sgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAP  826
            +GDV  V ++ +  G   W P+ RNWG+ W++N+ L+G++L F+VTT DG+ V S  VAP
Sbjct  183  AGDVHAVSIKGSRSG---WQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVVSNNVAP  239

Query  827  KSWQYGQTFEGK  862
             +WQ+GQTFEG 
Sbjct  240  SNWQFGQTFEGS  251



>ref|XP_007027012.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY07514.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=263

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/258 (49%), Positives = 163/258 (63%), Gaps = 19/258 (7%)
 Frame = +2

Query  140  TELQAASLL----IVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDT  298
            T L  ASLL    +V   +P V+  G+  W  AHATFYG  +  GT+GGACG  N     
Sbjct  10   TVLCFASLLSFSVVVNARIPGVYTGGS--WESAHATFYGGSDASGTMGGACGYGNLYSQG  67

Query  299  YAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDG  457
            Y   T ALS ALF N  SCGAC+ ++C N+   C   +P I VTAT+ CP      + +G
Sbjct  68   YGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHPGSPSIFVTATNFCPPNYALPSDNG  127

Query  458  KWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsn  637
             WC PPR+HFDL+MP +LKI EY+AG + V + +VPC ++GG RFTI G  YFNLV V+N
Sbjct  128  GWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLVTN  187

Query  638  vggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRK  817
            V G+GD+ KV V+    G   W+ + RNWG+ W++NA L G+AL F+VT  D +  TS  
Sbjct  188  VAGAGDIVKVSVKGTKTG---WLSMSRNWGQNWQSNAVLVGQALSFRVTGSDKRTSTSWN  244

Query  818  VAPKSWQYGQTFEGKNSR  871
            VA  +WQ+GQTF GKN R
Sbjct  245  VASANWQFGQTFTGKNFR  262



>ref|NP_001288899.1| expansin-A6 precursor [Brassica rapa]
 gb|AGM16348.1| alpha-expansin protein 6 [Brassica rapa]
Length=260

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/267 (46%), Positives = 164/267 (61%), Gaps = 23/267 (9%)
 Frame = +2

Query  101  L*LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGAC  274
            L L VL I A   T  +A         +P V+  G  GW  AHATFYG  +  GT+GGAC
Sbjct  6    LVLCVLTILADFTTISEAR--------IPGVYSGG--GWETAHATFYGGSDASGTMGGAC  55

Query  275  GLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP-  445
            G  N     Y   T ALS ALF N  SCGAC+ L+C ++   C + +P I VTAT+ CP 
Sbjct  56   GYGNLYSQGYGVNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPP  115

Query  446  -----TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHE  610
                 + +G WC PPR HFDL+MP +LKI EY+AG + V + +VPC ++GG RFTI G  
Sbjct  116  NFAQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFR  175

Query  611  YFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQ  790
            YFNLV V+NV G+G++ ++ V+        W+ + RNWG+ W++N+ L G++L F+VT  
Sbjct  176  YFNLVLVTNVAGAGNIVRLSVKGT---RTSWMSMSRNWGQNWQSNSVLVGQSLSFRVTAS  232

Query  791  DGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            D ++ TS  +AP  WQ+GQTF GKN R
Sbjct  233  DRRSSTSWNIAPAHWQFGQTFTGKNFR  259



>gb|ABO32367.1| expansin [Litchi chinensis]
Length=256

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 160/257 (62%), Gaps = 22/257 (9%)
 Frame = +2

Query  158  SLLIVLCALPCVFGDGNSG---------WSEAHATFYGPPE--GTVGGACGLQNQ-KDTY  301
            ++  VLC L  +F   N+          W  AHATFYG  +  GT+GGACG  N     Y
Sbjct  2    AVFNVLCFLSLLFLTANAKIPGVYTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGY  61

Query  302  APYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGK  460
               T ALS ALF N  SCGAC+ L+CV +   C   NP I+VTAT+ CP      + DG 
Sbjct  62   GVNTAALSTALFNNGLSCGACFELKCVADPRWCLPGNPSILVTATNFCPPNFAQPSDDGG  121

Query  461  WCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnv  640
            WC PPR HFDL+MP +LKI +Y+AG + V Y +VPC ++GG RFTI G  YFNLV V+NV
Sbjct  122  WCNPPRTHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNV  181

Query  641  ggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKV  820
             G+GD+ KV V+ +  G   W+ + RNWG+ W++NA L G+AL F+VT  D +  TS  V
Sbjct  182  AGAGDIVKVSVKGSKTG---WLTMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNV  238

Query  821  APKSWQYGQTFEGKNSR  871
            A  +WQ+GQTF GKN R
Sbjct  239  AKSNWQFGQTFVGKNFR  255



>emb|CDX77222.1| BnaC04g40170D [Brassica napus]
Length=260

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 122/267 (46%), Positives = 164/267 (61%), Gaps = 23/267 (9%)
 Frame = +2

Query  101  L*LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGAC  274
            L L +L I A   T  +A         +P V+  G  GW  AHATFYG  +  GT+GGAC
Sbjct  6    LVLCLLTILADFTTISEAR--------IPGVYSGG--GWETAHATFYGGSDASGTMGGAC  55

Query  275  GLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP-  445
            G  N     Y   T ALS ALF N  SCGAC+ L+C ++   C + +P I VTAT+ CP 
Sbjct  56   GYGNLYSQGYGVNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPP  115

Query  446  -----TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHE  610
                 + +G WC PPR HFDL+MP +LKI EY+AG + V + +VPC ++GG RFTI G  
Sbjct  116  NFAQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFR  175

Query  611  YFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQ  790
            YFNLV V+NV G+G++ ++ V+        W+ + RNWG+ W++N+ L G+AL F+VT  
Sbjct  176  YFNLVLVTNVAGAGNIVRLSVKGT---RTSWISMSRNWGQNWQSNSVLVGQALSFRVTAS  232

Query  791  DGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            D ++ TS  +AP  WQ+GQTF GKN R
Sbjct  233  DRRSSTSWNIAPTHWQFGQTFMGKNFR  259



>ref|XP_003537990.1| PREDICTED: expansin-A4-like [Glycine max]
Length=259

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/262 (46%), Positives = 161/262 (61%), Gaps = 20/262 (8%)
 Frame = +2

Query  131  AMATELQAASLLIVL-----CALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-  286
            A+A  +   + +I L       +P ++  G   W  AHATFYG  +  GT+GGACG  N 
Sbjct  2    AVANNVLCIAFIITLTWAVEARIPGIYSGG--AWQSAHATFYGGSDASGTMGGACGYGNL  59

Query  287  QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------  445
                Y   T ALS ALF +  SCGAC+ ++C N+   C + +P I +TAT+ CP      
Sbjct  60   YSQGYGVNTAALSTALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFALP  119

Query  446  TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLv  625
              +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC + GG RFT+ G  YFNLV
Sbjct  120  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKHGGIRFTVNGFRYFNLV  179

Query  626  tvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAV  805
             VSNV G+GD+ +  V+    G   W+P+ RNWG+ W++NA L G+AL F+VT  D +  
Sbjct  180  LVSNVAGAGDIVRTYVKGTRTG---WMPMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTS  236

Query  806  TSRKVAPKSWQYGQTFEGKNSR  871
            TS  +AP +WQ+GQTF GKN R
Sbjct  237  TSWNIAPPNWQFGQTFTGKNFR  258



>ref|XP_007218834.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
 gb|EMJ20033.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
Length=259

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/254 (47%), Positives = 160/254 (63%), Gaps = 15/254 (6%)
 Frame = +2

Query  140  TELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPY  310
              L A +  IV   +P V+      W  AHATFYG  +  GT+GGACG  N     Y   
Sbjct  10   VSLIALASTIVEARIPGVYSG--EAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  67

Query  311  TTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCT  469
            T ALS ALF N  SCGAC+ ++C N    C + +P I VTAT+ CP        +G WC 
Sbjct  68   TAALSTALFNNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYALPNDNGGWCN  127

Query  470  PPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggs  649
            PPR+HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFT+ G +YFNLV ++NV G+
Sbjct  128  PPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTVNGFKYFNLVLITNVAGA  187

Query  650  gdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPK  829
            GD+ KV V+ +  G   W+ L RNWG+ W++NA L+G++L F+VT  D +  TS  + P 
Sbjct  188  GDIVKVSVKGSKTG---WMSLSRNWGQNWQSNAVLAGQSLSFRVTGSDRRTSTSWNIVPA  244

Query  830  SWQYGQTFEGKNSR  871
            +WQ+GQTF GKN R
Sbjct  245  NWQFGQTFTGKNFR  258



>emb|CDP19176.1| unnamed protein product [Coffea canephora]
Length=248

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 118/243 (49%), Positives = 152/243 (63%), Gaps = 13/243 (5%)
 Frame = +2

Query  161  LLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSAA  331
            LLI    L  V     S WS AHATFYG     GT+GGACG  N     Y   T ALS A
Sbjct  8    LLISTFVLKTVHSLNPSAWSAAHATFYGGNDASGTMGGACGYGNLYSQGYGTSTAALSTA  67

Query  332  LFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDL  493
            LF N ++CGAC+ ++CVN    C +   I+VTAT+ CP        DG WC PP  HFDL
Sbjct  68   LFNNGQACGACFEIKCVNAGKWCLS-GSIMVTATNFCPPNNALPNNDGGWCNPPLKHFDL  126

Query  494  SMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdv  673
            S P + +I +Y+AG + VQY +VPC + GG RFTI GH YFNLV V+NVGG+GDV  + +
Sbjct  127  SQPIFQRIAQYEAGIVPVQYRRVPCRKSGGIRFTINGHSYFNLVLVTNVGGAGDVVSLSI  186

Query  674  edNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTF  853
            +    G   W+ + RNWG+ W++N+ L G+AL FKVTT DG+++ S  VAP  W +GQT+
Sbjct  187  KGTRTG---WIAMSRNWGQNWQSNSYLDGQALSFKVTTSDGRSLVSNNVAPPKWSFGQTY  243

Query  854  EGK  862
             G+
Sbjct  244  SGR  246



>ref|XP_011034337.1| PREDICTED: expansin-A10-like [Populus euphratica]
Length=242

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 155/243 (64%), Gaps = 9/243 (4%)
 Frame = +2

Query  143  ELQAASLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYT  313
            +     L++ L     V G G  GWS AHATFYG     GT+GGACG  N     Y   T
Sbjct  2    DFLGVCLVVFLTMSKTVHGYG-GGWSHAHATFYGGGDASGTMGGACGYGNLYSQGYGTNT  60

Query  314  TALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP-TGDGKWCTPPRAHFD  490
             ALS ALFKN  +CGAC+ L+CVN+   C +   IIVTAT+ CP    G WC PP  HFD
Sbjct  61   AALSTALFKNGLTCGACFELKCVNDARWCLS-GSIIVTATNFCPPNSAGGWCNPPSQHFD  119

Query  491  LSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvd  670
            LS P + ++  YKAG + V Y +V C + GG RFTI GH YFNLV ++NVGG+GDV+ V 
Sbjct  120  LSQPVFQRLARYKAGIVPVLYRRVACRKTGGIRFTINGHSYFNLVLITNVGGAGDVASVS  179

Query  671  vedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQT  850
            ++ +  G   W P+ RNWG+ W++N+ L+G+AL FKVTT DG+++ S  VAP +W +GQT
Sbjct  180  IKGSRTG---WQPMSRNWGQNWQSNSYLNGQALSFKVTTSDGRSIISSNVAPPNWAFGQT  236

Query  851  FEG  859
            F G
Sbjct  237  FHG  239



>ref|XP_007162798.1| hypothetical protein PHAVU_001G181600g [Phaseolus vulgaris]
 gb|ESW34792.1| hypothetical protein PHAVU_001G181600g [Phaseolus vulgaris]
Length=273

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 142/225 (63%), Gaps = 9/225 (4%)
 Frame = +2

Query  215  WSEAHATFYGPPEGTVGGACGLQNQ-KDTYAPYTTALSAALFKNAESCGACYALRCVNNT  391
            W +AHATFY     T GGACG  +  KD Y   TTALS+ LFK  ++CGACY ++C  + 
Sbjct  48   WKQAHATFYEGGSETFGGACGYGDVVKDGYGLDTTALSSILFKEGQTCGACYEIKCTKSG  107

Query  392  GQCKT-QNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQ  550
              CK  ++ I+VTAT+LCP      + +G WC PPR HFDL+ PAYLKI EYKAG + +Q
Sbjct  108  VGCKAGKSSILVTATNLCPPNYDLPSDNGGWCNPPREHFDLAKPAYLKIAEYKAGIVPIQ  167

Query  551  YSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGE  730
            Y +VPC ++GG RFTI G+ YFNL       G        +    +  K W  LKRNWG+
Sbjct  168  YRRVPCKKEGGIRFTITGNPYFNL-VSVWNVGGSGEITEVLVKGEEKVKNWTNLKRNWGQ  226

Query  731  KWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKN  865
            KWE++  L G+ L F+V   DG+  TS ++APK W++GQTF GKN
Sbjct  227  KWESDEMLVGETLSFRVKASDGRYTTSLRIAPKDWKFGQTFVGKN  271



