BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19820_g2_i1 len=1807 path=[1:0-939 941:940-963 965:964-1342
1344:1343-1386 6196:1387-1474 1476:1475-1500 6418:1501-1806]

Length=1807
                                                                      Score     E

ref|XP_006355931.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    662   0.0      
ref|XP_009613546.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    659   0.0      
ref|XP_009784160.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    658   0.0      
ref|XP_004238716.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    657   0.0      
ref|XP_002269424.2|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    635   0.0      Vitis vinifera
ref|XP_006438487.1|  hypothetical protein CICLE_v10031540mg             631   0.0      
ref|XP_006483777.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    627   0.0      
emb|CDP00215.1|  unnamed protein product                                626   0.0      
gb|KDO82610.1|  hypothetical protein CISIN_1g013395mg                   626   0.0      
gb|KDP21295.1|  hypothetical protein JCGZ_21766                         618   0.0      
ref|XP_002266978.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    619   0.0      Vitis vinifera
ref|XP_006378179.1|  hypothetical protein POPTR_0010s04530g             617   0.0      
ref|XP_009351298.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    616   0.0      
ref|XP_011009011.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    615   0.0      
ref|XP_010044662.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    609   0.0      
ref|XP_007223059.1|  hypothetical protein PRUPE_ppa006982mg             606   0.0      
ref|XP_002520216.1|  IAA-amino acid hydrolase ILR1 precursor, put...    605   0.0      Ricinus communis
emb|CBI32084.3|  unnamed protein product                                618   0.0      
ref|XP_004297670.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    603   0.0      
ref|XP_008389584.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    599   0.0      
ref|XP_009360455.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    597   0.0      
ref|XP_010100519.1|  IAA-amino acid hydrolase ILR1-like 2               592   0.0      
gb|KCW86759.1|  hypothetical protein EUGRSUZ_B03368                     590   0.0      
ref|XP_004155341.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    586   0.0      
ref|XP_003532037.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    586   0.0      
ref|XP_004135471.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    587   0.0      
ref|XP_008446258.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    587   0.0      
ref|XP_011071286.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    591   0.0      
ref|XP_006602366.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    580   0.0      
ref|XP_010272050.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    578   0.0      
ref|XP_010254871.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    576   0.0      
ref|XP_008353108.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    566   0.0      
ref|XP_011087079.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    568   0.0      
ref|XP_007153678.1|  hypothetical protein PHAVU_003G055600g             566   0.0      
gb|KHN10633.1|  IAA-amino acid hydrolase ILR1-like 4                    564   0.0      
ref|XP_003628629.1|  IAA-amino acid hydrolase ILR1-like protein         562   0.0      
ref|XP_010928552.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    558   0.0      
ref|XP_004509886.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    553   0.0      
ref|XP_004509887.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    548   0.0      
ref|XP_008244971.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    548   0.0      
gb|AET03754.2|  IAA-amino acid hydrolase ILR1-like protein              533   0.0      
ref|XP_003629278.1|  IAA-amino acid hydrolase ILR1-like protein         533   0.0      
gb|AFK39723.1|  unknown                                                 505   2e-171   
gb|ABR17898.1|  unknown                                                 504   9e-170   Picea sitchensis
ref|XP_009417547.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    503   1e-169   
ref|XP_002303219.1|  putative auxin-amidohydrolase precursor fami...    501   5e-169   Populus trichocarpa [western balsam poplar]
gb|ABK24715.1|  unknown                                                 501   1e-168   Picea sitchensis
gb|ACZ56438.1|  IAA-amino acid hydrolase                                499   3e-168   
emb|CAG32961.1|  putative auxin-amidohydrolase precursor                497   1e-167   Populus tremula x Populus alba [gray poplar]
ref|XP_008447583.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    497   1e-167   
ref|XP_011013030.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    496   2e-167   
ref|XP_004146834.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    495   8e-167   
gb|KHG30726.1|  IAA-amino acid hydrolase ILR1-like 4                    494   2e-166   
gb|ACZ56435.1|  IAA-amino acid hydrolase                                493   6e-166   
ref|XP_006438486.1|  hypothetical protein CICLE_v10031540mg             486   3e-165   
ref|XP_002302231.2|  hypothetical protein POPTR_0002s08300g             492   4e-165   Populus trichocarpa [western balsam poplar]
ref|XP_007019095.1|  IAA-leucine resistant-like gene 6 isoform 1        491   1e-164   
ref|XP_009786385.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    489   1e-164   
ref|XP_003526641.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    489   3e-164   
ref|XP_006351275.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    490   3e-164   
ref|XP_011027512.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    489   4e-164   
ref|XP_010243489.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    489   5e-164   
ref|XP_009762344.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    489   7e-164   
ref|XP_006838393.1|  hypothetical protein AMTR_s00002p00075740          487   2e-163   
gb|AFR58665.1|  jasmonoyl-L-isoleucine hydrolase 1                      486   2e-163   
gb|KDO82611.1|  hypothetical protein CISIN_1g013395mg                   481   2e-163   
ref|XP_009391385.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    487   4e-163   
ref|XP_006426465.1|  hypothetical protein CICLE_v10025591mg             485   9e-163   
ref|XP_009592954.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    486   9e-163   
ref|XP_006853919.1|  hypothetical protein AMTR_s00036p00189900          485   1e-162   
gb|KDO58672.1|  hypothetical protein CISIN_1g013076mg                   484   1e-162   
ref|XP_003523432.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    485   2e-162   
ref|XP_009630468.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    483   4e-162   
ref|XP_011011908.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    485   4e-162   
gb|KHN35503.1|  IAA-amino acid hydrolase ILR1-like 6                    481   4e-162   
sp|Q84XG9.1|ILL1_ORYSI  RecName: Full=IAA-amino acid hydrolase IL...    483   6e-162   Oryza sativa Indica Group [Indian rice]
ref|XP_010999399.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    484   6e-162   
ref|NP_001043347.1|  Os01g0560000                                       483   7e-162   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004249219.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    483   2e-161   
ref|XP_010924947.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    481   2e-161   
ref|XP_010268965.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    483   2e-161   
ref|XP_006466100.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    481   2e-161   
ref|XP_010268967.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    481   5e-161   
ref|XP_007024408.1|  Peptidase M20/M25/M40 family protein               480   6e-161   
ref|XP_004235624.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    479   1e-160   
ref|XP_003543612.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    479   1e-160   
ref|XP_002515893.1|  IAA-amino acid hydrolase ILR1 precursor, put...    479   1e-160   Ricinus communis
ref|XP_004502492.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    481   1e-160   
emb|CDO97948.1|  unnamed protein product                                477   2e-160   
gb|EMT10443.1|  IAA-amino acid hydrolase ILR1-like protein 1            478   2e-160   
ref|XP_009396760.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    478   3e-160   
ref|XP_009414063.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    479   3e-160   
ref|XP_003602066.1|  IAA-amino acid hydrolase ILR1-like protein         479   4e-160   
gb|KDP40816.1|  hypothetical protein JCGZ_24815                         478   6e-160   
ref|XP_006343020.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    478   6e-160   
ref|XP_010231929.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    478   7e-160   
ref|XP_009794201.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    477   8e-160   
ref|XP_006434209.1|  hypothetical protein CICLE_v10000964mg             479   9e-160   
ref|XP_004158429.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    477   9e-160   
dbj|BAJ94305.1|  predicted protein                                      477   1e-159   
ref|XP_006472793.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    478   1e-159   
ref|XP_004297620.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    477   1e-159   
gb|AAU06081.1|  auxin amidohydrolase                                    476   2e-159   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006438485.1|  hypothetical protein CICLE_v10031540mg             472   2e-159   
ref|XP_004135685.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    476   2e-159   
ref|XP_010062569.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    476   2e-159   
ref|XP_010244354.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    476   2e-159   
ref|XP_008806725.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    476   2e-159   
gb|KDO80612.1|  hypothetical protein CISIN_1g011407mg                   478   3e-159   
ref|XP_010906094.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    478   3e-159   
ref|XP_004149796.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    477   3e-159   
ref|XP_007135595.1|  hypothetical protein PHAVU_010G142600g             475   4e-159   
emb|CDM83125.1|  unnamed protein product                                475   4e-159   
gb|KDP33760.1|  hypothetical protein JCGZ_07331                         475   5e-159   
ref|XP_011077949.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    475   7e-159   
ref|XP_006646005.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    475   1e-158   
ref|XP_006353512.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    474   1e-158   
ref|XP_007012935.1|  Peptidase M20/M25/M40 family protein isoform 1     474   2e-158   
ref|XP_010536843.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    474   2e-158   
ref|XP_002281321.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    473   2e-158   Vitis vinifera
ref|XP_008466723.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    474   3e-158   
ref|XP_003546640.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    473   3e-158   
ref|XP_002284503.2|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    475   4e-158   Vitis vinifera
emb|CBI19006.3|  unnamed protein product                                474   5e-158   
ref|XP_002283047.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    472   6e-158   Vitis vinifera
ref|XP_008450808.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    472   7e-158   
ref|XP_010911155.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    472   7e-158   
ref|XP_004251653.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    472   7e-158   
ref|XP_002306640.1|  hypothetical protein POPTR_0005s20110g             474   7e-158   Populus trichocarpa [western balsam poplar]
gb|ABB16358.1|  IAA hydrolase                                           472   8e-158   Phalaenopsis hybrid cultivar
emb|CAN70580.1|  hypothetical protein VITISV_033718                     472   1e-157   Vitis vinifera
ref|XP_009624362.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    472   1e-157   
gb|KGN47720.1|  hypothetical protein Csa_6G384060                       476   1e-157   
emb|CAN61999.1|  hypothetical protein VITISV_007874                     470   2e-157   Vitis vinifera
ref|XP_010500762.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    471   3e-157   
ref|XP_010104509.1|  IAA-amino acid hydrolase ILR1-like 6               472   3e-157   
ref|XP_002891660.1|  IAA-alanine resistant 3                            470   3e-157   
gb|EYU30670.1|  hypothetical protein MIMGU_mgv1a006375mg                470   6e-157   
ref|XP_008797894.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    469   6e-157   
ref|XP_002513747.1|  IAA-amino acid hydrolase ILR1 precursor, put...    471   7e-157   Ricinus communis
ref|XP_007012939.1|  Peptidase M20/M25/M40 family protein isoform 5     469   9e-157   
ref|XP_008244751.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    469   1e-156   
ref|XP_011077948.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    469   1e-156   
ref|XP_011072466.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    469   1e-156   
ref|XP_002275866.2|  PREDICTED: IAA-amino acid hydrolase ILR1-like      468   2e-156   Vitis vinifera
ref|XP_003531633.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    468   2e-156   
ref|XP_007215385.1|  hypothetical protein PRUPE_ppa005752mg             468   5e-156   
ref|XP_010462018.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    467   6e-156   
ref|XP_010535205.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    467   1e-155   
ref|XP_010690089.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    467   1e-155   
ref|XP_004968975.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    466   2e-155   
ref|XP_008219626.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    467   2e-155   
emb|CDM83724.1|  unnamed protein product                                465   4e-155   
ref|XP_010479682.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    465   5e-155   
ref|XP_010063397.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    466   7e-155   
ref|XP_008242448.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    464   9e-155   
ref|XP_006307542.1|  hypothetical protein CARUB_v10009165mg             464   1e-154   
ref|NP_175587.1|  IAA-amino acid hydrolase IAR3                         464   1e-154   Arabidopsis thaliana [mouse-ear cress]
emb|CDY22869.1|  BnaA06g02080D                                          464   2e-154   
ref|XP_010246176.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    463   2e-154   
ref|NP_001142151.1|  hypothetical protein precursor                     464   2e-154   Zea mays [maize]
ref|XP_007202052.1|  hypothetical protein PRUPE_ppa005751mg             463   3e-154   
ref|XP_008378480.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    464   6e-154   
ref|XP_009147731.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    462   1e-153   
ref|XP_004287508.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    462   1e-153   
ref|XP_011043650.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    461   1e-153   
gb|KDO55917.1|  hypothetical protein CISIN_1g013332mg                   461   2e-153   
ref|XP_006392998.1|  hypothetical protein EUTSA_v10011481mg             461   2e-153   
ref|XP_008243485.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    460   3e-153   
ref|XP_003597644.1|  IAA-amino acid hydrolase ILR1-like protein         461   3e-153   
emb|CDX87841.1|  BnaC06g09030D                                          460   5e-153   
ref|XP_009338136.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    461   6e-153   
ref|XP_007204388.1|  hypothetical protein PRUPE_ppa005836mg             459   7e-153   
ref|XP_002322806.1|  hypothetical protein POPTR_0016s07500g             461   9e-153   Populus trichocarpa [western balsam poplar]
gb|ACZ56437.1|  IAA-amino acid hydrolase                                458   1e-152   
ref|XP_006451368.1|  hypothetical protein CICLE_v100084061mg            458   1e-152   
gb|KFK27232.1|  hypothetical protein AALP_AA8G354700                    458   2e-152   
ref|XP_006475371.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    458   3e-152   
gb|KFK35825.1|  hypothetical protein AALP_AA4G042000                    456   3e-152   
emb|CDY43926.1|  BnaA05g15360D                                          457   4e-152   
gb|ABB60090.1|  IAA-amino acid hydrolase 3                              457   4e-152   Brassica rapa
ref|XP_010545642.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    457   4e-152   
ref|NP_001288913.1|  IAA-amino acid hydrolase ILR1-like 4 precursor     457   4e-152   
ref|XP_002981614.1|  hypothetical protein SELMODRAFT_421067             456   5e-152   
ref|XP_006281445.1|  hypothetical protein CARUB_v10027523mg             457   5e-152   
ref|XP_004510337.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    456   1e-151   
gb|AFK37903.1|  unknown                                                 456   1e-151   
ref|XP_004969701.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    457   1e-151   
gb|EYU21408.1|  hypothetical protein MIMGU_mgv1a006385mg                456   1e-151   
gb|KDO55915.1|  hypothetical protein CISIN_1g013332mg                   455   1e-151   
emb|CBI27959.3|  unnamed protein product                                454   1e-151   
ref|XP_004486800.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    456   2e-151   
gb|KDO55916.1|  hypothetical protein CISIN_1g013332mg                   455   3e-151   
gb|ACF84306.1|  unknown                                                 454   3e-151   Zea mays [maize]
emb|CBI30348.3|  unnamed protein product                                468   3e-151   
ref|XP_010049762.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    455   5e-151   
ref|XP_010451360.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    454   6e-151   
gb|KDO80611.1|  hypothetical protein CISIN_1g011407mg                   456   8e-151   
gb|EPS67015.1|  hypothetical protein M569_07761                         453   9e-151   
ref|XP_008655104.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    454   9e-151   
ref|XP_002963174.1|  hypothetical protein SELMODRAFT_141529             452   2e-150   
ref|XP_004955918.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    453   2e-150   
gb|KCW82520.1|  hypothetical protein EUGRSUZ_C03922                     456   2e-150   
ref|XP_003597649.1|  IAA-amino acid hydrolase ILR1-like protein         453   3e-150   
emb|CAA73905.1|  JR3 protein                                            453   3e-150   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004290879.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    454   3e-150   
ref|XP_008380826.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    453   3e-150   
gb|AES67900.2|  IAA-amino acid hydrolase ILR1-like protein              453   3e-150   
ref|XP_011094270.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    452   3e-150   
gb|ABF55219.1|  auxin conjugate hydrolase                               453   4e-150   Medicago truncatula
ref|XP_010049575.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    452   4e-150   
ref|XP_009608199.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    452   5e-150   
ref|XP_010943800.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    452   5e-150   
ref|XP_010246184.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    452   5e-150   
ref|XP_002864473.1|  hypothetical protein ARALYDRAFT_495757             452   6e-150   
ref|XP_010483143.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    452   8e-150   
ref|XP_010037299.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    451   8e-150   
ref|XP_004969012.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    452   9e-150   
gb|KHN11323.1|  IAA-amino acid hydrolase ILR1-like 4                    451   9e-150   
ref|XP_002459630.1|  hypothetical protein SORBIDRAFT_02g007730          451   1e-149   Sorghum bicolor [broomcorn]
ref|XP_008243486.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    451   1e-149   
ref|XP_009794644.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    451   2e-149   
ref|XP_009798014.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    450   2e-149   
ref|NP_001152128.1|  IAA-amino acid hydrolase ILR1-like 4 precursor     450   3e-149   Zea mays [maize]
ref|XP_004136498.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    450   3e-149   
ref|XP_002458379.1|  hypothetical protein SORBIDRAFT_03g032500          450   3e-149   Sorghum bicolor [broomcorn]
gb|EYU22976.1|  hypothetical protein MIMGU_mgv1a005140mg                452   4e-149   
ref|XP_008442881.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    449   4e-149   
ref|XP_003567041.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    449   5e-149   
ref|XP_002281507.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      449   5e-149   Vitis vinifera
ref|XP_006392997.1|  hypothetical protein EUTSA_v10011481mg             448   6e-149   
ref|XP_002891662.1|  hypothetical protein ARALYDRAFT_892161             449   8e-149   
gb|ABF55222.1|  auxin conjugate hydrolase                               449   1e-148   Medicago truncatula
dbj|BAK01726.1|  predicted protein                                      448   1e-148   
ref|XP_009414583.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    448   1e-148   
ref|XP_010558596.1|  PREDICTED: IAA-amino acid hydrolase ILR1           448   1e-148   
ref|XP_003530010.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    448   2e-148   
ref|XP_010088385.1|  IAA-amino acid hydrolase ILR1-like 4               448   2e-148   
gb|KCW48983.1|  hypothetical protein EUGRSUZ_K02598                     447   3e-148   
ref|XP_002275838.2|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    447   3e-148   Vitis vinifera
ref|XP_008387047.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    447   3e-148   
gb|KDP37575.1|  hypothetical protein JCGZ_08266                         447   4e-148   
gb|KHN32672.1|  IAA-amino acid hydrolase ILR1-like 4                    456   5e-148   
sp|Q8H3C9.1|ILL7_ORYSJ  RecName: Full=IAA-amino acid hydrolase IL...    447   6e-148   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003597384.1|  IAA-amino acid hydrolase ILR1-like protein         447   6e-148   
gb|EYU18085.1|  hypothetical protein MIMGU_mgv1a006848mg                446   7e-148   
ref|XP_010093789.1|  IAA-amino acid hydrolase ILR1-like 7               446   7e-148   
ref|NP_001148528.1|  IAA-amino acid hydrolase ILR1 precursor            446   8e-148   Zea mays [maize]
gb|KHG25042.1|  IAA-amino acid hydrolase ILR1-like 4                    446   1e-147   
ref|XP_009798013.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    446   2e-147   
ref|NP_001159338.1|  hypothetical protein precursor                     446   2e-147   Zea mays [maize]
ref|XP_010528938.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    446   2e-147   
ref|XP_004955917.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    446   2e-147   
ref|XP_010037297.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      446   2e-147   
ref|XP_008387506.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    446   2e-147   
ref|XP_006481705.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    445   2e-147   
ref|NP_001242429.1|  uncharacterized protein LOC100790664 precursor     445   3e-147   
ref|NP_001242296.1|  uncharacterized protein LOC100789607 precursor     444   3e-147   
ref|XP_002459628.1|  hypothetical protein SORBIDRAFT_02g007710          445   3e-147   Sorghum bicolor [broomcorn]
ref|XP_006430118.1|  hypothetical protein CICLE_v10013480mg             445   3e-147   
ref|XP_004241059.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    445   3e-147   
ref|NP_001142187.1|  hypothetical protein precursor                     444   5e-147   Zea mays [maize]
ref|XP_006356685.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    444   5e-147   
ref|XP_006430119.1|  hypothetical protein CICLE_v10011738mg             444   5e-147   
gb|EPS73983.1|  hypothetical protein M569_00763                         442   6e-147   
ref|XP_010093788.1|  IAA-amino acid hydrolase                           444   6e-147   
ref|XP_007027898.1|  Iaa-amino acid hydrolase 4, putative               446   7e-147   
ref|NP_001140633.1|  hypothetical protein                               443   7e-147   Zea mays [maize]
ref|XP_007027877.1|  Peptidase M20/M25/M40 family protein isoform 1     443   9e-147   
ref|XP_004136497.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    443   1e-146   
ref|XP_011003274.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    443   1e-146   
ref|XP_002269226.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    443   1e-146   Vitis vinifera
ref|XP_010443315.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    443   2e-146   
ref|XP_010037298.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    443   2e-146   
ref|NP_001288981.1|  IAA-amino acid hydrolase ILR1-like 2 precursor     443   2e-146   
pdb|1XMB|A  Chain A, X-ray Structure Of Iaa-aminoacid Hydrolase F...    442   2e-146   
gb|KDP36173.1|  hypothetical protein JCGZ_08817                         442   2e-146   
ref|XP_002530514.1|  IAA-amino acid hydrolase ILR1 precursor, put...    442   2e-146   Ricinus communis
gb|EMT05755.1|  IAA-amino acid hydrolase ILR1-like protein 8            443   3e-146   
ref|XP_008381545.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    442   3e-146   
ref|NP_200476.1|  IAA-amino acid hydrolase ILR1-like 1                  442   3e-146   
ref|XP_003531635.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    442   3e-146   
ref|XP_009603431.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    442   3e-146   
gb|EEC71359.1|  hypothetical protein OsI_03451                          443   3e-146   
ref|XP_007202069.1|  hypothetical protein PRUPE_ppa005951mg             442   4e-146   
dbj|BAK07626.1|  predicted protein                                      442   4e-146   
ref|NP_200477.1|  IAA-amino acid hydrolase ILR1-like 2                  442   5e-146   
gb|KDO70551.1|  hypothetical protein CISIN_1g013571mg                   442   6e-146   
ref|XP_002459629.1|  hypothetical protein SORBIDRAFT_02g007720          442   6e-146   
ref|XP_003597383.1|  IAA-amino acid hydrolase ILR1-like protein         442   6e-146   
ref|XP_008243488.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      441   7e-146   
ref|XP_002308453.2|  IAA-amino acid hydrolase 1 family protein          441   7e-146   
gb|AFW67046.1|  hypothetical protein ZEAMMB73_649011                    441   7e-146   
ref|XP_009352597.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    441   1e-145   
ref|XP_009349375.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      441   1e-145   
ref|XP_004959131.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    441   1e-145   
emb|CDY32768.1|  BnaA10g10810D                                          441   1e-145   
ref|XP_010674873.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    443   1e-145   
ref|XP_009405312.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    441   1e-145   
gb|ACG28942.1|  IAA-amino acid hydrolase ILR1-like 6 precursor          442   1e-145   
gb|ABR16872.1|  unknown                                                 441   2e-145   
ref|XP_004959130.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    441   2e-145   
ref|NP_001044020.1|  Os01g0706900                                       441   2e-145   
ref|XP_008391948.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    440   2e-145   
ref|XP_006481704.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      440   2e-145   
ref|XP_002438916.1|  hypothetical protein SORBIDRAFT_10g028140          443   2e-145   
ref|XP_010037293.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    440   3e-145   
ref|XP_008680979.1|  PREDICTED: uncharacterized protein LOC100191...    441   3e-145   
ref|NP_001288853.1|  IAA-amino acid hydrolase ILR1-like 6               441   3e-145   
gb|AAC49016.1|  ILL2                                                    439   4e-145   
ref|NP_001058422.1|  Os06g0691400                                       442   4e-145   
gb|EEC81225.1|  hypothetical protein OsI_24268                          442   5e-145   
gb|EMT31861.1|  IAA-amino acid hydrolase ILR1-like protein 8            442   5e-145   
gb|AAL59907.1|  IAA-amino acid hydrolase                                439   5e-145   
ref|XP_009351899.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    439   6e-145   
ref|XP_003557336.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 7    438   7e-145   
ref|XP_011069524.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    441   8e-145   
ref|XP_008234625.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    438   9e-145   
ref|XP_010683630.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    438   1e-144   
ref|NP_175589.1|  IAA-amino acid hydrolase ILR1-like 5                  438   1e-144   
ref|XP_010034919.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    438   1e-144   
ref|XP_009414584.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    437   2e-144   
ref|XP_003597645.1|  IAA-amino acid hydrolase ILR1-like protein         438   2e-144   
ref|XP_004303517.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      437   2e-144   
gb|AFK46529.1|  unknown                                                 437   3e-144   
gb|KFK37687.1|  hypothetical protein AALP_AA3G015600                    436   3e-144   
ref|XP_006307296.1|  hypothetical protein CARUB_v10008915mg             439   4e-144   
ref|XP_004305641.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      437   4e-144   
emb|CDY32874.1|  BnaC09g33210D                                          437   5e-144   
ref|XP_004955916.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    437   5e-144   
ref|XP_006846441.1|  hypothetical protein AMTR_s00018p00068150          436   5e-144   
emb|CDY11910.1|  BnaC03g13360D                                          436   5e-144   
ref|XP_010479046.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    437   5e-144   
gb|AFW69207.1|  IAA-amino acid hydrolase ILR1-like 6                    440   6e-144   
ref|XP_010500141.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    437   6e-144   
ref|XP_002968548.1|  hypothetical protein SELMODRAFT_409459             435   6e-144   
gb|KFK28293.1|  hypothetical protein AALP_AA8G497500                    436   7e-144   
ref|XP_007217994.1|  hypothetical protein PRUPE_ppa005643mg             436   8e-144   
ref|XP_006393728.1|  hypothetical protein EUTSA_v10011458mg             437   8e-144   
ref|XP_006646253.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    436   9e-144   
ref|XP_008798874.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    436   1e-143   
ref|XP_003530016.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    436   1e-143   
ref|XP_009760823.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    436   1e-143   
ref|XP_004486799.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    436   1e-143   
gb|AAL47552.1|  IAA-amino acid conjugate hydrolase-like protein         436   1e-143   
ref|XP_006854741.1|  hypothetical protein AMTR_s00030p00245020          435   2e-143   
ref|XP_009132189.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    435   2e-143   
ref|XP_004307893.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    434   2e-143   
ref|XP_006401299.1|  hypothetical protein EUTSA_v10013558mg             435   2e-143   
ref|XP_009596693.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    434   3e-143   
ref|XP_010229420.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    433   3e-143   
ref|XP_008797895.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    434   4e-143   
ref|XP_004241428.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    434   5e-143   
ref|NP_001169595.1|  uncharacterized protein LOC100383476 precursor     434   6e-143   
gb|KFK36207.1|  hypothetical protein AALP_AA4G091700                    434   7e-143   
ref|XP_006347315.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    433   9e-143   
ref|XP_010463717.1|  PREDICTED: IAA-amino acid hydrolase ILR1 iso...    433   1e-142   
ref|XP_006478084.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    432   1e-142   
emb|CAA09330.1|  gr1-protein                                            434   1e-142   
emb|CDX88581.1|  BnaA03g10680D                                          433   1e-142   
ref|XP_011046909.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      433   1e-142   
ref|XP_002893987.1|  gr1-protein                                        434   2e-142   
ref|XP_006658443.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    432   2e-142   
ref|XP_002308452.1|  IAA-amino acid hydrolase 1 family protein          432   2e-142   
ref|NP_175086.1|  IAA-amino acid hydrolase ILR1-like 6                  433   2e-142   
gb|AFK43667.1|  unknown                                                 432   2e-142   
ref|XP_011046911.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      432   2e-142   
ref|XP_009373052.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      432   3e-142   
ref|XP_006441277.1|  hypothetical protein CICLE_v10020281mg             431   3e-142   
gb|KDO37850.1|  hypothetical protein CISIN_1g014449mg                   431   4e-142   
ref|XP_010461441.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    432   4e-142   
ref|XP_007039231.1|  IAA-leucine-resistant-like 3                       431   4e-142   
ref|XP_006297680.1|  hypothetical protein CARUB_v10013712mg             431   6e-142   
ref|XP_002521309.1|  IAA-amino acid hydrolase ILR1 precursor, put...    431   9e-142   
ref|XP_002317832.1|  hypothetical protein POPTR_0012s00750g             431   1e-141   
ref|XP_002466139.1|  hypothetical protein SORBIDRAFT_01g002080          429   1e-141   
ref|XP_010485617.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      430   2e-141   
ref|XP_002466140.1|  hypothetical protein SORBIDRAFT_01g002090          429   2e-141   
ref|XP_002882255.1|  IAA amidohydrolase                                 430   2e-141   
dbj|BAJ90175.1|  predicted protein                                      430   2e-141   
ref|XP_011075876.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    430   2e-141   
gb|KHG23253.1|  IAA-amino acid hydrolase ILR1-like 3                    431   2e-141   
sp|Q8H3C8.1|ILL8_ORYSJ  RecName: Full=IAA-amino acid hydrolase IL...    430   3e-141   
ref|XP_010462020.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    430   3e-141   
gb|EMT32321.1|  IAA-amino acid hydrolase ILR1-like protein 4            429   3e-141   
gb|KHN39276.1|  IAA-amino acid hydrolase ILR1-like 4                    427   3e-141   
ref|XP_006658442.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    427   4e-141   
ref|NP_186937.1|  IAA-amino acid hydrolase ILR1                         429   5e-141   
gb|AAK97436.2|AF385367_1  IAA amidohydrolase                            429   6e-141   
ref|XP_011074843.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    430   6e-141   
ref|XP_004966179.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    431   7e-141   
gb|AAM63645.1|  IAA-amino acid hydrolase (ILR1)                         429   7e-141   
gb|EMT32322.1|  IAA-amino acid hydrolase ILR1-like protein 4            429   8e-141   
ref|XP_004228647.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    428   9e-141   
ref|XP_010500765.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    428   2e-140   
ref|XP_004955914.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    427   2e-140   
ref|XP_006354111.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    427   2e-140   
ref|XP_004305642.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      427   3e-140   
ref|XP_010479683.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    427   4e-140   
ref|XP_007027887.1|  Iaa-amino acid hydrolase 4                         426   4e-140   
ref|XP_010502342.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      427   5e-140   
gb|AAB60293.1|  ILR1                                                    426   6e-140   
ref|NP_001291249.1|  IAA-amino acid hydrolase ILR1-like 3 precursor     426   7e-140   
ref|XP_004981136.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    425   8e-140   
ref|XP_003523305.2|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    426   1e-139   
ref|XP_004502777.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    425   1e-139   
ref|XP_002975937.1|  hypothetical protein SELMODRAFT_104527             424   2e-139   
sp|Q851L5.1|ILL3_ORYSJ  RecName: Full=IAA-amino acid hydrolase IL...    424   3e-139   
ref|XP_007135596.1|  hypothetical protein PHAVU_010G142700g             424   4e-139   
gb|EYU45331.1|  hypothetical protein MIMGU_mgv1a023576mg                424   5e-139   
gb|ACZ56436.1|  IAA-amino acid hydrolase                                424   5e-139   
ref|XP_003602410.1|  IAA-amino acid hydrolase ILR1-like protein         422   8e-139   
ref|XP_003560269.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    422   8e-139   
ref|XP_006305862.1|  hypothetical protein CARUB_v10010946mg             423   8e-139   
dbj|BAK08232.1|  predicted protein                                      422   1e-138   
ref|XP_010683632.1|  PREDICTED: IAA-amino acid hydrolase ILR1           423   1e-138   
ref|XP_004143335.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      421   4e-138   
ref|XP_008243487.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      421   4e-138   
gb|KGN48287.1|  hypothetical protein Csa_6G454350                       421   4e-138   
emb|CAG32960.1|  putative auxin-amidohydrolase precursor                421   6e-138   
ref|XP_009400482.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    420   1e-137   
ref|XP_010691394.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    420   1e-137   
ref|XP_010227391.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    421   2e-137   
ref|XP_003557334.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 9    419   3e-137   
emb|CDY28718.1|  BnaCnng06040D                                          419   3e-137   
ref|XP_008462603.1|  PREDICTED: IAA-amino acid hydrolase ILR1           419   5e-137   
ref|XP_009373051.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      419   5e-137   
sp|Q8H3C7.2|ILL9_ORYSJ  RecName: Full=IAA-amino acid hydrolase IL...    419   6e-137   
ref|XP_002976283.1|  hypothetical protein SELMODRAFT_105028             418   8e-137   
ref|XP_007136362.1|  hypothetical protein PHAVU_009G038900g             417   9e-137   
ref|XP_009147310.1|  PREDICTED: IAA-amino acid hydrolase ILR1           417   2e-136   
emb|CDY51525.1|  BnaA05g33250D                                          417   2e-136   
gb|EEC81805.1|  hypothetical protein OsI_25528                          416   2e-136   
ref|XP_010500767.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    417   3e-136   
ref|XP_008783551.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    417   5e-136   
ref|XP_010251241.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    415   5e-136   
ref|XP_010103068.1|  IAA-amino acid hydrolase ILR1-like 3               415   8e-136   
ref|XP_010251233.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    415   9e-136   
ref|XP_008351526.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    414   2e-135   
gb|EAZ03384.1|  hypothetical protein OsI_25529                          414   2e-135   
ref|NP_001051828.1|  Os03g0836900                                       413   3e-135   
gb|EPS72108.1|  hypothetical protein M569_02647                         428   5e-135   
ref|XP_009349385.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      413   7e-135   
ref|XP_010934036.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    412   1e-134   
ref|XP_010088388.1|  IAA-amino acid hydrolase ILR1-like 5               412   2e-134   
ref|XP_002446800.1|  hypothetical protein SORBIDRAFT_06g022860          410   4e-134   
dbj|BAC20816.1|  putative IAA amidohydrolase                            410   1e-133   
gb|EMT21700.1|  IAA-amino acid hydrolase ILR1-like protein 7            413   2e-132   
ref|XP_010943795.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    404   4e-132   
ref|XP_004976258.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    405   4e-132   
emb|CAN66058.1|  hypothetical protein VITISV_017036                     404   8e-132   
emb|CDP10924.1|  unnamed protein product                                402   9e-132   
ref|XP_006657280.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    403   8e-131   
tpg|DAA36899.1|  TPA: hypothetical protein ZEAMMB73_374396              400   5e-130   
ref|NP_001150846.1|  IAA-amino acid hydrolase ILR1-like 3 precursor     402   9e-130   
tpg|DAA36900.1|  TPA: IAA-amino acid hydrolase ILR1-like 3              401   3e-129   
emb|CDY69786.1|  BnaC06g41050D                                          394   9e-129   
dbj|BAJ99345.1|  predicted protein                                      397   1e-128   
ref|XP_006408371.1|  hypothetical protein EUTSA_v10021977mg             394   4e-128   
ref|NP_200225.1|  IAA-amino acid hydrolase ILR1-like 3                  395   4e-128   
ref|XP_002441732.1|  hypothetical protein SORBIDRAFT_08g001450          396   5e-128   
ref|XP_010463718.1|  PREDICTED: IAA-amino acid hydrolase ILR1 iso...    394   7e-128   
ref|XP_002864304.1|  hypothetical protein ARALYDRAFT_495494             394   9e-128   
ref|XP_006652529.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    394   1e-127   
ref|NP_001053339.1|  Os04g0521800                                       394   2e-127   
ref|XP_010537042.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    393   4e-127   
ref|XP_010943801.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    390   3e-126   
emb|CDY14333.1|  BnaA10g07220D                                          390   4e-126   
ref|XP_009119945.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    390   6e-126   
emb|CDY60579.1|  BnaCnng36490D                                          390   6e-126   
ref|XP_003580154.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    389   1e-125   
ref|XP_010093786.1|  IAA-amino acid hydrolase                           387   3e-125   
gb|EAZ39285.1|  hypothetical protein OsJ_23717                          390   3e-125   
dbj|BAJ93855.1|  predicted protein                                      388   3e-125   
gb|EMS55264.1|  IAA-amino acid hydrolase ILR1-like 5                    385   2e-124   
gb|KDO58673.1|  hypothetical protein CISIN_1g013076mg                   380   1e-123   
ref|XP_009760824.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    380   1e-122   
ref|XP_009596700.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    379   2e-122   
ref|XP_010446503.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    380   4e-122   
emb|CDP03213.1|  unnamed protein product                                374   5e-122   
ref|XP_010482822.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    379   1e-121   
ref|XP_007012936.1|  Peptidase M20/M25/M40 family protein isoform 2     375   1e-121   
ref|XP_010442989.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    378   2e-121   
ref|XP_007222851.1|  hypothetical protein PRUPE_ppa008809mg             372   1e-120   
gb|EEC81804.1|  hypothetical protein OsI_25527                          372   2e-120   
gb|KDO55918.1|  hypothetical protein CISIN_1g013332mg                   371   3e-120   
ref|XP_010934037.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    374   1e-119   
gb|EMT31863.1|  IAA-amino acid hydrolase ILR1-like protein 8            368   4e-119   
ref|XP_010451352.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    368   6e-119   
ref|XP_006478083.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    371   8e-119   
gb|EEE55272.1|  hypothetical protein OsJ_03195                          374   1e-118   
gb|KCW82521.1|  hypothetical protein EUGRSUZ_C03922                     370   2e-118   
gb|KDO80613.1|  hypothetical protein CISIN_1g011407mg                   367   8e-118   
ref|XP_007044501.1|  Peptidase M20/M25/M40 family protein, putati...    361   2e-117   
ref|XP_006392996.1|  hypothetical protein EUTSA_v10011481mg             364   2e-117   
ref|XP_008367918.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    365   8e-116   
ref|XP_007044502.1|  Peptidase M20/M25/M40 family protein, putati...    357   1e-115   
gb|EAZ39283.1|  hypothetical protein OsJ_23715                          360   3e-115   
emb|CDP10626.1|  unnamed protein product                                356   2e-114   
gb|ACL52754.1|  unknown                                                 355   3e-114   



>ref|XP_006355931.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Solanum 
tuberosum]
Length=444

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/416 (75%), Positives = 358/416 (86%), Gaps = 6/416 (1%)
 Frame = -1

Query  1585  GAGESSKLPLAVDGGL--KDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVR  1412
             G  E    P  +D  +  KD I+ LAN+TETV+WMR++RR+IH NPELAYEEF TSA++R
Sbjct  21    GHEEECLNPFLIDQNIFAKDHIINLANDTETVKWMRKIRRQIHENPELAYEEFMTSALIR  80

Query  1411  RELDRLGVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHA  1232
              ELDR+GVKYRWPVAKTGVVA IGSG PPFVALRADMDALPIQEL +WEHKS++DGKMHA
Sbjct  81    EELDRMGVKYRWPVAKTGVVAAIGSGKPPFVALRADMDALPIQELSKWEHKSKIDGKMHA  140

Query  1231  CGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGL  1052
             C HDAHT MLLGAAKILQQL+  L+GTV+LIFQPAEERG GAKDMI  GVL+NV+AIFG+
Sbjct  141   CAHDAHTTMLLGAAKILQQLQHNLQGTVVLIFQPAEERGHGAKDMIDEGVLENVEAIFGM  200

Query  1051  HVAHKYPVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIV  872
             H+ HKY  GVVASRPGEFLAGCG FKATI+GKGGHAAIPQ++VDPILAASTSVISLQSIV
Sbjct  201   HLVHKYSSGVVASRPGEFLAGCGSFKATIRGKGGHAAIPQDTVDPILAASTSVISLQSIV  260

Query  871   SRETDPFDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAA  692
             SRE DP +SQVVSV+MIQGGSSFNVIPD+ATI+GTYRAF+K SFY L+KRIEEIVRAQAA
Sbjct  261   SREADPLESQVVSVAMIQGGSSFNVIPDSATISGTYRAFSKKSFYGLRKRIEEIVRAQAA  320

Query  691   VHRCTVEIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDF  512
             VHRCTVEIDFDG ENPT P    PTIN+ +IYEHARK S +IVGE+N +L+P  MGSEDF
Sbjct  321   VHRCTVEIDFDGRENPTLP----PTINNEKIYEHARKVSKMIVGEENYKLSPSFMGSEDF  376

Query  511   GMYLDKVPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLS  344
              ++L+KVPG+ F +G KNEK   ++PPH+P F +DEDVLP+GAA+HA FAYTYL +
Sbjct  377   AVFLEKVPGSLFLLGTKNEKIGAIYPPHNPNFFIDEDVLPIGAAIHATFAYTYLFN  432



>ref|XP_009613546.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2 [Nicotiana tomentosiformis]
Length=443

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/408 (75%), Positives = 357/408 (88%), Gaps = 6/408 (1%)
 Frame = -1

Query  1561  PLAVDGG--LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGV  1388
             P  VD    +KD I  LAN TETV+WM ++RR+IH NPELAYEEF TS ++R ELDR+GV
Sbjct  30    PFLVDQNCYVKDYITKLANATETVKWMMKIRRQIHENPELAYEEFKTSGLIREELDRMGV  89

Query  1387  KYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTA  1208
             KYRWPVAKTGVVATIGSG PPFVALRADMDALPIQEL +WEHKS+VDGKMHAC HDAHTA
Sbjct  90    KYRWPVAKTGVVATIGSGKPPFVALRADMDALPIQELAKWEHKSKVDGKMHACAHDAHTA  149

Query  1207  MLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPV  1028
             MLLGAAKILQQLR  L+GTV+LIFQPAEERG GAKDMI+ GVL+NV+AIFG+H+ HKY  
Sbjct  150   MLLGAAKILQQLRHNLQGTVVLIFQPAEERGHGAKDMIEEGVLENVEAIFGMHLVHKYES  209

Query  1027  GVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFD  848
             GVVASRPGEFLAGCG FKATI+GKGGHAA+P +SVDPILAASTSVISLQSIVSRETDP +
Sbjct  210   GVVASRPGEFLAGCGSFKATIRGKGGHAAVPHDSVDPILAASTSVISLQSIVSRETDPLE  269

Query  847   SQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEI  668
             SQVVSV+MI+GG +FN+IP++ATI+GTYRAF+K SFY L+KRIEE++RAQAAVHRCTVEI
Sbjct  270   SQVVSVAMIEGGHAFNIIPESATISGTYRAFSKKSFYGLRKRIEEVIRAQAAVHRCTVEI  329

Query  667   DFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVP  488
             DFDG ENPT P    PTIND RIYEHARK S +IVGE++ ++AP  MGSEDF ++L+KVP
Sbjct  330   DFDGRENPTLP----PTINDERIYEHARKVSKMIVGEESFKIAPSFMGSEDFAVFLEKVP  385

Query  487   GAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLS  344
             G+FF +G KNEK   ++PPH+P+F +DEDVLP+GAA+HA FAY+YLL+
Sbjct  386   GSFFLLGTKNEKIGAIYPPHNPHFIIDEDVLPIGAAIHATFAYSYLLN  433



>ref|XP_009784160.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2 [Nicotiana sylvestris]
Length=436

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/418 (74%), Positives = 362/418 (87%), Gaps = 7/418 (2%)
 Frame = -1

Query  1579  GESSKL-PLAVDGG--LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRR  1409
             GE   L P  VD    +KD I  LAN+TETV+WM ++RR+IH NPEL YEEF TS ++R 
Sbjct  23    GEDECLNPFLVDQNSYVKDYITKLANDTETVKWMIKIRRQIHENPELGYEEFKTSGLIRE  82

Query  1408  ELDRLGVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHAC  1229
             ELDR+ VKYRWPVA TGVVATIGSG PPFVALRADMDALPIQEL +W+HKS+VDGKMHAC
Sbjct  83    ELDRMEVKYRWPVANTGVVATIGSGKPPFVALRADMDALPIQELAKWDHKSKVDGKMHAC  142

Query  1228  GHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLH  1049
              HDAHT+MLLGAAKILQQLR  L+GTV+LIFQPAEERG GAKDMI+ GVL+NV+AIFG+H
Sbjct  143   AHDAHTSMLLGAAKILQQLRHNLQGTVVLIFQPAEERGHGAKDMIEEGVLENVEAIFGMH  202

Query  1048  VAHKYPVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVS  869
             + HKY  GV+ASRPGEFLAGCG FKATI+GKGGHAAIPQESVDPILAASTSVISLQSIVS
Sbjct  203   LVHKYESGVIASRPGEFLAGCGSFKATIRGKGGHAAIPQESVDPILAASTSVISLQSIVS  262

Query  868   RETDPFDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAV  689
             RETDP +SQVVSV+MI+GG +FN+IPD+ATI+GTYRAF+K SFY L+KRIEE++RAQAAV
Sbjct  263   RETDPLESQVVSVAMIKGGHAFNIIPDSATISGTYRAFSKKSFYGLRKRIEEVIRAQAAV  322

Query  688   HRCTVEIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFG  509
             HRCTVEIDFDG ENPT P    PTIN+ RIYEHARK S++IVGE+N ++AP  MGSEDF 
Sbjct  323   HRCTVEIDFDGRENPTLP----PTINNERIYEHARKVSTMIVGEENFKIAPRFMGSEDFA  378

Query  508   MYLDKVPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
             ++L+KVPG+FFF+G KNEK   ++PPH+P+F +DEDVLP+GAA+HA FAY+YLL+  K
Sbjct  379   VFLEKVPGSFFFLGTKNEKIGAIYPPHNPHFIIDEDVLPIGAAIHATFAYSYLLNSNK  436



>ref|XP_004238716.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2 [Solanum lycopersicum]
Length=444

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/416 (74%), Positives = 357/416 (86%), Gaps = 6/416 (1%)
 Frame = -1