>gb|ABB59694.1| alpha-expansin 2 [Gossypium hirsutum]
Length=252

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 121/254 (48%), Positives = 161/254 (63%), Gaps = 15/254 (6%)
 Frame = +2

Query  134  MATELQAASLLIVLCA--LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDT  298
            MAT   +A+ L+ +    L   FGD   GW   HATFYG  +  GT+GGACG  N     
Sbjct  1    MATSAVSATFLLFVFGFCLRGAFGDYVGGWQGGHATFYGGGDASGTMGGACGYGNLYSQG  60

Query  299  YAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGK  460
            Y   T ALS ALF N  SCG+CY +RC ++   C     I VTAT+ CP        +G 
Sbjct  61   YGTNTAALSTALFNNGLSCGSCYEMRCDSDPKWC-LPGSITVTATNFCPPNLALSNDNGG  119

Query  461  WCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnv  640
            WC PP  HFDL+ PA+L+I +Y+AG + + + +VPC +KGG RFTI GH YFNLV ++NV
Sbjct  120  WCNPPLQHFDLAEPAFLQIAQYRAGIVPISFRRVPCMKKGGIRFTINGHSYFNLVLITNV  179

Query  641  ggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKV  820
            GG+GDV  V ++ +  G   W  + RNWG+ W++N+ L+G++L F+VTT DG+ VTS  V
Sbjct  180  GGAGDVHSVSIKGSKTG---WQSMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVTSYNV  236

Query  821  APKSWQYGQTFEGK  862
            AP +WQ+GQTFEG 
Sbjct  237  APGNWQFGQTFEGD  250



>ref|XP_004517307.1| PREDICTED: expansin-A9-like [Cicer arietinum]
Length=285

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 144/225 (64%), Gaps = 10/225 (4%)
 Frame = +2

Query  215  WSEAHATFYGPPEGTVGGACGLQNQ-KDTYAPYTTALSAALFKNAESCGACYALRCVNNT  391
            W +A+ATFY    GT GGACG ++  KD Y   T ALS ALF   ++CGACY ++CV++ 
Sbjct  61   WKQAYATFYEGGSGTFGGACGYEDVVKDGYGLDTAALSTALFNQGQTCGACYEIKCVDSP  120

Query  392  GQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQ  550
              CK   P + VTATD CP      + +G WC PPR HFDL+ PAYLK+ EY AG + VQ
Sbjct  121  KGCKPGQPSLFVTATDHCPPNYNLPSDNGGWCNPPREHFDLAKPAYLKMAEYTAGIVPVQ  180

Query  551  YSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGE  730
            Y +VPC ++GG RFTI G+ YF L  +      G    V V+   + + +W  LKRNWG+
Sbjct  181  YRRVPCKKQGGIRFTITGNPYFYL--IKVWNVGGAGDVVGVQVKGEDKLQWTDLKRNWGQ  238

Query  731  KWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKN  865
            KWETNA L G+ L F+V T DG++ TS +V P  WQ GQTFEGKN
Sbjct  239  KWETNAMLLGETLTFRVKTSDGRSSTSLRVVPNKWQLGQTFEGKN  283



>ref|XP_009406842.1| PREDICTED: expansin-A15-like [Musa acuminata subsp. malaccensis]
Length=247

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 156/244 (64%), Gaps = 17/244 (7%)
 Frame = +2

Query  164  LIVLCALPCVFG---DGNSGWSEAHATFYG--PPEGTVGGACGLQNQKDT-YAPYTTALS  325
            L     L  +FG    G+ GW +AHATFYG     GT+GGACG  N  D  Y   + ALS
Sbjct  6    LFSFVTLLIMFGVAHGGDGGWIDAHATFYGGGDASGTMGGACGYGNLYDQGYGTESAALS  65

Query  326  AALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHF  487
             ALF N +SCGAC+ ++C    GQ   +  I++TAT+ CP        DG WC PPR HF
Sbjct  66   TALFNNGQSCGACFEIKCAG--GQWCLKGSIVITATNFCPPNNALPNDDGGWCNPPRHHF  123

Query  488  DLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskv  667
            DLS P + KI +YKAG + +QY +VPC +KGG RFTI GH YFNLV ++NVGG+GDV  V
Sbjct  124  DLSQPVFEKIAQYKAGIVPIQYKRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVVAV  183

Query  668  dvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQ  847
             V+ +  G   W P+ RNWG+ W++++ L G++L F VTT DG +VTS  VAP +W +GQ
Sbjct  184  SVKGSRTG---WQPMSRNWGQNWQSSSNLDGQSLSFSVTTSDGLSVTSMDVAPPNWSFGQ  240

Query  848  TFEG  859
            T+ G
Sbjct  241  TYLG  244



>emb|CDP09064.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 161/256 (63%), Gaps = 15/256 (6%)
 Frame = +2

Query  134  MATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYA  304
            +A+ L  A +L     +P V+  G+  W  AHATFYG  +  GT+GGACG  N     Y 
Sbjct  9    IASVLALAFMLGAEARIPGVYTGGD--WQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  305  PYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKW  463
              T ALS ALF +  SCGAC+ ++C ++ G C   +P I VTAT+ CP        +G W
Sbjct  67   VNTAALSTALFSSGLSCGACFEIKCASDPGWCHPGSPSIFVTATNFCPPNYALPNDNGGW  126

Query  464  CTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvg  643
            C PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV V+NV 
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGIRFTINGFRYFNLVLVTNVA  186

Query  644  gsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVA  823
            G+G++ +V V+ +  G   W+ + RNWG+ W+TN  L G++L F+V   D ++ TS  +A
Sbjct  187  GAGNIVRVSVKGSRTG---WISMSRNWGQNWQTNGNLVGQSLSFRVAASDRRSSTSWNIA  243

Query  824  PKSWQYGQTFEGKNSR  871
            P  WQ+GQTF GKN R
Sbjct  244  PAHWQFGQTFVGKNFR  259



>ref|XP_006409928.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
 gb|ESQ51381.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
Length=260

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 163/263 (62%), Gaps = 20/263 (8%)
 Frame = +2

Query  128  AAMATELQAASLLIVLCAL-----PCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN  286
            A +A  L   ++L  L A+     P V+  G  GW  AHATFYG  +  GT+GGACG  N
Sbjct  2    AVLALVLCVLTILADLTAIYEARIPGVYNGG--GWESAHATFYGGSDASGTMGGACGYGN  59

Query  287  -QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP-----  445
                 Y   T ALS ALF N  SCGAC+ L+C ++   C + +P I +TAT+ CP     
Sbjct  60   LYSQGYGVNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQ  119

Query  446  -TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNL  622
             + +G WC PPR HFDL+MP +LKI EY+AG + V + +VPC ++GG RFTI G  YFNL
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNL  179

Query  623  vtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKA  802
            V V+NV G+G++ ++ V+        W+ + RNWG+ W++N+ L G++L F+VT  D + 
Sbjct  180  VLVTNVAGAGNIVRLSVKGT---RTSWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRT  236

Query  803  VTSRKVAPKSWQYGQTFEGKNSR  871
             TS  +AP  WQ+GQTF GKN R
Sbjct  237  STSWNIAPAHWQFGQTFMGKNFR  259



>ref|XP_007205748.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
 gb|EMJ06947.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
Length=258

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 161/261 (62%), Gaps = 19/261 (7%)
 Frame = +2

Query  131  AMATELQAASLLIVLCA----LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            A    L  ASLL +  A    +P V+  G   W  AHATFYG  +  GT+GGACG  N  
Sbjct  2    AFVHMLCIASLLSLFMAANARIPGVYTGGP--WEGAHATFYGGSDASGTMGGACGYGNLY  59

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
             + Y   T ALS ALF N  SCGAC+ ++C ++   C   NP I +TAT+ CP       
Sbjct  60   SEGYGVNTAALSTALFNNGLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNYALPN  119

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             DG WC PPR HFDL+MP +L+I EYKAG + V + +VPC ++GG RFTI G  YFNLV 
Sbjct  120  DDGGWCNPPRTHFDLAMPMFLQIAEYKAGIVPVSFRRVPCRKEGGVRFTINGFRYFNLVL  179

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            ++NV G+GD+ +V V+       +W+P+ RNWG+ W++NA L G+ L F+VT  D +  T
Sbjct  180  ITNVAGAGDIVRVSVK---GANTEWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTST  236

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  VAP  WQ+GQTF GKN R
Sbjct  237  SWNVAPGHWQFGQTFSGKNFR  257



>ref|XP_010690765.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=258

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 164/262 (63%), Gaps = 16/262 (6%)
 Frame = +2

Query  119  IITAAMATELQAASLLIVLCA-LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-  286
            + +  +   L   SL  ++ A  P V+  G  GW  AHATFYG  +  GT+GGACG  N 
Sbjct  1    MASIILPITLSLFSLFSLIHARYPGVYSRG--GWQSAHATFYGGSDASGTMGGACGYGNL  58

Query  287  QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------  445
                Y   T ALS ALF + +SCGAC+ L+C ++   C   +P I +TAT+ CP      
Sbjct  59   YSQGYGVNTAALSTALFNSGQSCGACFELKCADDPRWCHPGSPSIFITATNFCPPNYALP  118

Query  446  TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLv  625
            + +G WC PPR HFDL+MP +LKI EY+AG + V + +VPC +KGG RFTI G  YFNLV
Sbjct  119  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKKGGIRFTINGFRYFNLV  178

Query  626  tvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAV  805
             +SNV G+GD+  V V+ +  G   W+ L RNWG+ W++NA L G++L F+VT  D +  
Sbjct  179  LISNVAGAGDLVSVSVKGSRTG---WMSLSRNWGQNWQSNAVLVGQSLSFRVTASDRRTS  235

Query  806  TSRKVAPKSWQYGQTFEGKNSR  871
            TS  +AP +WQ+GQTF G+N R
Sbjct  236  TSLNIAPSNWQFGQTFIGRNFR  257



>ref|XP_008464122.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=258

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 118/257 (46%), Positives = 161/257 (63%), Gaps = 15/257 (6%)
 Frame = +2

Query  131  AMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTY  301
            ++   L  +  L++   +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y
Sbjct  6    SLCIALLLSFSLLIDARIPGVYSGGP--WQSAHATFYGGADASGTMGGACGYGNLYSQGY  63

Query  302  APYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGK  460
               T ALS ALF   +SCGAC+ ++C N+   C + +P I++TAT+ CP        +G 
Sbjct  64   GVNTAALSTALFNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYALPNDNGG  123

Query  461  WCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnv  640
            WC PPR+HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV ++NV
Sbjct  124  WCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNV  183

Query  641  ggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKV  820
             G+GD+ +V V+    G   W+ L RNWG+ W++NA L G+AL F+VT  D +  TS  +
Sbjct  184  AGAGDIVRVSVKGTRTG---WMSLTRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNI  240

Query  821  APKSWQYGQTFEGKNSR  871
             P  WQ+GQTF GKN R
Sbjct  241  VPAHWQFGQTFTGKNFR  257



>ref|XP_006435913.1| hypothetical protein CICLE_v10032524mg [Citrus clementina]
 gb|ESR49153.1| hypothetical protein CICLE_v10032524mg [Citrus clementina]
Length=254

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 119/254 (47%), Positives = 159/254 (63%), Gaps = 14/254 (6%)
 Frame = +2

Query  128  AAMATELQAASLLIVL-CALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKD  295
            A +A     A LL VL       FGD   GW   HATFYG  +  GT+GGACG  N    
Sbjct  2    ANIAASSSVALLLFVLNFCFRGTFGDYGGGWQSGHATFYGGGDASGTMGGACGYGNLYSQ  61

Query  296  TYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDG  457
             Y   T ALS ALF N  SCG+CY ++C N+   C     IIVTAT+ CP        +G
Sbjct  62   GYGTNTAALSTALFNNGLSCGSCYEMKCENDPKWC-LPGSIIVTATNFCPPNLALSNDNG  120

Query  458  KWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsn  637
             WC PP  HFD++ PA+L+I +Y+AG + + + ++PC++KGG RFT+ GH YFNLV V+N
Sbjct  121  GWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLVTN  180

Query  638  vggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRK  817
            VGG+GDV  V ++ +  G   W  + RNWG+ W++N+ L+G++L F+VT  DG+ VTS  
Sbjct  181  VGGAGDVHSVSIKGSKTG---WQAMSRNWGQNWQSNSYLNGQSLSFQVTASDGRTVTSNN  237

Query  818  VAPKSWQYGQTFEG  859
            V P +WQ+GQTFEG
Sbjct  238  VVPANWQFGQTFEG  251



>dbj|BAN09211.1| alpha expansin [Eustoma exaltatum subsp. russellianum]
Length=249

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 151/226 (67%), Gaps = 12/226 (5%)
 Frame = +2

Query  212  GWSEAHATFYG--PPEGTVGGACGLQNQKDT-YAPYTTALSAALFKNAESCGACYALRCV  382
            GW  AHATFYG     GT+GGACG  N     Y   T ALS ALF N  SCGACYA++C 
Sbjct  25   GWQTAHATFYGGGDASGTMGGACGYGNLYSAGYGTNTAALSTALFNNGLSCGACYAIKCS  84