Query  1585  GAGESSKLPLAVDGGL--KDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVR  1412
             G  E    P  +D  +  KD I+ LAN+TETV+WM+++RR+IH NPELAYEEF TSA++R
Sbjct  21    GREEECLNPFLIDQNIFAKDYIINLANDTETVKWMKKIRRQIHENPELAYEEFMTSALIR  80

Query  1411  RELDRLGVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHA  1232
              ELDR+GVKYRWPVAKTGVVA IGSG PPFVALRADMDALPIQEL  WEHKS++DGKMHA
Sbjct  81    EELDRMGVKYRWPVAKTGVVAAIGSGKPPFVALRADMDALPIQELSNWEHKSKIDGKMHA  140

Query  1231  CGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGL  1052
             C HDAHT MLLGAAKILQQL+  L+GTV+LIFQPAEERG GAKDMI  GVL+NV+AIFGL
Sbjct  141   CAHDAHTTMLLGAAKILQQLQHNLQGTVVLIFQPAEERGHGAKDMIDEGVLENVEAIFGL  200

Query  1051  HVAHKYPVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIV  872
             H+ HKY  G+VASR GEFLAGCG FKATI+GKGGHAAIPQ++VDPILAASTSVISLQSIV
Sbjct  201   HLVHKYSSGIVASRAGEFLAGCGSFKATIRGKGGHAAIPQDTVDPILAASTSVISLQSIV  260

Query  871   SRETDPFDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAA  692
             SRE DP +SQVVSV+MIQGGSSFNVIPD+ATI+GTYRAF+K+SFY L+KRIEEIVRAQAA
Sbjct  261   SREADPLESQVVSVAMIQGGSSFNVIPDSATISGTYRAFSKESFYGLRKRIEEIVRAQAA  320

Query  691   VHRCTVEIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDF  512
             VHRCTVEIDFDG ENPT P    PTIN+ +IY+HARK S +IVGE+N +LA   MGSEDF
Sbjct  321   VHRCTVEIDFDGRENPTVP----PTINNEKIYKHARKVSKMIVGEENYKLASSFMGSEDF  376

Query  511   GMYLDKVPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLS  344
              ++L+ +PG+ FF+G KNEK   ++PPH+P F +DEDVLP+GAA+HA FAYTYLL+
Sbjct  377   AVFLENIPGSLFFLGTKNEKIGAIYPPHNPNFFIDEDVLPIGAAIHATFAYTYLLN  432



>ref|XP_002269424.2| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Vitis vinifera]
Length=477

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/405 (72%), Positives = 348/405 (86%), Gaps = 4/405 (1%)
 Frame = -1

Query  1549  DGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPV  1370
             +  +KD I G+AN+  TV WM+R+RREIH NPELAYEEFATSAV+RREL+ LGV YRWPV
Sbjct  70    NSSVKDHITGVANDPFTVNWMKRIRREIHENPELAYEEFATSAVIRRELEELGVGYRWPV  129

Query  1369  AKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAA  1190
             A+TGVVATIGSGSPPFVALRADMDALPIQE+VEWEHKS+VDGKMHACGHDAH AMLLGAA
Sbjct  130   ARTGVVATIGSGSPPFVALRADMDALPIQEMVEWEHKSKVDGKMHACGHDAHVAMLLGAA  189

Query  1189  KILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASR  1010
             KILQ++R +L+GTV+LIFQPAEERG GAKDMIQ GVL+N++AIFG+H  H YP G VA+R
Sbjct  190   KILQEIRDELQGTVVLIFQPAEERGVGAKDMIQEGVLENIEAIFGIHTVHGYPTGTVAAR  249

Query  1009  PGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSV  830
              GEFLAGCG F+A I G+GGHAA PQ S+DPILA STSVISLQ+IVSRE DP DSQVVSV
Sbjct  250   SGEFLAGCGGFRAKISGRGGHAASPQHSIDPILAVSTSVISLQNIVSREIDPLDSQVVSV  309

Query  829   SMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTE  650
             +MI GG++FNVIPD ATITGT+RAF+K SFY+L++RIEE+V+AQAAVHRC+ EIDF G E
Sbjct  310   AMIHGGTAFNVIPDAATITGTFRAFSKKSFYALRERIEEVVKAQAAVHRCSAEIDFAGME  369

Query  649   NPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFI  470
              PT P    PTIND RIYEH R+ S  IVGE+N + +P  MGSEDF  YLDKVPG+F  +
Sbjct  370   QPTIP----PTINDERIYEHVRQVSIEIVGEENTKRSPSFMGSEDFAFYLDKVPGSFLLV  425

Query  469   GVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
             G++NE++ +++PPHSPYF++DE+VLP+GAA+HAAFAY+YL +  K
Sbjct  426   GMRNERAGSIYPPHSPYFSIDEEVLPIGAAIHAAFAYSYLSNSTK  470



>ref|XP_006438487.1| hypothetical protein CICLE_v10031540mg [Citrus clementina]
 gb|ESR51727.1| hypothetical protein CICLE_v10031540mg [Citrus clementina]
Length=444

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/405 (70%), Positives = 350/405 (86%), Gaps = 4/405 (1%)
 Frame = -1

Query  1549  DGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPV  1370
             +  +K RI+ LAN+ +TV WM+++RR+IH NPELAYEEF TS ++RRELD+LG+ YRWPV
Sbjct  42    NSSIKSRIIELANDQDTVNWMKKMRRQIHENPELAYEEFETSELIRRELDQLGIAYRWPV  101

Query  1369  AKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAA  1190
             AKTGVVAT+GSGSPPFVALRADMDALPIQELVEWEHKS++DGKMHACGHDAH AMLLGAA
Sbjct  102   AKTGVVATVGSGSPPFVALRADMDALPIQELVEWEHKSKIDGKMHACGHDAHVAMLLGAA  161

Query  1189  KILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASR  1010
             KILQ++R+ LKGTV+LIFQPAEERG GAKDMIQ GVL+NV+AIFGLH+ HKYP GVVASR
Sbjct  162   KILQEMRETLKGTVVLIFQPAEERGTGAKDMIQEGVLENVEAIFGLHLVHKYPTGVVASR  221

Query  1009  PGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSV  830
             PG+FLAGCG FKA I GKGGHAAIPQ  +DPILA S+SVISLQ+IVSRE DP DSQVVSV
Sbjct  222   PGDFLAGCGSFKAKISGKGGHAAIPQHCIDPILAVSSSVISLQNIVSREIDPLDSQVVSV  281

Query  829   SMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTE  650
             +MI GGSS+N+IPD+AT+ GT+RAFNK  F +L++RIEEI++ QAAVHRC+ E+DF G E
Sbjct  282   AMINGGSSYNMIPDSATVAGTFRAFNKKRFNALRERIEEIIKGQAAVHRCSAEVDFSGRE  341

Query  649   NPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFI  470
             +PT PPT+    NDVRIY+H R+ ++ I+GE+NV+LAP   GSEDF  +LD++PG+F  +
Sbjct  342   HPTLPPTM----NDVRIYQHVRRVTAEILGEENVKLAPIFTGSEDFAFFLDEIPGSFLLL  397

Query  469   GVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
             G+ N+   +++PPHSPYFT+DE+VLP+GA +HAAFA++YL++  K
Sbjct  398   GMLNDSVGSLYPPHSPYFTIDENVLPIGAVIHAAFAHSYLVNSGK  442



>ref|XP_006483777.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1-like [Citrus 
sinensis]
Length=444

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/405 (70%), Positives = 349/405 (86%), Gaps = 4/405 (1%)
 Frame = -1

Query  1549  DGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPV  1370
             +  +K RI+ LAN+ +TV WM+++RR+IH NPELAYEEF TS ++RRELD+LG+ YRWPV
Sbjct  42    NSSIKSRIIELANDQDTVNWMKKMRRQIHENPELAYEEFETSELIRRELDQLGIAYRWPV  101

Query  1369  AKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAA  1190
             AKTGVVAT+GSGSPPFVALRADMDALPIQELVEWEHKS++DGKMHACGHDAH AMLLGAA
Sbjct  102   AKTGVVATVGSGSPPFVALRADMDALPIQELVEWEHKSKIDGKMHACGHDAHVAMLLGAA  161

Query  1189  KILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASR  1010
             KILQ++R+ LKGTV+LIFQPAEERG GAKDMIQ GVL+NV+AIFGLH+ HKYP GVVASR
Sbjct  162   KILQEMRETLKGTVVLIFQPAEERGTGAKDMIQEGVLENVEAIFGLHLVHKYPTGVVASR  221

Query  1009  PGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSV  830
             PG+FLAGCG FKA I GKGGHAAIPQ  +DPILA S+SVISLQ+IVSRE DP DSQVVSV
Sbjct  222   PGDFLAGCGSFKAKISGKGGHAAIPQHCIDPILAVSSSVISLQNIVSREIDPLDSQVVSV  281

Query  829   SMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTE  650
             +MI GGSS+N+IPD+AT+ GT+RAFNK  F +L++RIEEI++ QAAVHRC+ E+DF G E
Sbjct  282   AMINGGSSYNMIPDSATVAGTFRAFNKKRFNALRERIEEIIKGQAAVHRCSAEVDFSGRE  341

Query  649   NPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFI  470
             +PT PPT+    NDVRIY+H R+ ++ I+GE+NV+LAP   GSEDF  +LD++PG+F  +
Sbjct  342   HPTLPPTM----NDVRIYQHVRRVTAEILGEENVKLAPIFTGSEDFAFFLDEIPGSFLLL  397

Query  469   GVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
             G+ N+   +++P HSPYFT+DE+VLP+GA +HAAFA++YL++  K
Sbjct  398   GMLNDSVGSLYPLHSPYFTIDENVLPIGAVIHAAFAHSYLVNSGK  442



>emb|CDP00215.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/400 (71%), Positives = 347/400 (87%), Gaps = 4/400 (1%)
 Frame = -1

Query  1549  DGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPV  1370
             +  LKD ++GLANE E VEWMR++RREIH+NPELAYEE ATS++VRREL+ +G+KYRWPV
Sbjct  46    NASLKDCVIGLANEPEMVEWMRKIRREIHKNPELAYEELATSSLVRRELEEMGIKYRWPV  105

Query  1369  AKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAA  1190
             AKTGVVA +GSGSPPFVALRADMDALPIQEL + EHKSQVDGKMHACGHDAHT+MLLGAA
Sbjct  106   AKTGVVAAVGSGSPPFVALRADMDALPIQELADLEHKSQVDGKMHACGHDAHTSMLLGAA  165

Query  1189  KILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASR  1010
             +IL++L   L+GTV+LIFQPAEERG GAKDMI+ GVL +VDAIFG+H+ HK+P+GV ASR
Sbjct  166   RILKELESSLQGTVILIFQPAEERGEGAKDMIKEGVLKDVDAIFGVHIIHKFPIGVAASR  225

Query  1009  PGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSV  830
             PG+FLAGCG FKA IKGKGGHAA PQES+DPILAA+TS+ISLQ I+SRETDP DSQVVSV
Sbjct  226   PGQFLAGCGSFKAIIKGKGGHAAAPQESIDPILAAATSIISLQHIISRETDPLDSQVVSV  285

Query  829   SMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTE  650
             S++Q G+S+NVIP++ATI GTYRAF    F  L++R+EE+++AQAAVHRC+V+IDFDG E
Sbjct  286   SIVQAGTSYNVIPESATIAGTYRAFGWKGFRDLRERLEEVIKAQAAVHRCSVKIDFDGKE  345

Query  649   NPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFI  470
             +PT P    PT+ND RIYEHAR+ S+LIVGE+N ++A    GSEDF  YL+K+PG+F  +
Sbjct  346   HPTLP----PTVNDERIYEHARQVSNLIVGEENTKVATIFTGSEDFASYLEKIPGSFLLL  401

Query  469   GVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             G++NEK   ++PPHSPY+T+DEDVLP+GAA+H  FAY+YL
Sbjct  402   GIRNEKIGAIYPPHSPYYTIDEDVLPIGAALHTTFAYSYL  441



>gb|KDO82610.1| hypothetical protein CISIN_1g013395mg [Citrus sinensis]
Length=444

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/405 (70%), Positives = 348/405 (86%), Gaps = 4/405 (1%)
 Frame = -1

Query  1549  DGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPV  1370
             +  +K RI+ LAN+ +TV WM+++RR+IH NPELAYEEF TS ++RRELD+LG+ YRWPV
Sbjct  42    NSSIKSRIIELANDQDTVNWMKKMRRQIHENPELAYEEFETSELIRRELDQLGIAYRWPV  101

Query  1369  AKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAA  1190
             AKTGVVAT+GSGSPPFVALRADMDALPIQELVEWEHKS++DGKMHACGHDAH AMLLGAA
Sbjct  102   AKTGVVATVGSGSPPFVALRADMDALPIQELVEWEHKSKIDGKMHACGHDAHVAMLLGAA  161

Query  1189  KILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASR  1010
             KILQ++R+ LKGTV+LIFQPAEERG GAKDMIQ GVL+NV+AIFGLH+ HKYP GVVASR
Sbjct  162   KILQEMRETLKGTVVLIFQPAEERGTGAKDMIQEGVLENVEAIFGLHLVHKYPTGVVASR  221

Query  1009  PGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSV  830
             PG+FLAGCG FKA I GKGGHAAIPQ  +DPILA S+SVISLQ+IVSRE DP DSQVVSV
Sbjct  222   PGDFLAGCGSFKAKISGKGGHAAIPQHCIDPILAVSSSVISLQNIVSREIDPLDSQVVSV  281

Query  829   SMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTE  650
             +MI GGSS+N+IPD+AT+ GT+RAFNK  F +L++RIEEI++ QAAVHRC+ E+DF G E
Sbjct  282   AMINGGSSYNMIPDSATVAGTFRAFNKKRFNALRERIEEIIKGQAAVHRCSAEVDFSGRE  341

Query  649   NPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFI  470
             +PT PPT+    NDVRIY+H R+ ++ I+GE+NV+LAP   GSEDF  +LD++PG+F  +
Sbjct  342   HPTLPPTM----NDVRIYQHVRRVTAEILGEENVKLAPIFTGSEDFAFFLDEIPGSFLLL  397

Query  469   GVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
             G+ N+   +++P HSPYFT+DE VLP+GA +HAAFA++YL++  K
Sbjct  398   GMLNDSVGSLYPLHSPYFTIDEHVLPIGAVIHAAFAHSYLVNSGK  442



>gb|KDP21295.1| hypothetical protein JCGZ_21766 [Jatropha curcas]
Length=435

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/404 (70%), Positives = 338/404 (84%), Gaps = 4/404 (1%)
 Frame = -1

Query  1561  PLAVDGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKY  1382
             P+  +  +KDR + LAN+ +TV WM+ +RR+IH NPELA+EEF TS ++R ELD+LG+ Y
Sbjct  26    PILENASIKDRAVELANDPDTVNWMKDIRRKIHENPELAFEEFETSKIIRHELDQLGIAY  85

Query  1381  RWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAML  1202
             RWPVAKTGVVATIGSGSPPFVALRADMDALPIQEL EWEHKS+VDGKMHACGHD H AML
Sbjct  86    RWPVAKTGVVATIGSGSPPFVALRADMDALPIQELTEWEHKSKVDGKMHACGHDGHVAML  145

Query  1201  LGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGV  1022
             LGAAKILQ+LR  L+GTV+LIFQPAEE+G GAK MI+ GVLDNV+AIFGLH+  KYP G 
Sbjct  146   LGAAKILQELRHMLQGTVVLIFQPAEEQGEGAKAMIEAGVLDNVEAIFGLHLVQKYPTGA  205

Query  1021  VASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQ  842
             VASRPGEFLAGCG F A I GKGGHAA+PQ+S+DPILAAS SVISLQ IVSRETDP DSQ
Sbjct  206   VASRPGEFLAGCGGFTAKISGKGGHAAVPQQSIDPILAASASVISLQQIVSRETDPLDSQ  265

Query  841   VVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDF  662
             VVSV+MI GG++FNVIPD+ TI+GT+RAF+K  F++L++RIEE+++ QAAVHRC+ EIDF
Sbjct  266   VVSVAMINGGTAFNVIPDSTTISGTFRAFSKKGFHALRERIEEVIKGQAAVHRCSSEIDF  325

Query  661   DGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA  482
              G  NPT P    PT+NDV+IYEH R+ S  +VGE N ++AP  MGSEDF  Y +KVPG+
Sbjct  326   TGNGNPTIP----PTVNDVKIYEHVRRVSIDVVGEQNTQVAPAFMGSEDFAFYQEKVPGS  381

Query  481   FFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             F F+G++NEK   V PPHSPYFT+DEDV P+GAAVHA FA +YL
Sbjct  382   FLFLGIRNEKLGCVHPPHSPYFTVDEDVFPIGAAVHAEFALSYL  425



>ref|XP_002266978.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Vitis vinifera]
Length=445

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/396 (72%), Positives = 340/396 (86%), Gaps = 4/396 (1%)
 Frame = -1

Query  1537  KDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTG  1358
             K+ I GLAN+  TV WM+R+RREIH NPELAYEEFATSA++RREL++LG+ YRWP+A TG
Sbjct  42    KEHITGLANDPITVNWMKRIRREIHENPELAYEEFATSALIRRELEQLGIGYRWPIAGTG  101

Query  1357  VVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQ  1178
             VVATIGSGS PFVALR+DMDALPIQE+VEWEHKS+VDGKMHACGHDAH AMLLGAAKILQ
Sbjct  102   VVATIGSGSQPFVALRSDMDALPIQEMVEWEHKSKVDGKMHACGHDAHVAMLLGAAKILQ  161

Query  1177  QLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEF  998
             ++R +L GTV+LIFQPAEERG GAK MIQ G L+NV+AIFG+H   +YP G VA+R GEF
Sbjct  162   EIRDELPGTVVLIFQPAEERGVGAKAMIQEGALENVEAIFGVHAVIEYPTGTVAARSGEF  221

Query  997   LAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQ  818
             LAGCG F+A I G+GGHAA+PQ S+DPILA STSV+SLQ+IVSRETDP D QVVSV+MI 
Sbjct  222   LAGCGGFRAKISGRGGHAAVPQHSIDPILAVSTSVVSLQNIVSRETDPLDHQVVSVAMIH  281

Query  817   GGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTF  638
             GG++FNVIPD ATITGT+RAF+K SFY+L+ RIEE+++AQAAVHRC+ EIDF G E PT 
Sbjct  282   GGTAFNVIPDAATITGTFRAFSKKSFYALRDRIEEVIKAQAAVHRCSAEIDFSGMELPTI  341

Query  637   PPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKN  458
             P    PTIND RIYEHARK SS +VGE+N + +P  MGSEDF  YLDKVPG+F F+G++N
Sbjct  342   P----PTINDRRIYEHARKVSSEMVGEENTKTSPVCMGSEDFAFYLDKVPGSFLFLGMRN  397

Query  457   EKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             EK+ + +PPHSPY+ LDE+VLP+GAA+HAAFA +YL
Sbjct  398   EKAGSTYPPHSPYYVLDEEVLPIGAAIHAAFALSYL  433



>ref|XP_006378179.1| hypothetical protein POPTR_0010s04530g [Populus trichocarpa]
 gb|ERP55976.1| hypothetical protein POPTR_0010s04530g [Populus trichocarpa]
Length=469

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/397 (71%), Positives = 345/397 (87%), Gaps = 4/397 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             LK+RI+ LAN+  TV+WM+++RR+IH NPELA+EEF TS ++R++LD++G+ YRWPVA+T
Sbjct  66    LKERIVELANDPHTVDWMKKIRRQIHENPELAFEEFETSKLIRQQLDQMGIAYRWPVART  125

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVAT+GSGS PFVALRADMDALPIQE+VEWEHKS+VDGKMHACGHDAH AMLLGAA+IL
Sbjct  126   GVVATLGSGSSPFVALRADMDALPIQEMVEWEHKSKVDGKMHACGHDAHAAMLLGAARIL  185

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             +QL+  L+GTV+LIFQPAEE+G+G KDMI  GVLDNVDAIFGLH  H+YP GVVASRPGE
Sbjct  186   KQLQDTLQGTVVLIFQPAEEQGQGGKDMIAEGVLDNVDAIFGLHTVHRYPTGVVASRPGE  245

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG FKA I GKGGHAAIPQ+S+DPILAAST+VISLQ+IVSRE DP DSQVVSV+MI
Sbjct  246   FLAGCGSFKAKIIGKGGHAAIPQDSIDPILAASTAVISLQNIVSREIDPLDSQVVSVAMI  305

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
              GG++FNVIPD+ATI GT+RAF+K SF +L++RI+E++  QAAVHRCT E++F GTE+P 
Sbjct  306   HGGTAFNVIPDSATIEGTFRAFSKKSFNALRERIKEVIEGQAAVHRCTCEVNFTGTEHPI  365

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT+ND RIYEH R+ S  IVGE NVELAP  MGSEDF  YLDKVPG+F F+G++
Sbjct  366   IP----PTVNDARIYEHVRRVSIDIVGEGNVELAPIFMGSEDFAFYLDKVPGSFLFLGMR  421

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             NEK  +++ PHSPY+T+DEDV P+GA+++A FA++YL
Sbjct  422   NEKIGSIYLPHSPYYTIDEDVFPIGASIYAVFAHSYL  458



>ref|XP_009351298.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Pyrus x bretschneideri]
 ref|XP_011014605.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Populus euphratica]
Length=456

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/406 (69%), Positives = 351/406 (86%), Gaps = 4/406 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             LK+RI+ LAN+  TV+WM+++RR+IH+NPELA+EEF TS ++R++LD++G+ YRWPVA+T
Sbjct  53    LKERIVELANDPHTVDWMKKIRRQIHKNPELAFEEFETSKLIRQQLDQMGIAYRWPVART  112

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVAT+GSGS P+VALRADMDALPIQE+VEWEHKS+VDGKMHACGHDAH AMLLGAA+IL
Sbjct  113   GVVATLGSGSSPYVALRADMDALPIQEMVEWEHKSKVDGKMHACGHDAHAAMLLGAARIL  172

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             +QL+  L+GTV+LIFQPAEE+G+G KDMI  GVLDNVDAIFGLH  H+YP GVVASRPGE
Sbjct  173   KQLQDTLQGTVVLIFQPAEEQGQGGKDMIAEGVLDNVDAIFGLHTVHRYPTGVVASRPGE  232

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG FKA I GKGGHAAIPQ+S+DPILAAST+VISLQ+IVSRE DP DSQVVSV+MI
Sbjct  233   FLAGCGSFKAKIIGKGGHAAIPQDSIDPILAASTAVISLQNIVSREIDPLDSQVVSVAMI  292

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
              GG++FNVIPD+A+I GT+RAF+K SF +L++RI+E++  QAAVHRCT E++F GTE+P 
Sbjct  293   HGGTAFNVIPDSASIEGTFRAFSKKSFNALRERIKEVIEGQAAVHRCTCEVNFTGTEHPI  352

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT+ND RIYEH R+ S  IVGE NVE+AP  MGSEDF  YLDKVPG+F F+G++
Sbjct  353   IP----PTVNDARIYEHVRRVSIDIVGEGNVEIAPIFMGSEDFAFYLDKVPGSFLFLGMR  408

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHS  323
             NEK  +++ PHSPY+T+DEDV P+GA+++A FA++YLL+  +  +S
Sbjct  409   NEKIGSIYHPHSPYYTIDEDVFPIGASIYAVFAHSYLLNSTRNLNS  454



>ref|XP_011009011.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Populus euphratica]
Length=456

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/406 (69%), Positives = 350/406 (86%), Gaps = 4/406 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             LK+RI+ LAN+  TV+WM+++RR+IH NPELA+EEF TS ++R++LD++G+ YRWPVA+T
Sbjct  53    LKERIVELANDPHTVDWMKKIRRQIHENPELAFEEFETSKLIRQQLDQMGIAYRWPVART  112

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVAT+GSGS P+VALRADMDALPIQE+VEWEHKS+VDGKMHACGHDAH AMLLGAA+IL
Sbjct  113   GVVATLGSGSSPYVALRADMDALPIQEMVEWEHKSKVDGKMHACGHDAHAAMLLGAARIL  172

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             +QL+  L+GTV+LIFQPAEE+G+G KDMI  GVLDNVDAIFGLH  H+YP GVVASRPGE
Sbjct  173   KQLQDTLQGTVVLIFQPAEEQGQGGKDMIAEGVLDNVDAIFGLHTVHRYPTGVVASRPGE  232

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG FKA I GKGGHAAIPQ+S+DPILAAST+VISLQ+IVSRE DP DSQVVSV+MI
Sbjct  233   FLAGCGSFKAKIIGKGGHAAIPQDSIDPILAASTAVISLQNIVSREIDPLDSQVVSVAMI  292

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
              GG++FNVIPD+A+I GT+RAF+K SF +L++RI+E++  QAAVHRCT E++F GTE+P 
Sbjct  293   HGGTAFNVIPDSASIEGTFRAFSKKSFNALRERIKEVIEGQAAVHRCTCEVNFTGTEHPI  352

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT+ND RIYEH R+ S  IVGE NVE+AP  MGSEDF  YLDKVPG+F F+G++
Sbjct  353   IP----PTVNDARIYEHVRRVSIDIVGEGNVEIAPIFMGSEDFAFYLDKVPGSFLFLGMR  408

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHS  323
             NEK  +++ PHSPY+T+DEDV P+GA+++A FA++YLL+  +  +S
Sbjct  409   NEKIGSIYHPHSPYYTIDEDVFPIGASIYAVFAHSYLLNSTRNLNS  454



>ref|XP_010044662.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Eucalyptus grandis]
 gb|KCW86760.1| hypothetical protein EUGRSUZ_B03368 [Eucalyptus grandis]
Length=456

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/397 (70%), Positives = 336/397 (85%), Gaps = 4/397 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L++ +   A +     WM+++RREIH NPELAYEEF TSA+VRRELDRLGV YRWP A T
Sbjct  53    LREYVARRAKDASLAGWMKKIRREIHENPELAYEEFETSALVRRELDRLGVAYRWPTAGT  112

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVAT+GSGSPPFVALRADMDALPIQE+VEWEHKS+VDGKMHACGHDAH AMLLGAAK+L
Sbjct  113   GVVATVGSGSPPFVALRADMDALPIQEMVEWEHKSKVDGKMHACGHDAHVAMLLGAAKVL  172

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q++R  L+GTV+LIFQPAEE GRGAKDMIQ G L+NV+AIFGLH+ H+YP+GVVASRPGE
Sbjct  173   QEVRDHLQGTVVLIFQPAEESGRGAKDMIQGGALENVEAIFGLHLVHRYPIGVVASRPGE  232

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG F A IKGKGGHAAIP  S+DPILAAST+VISLQ+IVSRE DP DSQVVSV+MI
Sbjct  233   FLAGCGSFNARIKGKGGHAAIPHLSIDPILAASTAVISLQNIVSREVDPLDSQVVSVAMI  292

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             QGG++FNVIP+TATI GT+RAF+K SFY L +RIEE+++AQA VHRC+ E+D +G  +P+
Sbjct  293   QGGTAFNVIPNTATIGGTFRAFSKKSFYGLGERIEEVIKAQAVVHRCSAEVDLEGNGHPS  352

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT+ND RIY+H  + S+ IVGE+N  L+P   GSEDF  YLDKVPG+F  +G++
Sbjct  353   IP----PTVNDERIYKHVHRVSTEIVGEENTVLSPSFTGSEDFAFYLDKVPGSFLLLGIR  408

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             NEK  +V+PPHSPY+++DEDVL +GAA+HAAFA +Y+
Sbjct  409   NEKVGSVYPPHSPYYSIDEDVLSIGAAIHAAFALSYI  445



>ref|XP_007223059.1| hypothetical protein PRUPE_ppa006982mg [Prunus persica]
 gb|EMJ24258.1| hypothetical protein PRUPE_ppa006982mg [Prunus persica]
Length=387

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/380 (74%), Positives = 331/380 (87%), Gaps = 4/380 (1%)
 Frame = -1

Query  1489  MRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSPPFVALR  1310
             M+ VRREIH NPELAYEEF TSA++RRELD++GV Y WPVA TGVVATIGSGSPPFVALR
Sbjct  1     MKNVRREIHENPELAYEEFKTSALIRRELDKIGVAYTWPVAHTGVVATIGSGSPPFVALR  60

Query  1309  ADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQP  1130
             ADMDALPIQELVEWEHKS+VDGKMHACGHDAH AMLLGAAK+LQQL+  L+GTV+LIFQP
Sbjct  61    ADMDALPIQELVEWEHKSKVDGKMHACGHDAHVAMLLGAAKVLQQLKDTLQGTVVLIFQP  120

Query  1129  AEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIKGKGG  950
             AEERG GAKDMI+ GVLDNV+AIFGLHV H+YP GVVASRPGEFLAGCG FKA I GKGG
Sbjct  121   AEERGIGAKDMIKEGVLDNVEAIFGLHVVHRYPSGVVASRPGEFLAGCGSFKAKIHGKGG  180

Query  949   HAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTATITG  770
             HAAIPQ+S+DPI+AAS SVISLQ+IVSRE DP DSQVVSV+MIQ G+SFN+IP++ATI+G
Sbjct  181   HAAIPQQSIDPIVAASASVISLQNIVSREADPLDSQVVSVAMIQAGTSFNIIPESATISG  240

Query  769   TYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDVRIYEH  590
             T+RAF+K SF ++++RIEE+V+ QAAVHRC+ EI+F G E+P+ P    PTIND RIYE 
Sbjct  241   TFRAFSKKSFNAIRERIEEVVKGQAAVHRCSAEIEFLGNEHPSIP----PTINDERIYEQ  296

Query  589   ARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVFPPHSPYFTL  410
             AR+ S+ IVG++N +LAP  MGSEDF  YLDKVPG+  F+G  NEK   ++ PHSPYF +
Sbjct  297   ARRISTKIVGKENTKLAPTFMGSEDFAFYLDKVPGSMLFLGTGNEKKGAIYAPHSPYFFI  356

Query  409   DEDVLPVGAAVHAAFAYTYL  350
             DEDVLP+G+A+HAAFA++YL
Sbjct  357   DEDVLPIGSAIHAAFAHSYL  376



>ref|XP_002520216.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
 gb|EEF42271.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
Length=454

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/397 (70%), Positives = 336/397 (85%), Gaps = 4/397 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             +KD I+ LAN+ ETV WM++VRR+IH+NPELA+EE+ TS ++R ELD+LGV Y+WPVA T
Sbjct  52    VKDLILELANDQETVNWMKKVRRKIHQNPELAFEEYETSKLIRDELDQLGVAYKWPVATT  111

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVATIGSGSPPFVALRADMDALPIQEL  WE+KS+VDGKMHACGHD H AMLLGAAKIL
Sbjct  112   GVVATIGSGSPPFVALRADMDALPIQELTGWEYKSKVDGKMHACGHDGHVAMLLGAAKIL  171

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q+LR  L+GTV+LIFQPAEE+G GAK M++ GVLDNV+A+FG+HV  KYP GVVASRPGE
Sbjct  172   QELRDTLQGTVILIFQPAEEQGLGAKSMVEEGVLDNVEAVFGVHVVQKYPTGVVASRPGE  231

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG F+A I GKGGHAA+PQ S+DPILAAS SVISLQ I+SRE DPFDSQVVSV+MI
Sbjct  232   FLAGCGGFRAKISGKGGHAAVPQHSIDPILAASASVISLQQIISREVDPFDSQVVSVAMI  291

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
              GG++FNVIPD+ATI GTYRAF+K SF +L++RIEEI++ QAAVHRC+ EIDF G  +PT
Sbjct  292   NGGTAFNVIPDSATIAGTYRAFSKKSFNALRERIEEIIKGQAAVHRCSSEIDFTGKGSPT  351

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PTIND  IYEHA++ S  +VG  N+E+AP  MGSEDF  YL+KVPG+F F+G++
Sbjct  352   LP----PTINDAEIYEHAQRVSIDVVGVKNIEVAPTFMGSEDFAFYLEKVPGSFSFLGIR  407

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             NEK   + PPHSPYF +DE+V P+GAA++A FA++YL
Sbjct  408   NEKLGYIHPPHSPYFMIDENVFPIGAALYAGFAHSYL  444



>emb|CBI32084.3| unnamed protein product [Vitis vinifera]
Length=830

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/396 (72%), Positives = 340/396 (86%), Gaps = 4/396 (1%)
 Frame = -1

Query  1537  KDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTG  1358
             K+ I GLAN+  TV WM+R+RREIH NPELAYEEFATSA++RREL++LG+ YRWP+A TG
Sbjct  397   KEHITGLANDPITVNWMKRIRREIHENPELAYEEFATSALIRRELEQLGIGYRWPIAGTG  456

Query  1357  VVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQ  1178
             VVATIGSGS PFVALR+DMDALPIQE+VEWEHKS+VDGKMHACGHDAH AMLLGAAKILQ
Sbjct  457   VVATIGSGSQPFVALRSDMDALPIQEMVEWEHKSKVDGKMHACGHDAHVAMLLGAAKILQ  516

Query  1177  QLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEF  998
             ++R +L GTV+LIFQPAEERG GAK MIQ G L+NV+AIFG+H   +YP G VA+R GEF
Sbjct  517   EIRDELPGTVVLIFQPAEERGVGAKAMIQEGALENVEAIFGVHAVIEYPTGTVAARSGEF  576

Query  997   LAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQ  818
             LAGCG F+A I G+GGHAA+PQ S+DPILA STSV+SLQ+IVSRETDP D QVVSV+MI 
Sbjct  577   LAGCGGFRAKISGRGGHAAVPQHSIDPILAVSTSVVSLQNIVSRETDPLDHQVVSVAMIH  636

Query  817   GGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTF  638
             GG++FNVIPD ATITGT+RAF+K SFY+L+ RIEE+++AQAAVHRC+ EIDF G E PT 
Sbjct  637   GGTAFNVIPDAATITGTFRAFSKKSFYALRDRIEEVIKAQAAVHRCSAEIDFSGMELPTI  696

Query  637   PPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKN  458
             P    PTIND RIYEHARK SS +VGE+N + +P  MGSEDF  YLDKVPG+F F+G++N
Sbjct  697   P----PTINDRRIYEHARKVSSEMVGEENTKTSPVCMGSEDFAFYLDKVPGSFLFLGMRN  752

Query  457   EKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             EK+ + +PPHSPY+ LDE+VLP+GAA+HAAFA +YL
Sbjct  753   EKAGSTYPPHSPYYVLDEEVLPIGAAIHAAFALSYL  788


 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/339 (76%), Positives = 293/339 (86%), Gaps = 4/339 (1%)
 Frame = -1

Query  1489  MRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSPPFVALR  1310
             M+R+RREIH NPELAYEEFATSAV+RREL+ LGV YRWPVA+TGVVATIGSGSPPFVALR
Sbjct  1     MKRIRREIHENPELAYEEFATSAVIRRELEELGVGYRWPVARTGVVATIGSGSPPFVALR  60

Query  1309  ADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQP  1130
             ADMDALPIQE+VEWEHKS+VDGKMHACGHDAH AMLLGAAKILQ++R +L+GTV+LIFQP
Sbjct  61    ADMDALPIQEMVEWEHKSKVDGKMHACGHDAHVAMLLGAAKILQEIRDELQGTVVLIFQP  120

Query  1129  AEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIKGKGG  950
             AEERG GAKDMIQ GVL+N++AIFG+H  H YP G VA+R GEFLAGCG F+A I G+GG
Sbjct  121   AEERGVGAKDMIQEGVLENIEAIFGIHTVHGYPTGTVAARSGEFLAGCGGFRAKISGRGG  180

Query  949   HAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTATITG  770
             HAA PQ S+DPILA STSVISLQ+IVSRE DP DSQVVSV+MI GG++FNVIPD ATITG
Sbjct  181   HAASPQHSIDPILAVSTSVISLQNIVSREIDPLDSQVVSVAMIHGGTAFNVIPDAATITG  240

Query  769   TYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDVRIYEH  590
             T+RAF+K SFY+L++RIEE+V+AQAAVHRC+ EIDF G E PT P    PTIND RIYEH
Sbjct  241   TFRAFSKKSFYALRERIEEVVKAQAAVHRCSAEIDFAGMEQPTIP----PTINDERIYEH  296

Query  589   ARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFF  473
              R+ S  IVGE+N + +P  MGSEDF  YLDKVPG+F  
Sbjct  297   VRQVSIEIVGEENTKRSPSFMGSEDFAFYLDKVPGSFLL  335



>ref|XP_004297670.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1-like [Fragaria 
vesca subsp. vesca]
Length=441

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/397 (70%), Positives = 334/397 (84%), Gaps = 4/397 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             +KD I+ LA E  T  WM+ VRREIH +PELAYEE  TSAV+RREL++LGV YRWPVA+T
Sbjct  39    VKDEIVRLAKEPGTANWMKDVRREIHEHPELAYEEIKTSAVIRRELEKLGVSYRWPVAQT  98

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVATIGSGSPPFVALRADMDALP+QELVEWEHKS+VDGK HACGHDAH AMLLGAAK+L
Sbjct  99    GVVATIGSGSPPFVALRADMDALPMQELVEWEHKSKVDGKFHACGHDAHVAMLLGAAKVL  158

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             +Q+  +L+GTV+LIFQPAEERG GAKDMI+ GVLDNV+AIFG+H+ ++YP GV+ASRPGE
Sbjct  159   KQVEDKLQGTVVLIFQPAEERGEGAKDMIKEGVLDNVEAIFGIHIVNRYPSGVLASRPGE  218

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG FKA I GKGGHAA+PQ+S+DPILA S SV+SLQSIVSRE DP DS VVSV+MI
Sbjct  219   FLAGCGSFKAKIFGKGGHAALPQQSIDPILAVSASVVSLQSIVSREIDPLDSGVVSVAMI  278

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             QGGS+FN+IPD+ATI+GTYRAF+K SF +L +RIEE+V+ QAAVHRCT E++F G  +P 
Sbjct  279   QGGSAFNIIPDSATISGTYRAFSKKSFNALSQRIEEVVKGQAAVHRCTAEVEFLGEGHPN  338

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PTIND RIY+ AR  SS +VG +N ELAP  MGSEDF  +LDKVPG+ FF+G  
Sbjct  339   IP----PTINDERIYKQARGLSSELVGNENTELAPTFMGSEDFAFFLDKVPGSMFFLGTS  394

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             NEK    +PPHSPY+ +DED+ P+GAA+HA FA+++L
Sbjct  395   NEKIGATYPPHSPYYFIDEDIFPIGAALHATFAFSFL  431



>ref|XP_008389584.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Malus domestica]
Length=448

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/397 (70%), Positives = 335/397 (84%), Gaps = 4/397 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             +KD+I+ LANE  TV WM+ VRRE+H NPEL+YEEF TSA++RREL++LGV Y+WPVAKT
Sbjct  44    VKDQIVRLANEPSTVNWMKSVRREMHENPELSYEEFETSALIRRELEKLGVAYKWPVAKT  103

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVATIGSGSPPFVALRADMDALPI+E+V+WE+KS+V+GKMHACGHD H AMLLGAAKIL
Sbjct  104   GVVATIGSGSPPFVALRADMDALPIEEMVDWENKSKVEGKMHACGHDGHVAMLLGAAKIL  163

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             +QL+  L+GTV+LIFQPAEERG GAKDMI+ GVLDNV+A+FG+H+   YP GVV  RPGE
Sbjct  164   KQLQDTLQGTVVLIFQPAEERGVGAKDMIEEGVLDNVEAVFGMHIVLDYPTGVVXLRPGE  223

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG FKA I GKGGHAAIPQ+S+DPILAASTSVISLQSIVSRETDP DSQVVSVS+I
Sbjct  224   FLAGCGSFKAKIHGKGGHAAIPQQSIDPILAASTSVISLQSIVSRETDPLDSQVVSVSVI  283

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             + GSSFNVIP++ATI+GT+RAF+K +F  L  RIEE+V+ QAAVHRC+ E++F G E+PT
Sbjct  284   KAGSSFNVIPESATISGTFRAFSKKNFKGLMNRIEEVVKGQAAVHRCSAEVEFLGKEHPT  343

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT+ND RIYE  R  SS IVGE+N++LA   MGSEDF  YLDKVPG   F+G +
Sbjct  344   IP----PTVNDERIYEQVRGISSEIVGEENIQLAHTSMGSEDFAFYLDKVPGFMLFLGTR  399

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             NEK   +  PHSP + +DEDV P+GAA+HAAFA+++L
Sbjct  400   NEKIGAIHAPHSPNYIIDEDVFPIGAAIHAAFAHSFL  436



>ref|XP_009360455.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Pyrus x bretschneideri]
Length=444

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/397 (70%), Positives = 334/397 (84%), Gaps = 4/397 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             +KD+I+ LANE  TV WM+ VRRE+H NPEL+YEEF TSA++RRELD+LGV Y+WPVAKT
Sbjct  44    VKDQIVMLANEPSTVNWMKNVRREMHENPELSYEEFETSALIRRELDKLGVAYKWPVAKT  103

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVAT+GSG PPFVALRADMDALPI+E+V+WE+KS+V+GKMHACGHD H AMLLGAAKIL
Sbjct  104   GVVATMGSGCPPFVALRADMDALPIEEMVDWENKSKVEGKMHACGHDGHVAMLLGAAKIL  163

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             +QL+  L+GTV+LIFQPAEERG GAKDMI+ GVLDNV+A+FG+H+   YP GVV  RPGE
Sbjct  164   KQLQDTLQGTVVLIFQPAEERGVGAKDMIEEGVLDNVEAVFGMHIVLDYPTGVVGLRPGE  223

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG FKA I GKGGHAAIPQ+S+DPILAASTSVISLQ+IVSRETDP DSQVVSV++I
Sbjct  224   FLAGCGSFKAKIHGKGGHAAIPQQSIDPILAASTSVISLQNIVSRETDPLDSQVVSVAVI  283

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             + GSSFNVIP++ATI+GT+RAF+K +F  L  RIEE+V+ QAAVHRC+ E++F G E+PT
Sbjct  284   KAGSSFNVIPESATISGTFRAFSKKNFKGLMSRIEEVVKGQAAVHRCSAEVEFLGKEHPT  343

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT+ND RIYE  R  SS IVGE+N++LA   MGSEDF  YLDKVPG   F+G +
Sbjct  344   IP----PTVNDERIYEQVRGISSEIVGEENIQLAHTSMGSEDFAFYLDKVPGFMLFLGTR  399

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             NEK   +  PHSP + +DEDV P+GAA+HAAFA+++L
Sbjct  400   NEKIGAIHAPHSPNYIIDEDVFPIGAAIHAAFAHSFL  436



>ref|XP_010100519.1| IAA-amino acid hydrolase ILR1-like 2 [Morus notabilis]
 gb|EXB82653.1| IAA-amino acid hydrolase ILR1-like 2 [Morus notabilis]
Length=445

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/406 (68%), Positives = 334/406 (82%), Gaps = 4/406 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             ++D+I+GLAN+  TV+WM+ +RR IH NPELA++EF TS ++R ELDRLGV YRWPVA+T
Sbjct  42    VRDQIVGLANDPNTVKWMKSIRRRIHENPELAFQEFQTSELIRHELDRLGVSYRWPVART  101

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVATIG+GSPPFVALRADMDALPIQELVEWEHKS+ DG+MHACGHD H  MLLGAAKIL
Sbjct  102   GVVATIGTGSPPFVALRADMDALPIQELVEWEHKSKKDGEMHACGHDVHVTMLLGAAKIL  161

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             ++LR  L+GTV+L+FQPAEERG GAKDMI+ G LD V+AI GLHV+  +P GVVA+RP E
Sbjct  162   KELRDLLQGTVVLLFQPAEERGFGAKDMIKEGALDGVEAILGLHVSPDFPTGVVAARPRE  221

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG F A I GKGGHAAIPQ+S+DPILA STSVISLQSIVSRE DP DSQVVSV+MI
Sbjct  222   FLAGCGSFTAKISGKGGHAAIPQQSIDPILAVSTSVISLQSIVSREIDPLDSQVVSVAMI  281

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
               G++FNVIPD+ATI GT+RAF+K SF +L++RIEE+++ QAAVHRCT EIDF G    +
Sbjct  282   HAGTTFNVIPDSATIAGTFRAFSKKSFKALRERIEEVIKGQAAVHRCTAEIDFSGEGQTS  341

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PTIN+ RIY+H ++ SS IVGE+N +L+   MGSEDF  YLDKVPG+F  +G++
Sbjct  342   IP----PTINNERIYKHVQRVSSEIVGEENTQLSNTIMGSEDFAFYLDKVPGSFLMLGIR  397

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHS  323
             NE    ++ PHSPYF +DEDVLPVGAA+HAAFA +YL   +K  +S
Sbjct  398   NENMGAIYSPHSPYFLVDEDVLPVGAAIHAAFAVSYLSDSSKKLNS  443



>gb|KCW86759.1| hypothetical protein EUGRSUZ_B03368 [Eucalyptus grandis]
Length=449