Query  383  NNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIH  544
            ++  +      I VTAT+ CP        +G WC  PR HFDL+ PAYL+I +Y+AG + 
Sbjct  85   SSDPKYCLGGMITVTATNFCPPNPALPNDNGGWCNFPRQHFDLAEPAYLQIAQYRAGIVP  144

Query  545  VQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNW  724
            V + +VPC +KGG RFTI GH YFNLV V+NVGG+GDV  + V+ +  G   WVPL RNW
Sbjct  145  VDFMRVPCKKKGGIRFTINGHSYFNLVLVTNVGGAGDVHSISVKGSRTG---WVPLSRNW  201

Query  725  GEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGK  862
            G+ W++N+ L+G++L F+VTT DG+ +TS  VAP +WQ+GQTFEG 
Sbjct  202  GQNWQSNSYLNGQSLSFQVTTSDGRTLTSNNVAPPNWQFGQTFEGN  247



>gb|KDP44940.1| hypothetical protein JCGZ_01440 [Jatropha curcas]
Length=258

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 120/251 (48%), Positives = 159/251 (63%), Gaps = 19/251 (8%)
 Frame = +2

Query  161  LLIVL----CALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTA  319
            LL+VL      +P V+  G+  W  AHATFYG  +  GT+GGACG  N     Y   T A
Sbjct  12   LLLVLKLADARIPGVYSGGS--WESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  69

Query  320  LSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPR  478
            LS ALF N  SCGAC+ ++C N    C + +P I +TAT+ CP      + +G WC PPR
Sbjct  70   LSTALFNNGLSCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPR  129

Query  479  AHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdv  658
             HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV ++NV G+GD+
Sbjct  130  PHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDI  189

Query  659  skvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQ  838
             K  V+ +  G   W+ L RNWG+ W++NA L G++L F+VT  D +  TS  + P +WQ
Sbjct  190  VKASVKGSKTG---WMSLSRNWGQNWQSNAILVGQSLSFRVTGSDRRTSTSWNIVPANWQ  246

Query  839  YGQTFEGKNSR  871
            +GQTF GKN R
Sbjct  247  FGQTFTGKNFR  257



>gb|ABR18394.1| unknown [Picea sitchensis]
Length=246

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 158/251 (63%), Gaps = 19/251 (8%)
 Frame = +2

Query  146  LQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTT  316
            L +  LL +L A+ C      SGW  AHATFYG  +  GT+GGACG  N     Y   T 
Sbjct  6    LVSLGLLSILRAVHC------SGWISAHATFYGGSDATGTMGGACGYGNLYSQGYGTNTA  59

Query  317  ALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPR  478
            ALS ALF N  SCGACY ++C N+  Q      I+VTAT+ CP        +G WC PP 
Sbjct  60   ALSTALFNNGFSCGACYEIQC-NDDPQWCLPGSIVVTATNFCPPNNALPNDNGGWCNPPL  118

Query  479  AHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdv  658
             HFDLS P +  I +++AG + VQY +VPC RKGG RFT+ GH YFNLV ++NVGG+GDV
Sbjct  119  EHFDLSEPVFQHIAKFRAGIVPVQYRRVPCQRKGGIRFTVNGHSYFNLVLITNVGGAGDV  178

Query  659  skvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQ  838
              V ++ +  G   W P+ RNWG+ W++N+ L G++L FKVTT DGK VTS  VA  +WQ
Sbjct  179  EAVSIKGSKTG---WQPMSRNWGQNWQSNSCLDGQSLSFKVTTSDGKTVTSYNVAASNWQ  235

Query  839  YGQTFEGKNSR  871
            +GQTF G+  R
Sbjct  236  FGQTFAGEQMR  246



>ref|XP_006440617.1| hypothetical protein CICLE_v10021897mg [Citrus clementina]
 gb|ESR53857.1| hypothetical protein CICLE_v10021897mg [Citrus clementina]
 gb|KDO55537.1| hypothetical protein CISIN_1g025919mg [Citrus sinensis]
Length=246

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 149/225 (66%), Gaps = 13/225 (6%)
 Frame = +2

Query  212  GWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCV  382
            GW++AHATFYG     GT+GGACG  N   + Y   T ALS ALF N  SCGAC+ ++CV
Sbjct  22   GWTDAHATFYGGGDASGTMGGACGYGNLYSEGYGTNTAALSTALFNNGMSCGACFEIKCV  81

Query  383  NNTGQCKTQNPIIVTATDLCPTGD------GKWCTPPRAHFDLSMPAYLKIGEYKAGFIH  544
            N+   C+  + I VTAT+ CP  +      G WC PP+ HFDLS P + +I +YKAG + 
Sbjct  82   NDPRWCRPGS-IFVTATNFCPPNNALPNNAGGWCNPPQQHFDLSQPVFEQIAQYKAGIVP  140

Query  545  VQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNW  724
            V Y +VPCSRKGG RFTI GH YFNLV ++NVGG+GDV  V ++ +      W P+ RNW
Sbjct  141  VSYRRVPCSRKGGIRFTINGHSYFNLVLITNVGGAGDVRAVSIKGS---RTDWQPMSRNW  197

Query  725  GEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            G+ W++N+ L+G++L FKVTT DG  V S  VAP  W +GQTF G
Sbjct  198  GQNWQSNSYLNGQSLSFKVTTSDGHTVVSNNVAPAGWSFGQTFSG  242



>gb|AFB77223.1| expansin 1 [Betula platyphylla]
Length=258

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 158/249 (63%), Gaps = 15/249 (6%)
 Frame = +2

Query  155  ASLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALS  325
            A L +V   +P V+  G   W  AHATFYG     GT+GGACG  N     Y   T ALS
Sbjct  14   ALLTLVDAKIPGVYSGG--AWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALS  71

Query  326  AALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAH  484
             ALF N  SCGAC+ ++C N    C + +P I++TAT+ CP      + +G WC PPR H
Sbjct  72   TALFNNGLSCGACFEIKCANEPQWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPH  131

Query  485  FDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvsk  664
            FDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV ++NV G+GD+ K
Sbjct  132  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVK  191

Query  665  vdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYG  844
            V V+ +   + +W+ L RNWG+ W++N  L+G++L F+VT  D +  TS  + P  WQ+G
Sbjct  192  VSVKGS---KTEWMSLSRNWGQNWQSNVVLAGQSLSFRVTGSDRRTSTSWNIVPSDWQFG  248

Query  845  QTFEGKNSR  871
            QTF GKN R
Sbjct  249  QTFTGKNFR  257



>ref|XP_002441263.1| hypothetical protein SORBIDRAFT_09g023440 [Sorghum bicolor]
 gb|EES19693.1| hypothetical protein SORBIDRAFT_09g023440 [Sorghum bicolor]
Length=248

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 145/224 (65%), Gaps = 13/224 (6%)
 Frame = +2

Query  215  WSEAHATFYG--PPEGTVGGACGLQNQKDT-YAPYTTALSAALFKNAESCGACYALRCVN  385
            W  AHATFYG     GT+GGACG  N   T Y   T ALS ALF +  +CG+CY LRC +
Sbjct  26   WQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFNDGAACGSCYELRC-D  84

Query  386  NTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHV  547
            N G+      I VTAT+ CP      + DG WC PPR HFD++ PA+L I +Y+AG + V
Sbjct  85   NAGRSCLPGTITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIVPV  144

Query  548  QYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWG  727
             + +VPC +KGG RFTI GH YFNLV V+NV G+GDV  V +  +  G   W P+ RNWG
Sbjct  145  AFRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVRSVSIRGSRTG---WQPMSRNWG  201

Query  728  EKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            + W++NA L G+AL F+VT  DG+ VTS   AP  WQ+GQTFEG
Sbjct  202  QNWQSNADLDGQALSFQVTASDGRTVTSNNAAPAGWQFGQTFEG  245



>ref|XP_010415602.1| PREDICTED: expansin-A1-like [Camelina sativa]
Length=251

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 122/255 (48%), Positives = 153/255 (60%), Gaps = 13/255 (5%)
 Frame = +2

Query  134  MATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYA  304
            MA  +    + I+     CV G    GW  AHATFYG     GT+GGACG  N     Y 
Sbjct  1    MALVVAFLFMAILGVMTSCVNGYAGGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYG  60

Query  305  PYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTGD------GKWC  466
              T ALS ALF N  SCGAC+ LRC N+   C     I+VTAT+ CP  +      G WC
Sbjct  61   TNTAALSTALFNNGLSCGACFELRCQNDGKWC-LPGSIVVTATNFCPPNNALPNNAGGWC  119

Query  467  TPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvgg  646
             PP+ HFDLS P + +I +YKAG + V Y +VPC R+GG RFTI GH YFNLV ++NVGG
Sbjct  120  NPPQQHFDLSQPVFQRIAQYKAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVGG  179

Query  647  sgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAP  826
            +GDV  V V+ +  G   W  + RNWG+ W++N+ L+G+AL FKVTT DG+ + S   AP
Sbjct  180  AGDVHSVMVKGSRTG---WQAMSRNWGQNWQSNSYLNGQALSFKVTTSDGRTIISNNAAP  236

Query  827  KSWQYGQTFEGKNSR  871
              W +GQTF G   R
Sbjct  237  AGWSFGQTFTGAQLR  251



>gb|ABM66452.1| expansin [Vicia faba]
Length=254

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 118/241 (49%), Positives = 156/241 (65%), Gaps = 14/241 (6%)
 Frame = +2

Query  164  LIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSAAL  334
            L +   +  V GD   GW  AHATFYG     GT+GGACG  N     Y   T ALS AL
Sbjct  16   LFISLNMLSVEGD-YGGWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTAL  74

Query  335  FKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLS  496
            F N  SCG+CY +RC ++   CK    IIVTAT+ CP        DG WC PP  HFD++
Sbjct  75   FNNGLSCGSCYEMRCNDDPRWCKP-GSIIVTATNFCPPNPAQANNDGGWCNPPLQHFDMA  133

Query  497  MPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdve  676
             PA+L+I EY+AG + V + +VPC +KGG RFTI GH YF+LV V+NVGG+GDV  + ++
Sbjct  134  EPAFLQIAEYRAGIVPVSFRRVPCFKKGGVRFTINGHSYFDLVLVTNVGGAGDVHSISIK  193

Query  677  dNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFE  856
             +      W P+ RNWG+ W++N+ L+G++L F+VTT DG+ +TS  VAP +WQ+GQTF+
Sbjct  194  GS---RTSWQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTITSYNVAPANWQFGQTFQ  250

Query  857  G  859
            G
Sbjct  251  G  251



>ref|XP_011075523.1| PREDICTED: expansin-A10 [Sesamum indicum]
Length=248

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 153/248 (62%), Gaps = 14/248 (6%)
 Frame = +2

Query  155  ASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALS  325
            A L+  L  +  V G G  GW +AHATFYG  +  GT+GGACG  N     Y   T ALS
Sbjct  6    ALLVGFLAMVSHVHGYG-GGWIDAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALS  64

Query  326  AALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTGD------GKWCTPPRAHF  487
             ALF N  SCG+CY +RCVN    C     I+VTAT+ CP  +      G WC PP  HF
Sbjct  65   TALFNNGLSCGSCYEIRCVNERRWC-LPGSIVVTATNFCPPNNALPNNAGGWCNPPLRHF  123

Query  488  DLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskv  667
            DLS P +  I +YKAG + V Y +VPC R+GG RFTI GH YFNLV ++NVGG+GDV  V
Sbjct  124  DLSQPVFQHIAQYKAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHAV  183

Query  668  dvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQ  847
             ++ +  G   W P+ RNWG+ W+ NA L+G++L FKVTT +G+ V S   AP SW YGQ
Sbjct  184  SIKGSRTG---WQPMSRNWGQNWQNNAYLNGQSLSFKVTTSNGQTVVSYNAAPASWSYGQ  240

Query  848  TFEGKNSR  871
            TF G   R
Sbjct  241  TFAGAQFR  248



>ref|XP_010521846.1| PREDICTED: expansin-A6 [Tarenaya hassleriana]
Length=259

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 118/261 (45%), Positives = 163/261 (62%), Gaps = 15/261 (6%)
 Frame = +2

Query  119  IITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            +I+      +  +  L+    +P V+G G   W  AHATFYG  +  GT+GGACG  N  
Sbjct  3    MISLVFVLTILVSLTLMSEARIPGVYGGG--AWQNAHATFYGGSDASGTMGGACGYGNLY  60

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N   CGAC+ ++C ++   C + +P I +TAT+ CP      +
Sbjct  61   SQGYGVNTAALSTALFNNGFRCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPS  120

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV 
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            V+NV G+GDV +V V+ +  G   W+ + RNWG+ W++N+ L G++L F+VT  D ++ T
Sbjct  181  VTNVAGAGDVVRVSVKGSRTG---WMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRSST  237

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  +AP  WQ+GQTF GKN R
Sbjct  238  SWNIAPSHWQFGQTFVGKNFR  258



>ref|XP_008782645.1| PREDICTED: expansin-A2-like [Phoenix dactylifera]
Length=257

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 118/228 (52%), Positives = 150/228 (66%), Gaps = 13/228 (6%)
 Frame = +2

Query  203  GNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYAL  373
            G+SGW  AHATFYG     GT+GGACG  N     Y   T ALS ALF N  SCGACY +
Sbjct  31   GDSGWQTAHATFYGGGDASGTMGGACGYGNLYGQGYGTNTAALSTALFNNGLSCGACYEM  90

Query  374  RCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLKIGEYKAG  535
            RC +++  C     IIVTAT+ CP        +G WC PP  HFDL+ PA+L+I +Y+AG
Sbjct  91   RCADDSRWC-LPGSIIVTATNFCPPNNALPNDNGGWCNPPLQHFDLAEPAFLQIAQYRAG  149

Query  536  FIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLK  715
             + V + +VPC +KGG RFTI GH YFNLV ++NV GSGDV  V ++ +  G   W  + 
Sbjct  150  IVPVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGSGDVHAVSIKGSKTG---WQAMS  206

Query  716  RNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            +NWG+ W++NA L G++L F+VTT DG+ VTS  VAP  WQ+GQTFEG
Sbjct  207  QNWGQNWQSNAYLDGQSLSFQVTTSDGRTVTSNDVAPAGWQFGQTFEG  254



>gb|KEH35550.1| expansin A10 [Medicago truncatula]
Length=253

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 118/253 (47%), Positives = 158/253 (62%), Gaps = 13/253 (5%)
 Frame = +2

Query  128  AAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDT  298
            A +AT   +    ++   L   FGD   GW  AHATFYG  +  GT+GGACG  N     
Sbjct  2    AIVATSFISILFFVLSLCLRGTFGDYGGGWENAHATFYGGGDASGTMGGACGYGNLYSQG  61

Query  299  YAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGK  460
            Y   T ALS ALF N  SCG+CY ++C ++   C     I+VTAT+ CP        +G 
Sbjct  62   YGTNTAALSTALFNNGLSCGSCYEMKCNSDPKWC-LPGSILVTATNFCPPNFAESNTNGG  120

Query  461  WCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnv  640
            WC PP  HFDL+ PA+L+I +YKAG + + + +VPC +KGG RFTI GH YFNLV V+NV
Sbjct  121  WCNPPLQHFDLAEPAFLQIAQYKAGIVPISFRRVPCMKKGGIRFTINGHSYFNLVLVTNV  180

Query  641  ggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKV  820
            GG+GDV  V ++ +  G   W  + RNWG+ W++N  L+G++L F+VTT DG+ +TS  V
Sbjct  181  GGAGDVHSVSIKGSKTG---WQAMSRNWGQNWQSNNYLNGQSLSFQVTTSDGRTITSNNV  237

Query  821  APKSWQYGQTFEG  859
             P +WQ+GQTF G
Sbjct  238  VPGNWQFGQTFTG  250



>ref|XP_011098644.1| PREDICTED: expansin-A10 [Sesamum indicum]
Length=240

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 118/223 (53%), Positives = 146/223 (65%), Gaps = 9/223 (4%)
 Frame = +2

Query  212  GWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCV  382
            GW  AHATFYG     GT+GGACG  N     Y   T ALS ALF N  SCGAC+ L CV
Sbjct  24   GWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFQLVCV  83

Query  383  NNTGQCKTQNPIIVTATDLCPTGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKV  562
            N+   C  +  IIVTAT+ CP   G WC PP  HFDLS P +L+I +Y+AG + V Y +V
Sbjct  84   NDPQWC-LRGSIIVTATNFCP--PGGWCDPPNHHFDLSQPVFLRIAQYRAGIVPVLYRRV  140

Query  563  PCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWET  742
            PC R GG RFTI GH YFNLV V+NVGG+GDV  V ++ +      W P+ RNWG+ W++
Sbjct  141  PCRRSGGIRFTINGHSYFNLVLVTNVGGAGDVQAVYIKGS---RTAWQPMSRNWGQNWQS  197

Query  743  NAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            N+ L+G++L FKVTT DG++V S  VAP +W +GQTF G   R
Sbjct  198  NSYLNGQSLSFKVTTSDGRSVVSYNVAPPNWSFGQTFSGGQFR  240



>ref|NP_001289251.1| expansin-A4-like precursor [Pyrus x bretschneideri]
 dbj|BAC67190.1| expansin [Pyrus communis]
 gb|AGR44456.1| expansin 3 [Pyrus x bretschneideri]
Length=254

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 160/255 (63%), Gaps = 16/255 (6%)
 Frame = +2

Query  128  AAMATELQAASLLIVLCALPC--VFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QK  292
            AA A      +L +VL  L    VF    S W  AHATFYG     GT+GGACG  N   
Sbjct  2    AAHALSFAPIALSVVLFNLHLHGVFAVYGS-WEGAHATFYGGGDASGTMGGACGYGNLYS  60

Query  293  DTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGD  454
              Y   T ALS ALF N  SCG+CY +RC N+   C+    IIVTAT+ CP        +
Sbjct  61   QGYGTNTAALSTALFNNGLSCGSCYEMRCDNDPRWCRP-GSIIVTATNFCPPNFAQSNDN  119

Query  455  GKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvs  634
            G WC PP  HFDL+ PA+L+I +Y+AG + V + +VPC +KGG RFTI GH YFNLV ++
Sbjct  120  GGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFRRVPCVKKGGIRFTINGHSYFNLVLIT  179

Query  635  nvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSR  814
            NV G+GDV  V ++ +  G   W P+ RNWG+ W++N+ L+G+AL F+VTT DG+ VTS 
Sbjct  180  NVAGAGDVHSVSIKGSRTG---WQPMSRNWGQNWQSNSYLNGQALSFQVTTSDGRTVTSY  236

Query  815  KVAPKSWQYGQTFEG  859
             VAP +WQ+GQTF G
Sbjct  237  NVAPGNWQFGQTFSG  251



>gb|AFK38068.1| unknown [Medicago truncatula]
Length=253

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 118/254 (46%), Positives = 158/254 (62%), Gaps = 13/254 (5%)
 Frame = +2

Query  128  AAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDT  298
            A +AT   +    ++   L   FGD   GW  AHATFYG  +  GT+GGACG  N     
Sbjct  2    AIVATSFISTLFFVLSLCLKGTFGDYGGGWENAHATFYGGGDASGTMGGACGYGNLYSQG  61

Query  299  YAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGK  460
            Y   T ALS ALF N  SCG+CY ++C ++   C     I+VTAT+ CP        +G 
Sbjct  62   YGTNTAALSTALFNNGLSCGSCYEMKCNSDPKWC-LPGSILVTATNFCPPNFAESNTNGG  120

Query  461  WCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnv  640
            WC PP  HFDL+ PA+L+I +YKAG + +   +VPC +KGG RFTI GH YFNLV V+NV
Sbjct  121  WCNPPLQHFDLAEPAFLQIAQYKAGIVPISIRRVPCVKKGGIRFTINGHSYFNLVLVTNV  180

Query  641  ggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKV  820
            GG+GDV  V ++ +  G   W  + RNWG+ W++N  L+G++L F+VTT DG+ +TS  V
Sbjct  181  GGAGDVHSVSIKGSKTG---WQAMSRNWGQNWQSNNYLNGQSLSFQVTTSDGRTITSNNV  237

Query  821  APKSWQYGQTFEGK  862
             P +WQ+GQTF G+
Sbjct  238  VPGNWQFGQTFTGR  251



>ref|XP_002283530.1| PREDICTED: expansin-A4 [Vitis vinifera]
Length=258

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 156/245 (64%), Gaps = 15/245 (6%)
 Frame = +2

Query  167  IVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALF  337
            +V   +P  +  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF
Sbjct  18   LVQAKIPGAYSGG--AWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  75

Query  338  KNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLS  496
             N  SCGAC+ L+C N+   C + +P I++TAT+ CP      + +G WC PPR HFDL+
Sbjct  76   NNGLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLA  135

Query  497  MPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdve  676
            MP +LKI EY+AG + V + +VPC ++GG RFTI G  YFNLV ++NV G+GD+ +  V+
Sbjct  136  MPMFLKIAEYRAGIVPVAFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRASVK  195

Query  677  dNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFE  856
             +  G   W+ L RNWG+ W++NA L G++L F+VT  D +  TS  +AP  WQ+GQTF 
Sbjct  196  GSKTG---WMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIAPAHWQFGQTFS  252

Query  857  GKNSR  871
            GKN R
Sbjct  253  GKNFR  257



>ref|XP_004486999.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 119/259 (46%), Positives = 163/259 (63%), Gaps = 16/259 (6%)
 Frame = +2

Query  134  MATELQAASLLIVLCAL--PCVFGDGNSG-WSEAHATFYGPPE--GTVGGACGLQN-QKD  295
            M T +   SL++ L  L    + G+ N G W  AHATFYG  +  GT+GGACG  N    
Sbjct  1    MMTIVYIVSLIMSLTWLAESRIPGNYNGGAWETAHATFYGGSDASGTMGGACGYGNLYSQ  60

Query  296  TYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGD  454
             Y   T ALS ALF    SCGAC+ ++C N+   C + +P I +TAT+ CP        +
Sbjct  61   GYGVNTAALSTALFNKGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNYALPNDN  120

Query  455  GKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvs  634
            G WC PPR HFDL+MP +LKI EY+AG + V + +VPC ++GG RFT+ G  YFNLV +S
Sbjct  121  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKQGGIRFTVNGFRYFNLVLIS  180

Query  635  nvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSR  814
            NV G+GD+ +  V+       +W+P+ RNWG+ W++NA L G++L F+VT+ D +  TS 
Sbjct  181  NVAGAGDIVRTYVKGT---RTRWMPMSRNWGQNWQSNAVLVGQSLSFRVTSSDRRTSTSW  237

Query  815  KVAPKSWQYGQTFEGKNSR  871
             +AP +WQ+GQTF GKN R
Sbjct  238  NIAPHNWQFGQTFTGKNFR  256



>gb|AEN70914.1| expansin [Gossypium trilobum]
Length=259

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 163/265 (62%), Gaps = 23/265 (9%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGL  280
            +SVLI  ++M    +A         +P V+  G   W  AHATFYG  +  GT+GGACG 
Sbjct  7    ISVLIFISSMWMMGEAR--------IPGVYSGG--AWQNAHATFYGGADASGTMGGACGY  56

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF N  SCGAC+ ++C ++   C + +P I +TAT+ CP   
Sbjct  57   GNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNF  116

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
                 +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YF
Sbjct  117  ALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYF  176

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV +SNV G+GD+ KV V+ +  G   W+ + RNWG+ W++NA L G++L F+VT  D 
Sbjct  177  NLVLISNVAGAGDIVKVSVKGSRTG---WMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDR  233

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  TS  + P  WQ+GQTF GKN R
Sbjct  234  RTSTSWNIVPSHWQFGQTFTGKNFR  258



>gb|AEN70891.1| expansin [Gossypium thurberi]
Length=259

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 163/265 (62%), Gaps = 23/265 (9%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGL  280
            +SVLI  ++M    +A         +P V+  G   W  AHATFYG  +  GT+GGACG 
Sbjct  7    ISVLIFISSMWMMGEAR--------IPGVYSGG--AWQNAHATFYGGADASGTMGGACGY  56

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF N  SCGAC+ ++C ++   C + +P I +TAT+ CP   
Sbjct  57   GNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNY  116

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
                 +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YF
Sbjct  117  ALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYF  176

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV +SNV G+GD+ KV V+ +  G   W+ + RNWG+ W++NA L G++L F+VT  D 
Sbjct  177  NLVLISNVAGAGDIVKVSVKGSRTG---WMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDR  233

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  TS  + P  WQ+GQTF GKN R
Sbjct  234  RTSTSWNIVPSHWQFGQTFTGKNFR  258



>ref|XP_002298353.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|ABK92494.1| unknown [Populus trichocarpa]
 gb|EEE83158.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 119/257 (46%), Positives = 163/257 (63%), Gaps = 22/257 (9%)
 Frame = +2

Query  152  AASLLIVLCAL-------PCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTY  301
            A SLLI++ +L       P V+  G   W  AHATFYG  +  GT+GGACG  N     Y
Sbjct  10   ATSLLIIMSSLWMAEARIPGVYSGG--AWQNAHATFYGGADASGTMGGACGYGNLYSQGY  67

Query  302  APYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGK  460
               T ALS ALF N  +CG+C+ ++C ++   C + +P I +TAT+ CP      + +G 
Sbjct  68   GVSTAALSTALFNNGLTCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYALPSDNGG  127

Query  461  WCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnv  640
            WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV +SNV
Sbjct  128  WCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNV  187

Query  641  ggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKV  820
             G+GD+ +V V+ +  G   W+ + RNWG+ W++NA L G++L F+V   D ++ TS  +
Sbjct  188  AGAGDIVQVSVKGSKTG---WMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTSWNI  244