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/397 (69%), Positives = 331/397 (83%), Gaps = 11/397 (3%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L++ +   A +     WM+++RREIH NPELAYEEF TSA+VRRELDRLGV YRWP A T
Sbjct  53    LREYVARRAKDASLAGWMKKIRREIHENPELAYEEFETSALVRRELDRLGVAYRWPTAGT  112

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVAT+GSGSPPFVALRADMDALPIQE+VEWEHKS+VDGKMHACGHDAH AMLLGAAK+L
Sbjct  113   GVVATVGSGSPPFVALRADMDALPIQEMVEWEHKSKVDGKMHACGHDAHVAMLLGAAKVL  172

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q++R  L+GTV+LIFQPAEE GRGAKDMIQ G L+NV+AIFGLH+ H+YP+GVVASRPGE
Sbjct  173   QEVRDHLQGTVVLIFQPAEESGRGAKDMIQGGALENVEAIFGLHLVHRYPIGVVASRPGE  232

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG F A IKGKGGHAAIP  S+DPILAAST+VISLQ+IVSRE       VVSV+MI
Sbjct  233   FLAGCGSFNARIKGKGGHAAIPHLSIDPILAASTAVISLQNIVSRE-------VVSVAMI  285

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             QGG++FNVIP+TATI GT+RAF+K SFY L +RIEE+++AQA VHRC+ E+D +G  +P+
Sbjct  286   QGGTAFNVIPNTATIGGTFRAFSKKSFYGLGERIEEVIKAQAVVHRCSAEVDLEGNGHPS  345

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT+ND RIY+H  + S+ IVGE+N  L+P   GSEDF  YLDKVPG+F  +G++
Sbjct  346   IP----PTVNDERIYKHVHRVSTEIVGEENTVLSPSFTGSEDFAFYLDKVPGSFLLLGIR  401

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             NEK  +V+PPHSPY+++DEDVL +GAA+HAAFA +Y+
Sbjct  402   NEKVGSVYPPHSPYYSIDEDVLSIGAAIHAAFALSYI  438



>ref|XP_004155341.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1-like [Cucumis 
sativus]
Length=448

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/417 (66%), Positives = 332/417 (80%), Gaps = 4/417 (1%)
 Frame = -1

Query  1573  SSKLPLAVDGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRL  1394
             S  LP      L  +I+ LAN    V WM+ +RR+IH NPELA+EEF TS ++R+ELD L
Sbjct  32    SISLPTNHTSSLTHQIIDLANHPTAVNWMKTIRRKIHENPELAFEEFETSRLIRQELDNL  91

Query  1393  GVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAH  1214
              V YRWPVA TGVVA +GSGSPPFVALRADMDALPI+ELVEWEHKS+V+GKMHAC HDAH
Sbjct  92    RVSYRWPVAGTGVVAFVGSGSPPFVALRADMDALPIEELVEWEHKSKVEGKMHACSHDAH  151

Query  1213  TAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKY  1034
              AMLLGA KIL QLR +L+GTV+L+FQPAEE+G GAKDMI  G LD V+AIFGLHV H+Y
Sbjct  152   VAMLLGATKILNQLRHKLQGTVVLVFQPAEEKGGGAKDMINEGALDGVEAIFGLHVVHEY  211

Query  1033  PVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDP  854
             PVGVVASRPGEFLAGCG FKA IKGKGGHAAIPQ+S+DPILAAS ++ISLQSIVSRE DP
Sbjct  212   PVGVVASRPGEFLAGCGSFKAKIKGKGGHAAIPQDSIDPILAASAAIISLQSIVSREIDP  271

Query  853   FDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTV  674
              DSQVVSV+M+Q G++ NVIP++ATI GT+RAF+K SF +L+ RIEE++  QA VHRCT 
Sbjct  272   LDSQVVSVAMVQAGTALNVIPESATIAGTFRAFSKKSFNALRDRIEEVINGQAVVHRCTA  331

Query  673   EIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDK  494
             EIDF G E+PT P    P +ND +IYEH R+ S  IVG++  +++P  MGSEDF  + DK
Sbjct  332   EIDFLGKEHPTIP----PMVNDEKIYEHVRRVSMEIVGKEKTKVSPRLMGSEDFAFFADK  387

Query  493   VPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHS  323
             VPG+F F+G  NE+   + PPHSP + +DE+VLP+GAA+HAA AY+YLL+ +   HS
Sbjct  388   VPGSFLFLGTYNERIGAIHPPHSPRYKIDENVLPLGAAIHAAVAYSYLLNSSSTSHS  444



>ref|XP_003532037.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
Length=443

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/396 (69%), Positives = 329/396 (83%), Gaps = 4/396 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             LK +I+ LAN   TV+WM+R+RREIH +PELAYEEF TSAV+RRELD LGV+Y+WPVA T
Sbjct  42    LKQQILELANSPSTVKWMKRIRREIHEHPELAYEEFRTSAVIRRELDLLGVEYKWPVAGT  101

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVA IG GSPPFVALRADMDALPIQE+V+W+HKS+VDGKMHAC HDAH AMLLGAAKIL
Sbjct  102   GVVAKIGYGSPPFVALRADMDALPIQEMVDWDHKSKVDGKMHACAHDAHVAMLLGAAKIL  161

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q+++  L+ TV+LIFQPAEERG GAKDMIQ  VL++V AI GLH+  +YP GVVASRPGE
Sbjct  162   QEMKDMLQTTVVLIFQPAEERGTGAKDMIQEQVLEDVGAILGLHLGAEYPTGVVASRPGE  221

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG F+A IKGKGG A +PQ   DP+LAASTSVISLQ+IVSRE DP DSQV+SV+MI
Sbjct  222   FLAGCGSFEAKIKGKGGLAGVPQHCFDPVLAASTSVISLQNIVSREADPLDSQVLSVAMI  281

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
               GS+ ++IPD+AT  GTYRAF+K SFY L+KRIEE+++ QA VHRC+ E++F G E+PT
Sbjct  282   NAGSAHDIIPDSATFGGTYRAFSKKSFYGLRKRIEEVIKGQAEVHRCSGEVEFCGNEHPT  341

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT NDVRIY+ AR+ SS IVGEDN+ELAP   GSEDF  YL+KVPG+F  +G +
Sbjct  342   IP----PTTNDVRIYQLARQVSSKIVGEDNIELAPLFTGSEDFAFYLEKVPGSFVLVGTR  397

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTY  353
             NEKS ++ P HSPYF +DEDVLP+GAA+HAAFA +Y
Sbjct  398   NEKSGSIHPAHSPYFFIDEDVLPIGAALHAAFALSY  433



>ref|XP_004135471.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1-like [Cucumis 
sativus]
 gb|KGN51840.1| hypothetical protein Csa_5G603370 [Cucumis sativus]
Length=482

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/417 (66%), Positives = 332/417 (80%), Gaps = 4/417 (1%)
 Frame = -1

Query  1573  SSKLPLAVDGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRL  1394
             S  LP      L  +I+ LAN    V WM+ +RR+IH NPELA+EEF TS ++R+ELD L
Sbjct  66    SISLPTNHTSSLTHQIIDLANHPTAVNWMKTIRRKIHENPELAFEEFETSRLIRQELDNL  125

Query  1393  GVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAH  1214
              V YRWPVA TGVVA +GSGSPPFVALRADMDALPI+ELVEWEHKS+V+GKMHAC HDAH
Sbjct  126   RVSYRWPVAGTGVVAFVGSGSPPFVALRADMDALPIEELVEWEHKSKVEGKMHACSHDAH  185

Query  1213  TAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKY  1034
              AMLLGA KIL QLR +L+GTV+L+FQPAEE+G GAKDMI  G LD V+AIFGLHV H+Y
Sbjct  186   VAMLLGATKILNQLRHKLQGTVVLVFQPAEEKGGGAKDMINEGALDGVEAIFGLHVVHEY  245

Query  1033  PVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDP  854
             PVGVVASRPGEFLAGCG FKA IKGKGGHAAIPQ+S+DPILAAS ++ISLQSIVSRE DP
Sbjct  246   PVGVVASRPGEFLAGCGSFKAKIKGKGGHAAIPQDSIDPILAASAAIISLQSIVSREIDP  305

Query  853   FDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTV  674
              DSQVVSV+M+Q G++ NVIP++ATI GT+RAF+K SF +L+ RIEE++  QA VHRCT 
Sbjct  306   LDSQVVSVAMVQAGTALNVIPESATIAGTFRAFSKKSFNALRDRIEEVINGQAVVHRCTA  365

Query  673   EIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDK  494
             EIDF G E+PT P    P +ND +IYEH R+ S  IVG++  +++P  MGSEDF  + DK
Sbjct  366   EIDFLGKEHPTIP----PMVNDEKIYEHVRRVSMEIVGKEKTKVSPRLMGSEDFAFFADK  421

Query  493   VPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHS  323
             VPG+F F+G  NE+   + PPHSP + +DE+VLP+GAA+HAA AY+YLL+ +   HS
Sbjct  422   VPGSFLFLGTYNERIGAIHPPHSPRYKIDENVLPLGAAIHAAVAYSYLLNSSSTSHS  478



>ref|XP_008446258.1| PREDICTED: LOW QUALITY PROTEIN: IAA-amino acid hydrolase ILR1-like 
4 [Cucumis melo]
Length=478

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/406 (67%), Positives = 328/406 (81%), Gaps = 4/406 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L+ +I+ LAN   TV WM+ +RR+IH NPELA+EEF TS ++R+ELD L V YRWPVA T
Sbjct  73    LRHQILDLANHPTTVNWMKTIRRKIHENPELAFEEFETSRLIRQELDNLRVSYRWPVAGT  132

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVA +GSGSPPFVALRADMDALPI+ELVEWEHKS+V+GKMHAC HDAH AMLLGA KIL
Sbjct  133   GVVAFVGSGSPPFVALRADMDALPIEELVEWEHKSKVEGKMHACSHDAHVAMLLGATKIL  192

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
              QLR +L+GTV+L+FQPAEE+G GAKDMI  G LD V+AIFGLHV HKYPVGVVASRPGE
Sbjct  193   NQLRHKLQGTVVLVFQPAEEKGGGAKDMINEGALDGVEAIFGLHVVHKYPVGVVASRPGE  252

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG FKA IKGKGGHAAIPQ+S+DPILAAS ++ISLQSIVSRE DP DSQVVSV+M+
Sbjct  253   FLAGCGSFKAKIKGKGGHAAIPQDSIDPILAASAAIISLQSIVSREIDPLDSQVVSVAMV  312

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             Q G++ NVIP++ATI GT+RAF+K SF +L+ RIEE++  QA VHRCT EIDF G E PT
Sbjct  313   QAGTALNVIPESATIAGTFRAFSKKSFNALRDRIEEVINGQAVVHRCTAEIDFLGKEYPT  372

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    P IND +IYEH R+ S  IVG++  +     MGSEDF  + DKVPG+F F+G  
Sbjct  373   IP----PMINDEKIYEHVRRVSMEIVGKEKQKYLQAXMGSEDFAFFADKVPGSFLFLGTY  428

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHS  323
             NE+   + PPHSP++ +DE+VLP+GAA+HAA AY+YLL+ +   HS
Sbjct  429   NERIGAIHPPHSPHYKIDENVLPIGAAIHAAVAYSYLLNSSSTSHS  474



>ref|XP_011071286.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2 [Sesamum indicum]
Length=663

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/402 (67%), Positives = 332/402 (83%), Gaps = 4/402 (1%)
 Frame = -1

Query  1549  DGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPV  1370
             +  L D +  LANE ET+ W++ +RREIH+NPELA++EF TSA+VR EL+++GV+YRWPV
Sbjct  258   NASLTDYVKELANEPETLNWLKNIRREIHKNPELAFQEFNTSALVRLELEKMGVRYRWPV  317

Query  1369  AKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAA  1190
             A+TGVVA IG+G+PPFVALRADMDALPIQE+ EWEHKSQ+DGKMHACGHDAH AMLLGAA
Sbjct  318   ARTGVVAAIGTGAPPFVALRADMDALPIQEMREWEHKSQIDGKMHACGHDAHVAMLLGAA  377

Query  1189  KILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASR  1010
             KILQ+L   L GTV+LIFQPAEE G GAK+MI+ GVLDNV AI GLH  HKYP G VASR
Sbjct  378   KILQELSNYLHGTVILIFQPAEENGEGAKEMIREGVLDNVSAILGLHTVHKYPSGTVASR  437

Query  1009  PGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSV  830
             PG+FLAGCG FKA I+GKGGHAA P  SVDPILAAS S+ SLQSIVSRE DP DSQVVSV
Sbjct  438   PGQFLAGCGSFKAVIRGKGGHAAAPHNSVDPILAASVSISSLQSIVSRELDPMDSQVVSV  497

Query  829   SMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTE  650
             + ++GGS F+VIP++ATI GT+RAF ++SF +L+KRIEE++  QAAVHRC  +I+FDG +
Sbjct  498   TTVRGGSGFDVIPESATIAGTFRAFGRESFCALRKRIEEVIDGQAAVHRCLADIEFDGKD  557

Query  649   NPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFI  470
             +PT P    PTIND RIY+H  + S ++VGE+   LAP  MGSEDF +Y+++V G F  +
Sbjct  558   HPTLP----PTINDERIYKHVEQVSRMVVGEETTLLAPHFMGSEDFAVYMERVAGTFLLL  613

Query  469   GVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLS  344
             GV+NEK  +V+PPHSPY+T+DEDVLP+GA +HA FA++YLL+
Sbjct  614   GVRNEKVGSVYPPHSPYYTIDEDVLPIGATIHATFAFSYLLT  655



>ref|XP_006602366.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
 gb|KHN28274.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=441

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/396 (69%), Positives = 324/396 (82%), Gaps = 4/396 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             LK +I+ LAN   TV+WM+R+RREIH +PELAYEEF TSA++RRELD LGV Y+WPVA T
Sbjct  40    LKQQILELANSPRTVKWMKRIRREIHEHPELAYEEFRTSAIIRRELDLLGVGYKWPVAGT  99

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVA IGSGSPPFVALRADMDALPIQE+V+W+HKS+VDGKMHAC HDAH AMLLGAAKIL
Sbjct  100   GVVAKIGSGSPPFVALRADMDALPIQEMVDWDHKSKVDGKMHACAHDAHVAMLLGAAKIL  159

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q+++  L+ TV+LIFQPAEERG GAKDMIQ  VL +V AI GLH+   YP GVVASRPGE
Sbjct  160   QEMQDMLQTTVVLIFQPAEERGTGAKDMIQEQVLQDVGAILGLHLGAAYPTGVVASRPGE  219

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG FKA I GKGG A +P    DP+LAASTSVISLQ+IVSRE DP DSQV+SV+MI
Sbjct  220   FLAGCGSFKAKINGKGGLAGVPHHCFDPVLAASTSVISLQNIVSREADPLDSQVLSVAMI  279

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
               GS+ ++IPD+AT  GTYRAF+K SFY L+KRIEE+++ QA VHRC+ E++F G E+PT
Sbjct  280   HAGSAHDIIPDSATFGGTYRAFSKKSFYGLRKRIEEVIKGQAEVHRCSGEVEFFGNEHPT  339

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT NDVRIY+ AR  SS IVGEDN+ELAP   GSEDF  YL+KVPG+F  +G +
Sbjct  340   IP----PTTNDVRIYQLARLVSSKIVGEDNIELAPLFTGSEDFAFYLEKVPGSFVLVGTR  395

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTY  353
             NEKS ++ P HSPYF +DEDVLP+GAA+HAAFA ++
Sbjct  396   NEKSGSIHPAHSPYFFIDEDVLPIGAAIHAAFALSF  431



>ref|XP_010272050.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2 [Nelumbo nucifera]
Length=439

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/397 (66%), Positives = 326/397 (82%), Gaps = 5/397 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             ++D I+ L+N  +TV W++++RR+IH +PELAYEE+ TS ++R ELD++G++YRWPVAKT
Sbjct  40    IRDEIIRLSNAPDTVNWLKKIRRKIHEHPELAYEEYETSKLIRSELDQMGIEYRWPVAKT  99

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVATIGSGSPPFVALRADMDALPIQE+VEWEHKS+V GKMHACGHDAH  MLLGAAKIL
Sbjct  100   GVVATIGSGSPPFVALRADMDALPIQEMVEWEHKSKVAGKMHACGHDAHVTMLLGAAKIL  159

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q+LR  LKGTV+LIFQPAEERG GA  M + G L NV+AIF +H  ++YP GVVASRPGE
Sbjct  160   QELRTTLKGTVVLIFQPAEERGDGALKMAEEGALRNVEAIFAMHTVYQYPTGVVASRPGE  219

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG FKA I GKGGHAAIPQ SVDP+LAAS S+ISLQ+IVSRETDP DSQVVSVS  
Sbjct  220   FLAGCGSFKAKISGKGGHAAIPQHSVDPVLAASASIISLQNIVSRETDPLDSQVVSVSNF  279

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             Q G+++N+IPD+A I GT+RAF K++   LK RIEE+++ QAAVHRC+V++DF   E P 
Sbjct  280   QAGTAYNIIPDSALIGGTFRAFRKNNLNVLKTRIEEVIKGQAAVHRCSVDVDFS-VERPM  338

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT+ND R+Y+   + S+ I+G DN+ +AP  MGSEDF  YLD++PG F  IG +
Sbjct  339   IP----PTVNDKRLYDLMHRVSTGIIGHDNMHVAPCYMGSEDFAFYLDQIPGTFLLIGTR  394

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             NEK   ++PPHSPY+T+DEDVLP+GAA+HAAFA++YL
Sbjct  395   NEKIGAIYPPHSPYYTIDEDVLPIGAAIHAAFAHSYL  431



>ref|XP_010254871.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Nelumbo nucifera]
Length=446

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/397 (65%), Positives = 326/397 (82%), Gaps = 4/397 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             ++D I+ LAN  ETV W++ +RR+IH  PELAYEEF TS ++RREL R+GV+YRWPVAKT
Sbjct  47    IRDEIIRLANAPETVNWLKNIRRKIHEQPELAYEEFETSKLIRRELHRIGVEYRWPVAKT  106

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVATIGSG PPFVALRADMDALPIQE+VEWEHKS+V+GKMHACGHDAH  MLLGAAKIL
Sbjct  107   GVVATIGSGCPPFVALRADMDALPIQEMVEWEHKSKVEGKMHACGHDAHVTMLLGAAKIL  166

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q+LR  LKGTV+LIFQPAEERG+GA+ MI+ G L+NV+AIF +H   +Y  GVVASRPGE
Sbjct  167   QELRTTLKGTVVLIFQPAEERGKGAQKMIEEGALENVEAIFAMHTMSQYHTGVVASRPGE  226

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG FKA I GKGGHAAIPQ SVDP+LAAS S+ISLQ+IVSRETDP DSQVVSVS  
Sbjct  227   FLAGCGGFKAKISGKGGHAAIPQHSVDPVLAASASIISLQNIVSRETDPLDSQVVSVSNF  286

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
               G+ +N+IPD A I GT+RAF +    +LK+RIEE+++ QAAVHRC+V+++F   E+P 
Sbjct  287   NAGTEYNIIPDEAIIGGTFRAFRRKKLKALKQRIEEVIKGQAAVHRCSVDMEFSVEEHPM  346

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT+N+ R+Y+    +S+ IVGE+N+  AP  MGSEDF  YL+++PG+F  IG++
Sbjct  347   IP----PTVNNERVYDLMHHASTQIVGENNMHTAPCSMGSEDFAFYLEQIPGSFLLIGIR  402

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             NE+  +++P H+PY+T+DED+LP+GAA+HAAFA++YL
Sbjct  403   NERVGSIYPAHNPYYTIDEDILPIGAAIHAAFAHSYL  439



>ref|XP_008353108.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Malus domestica]
Length=381

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/373 (71%), Positives = 319/373 (86%), Gaps = 4/373 (1%)
 Frame = -1

Query  1468  IHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSPPFVALRADMDALP  1289
             +H NPEL+YEE  TSA++RRELD+LGV Y+WPVAKTGVVATIGSGSPPFVALRADMDALP
Sbjct  1     MHENPELSYEEIETSALIRRELDKLGVAYKWPVAKTGVVATIGSGSPPFVALRADMDALP  60

Query  1288  IQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRG  1109
             IQE+V+WE+KS+V+GKMHACGHD H AMLLGAAK+L+QL+  L+GTV+LIFQPAEERG G
Sbjct  61    IQEMVDWENKSKVEGKMHACGHDGHVAMLLGAAKVLEQLQDTLQGTVVLIFQPAEERGAG  120

Query  1108  AKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQE  929
             AKDMI+ GVLDNV+A+FG+HVA  YP GVVA RPGEFLAGCG FKA I GKGGHAAIPQ+
Sbjct  121   AKDMIEEGVLDNVEAVFGMHVAPIYPTGVVALRPGEFLAGCGSFKAKIHGKGGHAAIPQQ  180

Query  928   SVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNK  749
             S+DPILAASTSVISLQ+I+SRETDP DSQVVSV++I+ G+SFNVIP +ATI+GT+RAF+K
Sbjct  181   SIDPILAASTSVISLQNIISRETDPLDSQVVSVAVIKAGTSFNVIPQSATISGTFRAFSK  240

Query  748   DSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSL  569
              +   L KRIEE+V+ QAAVHRC+ E++F G E+    PT+ PT+ND RIYE  R+ SS 
Sbjct  241   KNLNGLMKRIEEVVKGQAAVHRCSAEVEFFGKEH----PTILPTVNDERIYEQVRRISSE  296

Query  568   IVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPV  389
             IVGE+N++LA   MGSEDF  YLDKVPG   F+G +NEK   +  PHSP++ LDEDVLP+
Sbjct  297   IVGEENIKLAHTFMGSEDFAFYLDKVPGFMLFLGARNEKIGAIHAPHSPHYILDEDVLPI  356

Query  388   GAAVHAAFAYTYL  350
             GAA+HAAFA+++L
Sbjct  357   GAAIHAAFAHSFL  369



>ref|XP_011087079.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2 [Sesamum indicum]
Length=448

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/393 (65%), Positives = 325/393 (83%), Gaps = 5/393 (1%)
 Frame = -1

Query  1519  LANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIG  1340
             LANE ETVEWM  +RREIH+NPELA+EEF TS+++  ELD++G++YRWPVA+TGVVATIG
Sbjct  51    LANEPETVEWMVNIRREIHKNPELAFEEFDTSSLITLELDKMGIEYRWPVARTGVVATIG  110

Query  1339  SGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQL  1160
             SGSPPFVALRADMDALPIQEL EWEHKSQVDGKMHACGHDAH AMLLGAA+ILQ+LR  L
Sbjct  111   SGSPPFVALRADMDALPIQELREWEHKSQVDGKMHACGHDAHMAMLLGAARILQKLRNYL  170