Query  821  APKSWQYGQTFEGKNSR  871
            AP  WQ+GQTF GKN R
Sbjct  245  APAHWQFGQTFTGKNFR  261



>ref|XP_010505357.1| PREDICTED: expansin-A3-like [Camelina sativa]
Length=262

 Score =   209 bits (532),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 156/240 (65%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  S
Sbjct  27   IPGVYSGGP--WQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFS  84

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ ++C ++   C   NP I+VTAT+ CP      + DG WC PPR HFDL+MP +L
Sbjct  85   CGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMPMFL  144

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
            KIG Y+AG + V Y +VPC + GG RFT+ G  YFNLV V+NV G+GD++ V V+     
Sbjct  145  KIGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKGT---  201

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            + +WV + RNWG+ W++NA L G++L F+VT  D ++ TS  VAP SWQ+GQTF GKN R
Sbjct  202  KTEWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAPPSWQFGQTFSGKNFR  261



>ref|XP_008354429.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=254

 Score =   209 bits (532),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 160/258 (62%), Gaps = 22/258 (9%)
 Frame = +2

Query  128  AAMATELQAASLLIVLCALP-----CVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN  286
            A  A  L   +L +VL  L       V+G     W  AHATFYG     GT+GGACG  N
Sbjct  2    AVHALSLAPIALSVVLFNLHLHGAFAVYGS----WEGAHATFYGGGDASGTMGGACGYGN  57

Query  287  -QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------  445
                 Y   T ALS ALF N  SCG+CY +RC N+   C+    IIVTAT+ CP      
Sbjct  58   LYSQGYGTNTAALSTALFNNGLSCGSCYEMRCDNDPRWCRP-GSIIVTATNFCPPNFAQS  116

Query  446  TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLv  625
              +G WC PP  HFDL+ PA+L+I +Y+AG + V + +VPC +KGG RFTI GH YFNLV
Sbjct  117  NDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFRRVPCVKKGGIRFTINGHSYFNLV  176

Query  626  tvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAV  805
             ++NV G+GDV  V ++ +  G   W P+ RNWG+ W++N+ L+G+AL F+VTT DG+ V
Sbjct  177  LITNVAGAGDVHSVSIKGSRTG---WQPMSRNWGQNWQSNSYLNGQALSFQVTTSDGRTV  233

Query  806  TSRKVAPKSWQYGQTFEG  859
            TS  VAP +WQ+GQTF G
Sbjct  234  TSYNVAPGNWQFGQTFSG  251



>gb|AGU13763.1| expansin [Rehmannia glutinosa]
 gb|AGU13764.1| expansin [Rehmannia glutinosa]
Length=253

 Score =   209 bits (531),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 120/236 (51%), Positives = 153/236 (65%), Gaps = 14/236 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            L   +GD   GW  AHATFYG     GT+GGACG  N     Y   T ALS ALF N  S
Sbjct  21   LRATYGD-YGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLS  79

Query  353  CGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYLK  514
            CG+CY L C ++   C  +  IIVTAT+ CP        +G WC PPR HFDL+ PA+L+
Sbjct  80   CGSCYELTCSSDPRWC-LRGSIIVTATNFCPPNPSLPNDNGGWCNPPRQHFDLAQPAFLQ  138

Query  515  IGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGE  694
            I +Y+AG + V + +VPC +KGG RFTI GH YFNLV V+NVGG+GDV  V ++ +  G 
Sbjct  139  IAQYRAGIVPVSFRRVPCRKKGGIRFTINGHSYFNLVLVTNVGGAGDVHSVSIKGSKTG-  197

Query  695  KKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGK  862
              W  L RNWG+ W++N+ L+G++L FKVTT DG+ + S  VAP +WQ+GQTFEG 
Sbjct  198  --WQSLSRNWGQNWQSNSYLNGQSLSFKVTTSDGRTLISNNVAPANWQFGQTFEGS  251



>ref|XP_007046062.1| Expansin A1, ALPHA 1.2,EXPA1 [Theobroma cacao]
 gb|EOY01894.1| Expansin A1, ALPHA 1.2,EXPA1 [Theobroma cacao]
Length=423

 Score =   214 bits (545),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 165/269 (61%), Gaps = 16/269 (6%)
 Frame = +2

Query  98   YL*LSVLIITAAMATELQAASLLIV--LCALPCVFGDGNSGWSEAHATFYGPPE--GTVG  265
            ++ LS L+    +  ++  A + +V  L  +  V GDG  GW  AHATFYG  +  GT+G
Sbjct  160  HIILSPLVSHTLIFMKMAFAGVFLVGFLAMVSAVHGDG-GGWINAHATFYGGSDASGTMG  218

Query  266  GACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLC  442
            GACG  N     Y   T ALS ALF N  SCG+CY ++CVN+   C     I+VTAT+ C
Sbjct  219  GACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKCVNDGKWC-LPGSIVVTATNFC  277

Query  443  PTGD------GKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAG  604
            P  +      G WC PP  HFDLS P +  I +Y+AG + V Y +VPC+R+GG RFTI G
Sbjct  278  PPNNALPNNAGGWCNPPLHHFDLSQPVFQHIAQYRAGIVPVAYKRVPCTRRGGIRFTING  337

Query  605  HEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVT  784
            H YFNL+ ++NVGG+GDV  V ++ +  G   W P+ RNWG+ W++N  L+G++L FKVT
Sbjct  338  HSYFNLILITNVGGAGDVHAVAIKGSRTG---WQPMSRNWGQNWQSNNYLNGQSLSFKVT  394

Query  785  TQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            T DG+ V S  VAP  W +GQTF G   R
Sbjct  395  TSDGRTVVSYNVAPAGWSFGQTFAGAQFR  423



>gb|AAT94292.1| alpha-expansin EXPA2 [Triticum aestivum]
Length=251

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/250 (48%), Positives = 156/250 (62%), Gaps = 17/250 (7%)
 Frame = +2

Query  149  QAASLLIVLCALPCVFGDGNSG----WSEAHATFYG--PPEGTVGGACGLQNQKDT-YAP  307
             A +LL++  A  C      +G    W  AHATFYG     GT+GGACG  N   T Y  
Sbjct  3    SANALLLLFSAAFCFLARRAAGDYGSWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGT  62

Query  308  YTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCT  469
             T ALS ALF +  +CG+CY L+C + +  C     I +TAT+LCP        DG WC 
Sbjct  63   NTAALSTALFYDGAACGSCYELKCQDVSSSC-LPGSITITATNLCPPNYALPNDDGGWCN  121

Query  470  PPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggs  649
            PPRAHFD++ PAYL+IG Y+AG + V Y +VPC +KGG RFTI GH YFNLV V+NV G+
Sbjct  122  PPRAHFDMAEPAYLQIGIYRAGIVAVAYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGA  181

Query  650  gdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPK  829
            GDV  V ++ ++ G +    + RNWG+ W++NA L G++L F+VT  DG+ VTS   AP 
Sbjct  182  GDVQSVAIKGSSTGCQA---MARNWGQNWQSNADLDGQSLSFRVTLSDGRTVTSNNAAPA  238

Query  830  SWQYGQTFEG  859
             W +GQTFEG
Sbjct  239  GWSFGQTFEG  248



>ref|NP_001242978.1| expansin-A4-like precursor [Glycine max]
 gb|AEV43316.1| expansin A5a [Glycine max]
Length=259

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 155/245 (63%), Gaps = 15/245 (6%)
 Frame = +2

Query  167  IVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALF  337
            +V   +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF
Sbjct  19   MVQARIPGVYSAG--AWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  76

Query  338  KNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLS  496
             +  SCGAC+ ++C N+   C + +P I +TAT+ CP        +G WC PPR HFDL+
Sbjct  77   NSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLA  136

Query  497  MPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdve  676
            MP +LKI EY+AG + V Y +VPC + GG RFTI G  YFNLV +SNV G+GD+ +  V+
Sbjct  137  MPMFLKIAEYRAGIVPVAYRRVPCRKHGGIRFTINGFRYFNLVLISNVAGAGDIVRTYVK  196

Query  677  dNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFE  856
                G   W+P+ RNWG+ W++NA L G+AL F+VT  D +  TS  +AP +WQ+GQTF 
Sbjct  197  GTRTG---WMPMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNIAPPNWQFGQTFT  253

Query  857  GKNSR  871
            GKN R
Sbjct  254  GKNFR  258



>ref|XP_004147685.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004161909.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN50556.1| hypothetical protein Csa_5G182120 [Cucumis sativus]
Length=259

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/244 (47%), Positives = 157/244 (64%), Gaps = 15/244 (6%)
 Frame = +2

Query  170  VLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFK  340
            V   +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF 
Sbjct  20   VHARIPGVYSGGQ--WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  77

Query  341  NAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSM  499
            N  SCGAC+ L+C N+   C + +P I +TAT+ CP      + +G WC PPR HFDL+M
Sbjct  78   NGLSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAM  137

Query  500  PAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdved  679
            P +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNL+ ++NV G+GD+ K  V+ 
Sbjct  138  PMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLILITNVAGAGDIVKASVKG  197

Query  680  NADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            +   + +W+ + RNWG+ W++NA L G++L F+VT+ D +  TS  + P +WQ+GQTF G
Sbjct  198  S---KTEWMSMSRNWGQNWQSNAILVGQSLSFRVTSSDRRTSTSWNIVPSNWQFGQTFTG  254

Query  860  KNSR  871
            KN R
Sbjct  255  KNFR  258



>ref|XP_011035307.1| PREDICTED: expansin-A6 [Populus euphratica]
Length=262

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/257 (46%), Positives = 162/257 (63%), Gaps = 22/257 (9%)
 Frame = +2

Query  152  AASLLIVLCAL-------PCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTY  301
            A SLLI++ +L       P V+  G   W  AHATFYG  +  GT+GGACG  N     Y
Sbjct  10   ATSLLIIMSSLWMGEARIPGVYSGG--AWQNAHATFYGGADASGTMGGACGYGNLYSQGY  67

Query  302  APYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGK  460
               T ALS ALF N  SCG+C+ ++C ++   C + +P I +TAT+ CP      + +G 
Sbjct  68   GVSTAALSTALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYALPSDNGG  127

Query  461  WCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnv  640
            WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV +SNV
Sbjct  128  WCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNV  187

Query  641  ggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKV  820
             G+GD+ +V V+ +  G   W+ + RNWG+ W++NA L G++L F+V   D ++ TS  +
Sbjct  188  AGAGDIVQVSVKGSKTG---WMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTSWNI  244

Query  821  APKSWQYGQTFEGKNSR  871
             P  WQ+GQTF GKN R
Sbjct  245  VPAHWQFGQTFTGKNFR  261



>gb|AEN70901.1| expansin [Gossypium barbadense var. brasiliense]
Length=259

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/265 (46%), Positives = 162/265 (61%), Gaps = 23/265 (9%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGL  280
            +SVLI  ++M    +A         +P V+  G   W  AHATFYG  +  GT+GGACG 
Sbjct  7    ISVLIFISSMWMMGEAR--------IPGVYSGG--AWQNAHATFYGGADASGTMGGACGY  56

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF N  SCGAC+ ++C ++   C + +P I +TAT+ CP   
Sbjct  57   GNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNY  116

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
                 +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YF
Sbjct  117  ALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYF  176

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV +SNV G+GD+ K  V+ +  G   W+ + RNWG+ W++NA L G++L F+VT  D 
Sbjct  177  NLVLISNVAGAGDIVKASVKGSRTG---WMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDR  233

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  TS  + P  WQ+GQTF GKN R
Sbjct  234  RTSTSWNIVPAHWQFGQTFTGKNFR  258



>gb|EPS58017.1| hypothetical protein M569_16799 [Genlisea aurea]
Length=249

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 150/245 (61%), Gaps = 17/245 (7%)
 Frame = +2

Query  167  IVLCALPCVF----GDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALS  325
             +L A+P +F    G+   GW+ AHATFYG  +  GT+GGACG  N     Y   T ALS
Sbjct  6    FLLLAVPSLFSHVNGEDGGGWTGAHATFYGGSDASGTMGGACGYGNLYSQGYGTDTAALS  65

Query  326  AALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTGD------GKWCTPPRAHF  487
             ALF N +SCG+CY +RCV     C  Q  ++VTAT+ CP  +      G WC PPR HF
Sbjct  66   TALFNNGQSCGSCYEIRCVGEQRWC-LQASVVVTATNFCPPNNALPNDAGGWCNPPRLHF  124

Query  488  DLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskv  667
            DLS P + +I  Y+AG + V Y +VPC RKGG RFTI GH YFNLV ++NV G+GDV  V
Sbjct  125  DLSQPIFQRIAVYRAGIVPVAYRRVPCVRKGGIRFTINGHSYFNLVLITNVAGAGDVIAV  184

Query  668  dvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQ  847
             ++ +  G   W P+ RNWG+ W++ + L G+ L FKVTT DG+ V S    P  W +GQ
Sbjct  185  SIKGSRSG---WEPMSRNWGQNWQSGSFLDGQGLSFKVTTSDGRTVVSNDAVPAGWSFGQ  241

Query  848  TFEGK  862
            TF G 
Sbjct  242  TFSGS  246



>gb|ADC35365.1| alpha-expansin 2 [Coffea arabica]
Length=258

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 167/261 (64%), Gaps = 18/261 (7%)
 Frame = +2

Query  128  AAMA-TELQAASLLIVL--CALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            AAM  T + A SLL+ L    +P V+  G+S W  AHATFYG  +  GT+GGACG  N  
Sbjct  2    AAMGLTCIVALSLLLTLTEARIPGVY-TGDS-WESAHATFYGGSDASGTMGGACGYGNLY  59

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCG+C+ L+C ++   C   +P I++TAT+ CP       
Sbjct  60   SQGYGVNTAALSTALFNNGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPNYALPN  119

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR HFDL+MP +L+I EY+AG + V Y +VPC ++GG RF I G  YFNLV 
Sbjct  120  DNGGWCNPPRPHFDLAMPMFLRIAEYRAGIVPVSYRRVPCRKQGGIRFQINGFRYFNLVL  179

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            ++NV G+GD+ +  V+ +  G   W+ L RNWG+ W+TNA L+G++L F+V   D ++ T
Sbjct  180  ITNVAGAGDIVQASVKGSKTG---WITLSRNWGQNWQTNAVLAGQSLSFRVRASDRRSST  236

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  +AP +WQ+GQTF GKN R
Sbjct  237  SWNIAPANWQFGQTFTGKNFR  257



>gb|AFK41150.1| unknown [Lotus japonicus]
Length=254

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 158/248 (64%), Gaps = 21/248 (8%)
 Frame = +2

Query  167  IVLCALPCVFGDGN--------SGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYT  313
            IVL  L  +F   N         GW  AHATFYG     GT+GGACG  N     Y   T
Sbjct  8    IVLTTLIVLFIGMNMQGAAADYGGWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTDT  67

Query  314  TALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPP  475
             ALS ALF N  SCG+CY +RC ++   CK    IIVTAT+ CP        +G WC PP
Sbjct  68   AALSTALFNNGLSCGSCYEMRCDDDPRWCKP-GSIIVTATNFCPPNPSLANNNGGWCNPP  126

Query  476  RAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgd  655
              HFD++ PA+L+I +Y+AG + V + +VPC++KGG RFTI GH YF+LV ++NVGG+GD
Sbjct  127  LQHFDMAEPAFLQIAQYRAGIVPVAFRRVPCAKKGGIRFTINGHSYFSLVLITNVGGAGD  186

Query  656  vskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSW  835
            V    ++ +  G   W P+ RNWG+ W++N+ L+G+AL F+VTT DG+ VTS  VAP +W
Sbjct  187  VHSASIKGSRSG---WQPMSRNWGQNWQSNSYLNGQALSFQVTTSDGRTVTSINVAPANW  243

Query  836  QYGQTFEG  859
            Q+GQTF+G
Sbjct  244  QFGQTFQG  251



>ref|XP_009761115.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=260

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 156/247 (63%), Gaps = 15/247 (6%)
 Frame = +2

Query  161  LLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAA  331
            LL V   +P V+  G+  W  AHATFYG  +  GT+GGACG  N     Y     ALS A
Sbjct  18   LLTVEARIPGVYSGGS--WQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTA  75

Query  332  LFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFD  490
            LF N  SCGAC+ ++C N    C   +P I++TAT+ CP        +G WC PPR HFD
Sbjct  76   LFNNGLSCGACFEIKCDNQPQWCHAGSPSILITATNFCPPNYALPNDNGGWCNPPRPHFD  135

Query  491  LSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvd  670
            L+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV V+NV G+GD+ K+ 
Sbjct  136  LAMPMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKLM  195

Query  671  vedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQT  850
            V+ +  G   W+ + RNWG+ W+TN+ L G+AL F+VT  D +  TS  +AP  WQ+GQT
Sbjct  196  VKGSRTG---WITMSRNWGQNWQTNSVLVGQALSFRVTASDRRKSTSWNIAPAHWQFGQT  252

Query  851  FEGKNSR  871
            F GKN R
Sbjct  253  FVGKNFR  259



>ref|XP_010517036.1| PREDICTED: expansin-A3 [Camelina sativa]
Length=262

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 156/240 (65%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  S
Sbjct  27   IPGVYSGGP--WQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFS  84

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ ++C ++   C   NP I+VTAT+ CP      + DG WC PPR HFDL+MP +L
Sbjct  85   CGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMPMFL  144

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
            KIG Y+AG + V Y +VPC + GG RFT+ G  YFNLV V+NV G+GD++ V V+ +   
Sbjct  145  KIGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKGS---  201

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  WV + RNWG+ W++NA L G++L F+VT  D ++ TS  VAP SWQ+GQTF GKN R
Sbjct  202  KTDWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAPPSWQFGQTFSGKNFR  261



>gb|ADY68814.1| expansin [Gossypium barbadense]
 gb|ADY68816.1| expansin [Gossypium herbaceum subsp. africanum]
 gb|AEN70897.1| expansin [Gossypium darwinii]
 gb|AEN70899.1| expansin [Gossypium tomentosum]
 gb|AEN70903.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70905.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70909.1| expansin [Gossypium davidsonii]
 gb|AEN70910.1| expansin [Gossypium klotzschianum]
Length=259

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 163/265 (62%), Gaps = 23/265 (9%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGL  280
            +SVLI  ++M    +A         +P V+  G   W  AHATFYG  +  GT+GGACG 
Sbjct  7    ISVLIFISSMWMMGEAR--------IPGVYSGG--AWQNAHATFYGGADASGTMGGACGY  56

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF N  SCGAC+ ++C ++   C + +P I +TAT+ CP   
Sbjct  57   GNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNY  116

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
                 +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YF
Sbjct  117  ALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYF  176

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV +SNV G+GD+ KV V+ +  G   W+ + RNWG+ W++NA L G++L F+VT  D 
Sbjct  177  NLVLISNVAGAGDIVKVSVKGSRTG---WMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDR  233

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  TS  + P  WQ+GQTF GKN R
Sbjct  234  RTSTSWNIVPAHWQFGQTFTGKNFR  258



>ref|XP_009780854.1| PREDICTED: expansin-A4-like [Nicotiana sylvestris]
Length=253

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/225 (53%), Positives = 147/225 (65%), Gaps = 13/225 (6%)
 Frame = +2

Query  212  GWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCV  382
            GW  AHATFYG     GT+GGACG  N     Y   T ALS ALF N  +CGACY L C 
Sbjct  30   GWQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYELTC-  88

Query  383  NNTGQCKTQNPIIVTATDLCPTGD------GKWCTPPRAHFDLSMPAYLKIGEYKAGFIH  544
            NN GQ   Q  IIVTAT+ CP         G WC PP  HFDL+ PA+L+I +Y+AG + 
Sbjct  89   NNDGQSCLQGSIIVTATNFCPPNPSLPNNNGGWCNPPLQHFDLAQPAFLQIAKYRAGIVP  148

Query  545  VQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNW  724
            V + +VPC RKGG RFTI GH +FNLV V+NVGG+GDV  V ++ +  G   W  + RNW
Sbjct  149  VSFRRVPCRRKGGVRFTINGHSFFNLVLVTNVGGAGDVQSVSIKGSNTG---WQTMSRNW  205

Query  725  GEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            G+ W+ NA L+G++L F+VTT DG+ +TS   AP +WQ+GQTFEG
Sbjct  206  GQNWQNNANLNGQSLSFQVTTSDGRTLTSNNAAPANWQFGQTFEG  250



>ref|XP_010922313.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A4-like [Elaeis guineensis]
Length=258

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/261 (46%), Positives = 162/261 (62%), Gaps = 19/261 (7%)
 Frame = +2

Query  131  AMATELQAASLLIVLCA----LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-Q  289
            A+   +  ASLL  L      +P V+  G   W  AHATFYG  +  GT+GGACG  N  
Sbjct  2    AILRLVALASLLAFLVPAAARIPGVYSSGP--WQSAHATFYGGSDASGTMGGACGYGNLY  59

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF +  SCGAC+ ++C ++   C + +P I +TAT+ CP      +
Sbjct  60   SQGYGVETAALSTALFNDGMSCGACFEIKCADDPQWCHSGSPSIFITATNFCPPNYALPS  119

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             DG WC PP  HFDL+MP +LKI EY+AG + V Y +VPC + GG RFTI G +YFNLV 
Sbjct  120  DDGGWCNPPXPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFQYFNLVL  179

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            ++NV G+GD+ +  V+ +  G   W+P+ RNWG+ W++NA L G++L F+VT  D +  T
Sbjct  180  ITNVAGAGDIVRASVKGSRTG---WMPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTST  236

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  + P +WQ+GQTF GKN R
Sbjct  237  SWNIVPANWQFGQTFAGKNFR  257



>gb|AAF35902.1|AF230333_1 expansin 3 [Zinnia violacea]
Length=242

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 151/240 (63%), Gaps = 10/240 (4%)
 Frame = +2

Query  152  AASLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTAL  322
            A   L +L  L  + G G  GWS AHATFYG     GT+GGACG  N     Y   T AL
Sbjct  5    AIFFLALLSPLHVIAGGG--GWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAAL  62

Query  323  SAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP-TGDGKWCTPPRAHFDLSM  499
            S ALF    SCG+CY +RCVN+   C     I+VTAT+ CP   +G WC PPR HFDLS 
Sbjct  63   STALFNKGLSCGSCYEIRCVNDRQWCLPAT-IVVTATNFCPPNSNGGWCDPPRQHFDLSQ  121

Query  500  PAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdved  679
            P +  I +YKAG + V Y +VPC R+GG RF I GH YFNLV ++NVGG+GDV  V ++ 
Sbjct  122  PIFQHIAQYKAGVVPVAYRRVPCRRRGGIRFQINGHSYFNLVLITNVGGAGDVHAVAIKG  181

Query  680  NADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            +  G   W  + RNWG+ W++N+ L+G++L FKVTT DG+ V S  VAP  W +GQTF G
Sbjct  182  SRTG---WQQMSRNWGQNWQSNSYLNGQSLSFKVTTSDGRTVVSYNVAPSRWSFGQTFAG  238



>ref|XP_010066900.1| PREDICTED: expansin-A1 [Eucalyptus grandis]
 gb|KCW64943.1| hypothetical protein EUGRSUZ_G02490 [Eucalyptus grandis]
 gb|KCW64944.1| hypothetical protein EUGRSUZ_G02490 [Eucalyptus grandis]
Length=250

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/236 (51%), Positives = 148/236 (63%), Gaps = 13/236 (6%)
 Frame = +2

Query  191  VFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGA  361
            V G G  GW  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCG+
Sbjct  19   VDGSGGGGWINAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGS  78

Query  362  CYALRCVNNTGQCKTQNPIIVTATDLCPTGD------GKWCTPPRAHFDLSMPAYLKIGE  523
            C+ +RCVN+   C     I+VTAT+ CP  +      G WC PP+ HFDLS P +  I +
Sbjct  79   CFEIRCVNDGKWC-LGGSIVVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHIAQ  137

Query  524  YKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKW  703
            Y+AG + V Y +VPC R GG RFTI GH YFNLV V+NVGG+GDV  V V+ +  G   W
Sbjct  138  YRAGIVPVAYRRVPCRRSGGIRFTINGHSYFNLVLVTNVGGAGDVHSVAVKGSRTG---W  194

Query  704  VPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
              + RNWG+ W++NA L+G++L FKVTT DG+ V S  VAP  W +GQTF G   R
Sbjct  195  QTMSRNWGQNWQSNANLNGQSLSFKVTTSDGRTVVSNNVAPAGWSFGQTFAGAQFR  250



>ref|XP_002881524.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002881525.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57783.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57784.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 156/240 (65%), Gaps = 15/240 (6%)
 Frame = +2

Query  182  LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAES  352
            +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  S
Sbjct  27   IPGVYSGGP--WQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFS  84

Query  353  CGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFDLSMPAYL  511
            CGAC+ ++C ++   C   NP I+VTAT+ CP      + DG WC PPR HFDL+MP +L
Sbjct  85   CGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMPMFL  144

Query  512  KIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADG  691
            KIG Y+AG + V Y +VPC + GG RFT+ G  YFNLV V+NV G+GD++ V V+ +   
Sbjct  145  KIGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKGS---  201

Query  692  EKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  WV + RNWG+ W++NA L G++L F+VT  D ++ TS  VAP +WQ+GQTF GKN R
Sbjct  202  KTDWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAPSTWQFGQTFSGKNFR  261



>dbj|BAJ99188.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03604.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=251

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/250 (48%), Positives = 151/250 (60%), Gaps = 19/250 (8%)
 Frame = +2

Query  152  AASLLIVLCALPCVFG-----DGNSGWSEAHATFYG--PPEGTVGGACGLQNQKDT-YAP  307
            A +L  V  +L C+        G  GW  AHATFYG     GT+GGACG  N   T Y  
Sbjct  4    AGALFFVFSSL-CLLARQAAAGGYGGWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGT  62

Query  308  YTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCT  469
             T ALS ALF +  +CG+CY LRC N    C+    I+VTAT+ CP      + DG WC 
Sbjct  63   NTAALSTALFNDGAACGSCYELRCDNAGSSCR-PGSIMVTATNFCPPNYGLPSDDGGWCN  121