Query  1159  K-GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCG  983
             +       FQPAEE G GAKD+++ GVLDNV AIFGLH  ++YP G VASRPG FLAGCG
Sbjct  171   QLSDXXXXFQPAEENGEGAKDIVREGVLDNVSAIFGLHTVYRYPSGTVASRPGRFLAGCG  230

Query  982   MFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSF  803
              FKA I+G+GGHAA P  S+DP+LAAS S+ISLQ IVSRETDP DSQVVSV+++Q G   
Sbjct  231   SFKAVIRGRGGHAAAPHGSIDPVLAASASIISLQHIVSRETDPLDSQVVSVTIVQCGGDL  290

Query  802   NVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLA  623
             + IP++ATI GT+RAF + SFY+L++RI E+++ QAAVHRC+ ++ FDG E+PT P    
Sbjct  291   DAIPESATIAGTFRAFGRTSFYALRRRIGEVIKGQAAVHRCSADVKFDGKEHPTLP----  346

Query  622   PTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSAT  443
             PTIND  IY+H ++ + ++VGE+  ++AP  MGSEDF +YL++VPG+F  +GV+NE+  +
Sbjct  347   PTINDEEIYQHVQRVTRMVVGEEKTKIAPIFMGSEDFAVYLERVPGSFLLLGVRNEEVGS  406

Query  442   VFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLS  344
             V+PPHSPY+T+DE+VLP+GA +HA FA++YLL+
Sbjct  407   VYPPHSPYYTVDEEVLPIGATIHAIFAFSYLLN  439



>ref|XP_007153678.1| hypothetical protein PHAVU_003G055600g [Phaseolus vulgaris]
 gb|ESW25672.1| hypothetical protein PHAVU_003G055600g [Phaseolus vulgaris]
Length=439

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/396 (67%), Positives = 320/396 (81%), Gaps = 4/396 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             LK +I  LAN   TV+WM+R+RREIH +PELA EEF TSA++RRELD+LGV Y+WPVA T
Sbjct  38    LKQQISELANSPSTVKWMKRIRREIHEHPELANEEFRTSALIRRELDQLGVSYKWPVAGT  97

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVA +GSGSPPFVALRADMDALPIQE VEW+HKS+VDGKMHAC HDAH AMLLGAAKIL
Sbjct  98    GVVAKLGSGSPPFVALRADMDALPIQERVEWDHKSKVDGKMHACAHDAHVAMLLGAAKIL  157

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q+++  L+ TV+LIFQPAEERG GAK+M++  VL++V AI GLH+  +Y  GVVASRPGE
Sbjct  158   QEMKDVLQTTVVLIFQPAEERGTGAKEMVREKVLEDVGAILGLHLGSEYQTGVVASRPGE  217

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG FKA I GKGG A +PQ   DP+LAASTSVISLQ+IVSRE DP DSQV+SV+MI
Sbjct  218   FLAGCGGFKAKISGKGGLAGVPQHCYDPVLAASTSVISLQNIVSREVDPLDSQVLSVAMI  277

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
               G + ++IPD+AT  GTYRAF+K SFY L+KRIEE+++ QA VHRC  E++F G E PT
Sbjct  278   NAGYAHDIIPDSATFGGTYRAFSKKSFYGLRKRIEEVIKGQAEVHRCFAEVEFLGNEQPT  337

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT NDVRIY+ A + SS IVGED V+LAP   GSEDF  YL+KVPG F  +G +
Sbjct  338   IP----PTTNDVRIYQLAHQVSSKIVGEDKVKLAPLFTGSEDFAFYLEKVPGTFILLGTR  393

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTY  353
             NEKS +++P HSPYF +DEDVLP+GAA+HAAFA +Y
Sbjct  394   NEKSGSIYPAHSPYFFIDEDVLPIGAAIHAAFALSY  429



>gb|KHN10633.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=385

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/379 (70%), Positives = 316/379 (83%), Gaps = 4/379 (1%)
 Frame = -1

Query  1489  MRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSPPFVALR  1310
             M+R+RREIH +PELAYEEF TSAV+RRELD LGV+Y+WPVA TGVVA IG GSPPFVALR
Sbjct  1     MKRIRREIHEHPELAYEEFRTSAVIRRELDLLGVEYKWPVAGTGVVAKIGYGSPPFVALR  60

Query  1309  ADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQP  1130
             ADMDALPIQE+V+W+HKS+VDGKMHAC HDAH AMLLGAAKILQ+++  L+ TV+LIFQP
Sbjct  61    ADMDALPIQEMVDWDHKSKVDGKMHACAHDAHVAMLLGAAKILQEMKDMLQTTVVLIFQP  120

Query  1129  AEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIKGKGG  950
             AEERG GAKDMIQ  VL++V AI GLH+  +YP GVVASRPGEFLAGCG F+A IKGKGG
Sbjct  121   AEERGTGAKDMIQEQVLEDVGAILGLHLGAEYPTGVVASRPGEFLAGCGSFEAKIKGKGG  180

Query  949   HAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTATITG  770
              A +PQ   DP+LAASTSVISLQ+IVSRE DP DSQV+SV+MI  GS+ ++IPD+AT  G
Sbjct  181   LAGVPQHCFDPVLAASTSVISLQNIVSREADPLDSQVLSVAMINAGSAHDIIPDSATFGG  240

Query  769   TYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDVRIYEH  590
             TYRAF+K SFY L+KRIEE+++ QA VHRC+ E++F G E+PT P    PT NDVRIY+ 
Sbjct  241   TYRAFSKKSFYGLRKRIEEVIKGQAEVHRCSGEVEFCGNEHPTIP----PTTNDVRIYQL  296

Query  589   ARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVFPPHSPYFTL  410
             AR+ SS IVGEDN+ELAP   GSEDF  YL+KVPG+F  +G +NEKS ++ P HSPYF +
Sbjct  297   ARQVSSKIVGEDNIELAPLFTGSEDFAFYLEKVPGSFVLVGTRNEKSGSIHPAHSPYFFI  356

Query  409   DEDVLPVGAAVHAAFAYTY  353
             DEDVLP+GAA+HA FA +Y
Sbjct  357   DEDVLPIGAALHATFALSY  375



>ref|XP_003628629.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
 gb|AET03105.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=433

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/396 (65%), Positives = 328/396 (83%), Gaps = 6/396 (2%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             LK++I+ +AN   TV+WM+++RREIH  PEL YEEF TS+V+RRELD+LG+ Y+WPVAKT
Sbjct  35    LKNQILEVANNPNTVKWMKQIRREIHEYPELGYEEFRTSSVIRRELDKLGISYQWPVAKT  94

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVA IGSG PPFVALRADMDALPIQELV+W+HKS+VDGKMHAC HDAH AMLLGAAKIL
Sbjct  95    GVVAKIGSGFPPFVALRADMDALPIQELVDWDHKSKVDGKMHACAHDAHVAMLLGAAKIL  154

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q+++ +LK TV+LIFQPAEE+G GA+DMIQ  VL++V+AIFGLH+A +YP+GVVASRPG+
Sbjct  155   QEMKNKLKATVVLIFQPAEEKGIGARDMIQENVLEDVEAIFGLHLATQYPLGVVASRPGD  214

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG FKA I  KGG A IPQ  +DP+LAAS SVISLQ+IVSRE DP DSQVVSV+M+
Sbjct  215   FLAGCGSFKAKI--KGGLAEIPQHCLDPVLAASMSVISLQNIVSREVDPLDSQVVSVAMV  272

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
                S+  +IPD+ T  GTYRA +K SF +L++RIEE+++ QA VHRCT E++F G E+PT
Sbjct  273   HSESAHELIPDSVTFGGTYRAISKKSFNALRQRIEEVIKGQAKVHRCTAEVEFFGKEHPT  332

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT ND RI++  R++SS+IVGE+N++LAP    SEDF  YL+KVPG+FF +G++
Sbjct  333   IP----PTTNDERIHQLGRQASSMIVGEENIKLAPTYTASEDFAFYLEKVPGSFFLLGIQ  388

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTY  353
             NEK  +++  HSP++ +DEDVLP+GAA+HAAFA +Y
Sbjct  389   NEKVGSIYSAHSPHYFIDEDVLPIGAAIHAAFALSY  424



>ref|XP_010928552.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Elaeis guineensis]
Length=472

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/419 (62%), Positives = 329/419 (79%), Gaps = 9/419 (2%)
 Frame = -1

Query  1549  DGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPV  1370
             DG L D I+ L N  +TV+W+R+VRREIH  PELA+EE  TS ++RRELD +GVKYRWP+
Sbjct  58    DGSLIDEIVRLGNLQQTVDWLRKVRREIHEYPELAHEELQTSELIRRELDLMGVKYRWPI  117

Query  1369  AKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAA  1190
             A TGVVATIG+G PP VALRADMDALPIQELVEWEHKS++DGKMHACGHDAH +MLLGAA
Sbjct  118   AGTGVVATIGTGLPPSVALRADMDALPIQELVEWEHKSKIDGKMHACGHDAHVSMLLGAA  177

Query  1189  KILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASR  1010
             KILQ +++ L+GTV+LIFQPAEERG GA  MI+ G L +V+AIF +HV++ YP GVVASR
Sbjct  178   KILQDIKETLQGTVVLIFQPAEERGVGAVQMIEEGALKDVEAIFSMHVSYAYPTGVVASR  237

Query  1009  PGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSV  830
             PGEFL GCG+FKA I G GGHAA   +SVDPILAAS S+ISLQ+++SRE DP DSQV+SV
Sbjct  238   PGEFLTGCGIFKAHISGGGGHAAASHDSVDPILAASASIISLQNLISREADPLDSQVISV  297

Query  829   SMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTE  650
             S   GGSS++ IPD+ T+ GT+RAF K SF  LK+RIEE+++ Q AV+RCT  ++F  ++
Sbjct  298   SSFHGGSSYSTIPDSVTVGGTFRAFTKRSFDVLKQRIEEVIKGQVAVYRCTARLEFFESQ  357

Query  649   NPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFI  470
             +P  P    PT+ND RIYE+ R+ S  +VG  N +++P  MGSEDF  YL+++PG+   I
Sbjct  358   HPPIP----PTVNDDRIYEYVRQVSKEVVGNTNTQMSPRVMGSEDFAFYLEQIPGSLLLI  413

Query  469   GVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL----SHAKPPHSSS*NPN  305
             G +NEK  ++ P HSPY+T+DED LP+GAA+HAAFA+ YLL    S+A+ P+ SS N N
Sbjct  414   GTRNEKIGSIHPQHSPYYTIDEDALPIGAAIHAAFAHVYLLQSTNSNAQSPNFSS-NSN  471



>ref|XP_004509886.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 7-like [Cicer arietinum]
Length=440

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/397 (65%), Positives = 320/397 (81%), Gaps = 5/397 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             LK++I+ LAN    ++WM+ +RREIH  PELAYEEF TS+V+RRELD+LGV Y+WPVAKT
Sbjct  41    LKNQILELANTPNMLKWMKSIRREIHEYPELAYEEFKTSSVIRRELDKLGVVYQWPVAKT  100

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVA IGSG PPFVALRADMDALPIQELV+W+HKS+VDGKMHAC HDAH+AMLLG AKIL
Sbjct  101   GVVAKIGSGFPPFVALRADMDALPIQELVDWDHKSKVDGKMHACAHDAHSAMLLGGAKIL  160

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q+++ +LK TV+LIFQPAEERG GAKDM+   VLD+V+AIFGLH+  +YP+GVVA+RPGE
Sbjct  161   QEMKDKLKATVVLIFQPAEERGVGAKDMVAENVLDDVEAIFGLHLMPEYPLGVVATRPGE  220

Query  1000  FLAGCGMFKATIK-GKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSM  824
             FLAGCG F A I  GK G   I Q  +DP+LAAS SVISLQ+IVSRE DP +SQVVSVS+
Sbjct  221   FLAGCGSFNAKINCGKVGLEGISQRYLDPVLAASASVISLQNIVSREMDPLESQVVSVSV  280

Query  823   IQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENP  644
             I  GS  NVIPD+ T  GTYR FN  SF +L+KRI E+++ Q  VHRC+ E++F G E P
Sbjct  281   INAGSDHNVIPDSVTFGGTYRTFNPKSFIALRKRIGEVIKGQVEVHRCSAEVEFFGREQP  340

Query  643   TFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGV  464
             T P    P  ND RIY+ AR++SS+IVGE+N++LAP   GSEDF  Y++KVPGAF  +G+
Sbjct  341   TVP----PITNDERIYKIARQASSMIVGEENIKLAPTLTGSEDFAYYMEKVPGAFILLGI  396

Query  463   KNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTY  353
             KNE++ ++ P HSP+F +DEDVLP+GAA+HAAFA +Y
Sbjct  397   KNEETGSIHPGHSPHFFIDEDVLPIGAAIHAAFALSY  433



>ref|XP_004509887.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6-like [Cicer arietinum]
Length=427

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/396 (65%), Positives = 319/396 (81%), Gaps = 13/396 (3%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             LK++I+ LAN    ++WM+ +RREIH  PELAYEEF TS+V+RRELD LGV Y+WPVAKT
Sbjct  41    LKNQILELANTPNMLKWMKSIRREIHEYPELAYEEFKTSSVIRRELDNLGVVYQWPVAKT  100

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVA IGSG PPFVA+RADMDALPIQELV+W+HKS+VDGKMHAC HDAH+AMLLGAAKIL
Sbjct  101   GVVAKIGSGFPPFVAIRADMDALPIQELVDWDHKSKVDGKMHACAHDAHSAMLLGAAKIL  160

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q+++ +LKGTV+LIFQPAEERG GAKDMI   VL++V+AIFGLH+  +YP+GVVASR GE
Sbjct  161   QEMKNKLKGTVVLIFQPAEERGVGAKDMIAENVLEDVEAIFGLHLVTQYPLGVVASRSGE  220

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAGCG FKA I G  G   I Q   DP+LAAS SVISLQ+IVSRE DP DSQV+SV+ +
Sbjct  221   FLAGCGSFKAKINGGKG---IHQRCFDPVLAASASVISLQNIVSREIDPLDSQVLSVATV  277

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
               GS      D+ T  GTYRAF+K SF SL+KRIEE+++ Q  VHRC  E++F G E+PT
Sbjct  278   NAGS------DSVTFGGTYRAFSKKSFNSLRKRIEEVIKGQVEVHRCAAEVEFFGREHPT  331

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT ND RIY+ AR++SS+IVGE+N++LAP   GSEDF  Y+DKVPGA+F +G++
Sbjct  332   IP----PTTNDDRIYKLARQASSMIVGEENIKLAPTWTGSEDFAFYMDKVPGAYFLLGIE  387

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTY  353
             NEKS +++  HSP+F +DEDVLP+GAA+HAAFA +Y
Sbjct  388   NEKSGSIYSGHSPHFFIDEDVLPIGAAIHAAFALSY  423



>ref|XP_008244971.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Prunus mume]
Length=433

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/401 (66%), Positives = 316/401 (79%), Gaps = 5/401 (1%)
 Frame = -1

Query  1549  DGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPV  1370
             D  LK +I+GLANE  TV WM+ VRREIH NPELAYEEF TSA++RRELD+LGV Y WPV
Sbjct  26    DYSLKKQIVGLANEFHTVNWMKNVRREIHENPELAYEEFKTSALIRRELDKLGVAYTWPV  85

Query  1369  AKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHT-AMLLGA  1193
             A TGVVATIGSGSPPFVALRADMDALPIQ  +   +   +     AC    +     +  
Sbjct  86    AHTGVVATIGSGSPPFVALRADMDALPIQMYISALYSFSLAFNQSACDKTLYIYKFFIFF  145

Query  1192  AKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVAS  1013
                 +     L+GTV+LIFQPAEERG GAKDMI+ GVLDNV+AIFGLHV H+YP GVVAS
Sbjct  146   RSPYKSTITLLQGTVVLIFQPAEERGIGAKDMIKEGVLDNVEAIFGLHVVHRYPSGVVAS  205

Query  1012  RPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVS  833
             RPGEFLAGCG FKA I GKGGHAAIPQ+S+DPI+AAS SVISLQ+IVSRE DP DSQVVS
Sbjct  206   RPGEFLAGCGSFKAKIHGKGGHAAIPQQSIDPIVAASASVISLQNIVSREADPLDSQVVS  265

Query  832   VSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGT  653
             V+MIQ G+SFN+IP++ATI+GT+RAF+K SF ++++RIEE+V+ QAAVHRC+ EI+F G 
Sbjct  266   VAMIQAGTSFNIIPESATISGTFRAFSKKSFNAIRERIEEVVKGQAAVHRCSAEIEFLGN  325

Query  652   ENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFF  473
             E+P+ P    PTIND RIYE AR+ S+ IVG++N +LAP  MGSEDF  YLDKVPG+  F
Sbjct  326   EHPSIP----PTINDERIYEQARRISTEIVGKENTKLAPTFMGSEDFAFYLDKVPGSMLF  381

Query  472   IGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             +G  NEK   ++ PHSPYF +DEDVLP+GAA+HAAFA++YL
Sbjct  382   LGTGNEKKGAIYAPHSPYFFIDEDVLPIGAAIHAAFAHSYL  422



>gb|AET03754.2| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=425

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/393 (66%), Positives = 311/393 (79%), Gaps = 21/393 (5%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             LK  I+ LAN   TV+WM+ +RREIH  PELAYEEF TS+V+RRELD+LGV Y+WPVAKT
Sbjct  42    LKSEILELANTPNTVKWMKNIRREIHEYPELAYEEFKTSSVIRRELDKLGVVYQWPVAKT  101

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVA +GSG  PFVALRADMDALPIQELV+W+HKS+VDGKMHAC HDAH AMLLGAAKIL
Sbjct  102   GVVAKVGSGFAPFVALRADMDALPIQELVDWDHKSKVDGKMHACAHDAHVAMLLGAAKIL  161

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q+++ +LKGTV+LIFQPAEE+G GAKDMIQ  VL++V+AIFGLH+A  YP+GVVASRPGE
Sbjct  162   QEMKDKLKGTVVLIFQPAEEKGTGAKDMIQENVLEDVEAIFGLHLASLYPLGVVASRPGE  221

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAG G FKA I  KGG A  PQ  +DPILAAS SVISLQ+I+SRE DP DSQV+SV+MI
Sbjct  222   FLAGYGSFKAKI--KGGLAGTPQRCLDPILAASASVISLQNIISREVDPLDSQVLSVAMI  279

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             Q  S   + PD+ T  GTYRAF+K SF +L+ RIEE+++ Q               E+PT
Sbjct  280   QSESGHELTPDSVTFGGTYRAFSKKSFNALRNRIEEVIKGQ---------------EHPT  324

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT ND RIY+ ARK SS+IVGE+N++L+P   GSEDF  YL+KVPG+FFF+G+K
Sbjct  325   IP----PTTNDERIYQLARKVSSMIVGEENIKLSPIVTGSEDFAFYLEKVPGSFFFLGIK  380

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFA  362
             NEKS +++  HSP F +DEDVLP+GAA+HAAFA
Sbjct  381   NEKSGSIYSAHSPQFFIDEDVLPIGAAIHAAFA  413



>ref|XP_003629278.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=424

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/393 (66%), Positives = 311/393 (79%), Gaps = 21/393 (5%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             LK  I+ LAN   TV+WM+ +RREIH  PELAYEEF TS+V+RRELD+LGV Y+WPVAKT
Sbjct  41    LKSEILELANTPNTVKWMKNIRREIHEYPELAYEEFKTSSVIRRELDKLGVVYQWPVAKT  100

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVA +GSG  PFVALRADMDALPIQELV+W+HKS+VDGKMHAC HDAH AMLLGAAKIL
Sbjct  101   GVVAKVGSGFAPFVALRADMDALPIQELVDWDHKSKVDGKMHACAHDAHVAMLLGAAKIL  160

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q+++ +LKGTV+LIFQPAEE+G GAKDMIQ  VL++V+AIFGLH+A  YP+GVVASRPGE
Sbjct  161   QEMKDKLKGTVVLIFQPAEEKGTGAKDMIQENVLEDVEAIFGLHLASLYPLGVVASRPGE  220

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAG G FKA I  KGG A  PQ  +DPILAAS SVISLQ+I+SRE DP DSQV+SV+MI
Sbjct  221   FLAGYGSFKAKI--KGGLAGTPQRCLDPILAASASVISLQNIISREVDPLDSQVLSVAMI  278

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             Q  S   + PD+ T  GTYRAF+K SF +L+ RIEE+++ Q               E+PT
Sbjct  279   QSESGHELTPDSVTFGGTYRAFSKKSFNALRNRIEEVIKGQ---------------EHPT  323

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT ND RIY+ ARK SS+IVGE+N++L+P   GSEDF  YL+KVPG+FFF+G+K
Sbjct  324   IP----PTTNDERIYQLARKVSSMIVGEENIKLSPIVTGSEDFAFYLEKVPGSFFFLGIK  379

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFA  362
             NEKS +++  HSP F +DEDVLP+GAA+HAAFA
Sbjct  380   NEKSGSIYSAHSPQFFIDEDVLPIGAAIHAAFA  412



>gb|AFK39723.1| unknown [Medicago truncatula]
Length=391

 Score =   505 bits (1300),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 241/356 (68%), Positives = 290/356 (81%), Gaps = 6/356 (2%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             LK  I+ LAN   TV+WM+ +RREIH  PELAYEEF TS+V+RRELD+LGV Y+WPVAKT
Sbjct  42    LKSEILELANTPNTVKWMKNIRREIHEYPELAYEEFKTSSVIRRELDKLGVVYQWPVAKT  101

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVA +GSG  PFVALRADMDALPIQELV+W+HKS+VDGKMHAC HDAH AMLLGAAKIL
Sbjct  102   GVVAKVGSGFAPFVALRADMDALPIQELVDWDHKSKVDGKMHACAHDAHVAMLLGAAKIL  161

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q+++ +LKGTV+LIFQPAEE+G GAKDMIQ  VL++V+AIFGLH+A  YP+GVVASRPGE
Sbjct  162   QEMKDKLKGTVVLIFQPAEEKGTGAKDMIQENVLEDVEAIFGLHLASLYPLGVVASRPGE  221

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAG G FKA I  KGG A  PQ  +DPILAAS SVISLQ+I+SRE DP DSQV+SV+MI
Sbjct  222   FLAGYGSFKAKI--KGGLAGTPQRCLDPILAASASVISLQNIISREVDPLDSQVLSVAMI  279

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             Q  S   + PD+ T  GTYRAF+K SF +L+ RIEE+++ QA V+RC+ E++F G E+PT
Sbjct  280   QSESGHELTPDSVTFGGTYRAFSKKSFNALRNRIEEVIKGQAEVYRCSAEVEFFGEEHPT  339