Query  470  PPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggs  649
            PPR HFD++ PA+L I +Y+AG + V Y +VPC +KGG RFTI GH YFNLV V+NV G+
Sbjct  122  PPRPHFDMAEPAFLHIAQYRAGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGA  181

Query  650  gdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPK  829
            GD   V ++    G   W  + RNWG  W++N  L G+ L F+VT+ DG+ VTS   AP 
Sbjct  182  GDARSVSIKGTRTG---WQAMSRNWGMNWQSNTFLDGQCLSFRVTSSDGRTVTSNAAAPA  238

Query  830  SWQYGQTFEG  859
             WQ+GQTFEG
Sbjct  239  GWQFGQTFEG  248



>gb|AEQ55276.1| expansin [Breonia chinensis]
 gb|AEQ55291.1| expansin [Breonia chinensis]
Length=240

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 148/220 (67%), Gaps = 9/220 (4%)
 Frame = +2

Query  212  GWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCV  382
            GW  AHATFYG     GT+GGACG  N     Y   TTALS ALF N  SCG+CY + C 
Sbjct  24   GWITAHATFYGGGDASGTMGGACGYGNLYSQGYGTATTALSTALFNNGLSCGSCYQIVCA  83

Query  383  NNTGQCKTQNPIIVTATDLCPTGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKV  562
            N+   C  +  I+VTAT+ CP   G WC PP  HFDLS PA+L+I +Y+AG + V Y +V
Sbjct  84   NDPRWC-LRGSIVVTATNFCP--PGGWCDPPNHHFDLSEPAFLRIAQYRAGIVSVLYRRV  140

Query  563  PCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWET  742
            PC R+GG RFTI GH YFNLV V+NVGG+GDV  V ++ +     +W  + RNWG+ W++
Sbjct  141  PCRRRGGIRFTINGHSYFNLVLVTNVGGAGDVQAVYIKGS---RTRWQQMSRNWGQNWQS  197

Query  743  NAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGK  862
            N+ L+G++L FKVTT DG++V S  VAP SW +GQT+ G+
Sbjct  198  NSYLNGQSLSFKVTTSDGRSVVSYNVAPPSWSFGQTYSGR  237



>gb|AEQ55274.1| expansin [Breonia chinensis]
 gb|AEQ55289.1| expansin [Breonia chinensis]
Length=256

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/260 (46%), Positives = 162/260 (62%), Gaps = 15/260 (6%)
 Frame = +2

Query  122  ITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QK  292
            +   + T + +   L+    +P V+  G+  W  AHATFYG  +  GT+GGACG  N   
Sbjct  1    MAIVVLTCIASVLALVAEARIPGVYTGGS--WQSAHATFYGGSDASGTMGGACGYGNLYS  58

Query  293  DTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TG  451
              Y   T ALS ALF +  SCGAC+ L+C N+ G C   +P I +TAT+ CP        
Sbjct  59   QGYGVNTGALSTALFNSGLSCGACFELKCANDPGWCHPGSPSIFITATNFCPPNYALPND  118

Query  452  DGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtv  631
            +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV V
Sbjct  119  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVNYRRVPCRKQGGIRFTINGFRYFNLVLV  178

Query  632  snvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTS  811
            +NV G+GD+ +V V+ +  G   W+ + RNWG+ W+TN+ L G++L F+VT  D ++ TS
Sbjct  179  TNVAGAGDIVRVFVKGSRTG---WISMSRNWGQNWQTNSVLVGQSLSFRVTASDRRSSTS  235

Query  812  RKVAPKSWQYGQTFEGKNSR  871
              + P  WQ+GQTF GKN R
Sbjct  236  WNMVPAHWQFGQTFVGKNFR  255



>ref|XP_002319704.2| expansin S1 precursor family protein [Populus trichocarpa]
 gb|EEE95627.2| expansin S1 precursor family protein [Populus trichocarpa]
Length=242

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 152/237 (64%), Gaps = 9/237 (4%)
 Frame = +2

Query  161  LLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSAA  331
            L++ L     V G G  GWS AHATFYG     GT+GGACG  N     Y   T ALS A
Sbjct  8    LVVFLTMSKTVHGYG-GGWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTA  66

Query  332  LFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP-TGDGKWCTPPRAHFDLSMPAY  508
            LFKN  +CGAC+ L+CVN+   C +   IIVTAT+ CP    G WC PP  HFDLS P +
Sbjct  67   LFKNGLTCGACFELKCVNDARWCLS-GSIIVTATNFCPPNSAGGWCNPPSQHFDLSQPVF  125

Query  509  LKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNAD  688
              +  YKAG + V Y +V C + GG RFTI GH YFNLV ++NVGG+GDV  V ++ +  
Sbjct  126  QHLARYKAGIVPVLYRRVACRKTGGIRFTINGHSYFNLVLITNVGGAGDVVSVSIKGSRT  185

Query  689  GEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            G   W P+ RNWG+ W++N+ L+G+AL FKVTT DG+++ S  VAP +W +GQTF G
Sbjct  186  G---WQPMSRNWGQNWQSNSYLNGQALSFKVTTSDGRSIISSNVAPPNWAFGQTFHG  239



>emb|CDP06606.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 157/247 (64%), Gaps = 15/247 (6%)
 Frame = +2

Query  161  LLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAA  331
            L +V   LP  +  G   W  AHATFYG  +  GT+GGACG  N     Y   T ALS A
Sbjct  16   LTVVNARLPGAYSGGP--WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTA  73

Query  332  LFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTPPRAHFD  490
            LF +  SCGAC+ L+C ++   C   +P I +TAT+ CP        +G WC PPR HFD
Sbjct  74   LFNDGLSCGACFELKCADDPKWCLPGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFD  133

Query  491  LSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvd  670
            L+MP +LKI +Y+AG + V + +VPC ++GG RFT+ G  YFNLV ++NV G+G+V +  
Sbjct  134  LAMPMFLKIAQYRAGIVPVNFRRVPCRKRGGIRFTVDGFRYFNLVLITNVAGAGNVMRAS  193

Query  671  vedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQT  850
            V+       +W+PL RNWG+ W++NA L+G+AL F+VTT D +  TS  VAP +WQ+GQT
Sbjct  194  VKGT---RTQWLPLSRNWGQNWQSNAQLAGQALSFRVTTSDRRTSTSWNVAPPNWQFGQT  250

Query  851  FEGKNSR  871
            F GKN R
Sbjct  251  FVGKNFR  257



>ref|XP_008240857.1| PREDICTED: expansin-A6-like [Prunus mume]
Length=258

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 159/259 (61%), Gaps = 15/259 (6%)
 Frame = +2

Query  131  AMATELQAASLLIVLCALPCVFGDGNSG--WSEAHATFYGPPE--GTVGGACGLQN-QKD  295
            A    L  ASLL +  A        ++G  W  AHATFYG  +  GT+GGACG  N   +
Sbjct  2    AFVHMLCIASLLSLFMAANARIRGFDTGGPWEGAHATFYGGSDASGTMGGACGYGNLYSE  61

Query  296  TYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGD  454
             Y   T ALS ALF N  SCGAC+ ++C ++   C   NP I +TAT+ CP        D
Sbjct  62   GYGVNTAALSTALFNNGLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNYALPNDD  121

Query  455  GKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvs  634
            G WC PPR HFDL+MP +L+I EYKAG + V + +VPC ++GG RFTI G  YFNLV ++
Sbjct  122  GGWCNPPRTHFDLAMPMFLQIAEYKAGIVPVSFRRVPCRKEGGVRFTINGFRYFNLVLIT  181

Query  635  nvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSR  814
            NV G+GD+ +V V+       +W+P+ RNWG+ W++NA L G+ L F+VT  D +  TS 
Sbjct  182  NVAGAGDIVRVSVK---GANTEWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSW  238

Query  815  KVAPKSWQYGQTFEGKNSR  871
             VAP  WQ+GQTF GKN R
Sbjct  239  NVAPGHWQFGQTFSGKNFR  257



>ref|NP_181300.1| expansin-A3 [Arabidopsis thaliana]
 ref|XP_004253297.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
 sp|O80932.1|EXPA3_ARATH RecName: Full=Expansin-A3; Short=AtEXPA3; AltName: Full=Alpha-expansin-3; 
Short=At-EXP3; Short=AtEx3; AltName: Full=Ath-ExpAlpha-1.9; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC23634.1| putative expansin [Arabidopsis thaliana]
 gb|AAL91271.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AAM67431.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AEC09429.1| expansin-A3 [Arabidopsis thaliana]
Length=262

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 123/253 (49%), Positives = 162/253 (64%), Gaps = 16/253 (6%)
 Frame = +2

Query  146  LQAASLLIVLCA-LPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYT  313
            + A+ LL    A +P V+  G   W  AHATFYG  +  GT+GGACG  N     Y   T
Sbjct  14   VTASFLLTATNAKIPGVYSGGP--WQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNT  71

Query  314  TALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTP  472
             ALS ALF N  SCGAC+ ++C ++   C   NP I+VTAT+ CP      + DG WC P
Sbjct  72   AALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNP  131

Query  473  PRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsg  652
            PR HFDL+MP +LKIG Y+AG + V Y +VPC + GG RFT+ G  YFNLV V+NV G+G
Sbjct  132  PREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAG  191

Query  653  dvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKS  832
            D++ V V+ +   +  WV + RNWG+ W++NA L G++L F+VT  D ++ TS  VAP +
Sbjct  192  DINGVSVKGS---KTDWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAPAT  248

Query  833  WQYGQTFEGKNSR  871
            WQ+GQTF GKN R
Sbjct  249  WQFGQTFSGKNFR  261



>ref|XP_010111142.1| hypothetical protein L484_010756 [Morus notabilis]
 gb|EXC30507.1| hypothetical protein L484_010756 [Morus notabilis]
Length=258

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 162/256 (63%), Gaps = 21/256 (8%)
 Frame = +2

Query  158  SLLIVLCALPCV-FGD----GNSG---WSEAHATFYGPPE--GTVGGACGLQN-QKDTYA  304
            S +I+L  + C  F D    GN G   W  AHATFYG  +  GT+GGACG  N     Y 
Sbjct  5    SFIILLSLIACAAFVDAKIPGNYGGGSWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  64

Query  305  PYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKW  463
              T ALS ALF N  SCGAC+ ++C N+   C + +P I+VTAT+ CP        +G W
Sbjct  65   VNTAALSTALFNNGLSCGACFEIKCANDPQWCHSGSPSILVTATNFCPPNYALPNDNGGW  124

Query  464  CTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvg  643
            C PPR+HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G +YFNLV ++NV 
Sbjct  125  CNPPRSHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGVRFTINGFKYFNLVLITNVA  184

Query  644  gsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVA  823
            G+GD+ +  V+ +  G   W+ + RNWG+ W++N+ L G++L F++T  D +  T+  + 
Sbjct  185  GAGDIVRASVKGSKTG---WMSMSRNWGQNWQSNSVLVGQSLSFRITGSDRRTSTAWNIV  241

Query  824  PKSWQYGQTFEGKNSR  871
            P  WQ+GQTF GKN R
Sbjct  242  PSHWQFGQTFTGKNFR  257



>ref|XP_010106493.1| hypothetical protein L484_025251 [Morus notabilis]
 gb|EXC10669.1| hypothetical protein L484_025251 [Morus notabilis]
Length=258

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/253 (47%), Positives = 161/253 (64%), Gaps = 19/253 (8%)
 Frame = +2

Query  155  ASLLIVL----CALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYT  313
            ASLL ++      +P V+  G+  W  AHATFYG  +  GT+GGACG  N     Y   T
Sbjct  10   ASLLSLMWMAEARIPGVYTGGS--WETAHATFYGGSDASGTMGGACGYGNLYSQGYGVST  67

Query  314  TALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------TGDGKWCTP  472
             ALS ALF N  SCGAC+ ++C N+   C + +P I++TAT+ CP        +G WC P
Sbjct  68   AALSTALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNYALPNDNGGWCNP  127

Query  473  PRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsg  652
            PR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YFNLV +SNV G+G
Sbjct  128  PRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAG  187

Query  653  dvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKS  832
            D+ +  V+ +  G   W+ + RNWG+ W++NA L G++L F+VT  D +  TS  + P +
Sbjct  188  DIVRTSVKGSKTG---WMLMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAN  244

Query  833  WQYGQTFEGKNSR  871
            WQ+GQTF GKN R
Sbjct  245  WQFGQTFTGKNFR  257



>ref|XP_003518007.1| PREDICTED: expansin-A1-like [Glycine max]
 gb|KHN01248.1| Expansin-A1 [Glycine soja]
Length=250

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 147/228 (64%), Gaps = 13/228 (6%)
 Frame = +2

Query  215  WSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCVN  385
            W  AHATFYG  +  GT+GGACG  N     Y   T ALS ALF N  SCG+CY +RCVN
Sbjct  27   WVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIRCVN  86

Query  386  NTGQCKTQNPIIVTATDLCPTGD------GKWCTPPRAHFDLSMPAYLKIGEYKAGFIHV  547
            +   C     I+VTAT+ CP  +      G WC PP  HFDLS P +L+I +Y+AG + V
Sbjct  87   DHRWC-LPGSIMVTATNFCPPNNALPNNAGGWCNPPMHHFDLSQPVFLRIAQYRAGIVPV  145

Query  548  QYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWG  727
             Y +VPC R+GG RFTI GH YFNLV ++NVGG+GDV  V ++ +  G   W+P+ RNWG
Sbjct  146  SYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHGVAIKGSRTG---WMPMSRNWG  202

Query  728  EKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEGKNSR  871
            + W++N  L+G++L FKVTT DG+ V S  VAP  W +GQT+ G   R
Sbjct  203  QNWQSNNYLNGQSLSFKVTTSDGRTVVSYNVAPAGWSFGQTYTGAQFR  250



>ref|XP_002881024.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57283.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/261 (46%), Positives = 162/261 (62%), Gaps = 20/261 (8%)
 Frame = +2

Query  134  MATELQAASLLIVLCAL-----PCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQNQ-  289
            MA      S+L  + AL     P V+  G  GW  AHATFYG  +  GT+GGACG  N  
Sbjct  1    MAMLGLVLSVLTTILALSEARIPGVYNGG--GWETAHATFYGGSDASGTMGGACGYGNLY  58

Query  290  KDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP------T  448
               Y   T ALS ALF N  SCGAC+ L+C ++   C + +P I +TAT+ CP      +
Sbjct  59   SQGYGVNTAALSTALFNNGFSCGACFELKCASDPRWCHSGSPSIFITATNFCPPNFAQPS  118

Query  449  GDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvt  628
             +G WC PPR HFDL+MP +LKI EY+AG + V + +VPC ++GG RFTI G  YFNLV 
Sbjct  119  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGIRFTINGFRYFNLVL  178

Query  629  vsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVT  808
            V+NV G G++ ++ V+        W+ + RNWG+ W++N+ L G++L F+VT  D ++ T
Sbjct  179  VTNVAGVGNIVRLGVKGT---HTSWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRSST  235

Query  809  SRKVAPKSWQYGQTFEGKNSR  871
            S  +AP +WQ+GQTF GKN R
Sbjct  236  SWNIAPANWQFGQTFMGKNFR  256



>gb|AAC96081.1| alpha-expansin precursor [Nicotiana tabacum]
Length=249

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/225 (53%), Positives = 147/225 (65%), Gaps = 13/225 (6%)
 Frame = +2

Query  212  GWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSAALFKNAESCGACYALRCV  382
            GW  AHATFYG     GT+GGACG  N     Y   T ALS ALF N  +CGACY L C 
Sbjct  26   GWQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYELTC-  84

Query  383  NNTGQCKTQNPIIVTATDLCPTGD------GKWCTPPRAHFDLSMPAYLKIGEYKAGFIH  544
            NN GQ   Q  IIVTAT+ CP         G WC PP  HFDL+ PA+L+I +Y+AG + 
Sbjct  85   NNDGQSCLQGSIIVTATNFCPPNPSLPNNNGGWCNPPLQHFDLAQPAFLQIAKYRAGIVP  144

Query  545  VQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNW  724
            V + +VPC RKGG RFTI GH +FNLV V+NVGG+GDV  V ++ +  G   W  + RNW
Sbjct  145  VSFRRVPCRRKGGVRFTINGHSFFNLVLVTNVGGAGDVQSVSIKGSNTG---WQTMSRNW  201

Query  725  GEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTFEG  859
            G+ W+ NA L+G++L F+VTT DG+ +TS   AP +WQ+GQTFEG
Sbjct  202  GQNWQNNANLNGQSLSFQVTTSDGRTLTSNNAAPANWQFGQTFEG  246



>gb|ABR17119.1| unknown [Picea sitchensis]
Length=253

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 160/251 (64%), Gaps = 15/251 (6%)
 Frame = +2

Query  134  MATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYA  304
            +   +  ASLL ++  +    G G+  W  AHATFYG  +  GT+GGACG  N     Y 
Sbjct  6    LVKSIALASLLTIIWLITGAHGYGD--WESAHATFYGGSDASGTMGGACGYGNLYSQGYG  63

Query  305  PYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWC  466
              T ALS ALF +  SCGACY ++C N+  Q      I+VTAT+ CP        DG WC
Sbjct  64   TNTAALSTALFNDGLSCGACYEMQC-NDDPQWCLPGTIMVTATNFCPPNNALPNNDGGWC  122

Query  467  TPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvgg  646
             PP  HFD++ P+YLKI +Y++G + + Y +VPC RKGG RFT+ GH YFNLV ++NVGG
Sbjct  123  NPPLQHFDMAEPSYLKIAKYRSGIVPILYRRVPCLRKGGIRFTVNGHSYFNLVLITNVGG  182

Query  647  sgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAP  826
            +GDV  V ++ +  G   W P+ RNWG+ W++N+ L+G++L F+VTT DG+ V S   AP
Sbjct  183  AGDVHAVSIKGSRTG---WQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVVSYNAAP  239

Query  827  KSWQYGQTFEG  859
             +WQ+GQTFEG
Sbjct  240  SNWQFGQTFEG  250



>ref|XP_010470942.1| PREDICTED: expansin-A1-like [Camelina sativa]
Length=251

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/255 (47%), Positives = 153/255 (60%), Gaps = 13/255 (5%)
 Frame = +2

Query  134  MATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYA  304
            MA  +    + I+     CV G    GW  AHATFYG     GT+GGACG  N     Y 
Sbjct  1    MALVVAFLFMAILGVMTSCVNGYAGGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYG  60

Query  305  PYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTGD------GKWC  466
              T ALS ALF N  SCGAC+ LRC N+   C     I+VTAT+ CP  +      G WC
Sbjct  61   TNTAALSTALFNNGLSCGACFELRCQNDGKWC-LPGSIVVTATNFCPPNNALPNNAGGWC  119

Query  467  TPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvgg  646
             PP+ HFDLS P + +I +Y+AG + V Y +VPC R+GG RFTI GH YFNLV ++NVGG
Sbjct  120  NPPQQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVGG  179

Query  647  sgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAP  826
            +GDV  V V+ +  G   W  + RNWG+ W++N+ L+G+AL FK+TT DG+ + S   AP
Sbjct  180  AGDVHSVMVKGSRTG---WQAMSRNWGQNWQSNSYLNGQALSFKITTSDGRTIISNNAAP  236

Query  827  KSWQYGQTFEGKNSR  871
              W +GQTF G   R
Sbjct  237  AGWSFGQTFTGAQLR  251



>gb|AFK34543.1| unknown [Medicago truncatula]
Length=248

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/244 (48%), Positives = 154/244 (63%), Gaps = 17/244 (7%)
 Frame = +2

Query  164  LIVLCAL---PCVFGDGNSGWSEAHATFYGPPE--GTVGGACGLQN-QKDTYAPYTTALS  325
            L+++C+L     V+  G  GW+ AHATFYG  +  GT+GGACG  N     Y   T ALS
Sbjct  6    LVLVCSLTMFSSVYAYG-GGWTNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALS  64

Query  326  AALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKWCTPPRAHF  487
             ALF N  SCG+CY +RC N+   C     I+VTAT+ CP        DG WC PP  HF
Sbjct  65   TALFNNGLSCGSCYEIRCANDHRWC-LPGSIVVTATNFCPPNNALPNNDGGWCNPPLQHF  123

Query  488  DLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskv  667
            DL+ P +L+I +YKAG + V + +V C RKGG RFTI GH YFNLV ++NVGG+GDV   
Sbjct  124  DLAQPVFLRIAQYKAGIVPVDFRRVSCRRKGGIRFTINGHSYFNLVLITNVGGAGDVHAA  183

Query  668  dvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQ  847
             ++ +  G   W+ + RNWG+ W++N  L+G++L FKVTT DG+ V S  VAP  W +GQ
Sbjct  184  SIKGSKTG---WISMSRNWGQNWQSNNYLNGQSLSFKVTTSDGRTVVSNNVAPAGWSFGQ  240

Query  848  TFEG  859
            T+ G
Sbjct  241  TYTG  244



>gb|ADC35364.1| alpha-expansin 1 [Coffea arabica]
Length=257

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/242 (48%), Positives = 156/242 (64%), Gaps = 14/242 (6%)
 Frame = +2

Query  161  LLIVLCALPCVFGDGNSGWSEAHATFYG--PPEGTVGGACGLQN-QKDTYAPYTTALSAA  331
            +++    +P  FGD   GW  AHATFYG     GT+GGACG  N     Y   T ALS A
Sbjct  18   VVVTSMCIPTAFGD-YGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTDTAALSTA  76

Query  332  LFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCPTG------DGKWCTPPRAHFDL  493
            LF N  +CG+CY +RC ++   C     I VTAT+ CP        +G WC PPR HFDL
Sbjct  77   LFNNGLACGSCYEIRCDSDPEAC-LPGTITVTATNFCPANPALPNDNGGWCNPPRQHFDL  135

Query  494  SMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvggsgdvskvdv  673
            + PA+L+I +Y+AG + V + +VPCS+KGG R+TI GH YFNLV V+NV G+GDV  V +
Sbjct  136  AEPAFLQIAQYRAGIVPVAFQRVPCSKKGGVRYTINGHSYFNLVLVTNVAGAGDVHTVAI  195

Query  674  edNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVAPKSWQYGQTF  853
            + +  G   W  + RNWG+ W++N+ L+G+ L F++TT DG+ +TS  VAP +WQ+GQTF
Sbjct  196  KGSRTG---WQSMSRNWGQNWQSNSYLNGQTLSFQITTSDGRTLTSYNVAPANWQFGQTF  252

Query  854  EG  859
            EG
Sbjct  253  EG  254



>gb|ADY68818.1| expansin [Gossypium hirsutum]
Length=259

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 163/265 (62%), Gaps = 23/265 (9%)
 Frame = +2

Query  107  LSVLIITAAMATELQAASLLIVLCALPCVFGDGNSGWSEAHATFYGPPE--GTVGGACGL  280
            +SVLI  ++M    +A         +P V+  G   W  AHATFYG  +  GT+GGACG 
Sbjct  7    ISVLIFISSMWMMGEAR--------IPGVYSGG--AWQNAHATFYGGADASGTMGGACGY  56

Query  281  QN-QKDTYAPYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNP-IIVTATDLCP---  445
             N     Y   T ALS ALF N  SCGAC+ ++C ++   C + +P I +TAT+ CP   
Sbjct  57   GNLYGQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNY  116

Query  446  ---TGDGKWCTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYF  616
                 +G WC PPR HFDL+MP +LKI EY+AG + V Y +VPC ++GG RFTI G  YF
Sbjct  117  ALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYF  176

Query  617  NLvtvsnvggsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDG  796
            NLV +SNV G+GD+ KV V+ +  G   W+ + RNWG+ W++NA L G++L F+VT  D 
Sbjct  177  NLVLISNVAGAGDIVKVSVKGSRTG---WMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDR  233

Query  797  KAVTSRKVAPKSWQYGQTFEGKNSR  871
            +  TS  + P  WQ+GQTF GKN R
Sbjct  234  RTSTSWNIVPAHWQFGQTFTGKNFR  258



>gb|AAW88315.1| expansin EXPA11 [Triticum aestivum]
Length=251

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 150/252 (60%), Gaps = 18/252 (7%)
 Frame = +2

Query  146  LQAASLLIVLCALPCVFG-----DGNSGWSEAHATFYG--PPEGTVGGACGLQNQKDT-Y  301
            + AA  L  L +  C+        G  GW  AHATFYG     GT+GGACG  N   T Y
Sbjct  1    MAAAGALFFLFSSFCLLARQAAAGGYGGWQSAHATFYGGGDASGTMGGACGYGNLYSTGY  60

Query  302  APYTTALSAALFKNAESCGACYALRCVNNTGQCKTQNPIIVTATDLCP------TGDGKW  463
               T ALS ALF +  +CG+CY LRC N    C+    I+VTAT+ CP      + DG W
Sbjct  61   GTNTAALSTALFNDGAACGSCYELRCDNAGSSCR-PGSILVTATNFCPPNYGLPSDDGGW  119

Query  464  CTPPRAHFDLSMPAYLKIGEYKAGFIHVQYSKVPCSRKGGERFTIAGHEYFNLvtvsnvg  643
            C PPR HFD++ PA+L I +Y+AG + V Y +VPC +KGG RFTI GH YFNLV V+NV 
Sbjct  120  CNPPRPHFDMAEPAFLHIAQYRAGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVA  179

Query  644  gsgdvskvdvedNADGEKKWVPLKRNWGEKWETNAPLSGKALDFKVTTQDGKAVTSRKVA  823
            G+GD   V ++    G   W  + RNWG  W++N  L G+ L F+VT+ DG+ VTS   A
Sbjct  180  GAGDARSVSIKGTRTG---WQAMSRNWGMNWQSNTFLDGQCLSFRVTSSDGRTVTSNAAA  236

Query  824  PKSWQYGQTFEG  859
            P  W +GQTFEG
Sbjct  237  PAGWHFGQTFEG  248



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3177808337144