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFF  473
              P    PT ND RIY+ ARK SS+IVGE+N++L+P   GSEDF  YL+KVPG+FFF
Sbjct  340   IP----PTTNDERIYQLARKVSSMIVGEENIKLSPIVTGSEDFAFYLEKVPGSFFF  391



>gb|ABR17898.1| unknown [Picea sitchensis]
Length=487

 Score =   504 bits (1298),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 233/398 (59%), Positives = 304/398 (76%), Gaps = 4/398 (1%)
 Frame = -1

Query  1543  GLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAK  1364
             G+   I+ LA   ETVEW++ VRR+IH  PELAY+EF TSA++RRELD +G+KYRWP+A+
Sbjct  75    GVSQEILRLAKLPETVEWLKNVRRKIHERPELAYQEFETSALIRRELDEMGIKYRWPLAE  134

Query  1363  TGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKI  1184
             TGVVA+IG+G PPFVALRADMDALPIQE VEWEHKS+  GKMHACGHDAH  MLLGAAKI
Sbjct  135   TGVVASIGTGGPPFVALRADMDALPIQEEVEWEHKSKNLGKMHACGHDAHATMLLGAAKI  194

Query  1183  LQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPG  1004
             LQ+ +  L+GTV+LIFQPAEE G GAK MI++G L+NV+AIFG+H+A+ +P G V S+PG
Sbjct  195   LQERQHMLQGTVVLIFQPAEEAGAGAKRMIKDGALENVEAIFGMHLAYDHPTGTVMSKPG  254

Query  1003  EFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSM  824
                AGCG FKA I GKGGHAA+P+ ++DPI+AAS S++SLQ +VSRET+P DSQVV+V+ 
Sbjct  255   PLTAGCGFFKAVITGKGGHAALPELAIDPIIAASASIVSLQHLVSRETNPLDSQVVTVTT  314

Query  823   IQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENP  644
               GG +FNVIPD+ TI+GT+RAF+ +SFY LK+RIEEI+  Q+ V RC   ++F   E P
Sbjct  315   SSGGDAFNVIPDSVTISGTFRAFSNESFYRLKQRIEEIIVGQSLVQRCAATVEFLEKEYP  374

Query  643   TFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGV  464
               P    PT+N+  +++H  K ++ +VG  N+++A   M  EDF  Y + +P  FF  G+
Sbjct  375   FIP----PTVNNQIMHDHVCKVAADLVGSHNLKIATPLMAGEDFAFYTEVIPADFFLFGM  430

Query  463   KNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             KNE   ++  PH+  FT+DE+VLP+GAA+HAA A  YL
Sbjct  431   KNETCGSIHAPHTSLFTVDENVLPLGAAMHAAIAERYL  468



>ref|XP_009417547.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Musa acuminata 
subsp. malaccensis]
Length=461

 Score =   503 bits (1296),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 248/411 (60%), Positives = 313/411 (76%), Gaps = 5/411 (1%)
 Frame = -1

Query  1567  KLPLAVDGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGV  1388
             +L  +V+  +   I+ LAN  ETV+W+R+VRR+IH  PELA+EEF TS  +RRELD +G+
Sbjct  52    QLETSVEESVTREIVRLANAPETVDWIRKVRRDIHEFPELAHEEFVTSERIRRELDLMGI  111

Query  1387  KYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTA  1208
              Y+WPVA TGVVATIG+G PPFVALRADMDALPIQELVEWEHKS+V GKMHACGHDAH +
Sbjct  112   AYKWPVAGTGVVATIGTGLPPFVALRADMDALPIQELVEWEHKSKVKGKMHACGHDAHVS  171

Query  1207  MLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPV  1028
             MLLGAAKILQ LR  L+GTV+L+FQPAEE+G GA +MI+ G L  V+AI G+HVA+ +P 
Sbjct  172   MLLGAAKILQGLRHTLQGTVVLLFQPAEEKGVGASEMIREGALRGVEAILGMHVAYIFPT  231

Query  1027  GVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFD  848
             GVVASRPGEFLAGCG F+A ++ +       Q S DPILAAS SVISLQS+VSRE  P +
Sbjct  232   GVVASRPGEFLAGCGNFRAIVR-RRSLGVTRQGSTDPILAASASVISLQSLVSREASPLE  290

Query  847   SQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEI  668
             +QVVSV+ + GG S++ +PD+ TI+GT+R F+K SF  +  RIEE++RAQAAV+RCT EI
Sbjct  291   AQVVSVTKVDGGDSYSTVPDSVTISGTFRVFSKRSFNEITSRIEEVIRAQAAVYRCTAEI  350

Query  667   DFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVP  488
             +F  +E P  P    PT+ND  I+E+ ++ S  +VGE    +AP  MGSEDF  +L++VP
Sbjct  351   EFLESEEPPIP----PTVNDRAIHEYVQQVSREVVGEKKTRVAPQVMGSEDFAFFLEEVP  406

Query  487   GAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
             G    IG  NE+  ++ PPHSPYFT+DED LPVGAA+HAAFA+ YLL  A 
Sbjct  407   GTLLLIGTYNERIGSIHPPHSPYFTIDEDALPVGAAIHAAFAHFYLLKSAN  457



>ref|XP_002303219.1| putative auxin-amidohydrolase precursor family protein [Populus 
trichocarpa]
 gb|EEE78198.1| putative auxin-amidohydrolase precursor family protein [Populus 
trichocarpa]
Length=438

 Score =   501 bits (1289),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 246/406 (61%), Positives = 304/406 (75%), Gaps = 6/406 (1%)
 Frame = -1

Query  1558  LAVDGG--LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVK  1385
             L+++G   +  R +  A + E  +WM  VRR+IH NPEL +EEF TS +VR ELD++GVK
Sbjct  20    LSLNGSSDIPSRFLNYAKKEELFDWMVGVRRKIHENPELGFEEFETSKLVRAELDKIGVK  79

Query  1384  YRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAM  1205
             Y+ P++ TGVV  IGSG PPFVALRADMDAL +QE+VEWE+KS+V GKMHACGHD+H AM
Sbjct  80    YKHPLSVTGVVGFIGSGKPPFVALRADMDALAMQEMVEWEYKSKVPGKMHACGHDSHVAM  139

Query  1204  LLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVG  1025
             LLGAAKILQ  R++LKGTV+LIFQPAEE G GAK MI  G L+NV+AIFGLHVA+K P+G
Sbjct  140   LLGAAKILQDHREELKGTVVLIFQPAEEGGGGAKKMIDEGALENVNAIFGLHVANKLPIG  199

Query  1024  VVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDS  845
              VASR G  LAG G F+A I GKGGHAAIPQ S+DPILAAS  ++SLQ +VSRE DP DS
Sbjct  200   EVASRHGPLLAGSGFFEAVISGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDS  259

Query  844   QVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEID  665
             QVV+V+  QGG +FNVIPD+ TI GT+RAF K+SF  LK+RIEE+V  QAAV RC   I+
Sbjct  260   QVVTVAKFQGGGAFNVIPDSVTIGGTFRAFLKESFMQLKQRIEEVVTGQAAVQRCKAVIN  319

Query  664   FDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPG  485
             F   E P FP    PTIND  ++++ R  +S ++G D V+     MGSEDF  Y + +PG
Sbjct  320   FLENEKPFFP----PTINDKYLHDYFRIVASDMLGIDKVKDMQPLMGSEDFAFYQEMIPG  375

Query  484   AFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
              FFFIG++NE    +  PHSPYF ++EDVLP GAA+HA+ A  YLL
Sbjct  376   YFFFIGMQNETHKQLQSPHSPYFEINEDVLPYGAALHASLAARYLL  421



>gb|ABK24715.1| unknown [Picea sitchensis]
Length=476

 Score =   501 bits (1290),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 234/396 (59%), Positives = 297/396 (75%), Gaps = 4/396 (1%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
             I+ +AN  E VEW++R+RR IH +PELAYEEF TS ++R ELD++ V YR+PVA+TGVVA
Sbjct  78    IVEVANLPENVEWLKRIRRRIHEHPELAYEEFETSKLIRHELDQMNVSYRYPVARTGVVA  137

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
             +IG+G+PPFVALRADMDALPIQE VEWEHKS+  GKMHACGHDAH  MLLG AKILQQ +
Sbjct  138   SIGNGNPPFVALRADMDALPIQEAVEWEHKSKSPGKMHACGHDAHVTMLLGGAKILQQRQ  197

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
               L+GTV+L+FQPAEE G G+K MI  G L+NV+ IF +HV+  YP  V+ S+PG  LAG
Sbjct  198   HLLQGTVILLFQPAEESGAGSKRMIAEGALENVEGIFAMHVSSDYPTSVIGSKPGPLLAG  257

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
             CG FKA I GKGGHAAIPQ S+DPILA S SV+SLQ +VSRE +P DSQVVSV+   GG 
Sbjct  258   CGFFKAVITGKGGHAAIPQHSIDPILAGSASVVSLQHLVSREANPLDSQVVSVAAFNGGG  317

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
             + NVIPD+ TI GT+RAF+ +SFY L++RIEE++  QAAVHRCT  +DF   E+  +PPT
Sbjct  318   ALNVIPDSVTIGGTFRAFSNESFYRLRQRIEEVILGQAAVHRCTAVVDFFEKEDQFYPPT  377

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
                  ND  +++H  + ++ +VG  N ++ P  MG+EDF  Y +  P AFF+IG++NE  
Sbjct  378   F----NDKDMHKHVHRVAADVVGVHNFKIVPPMMGAEDFVFYTEVTPAAFFYIGMRNEAI  433

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
              +    HSPYF +DE+VLP GAA+HAA A  +L  H
Sbjct  434   GSTRSGHSPYFMIDENVLPTGAAMHAAIAERFLNEH  469



>gb|ACZ56438.1| IAA-amino acid hydrolase [Populus tomentosa]
Length=438

 Score =   499 bits (1284),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 244/409 (60%), Positives = 301/409 (74%), Gaps = 4/409 (1%)
 Frame = -1

Query  1573  SSKLPLAVDGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRL  1394
             S  L L     +  R +  A + E  +WM  VRR+IH NPEL YEEF TS ++R ELD++
Sbjct  17    SPILSLNGSSDIPSRFLNYAKKEELFDWMVGVRRKIHENPELGYEEFETSKLIRAELDKI  76

Query  1393  GVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAH  1214
             GVKY+ P++ TGVV  IGSG PPFVA+RADMDAL +QE+VEWE+KS+V GKMHACGHD+H
Sbjct  77    GVKYKHPLSVTGVVGFIGSGEPPFVAVRADMDALAMQEMVEWEYKSKVPGKMHACGHDSH  136

Query  1213  TAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKY  1034
              AMLLGAAKILQ  R++LKGTV LIFQPAEE G GAK MI  G L+NV+AIFGLHVA+K 
Sbjct  137   VAMLLGAAKILQDHREELKGTVALIFQPAEEGGGGAKKMIDEGALENVNAIFGLHVANKL  196

Query  1033  PVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDP  854
             P+G VASR G  LAG G F+A I GKGGHAAIPQ S+DPILAAS  ++SLQ +VSRE DP
Sbjct  197   PIGEVASRHGPLLAGSGFFEAVISGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADP  256

Query  853   FDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTV  674
              DSQVV+V+  QGG +FNVIPD+ TI GT+RAF K+SF  L++RIEE+V  QAAV RC  
Sbjct  257   LDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFLKESFMQLRQRIEEVVTGQAAVQRCKA  316

Query  673   EIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDK  494
              I+F   E P FP    PTIND  ++++ R  +S ++G D V+     MGSEDF  Y +K
Sbjct  317   VINFLENEKPFFP----PTINDKNLHDYFRVVASDVLGTDKVKDMQPLMGSEDFAFYQEK  372

Query  493   VPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             +PG FFF+G++NE    +  PHSPYF ++EDVLP GAA+H + A  YLL
Sbjct  373   IPGYFFFLGMQNETRKQLQSPHSPYFEINEDVLPYGAALHVSLAARYLL  421



>emb|CAG32961.1| putative auxin-amidohydrolase precursor [Populus tremula x Populus 
alba]
Length=438

 Score =   497 bits (1279),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 244/409 (60%), Positives = 301/409 (74%), Gaps = 4/409 (1%)
 Frame = -1

Query  1573  SSKLPLAVDGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRL  1394
             S  L L     +  R +  A + E  +WM  VRR+IH NPEL YEEF TS ++R ELD++
Sbjct  17    SPILSLNGSSDIPSRFLNHAKKEELFDWMVGVRRKIHENPELGYEEFETSKLIRAELDKI  76

Query  1393  GVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAH  1214
             GVKY+ P++ TGVV  IGSG PPFVALRADMDAL +QE+VEWE+KS+V GKMHACGHD+H
Sbjct  77    GVKYKHPLSVTGVVGFIGSGEPPFVALRADMDALAMQEMVEWEYKSKVPGKMHACGHDSH  136

Query  1213  TAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKY  1034
              AMLLGAAKILQ  R++LKGTV+LIFQPAEE G GAK MI  G L+NV+AIFGLHVA+K 
Sbjct  137   VAMLLGAAKILQDHREELKGTVVLIFQPAEEGGGGAKKMIDEGALENVNAIFGLHVANKL  196

Query  1033  PVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDP  854
             P+G VASR G  LAG G F+A I GKGGHAAIPQ S+DPILAAS  ++SLQ +VSRE DP
Sbjct  197   PIGEVASRHGPLLAGSGFFEAVISGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADP  256

Query  853   FDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTV  674
              DSQVV+V+  QGG +FNVIPD+ T  GT+RAF K+SF  L++RIEE+V  QAAV RC  
Sbjct  257   LDSQVVTVAKFQGGGAFNVIPDSVTTGGTFRAFLKESFMQLRQRIEEVVTGQAAVQRCKA  316

Query  673   EIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDK  494
              I+    E P FP    PTIND  ++++ R  +S ++G D V+     MGSEDF  Y +K
Sbjct  317   VINLLENEKPFFP----PTINDKNLHDYFRVVASDVLGIDKVKDMQPLMGSEDFAFYQEK  372

Query  493   VPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             +PG FFF+G++NE    +  PHSPYF ++EDVLP GAA+HA+ A  YLL
Sbjct  373   IPGYFFFVGMQNETRKQLQSPHSPYFEINEDVLPYGAALHASLAARYLL  421



>ref|XP_008447583.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Cucumis melo]
Length=449

 Score =   497 bits (1280),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 233/395 (59%), Positives = 295/395 (75%), Gaps = 4/395 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             R +  A E+E  +WM  +RR+IH NPEL +EEF TS ++R ELD+LG+ Y++PVA TGV+
Sbjct  42    RFLQFAKESELFDWMVGIRRKIHENPELGFEEFETSKLIRTELDKLGISYKYPVASTGVI  101

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               +GSG PPFVA+RADMDALP+QELVEWEHKS+V GKMHACGHDAH AM+LGAAKILQ+ 
Sbjct  102   GFVGSGQPPFVAIRADMDALPMQELVEWEHKSKVPGKMHACGHDAHVAMVLGAAKILQKH  161

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
              ++LKGTV+L+FQPAEE G GA  +I+ GVLDNV+AIFGLH+ H  P+G VA R G  LA
Sbjct  162   SEELKGTVVLVFQPAEEGGGGAMKIIEAGVLDNVNAIFGLHIVHNIPLGKVAGRSGPMLA  221

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I GKGGHAAIPQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+V+  QGG
Sbjct  222   GSGFFEAVISGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFQGG  281

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF KDS   LK+RI+E++  QA VHRC   +DF   + P FP 
Sbjct  282   GAFNVIPDSVTIGGTFRAFLKDSMVQLKQRIKEVITGQAIVHRCNATVDFLENDKPIFP-  340

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PT+ND  ++EH +  +  ++G D V+     MGSEDF  Y + +PG FFF+G++NE 
Sbjct  341   ---PTVNDKELHEHFQNVAGDMLGIDKVKEMQPVMGSEDFSFYQEMIPGYFFFLGMENET  397

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             S  +   HSPYF ++ED LP GAA+HA+ A  YLL
Sbjct  398   SGHLDSVHSPYFRINEDALPYGAALHASLATRYLL  432



>ref|XP_011013030.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Populus euphratica]
Length=438

 Score =   496 bits (1278),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 244/409 (60%), Positives = 299/409 (73%), Gaps = 4/409 (1%)
 Frame = -1

Query  1573  SSKLPLAVDGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRL  1394
             S  L L     +  R +  A + E  +WM  VRR+IH NPEL +EEF TS ++R ELD++
Sbjct  17    SPILSLKGSSDIPSRFLNYAKKEELFDWMVGVRRKIHENPELGFEEFETSKLIRAELDKI  76

Query  1393  GVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAH  1214
             GVKY+ P++ TGVV  IGSG PPFVALRADMDAL +QE+VEWE+KS+V GKMHACGHD+H
Sbjct  77    GVKYKHPLSVTGVVGFIGSGKPPFVALRADMDALAMQEMVEWEYKSKVPGKMHACGHDSH  136

Query  1213  TAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKY  1034
              AMLLGAAKILQ  R++LKGTV+LIFQPAEE G GAK MI  G L+NV+AIFGLHV +K 
Sbjct  137   VAMLLGAAKILQDHREELKGTVVLIFQPAEEGGGGAKKMIDEGALENVNAIFGLHVTNKL  196

Query  1033  PVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDP  854
             P+G VASR G  LAG G F+A I GKGGHAAIPQ S+DPILAAS  ++SLQ +VSRE DP
Sbjct  197   PIGEVASRHGPLLAGSGFFEAVISGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADP  256

Query  853   FDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTV  674
              DSQVV+V+  QGG +FNVIPD+ TI GT+RAF K+SF  L+ RIEE+V  QAAV RC  
Sbjct  257   LDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFLKESFMQLRHRIEEVVTGQAAVQRCKA  316

Query  673   EIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDK  494
              I+F   E P FP    PTIND  ++ + R  +S ++G D V+     MGSEDF  Y + 
Sbjct  317   VINFLENEKPFFP----PTINDKYLHNYFRIVASDLLGIDKVKDMQPLMGSEDFAFYQEM  372

Query  493   VPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             +PG FFFIG++NE    +  PHSPYF ++EDVLP GAA+HA+ A  YLL
Sbjct  373   IPGYFFFIGMQNETHKQLQSPHSPYFEINEDVLPYGAALHASLAARYLL  421



>ref|XP_004146834.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cucumis 
sativus]
 ref|XP_004154807.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cucumis 
sativus]
 gb|KGN59844.1| hypothetical protein Csa_3G850490 [Cucumis sativus]
Length=449

 Score =   495 bits (1275),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 231/395 (58%), Positives = 294/395 (74%), Gaps = 4/395 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + +  A E+E  +WM  +RR+IH NPEL +EEF TS ++R ELD+LG+ Y++PVA TGV+
Sbjct  42    KFLQFAKESELFDWMVGIRRKIHENPELGFEEFETSKLIRTELDKLGISYKYPVASTGVI  101

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               +GSG PPFVA+RADMDALP+QELVEWEHKS+V GKMHACGHDAH AM+LGAAKILQ+ 
Sbjct  102   GFVGSGQPPFVAIRADMDALPMQELVEWEHKSKVPGKMHACGHDAHVAMVLGAAKILQKH  161

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
              ++LKGTV+L+FQPAEE G GA  +I+ GVLDNV+AIFGLH+ H  P+G VA R G  LA
Sbjct  162   SEELKGTVVLVFQPAEEGGGGAMKIIEAGVLDNVNAIFGLHIVHNIPIGKVAGRSGPLLA  221

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G   F+A I GKGGHAAIPQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+V+  QGG
Sbjct  222   GSAFFEAVISGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFQGG  281

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF KDS   LK+RI+E++  QA VHRC   +DF   + P FP 
Sbjct  282   GAFNVIPDSVTIGGTFRAFLKDSMVQLKQRIKEVITGQAIVHRCNATVDFLENDKPIFP-  340

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PT+ND  ++EH +  +  ++G D V+     MGSEDF  Y + +PG FFF+G++NE 
Sbjct  341   ---PTVNDKELHEHFQNVAGDMLGIDKVKDMQPVMGSEDFSFYQEMIPGYFFFLGMENET  397

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             S  +   HSPYF ++ED LP GAA+HA+ A  YLL
Sbjct  398   SGHLDSVHSPYFRINEDALPYGAALHASLATRYLL  432



>gb|KHG30726.1| IAA-amino acid hydrolase ILR1-like 4 [Gossypium arboreum]
Length=453

 Score =   494 bits (1273),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 235/397 (59%), Positives = 295/397 (74%), Gaps = 6/397 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + +  A   E V+WM  +RR+IH NPEL YEEF TS ++R ELD+LG+ Y++PV+ TG+V
Sbjct  44    KFLDFAKRKEVVDWMVGIRRKIHENPELGYEEFETSKLIRLELDKLGIPYKYPVSVTGIV  103

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               +G+G PPFVA+RADMDALPIQE V+WEHKS+  GKMHACGHDAH +M+LGAAKIL+Q 
Sbjct  104   GFVGTGEPPFVAIRADMDALPIQETVDWEHKSKNPGKMHACGHDAHVSMVLGAAKILKQH  163

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
              Q+LKGTV+L+FQPAEE G GAK M+  GVLDNVDAIFGLHV H  P+G VA +PG  LA
Sbjct  164   LQELKGTVVLVFQPAEEGGGGAKKMLDAGVLDNVDAIFGLHVLHSAPIGTVACKPGPVLA  223

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G+F A I GKGGHAAIPQ S+DPILAAS  V+SLQ +VSRE DP DSQVV+V+  QGG
Sbjct  224   GSGLFDAVISGKGGHAAIPQHSIDPILAASNVVVSLQHLVSREADPLDSQVVTVAKFQGG  283

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT--F  638
              +FNVIPD+  I GT+RAF+K S   LKKRIEE+++ QAAV RC+  +DF  T+ P   F
Sbjct  284   GAFNVIPDSVRIGGTFRAFSKASLIQLKKRIEEVIKGQAAVQRCSATVDFYNTKKPMLFF  343

Query  637   PPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKN  458
             P    PT+ND  ++EH  K +  ++G D V+     MGSEDF  Y +  PG FFFIG+++
Sbjct  344   P----PTVNDKDLHEHFLKVAGDMLGNDKVKDMKPVMGSEDFAFYQEAFPGYFFFIGMQD  399

Query  457   EKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             E S  +   H+P FT++EDVLP GAA+HA+   TYLL
Sbjct  400   ENSPKLSSVHNPNFTINEDVLPYGAALHASLVTTYLL  436



>gb|ACZ56435.1| IAA-amino acid hydrolase, partial [Populus tomentosa]
Length=462

 Score =   493 bits (1270),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 226/396 (57%), Positives = 298/396 (75%), Gaps = 4/396 (1%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
             ++ LA   +TV W++ VRR+IH NPELA+EE  TS +VR ELD++G++YR+P+AKTG+ A
Sbjct  70    VLALARRPDTVTWLKSVRRKIHENPELAFEEVKTSELVRYELDKMGIEYRYPLAKTGIRA  129

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              IG+G PPFVA+RADMDALPIQE VEWEHKS+V GKMHACGHDAH AML+GAAKIL+   
Sbjct  130   WIGTGEPPFVAVRADMDALPIQEAVEWEHKSKVAGKMHACGHDAHVAMLMGAAKILKSRE  189

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
               L+GTV+L+FQPAEE G GAK MI +G LD+V+AIF +HV+H++P  ++ SRPG  LAG
Sbjct  190   HLLQGTVILLFQPAEEAGNGAKRMIADGALDDVEAIFAVHVSHEHPTAIIGSRPGALLAG  249

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
             CG F+A I GK G A  P  SVDPILAAS +VISLQ IVSRET+P DSQVVSV+ + GG+
Sbjct  250   CGFFRAVISGKKGRAGSPHHSVDPILAASAAVISLQGIVSRETNPLDSQVVSVTTMDGGN  309

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
             + ++IP+T  + GT+RA++  SFY L +RI+E++  QA+V+RC+  +DF   E+  +P  
Sbjct  310   NLDMIPETVVLGGTFRAYSNTSFYQLLRRIKEVIVEQASVYRCSATVDFFEKESTIYP--  367

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
               PT+ND  +YEH RK ++ ++G  N  + P  MG+EDF  Y   VP AF++IGV+NE  
Sbjct  368   --PTVNDDHMYEHVRKVATDLLGPTNFRVVPPMMGAEDFSFYTQVVPAAFYYIGVRNETL  425

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
              ++   HSPYF +DEDVLP+GAA HAA A  YL+ H
Sbjct  426   GSIHTGHSPYFMIDEDVLPIGAATHAAIAERYLIEH  461



>ref|XP_006438486.1| hypothetical protein CICLE_v10031540mg [Citrus clementina]
 gb|ESR51726.1| hypothetical protein CICLE_v10031540mg [Citrus clementina]
Length=323

 Score =   486 bits (1252),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 219/318 (69%), Positives = 273/318 (86%), Gaps = 4/318 (1%)
 Frame = -1

Query  1288  IQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRG  1109
             +QELVEWEHKS++DGKMHACGHDAH AMLLGAAKILQ++R+ LKGTV+LIFQPAEERG G
Sbjct  8     LQELVEWEHKSKIDGKMHACGHDAHVAMLLGAAKILQEMRETLKGTVVLIFQPAEERGTG  67

Query  1108  AKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQE  929
             AKDMIQ GVL+NV+AIFGLH+ HKYP GVVASRPG+FLAGCG FKA I GKGGHAAIPQ 
Sbjct  68    AKDMIQEGVLENVEAIFGLHLVHKYPTGVVASRPGDFLAGCGSFKAKISGKGGHAAIPQH  127

Query  928   SVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNK  749
              +DPILA S+SVISLQ+IVSRE DP DSQVVSV+MI GGSS+N+IPD+AT+ GT+RAFNK
Sbjct  128   CIDPILAVSSSVISLQNIVSREIDPLDSQVVSVAMINGGSSYNMIPDSATVAGTFRAFNK  187

Query  748   DSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSL  569
               F +L++RIEEI++ QAAVHRC+ E+DF G E+PT PPT+    NDVRIY+H R+ ++ 
Sbjct  188   KRFNALRERIEEIIKGQAAVHRCSAEVDFSGREHPTLPPTM----NDVRIYQHVRRVTAE  243

Query  568   IVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPV  389
             I+GE+NV+LAP   GSEDF  +LD++PG+F  +G+ N+   +++PPHSPYFT+DE+VLP+
Sbjct  244   ILGEENVKLAPIFTGSEDFAFFLDEIPGSFLLLGMLNDSVGSLYPPHSPYFTIDENVLPI  303

Query  388   GAAVHAAFAYTYLLSHAK  335
             GA +HAAFA++YL++  K
Sbjct  304   GAVIHAAFAHSYLVNSGK  321



>ref|XP_002302231.2| hypothetical protein POPTR_0002s08300g [Populus trichocarpa]
 gb|EEE81504.2| hypothetical protein POPTR_0002s08300g [Populus trichocarpa]
Length=477

 Score =   492 bits (1266),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 226/398 (57%), Positives = 298/398 (75%), Gaps = 4/398 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + ++ LA   +TV W++ VRR+IH NPELA+EE  TS +VR ELD++G++YR+P+AKTG+
Sbjct  83    EAVLALARRPDTVTWLKSVRRKIHENPELAFEEVKTSELVRYELDKMGIEYRYPLAKTGI  142

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IG+G PPFVA+RADMDALPIQE VEWEHKS+V GKMHACGHDAH AML+GAAKIL+ 
Sbjct  143   RAWIGTGGPPFVAVRADMDALPIQEAVEWEHKSKVAGKMHACGHDAHVAMLVGAAKILKS  202

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 L+GTV+L+FQPAEE G GAK MI +G LD+V+AIF +HV+H++P  ++ SRPG  L
Sbjct  203   REHLLQGTVILLFQPAEEAGNGAKRMIADGALDDVEAIFAVHVSHEHPTAIIGSRPGALL  262

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I GK G A  P  SVDPILAAS +VISLQ IVSRET+P DSQVVSV+ + G
Sbjct  263   AGCGFFRAVISGKKGRAGSPHHSVDPILAASAAVISLQGIVSRETNPLDSQVVSVTTMDG  322

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G++ ++IP+T  + GT+RA++  SFY L +RI+E++  QA+V RC+  +DF   E+  +P
Sbjct  323   GNNLDMIPETVVLGGTFRAYSNTSFYQLLQRIKEVIVEQASVFRCSATVDFFEKESTIYP  382

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND  +YEH RK ++ ++G  N  + P  MG+EDF  Y   VP AF++IGV+NE
Sbjct  383   ----PTVNDDHMYEHVRKVATDLLGPTNFRVVPPMMGAEDFSFYTQVVPAAFYYIGVRNE  438

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                ++   HSPYF +DEDVLP+GAA HAA A  YL+ H
Sbjct  439   TLGSIHTGHSPYFMIDEDVLPIGAATHAAIAERYLIEH  476



>ref|XP_007019095.1| IAA-leucine resistant-like gene 6 isoform 1 [Theobroma cacao]
 gb|EOY16320.1| IAA-leucine resistant-like gene 6 isoform 1 [Theobroma cacao]
Length=481

 Score =   491 bits (1264),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 229/403 (57%), Positives = 300/403 (74%), Gaps = 4/403 (1%)
 Frame = -1

Query  1549  DGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPV  1370
             D    + ++G+A + E VEW++ +RR+IH NPELA+EE+ TS +V  ELDR+ ++YR+P+
Sbjct  82    DVACSEAVLGVARKPENVEWIKGLRRKIHENPELAFEEYETSKLVCAELDRMDIEYRYPL  141

Query  1369  AKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAA  1190
             AKTG+ A IG+G PPFVA+RADMDALPIQE VEWEHKS+V GKMHACGHDAH AML+GAA
Sbjct  142   AKTGIRAWIGTGGPPFVAIRADMDALPIQEAVEWEHKSKVPGKMHACGHDAHVAMLVGAA  201

Query  1189  KILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASR  1010
             KIL+     LKGTV+L+FQPAEE G GAK MI +G L+NV+AIF +HV+H++P  ++ SR
Sbjct  202   KILKNREHLLKGTVILLFQPAEEAGNGAKRMIGDGALENVEAIFAVHVSHEHPTAIIGSR  261

Query  1009  PGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSV  830
             PG  LAGCG F+A I G+ G A  P  SVDPILAAS +VISLQ IVSRE++P DSQVVSV
Sbjct  262   PGPLLAGCGFFRAVISGRKGLAGNPHHSVDPILAASAAVISLQGIVSRESNPLDSQVVSV  321

Query  829   SMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTE  650
             +   GG++ ++IPDT  I GT+RAF+  SFY+L +RIEE++  QA+V RC+  +DF   E
Sbjct  322   TSFNGGNNLDMIPDTVVIGGTFRAFSNASFYNLLQRIEEVIVEQASVFRCSATVDFFEKE  381

Query  649   NPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFI  470
                +P    PT+ND R+YEH +K ++ ++G  N  + P  MG+EDF  Y   VP AF++I
Sbjct  382   YTIYP----PTVNDDRMYEHVKKVATDLLGPPNFRVVPPMMGAEDFSFYSQVVPAAFYYI  437

Query  469   GVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
             G++NE   +V   HSPYF +DEDVLP+GAAVHA  A  YL+ H
Sbjct  438   GIRNETLGSVHTGHSPYFMIDEDVLPIGAAVHATIAERYLIEH  480



>ref|XP_009786385.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Nicotiana sylvestris]
Length=441

 Score =   489 bits (1260),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 234/421 (56%), Positives = 306/421 (73%), Gaps = 8/421 (2%)
 Frame = -1

Query  1570  SKLPLAVDGGLKD---RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELD  1400
             S +P+  D  L +     +  A + E  +W+  VRR IH NPEL YEEF TS ++R ELD
Sbjct  17    SAIPIWSDSSLSEIPINFLNFAKKAEVFDWIVGVRRRIHENPELGYEEFETSKLIREELD  76

Query  1399  RLGVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHD  1220
             +LG+ Y++P A TGVV  IGSG  PFVA+RADMDALP+QE+V+WEHKS+  GKMHACGHD
Sbjct  77    KLGISYKYPFATTGVVGFIGSGKSPFVAIRADMDALPMQEMVDWEHKSKNAGKMHACGHD  136

Query  1219  AHTAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAH  1040
             AH AMLLGAAKILQ+ R  LKGTV L+FQPAEE G GAK MI  G L+N++AIFGLHV  
Sbjct  137   AHIAMLLGAAKILQEHRDILKGTVALVFQPAEEGGGGAKKMIDAGALENIEAIFGLHVNP  196

Query  1039  KYPVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRET  860
             ++P+G V+SRPG FLAG G F+A I GKGGHAAIPQ S+DPILAAS  ++SLQ +VSRE 
Sbjct  197   QFPLGKVSSRPGPFLAGSGFFEAVISGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREA  256

Query  859   DPFDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRC  680
             DP DSQVV+V+  QGG +FNVIPD+ TI GT+RAF+K+SF  L++RIEE++  QAAV RC
Sbjct  257   DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFQQLRQRIEEVIVGQAAVQRC  316

Query  679   TVEIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYL  500
                +DF   E P FP    PT+ND  +++H ++ +  ++G D+V+     MGSEDF  Y 
Sbjct  317   NATVDFLTKEKPFFP----PTVNDKNLHKHFQRVAGDMLGNDHVKDMEPLMGSEDFAFYQ  372

Query  499   DKVPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL-SHAKPPHS  323
             + +PG F+ +G++ E +  +   HSPYF ++E+ LP+GAA+ A+ A TYLL + ++ P S
Sbjct  373   EVIPGYFYLLGMQEETNEKLVSVHSPYFKINEEALPIGAALQASLAITYLLEAQSQVPSS  432

Query  322   S  320
             S
Sbjct  433   S  433



>ref|XP_003526641.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6-like [Glycine 
max]
Length=465

 Score =   489 bits (1260),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 225/398 (57%), Positives = 295/398 (74%), Gaps = 4/398 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + ++ +A   ET EW++++RR+IH NPELA+EE  TS ++R ELD + V YR+P+AKTG+
Sbjct  71    EAVLSVARRPETAEWLKKIRRKIHANPELAFEEIETSGLIREELDLMEVSYRYPLAKTGI  130

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IG+G PPFVA+RADMDALPIQE VEWE+KS+V GKMHACGHDAH AML+GAAKIL+ 
Sbjct  131   RAWIGTGGPPFVAIRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKT  190

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+L+FQPAEE G GAK M+Q+G L++V+AIF  HV+H++P G++ SRPG  L
Sbjct  191   REHLLKGTVILLFQPAEEAGNGAKRMMQDGALEDVEAIFAAHVSHEHPTGIIGSRPGPLL  250

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I GK G AA P  SVDP+LAAS +VISLQ IVSRE +P DSQVVSV+   G
Sbjct  251   AGCGFFRAVISGKKGLAANPHRSVDPVLAASAAVISLQGIVSREANPLDSQVVSVTSFNG  310

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G++ ++IPD+  + GT+RAF+  SFY L +RIE+++  QA+V+RC  E+DF   E   +P
Sbjct  311   GNNLDMIPDSVVLLGTFRAFSNTSFYQLLERIEQVIVEQASVYRCLAEVDFFEKEYTIYP  370

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND R+YEH +K S  ++G  N  + P  MG+EDF  Y + VP  FF+IGV+NE
Sbjct  371   ----PTVNDNRMYEHVKKVSIDLLGHKNFRVVPPMMGAEDFSFYSEVVPSGFFYIGVRNE  426

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                +    HSPYF +DEDVLP+GAA HA+ A  YL+ H
Sbjct  427   TLGSTHTGHSPYFMIDEDVLPIGAAAHASIAERYLIEH  464



>ref|XP_006351275.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6-like [Solanum 
tuberosum]
Length=485

 Score =   490 bits (1261),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 224/398 (56%), Positives = 300/398 (75%), Gaps = 4/398 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + I+ +A +TE V+W++ VRR+IH +PELA++EF TS +VR+EL+++ + YR+P+A TG+
Sbjct  90    NEILKIAQKTEHVKWIKSVRRKIHEHPELAFQEFETSKLVRQELEKMEISYRFPLATTGI  149

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IGSG PPFVALRADMDALPIQE VEWEHKS++ GKMHACGHDAH AML+GAA+IL+ 
Sbjct  150   RAIIGSGQPPFVALRADMDALPIQEAVEWEHKSKIAGKMHACGHDAHVAMLIGAARILKA  209

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
               + LKGTV+LIFQPAEE G GAK MI++G L+NV+AIF  HV+H++P GV+ SR G  L
Sbjct  210   REKNLKGTVILIFQPAEEAGNGAKRMIKDGALENVEAIFAAHVSHQHPTGVIGSRTGPLL  269

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG FKA I GK G A+ P  S+DP+LAAS +VISLQSIVSRE++P DSQVVSV+    
Sbjct  270   AGCGFFKAVISGKTGQASNPHHSIDPVLAASAAVISLQSIVSRESNPLDSQVVSVTSFNA  329

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G + +VIP+T T++GT+RAF+  +FY L KRI E+   QA+V RC+  +DF   ++  +P
Sbjct  330   GDNLDVIPETVTLSGTFRAFSTTNFYQLLKRIREVFTEQASVFRCSATVDFFEDKDTIYP  389

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND  +YEH +K +S +VG  N ++ P  MG+EDF  Y + +P AFF+IG++NE
Sbjct  390   ----PTVNDNTMYEHVKKVASDLVGTTNFKVVPPMMGAEDFSFYSEVIPAAFFYIGIRNE  445

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                ++   HSP+F +DEDVLP+GAA HAA A  YL  +
Sbjct  446   TLGSIHTGHSPHFMIDEDVLPIGAATHAAIAERYLYEY  483



>ref|XP_011027512.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Populus euphratica]
Length=476

 Score =   489 bits (1260),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 226/398 (57%), Positives = 297/398 (75%), Gaps = 4/398 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + ++ LA   +TV W++ VRR+IH NPELA+EE  TS +VR ELD++G++YR+P+AKTG+
Sbjct  82    EAVLALARRPDTVTWLKIVRRKIHENPELAFEEVKTSELVRYELDKMGIEYRYPLAKTGI  141

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IG+G PPFVA+RADMDALPIQE VEWEHKS+V GKMHACGHDAH AML+GAAKIL+ 
Sbjct  142   RAWIGTGGPPFVAVRADMDALPIQEAVEWEHKSKVAGKMHACGHDAHVAMLVGAAKILKS  201

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 L+GTV+L+FQPAEE G GAK MI +G LD+V+AIF +HV+H++P  ++ SRPG  L
Sbjct  202   REHLLQGTVILLFQPAEEAGNGAKRMIADGALDDVEAIFAVHVSHEHPTAIIGSRPGALL  261

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I GK G A  P  SVDPILAAS +VISLQ IVSRET+P DSQVVSV+ + G
Sbjct  262   AGCGFFRAVISGKKGRAGSPHHSVDPILAASAAVISLQGIVSRETNPLDSQVVSVTTMDG  321

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G++ ++IP+T  + GT+RA++  SFY L +RI+E++  QA+V RC+  +DF   E+  +P
Sbjct  322   GNNLDMIPETVVLGGTFRAYSNTSFYQLLQRIKEVIVEQASVFRCSATVDFFEKESTIYP  381

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND  +YEH RK ++ ++G  N  + P  MG+EDF  Y   VP AF++IGV+NE
Sbjct  382   ----PTVNDDHMYEHVRKVATDLLGPTNFRVVPPMMGAEDFSFYTQVVPAAFYYIGVRNE  437

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                ++   HSPYF +DEDVLP+GAA HAA A  YL  H
Sbjct  438   TLGSIHTGHSPYFMIDEDVLPIGAATHAAIAERYLNEH  475



>ref|XP_010243489.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Nelumbo nucifera]
Length=476

 Score =   489 bits (1259),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 229/398 (58%), Positives = 296/398 (74%), Gaps = 4/398 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + ++ LAN  ETV+W++ +RR IH +PELA++EF TS ++R ELD+L + YR+P+A+TG+
Sbjct  82    EEVLELANRPETVDWLKGLRRRIHEHPELAFQEFETSRLIRDELDKLQISYRFPLAETGI  141

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A+IG+G PPFVALRADMDALPIQE VEWEHKS++ GKMHACGHDAHTAMLLGAAKIL+ 
Sbjct  142   RASIGTGGPPFVALRADMDALPIQEAVEWEHKSKIPGKMHACGHDAHTAMLLGAAKILKS  201

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+LIFQPAEE G GAK M+Q+G L++V+AIF +HV+H+ P G + SRPG  L
Sbjct  202   REPNLKGTVILIFQPAEEAGNGAKRMMQDGALEDVEAIFAVHVSHERPSGTIGSRPGPLL  261

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I GK G A  P  SVDPILAAS +VISLQ++VSRE DP DSQVVSV+   G
Sbjct  262   AGCGFFRAIISGKKGSAGSPHHSVDPILAASAAVISLQNLVSREADPLDSQVVSVASFNG  321

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G++ ++IP++  ++GT RAF+  SFY L +RIEE++  QA+V+RC   +DF   +   +P
Sbjct  322   GNNLDLIPESVILSGTLRAFSNASFYRLLQRIEEVIVEQASVYRCLATVDFFEKKTQIYP  381

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND  +YEH RK +  +VG  N  + P  MG+EDF  Y + VP AFF+IGV NE
Sbjct  382   ----PTVNDEHMYEHVRKVAIDLVGAKNFIVVPPMMGAEDFSFYSEMVPAAFFYIGVMNE  437

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                +    HSPYF +DEDVLP+GAA HAA A  YL+ H
Sbjct  438   TLGSTHSGHSPYFMIDEDVLPIGAATHAAIAERYLIEH  475



>ref|XP_009762344.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Nicotiana sylvestris]
Length=484

 Score =   489 bits (1259),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 224/398 (56%), Positives = 299/398 (75%), Gaps = 4/398 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             D I+ +A++ E V+W++ VRR+IH  PELA+EE+ TS +VR+EL+++ + +++P+A TG+
Sbjct  89    DEILKIAHKKEHVKWIKSVRRKIHEYPELAFEEYETSKLVRQELEKMEIPFQFPLATTGI  148

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IGSG PPFVALRADMDALPIQE VEWEHKS++ GKMHACGHDAH AML+GAAKIL+ 
Sbjct  149   RAMIGSGQPPFVALRADMDALPIQEAVEWEHKSKIAGKMHACGHDAHVAMLIGAAKILKA  208

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
               + LKGTV+LIFQPAEE+G GAK MI+NG L+NV+AIF +HV+H++P GV+ SRPG  L
Sbjct  209   REKNLKGTVILIFQPAEEKGNGAKRMIKNGALENVEAIFAVHVSHQHPTGVIGSRPGPLL  268

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I GK G A+ P  S+DP+LAAS +VISLQSIVSRE++P DSQVVSV+    
Sbjct  269   AGCGFFRAVISGKTGQASNPHHSIDPVLAASAAVISLQSIVSRESNPLDSQVVSVTSFNA  328

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G   +VIPD  T++GT+RAF+  +FY L KRI E+   QA+V RC+  +DF   ++  +P
Sbjct  329   GDKLDVIPDAVTLSGTFRAFSSTNFYQLLKRIREVFEEQASVFRCSATVDFFEDKDTIYP  388

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND R+YEH +K +  +VG  N ++ P  MG+EDF  Y + +P AFF+IG++NE
Sbjct  389   ----PTVNDDRMYEHVKKVAGDLVGPANFKVVPPIMGAEDFSFYSEVIPAAFFYIGIRNE  444

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                +    HSP+F +DEDVLP+GAA HAA A  YL  +
Sbjct  445   TLGSYHTGHSPHFMIDEDVLPIGAATHAAIAERYLYEY  482



>ref|XP_006838393.1| hypothetical protein AMTR_s00002p00075740 [Amborella trichopoda]
 gb|ERN00962.1| hypothetical protein AMTR_s00002p00075740 [Amborella trichopoda]
Length=458

 Score =   487 bits (1254),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 232/398 (58%), Positives = 296/398 (74%), Gaps = 5/398 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + I+ LA   ET +W++ +RR IH NPELAYEE  TS ++R+ELD++GVKYR+P+AKTG+
Sbjct  65    EEILALAKRPETKKWLKGLRRTIHENPELAYEEVETSRLIRKELDKMGVKYRYPLAKTGI  124

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
             VA+IG+G PPFVA+RADMDALPIQE VEWEHKS+V GKMHACGHDAH AML+GAA IL+ 
Sbjct  125   VASIGTGGPPFVAIRADMDALPIQEAVEWEHKSKVAGKMHACGHDAHVAMLIGAASILKD  184

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 L GTV L+FQPAEE G GAK MI++G L+NV+AIF +HV+ ++   ++ SRPG  L
Sbjct  185   REHLLYGTVKLLFQPAEESGAGAKRMIEDGALENVEAIFAVHVSSQHSTSLIGSRPGPLL  244

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG FKA I G GGHA  P  S DPILAAS +VISLQ+IVSRE +P D+QVVSV+   G
Sbjct  245   AGCGFFKALISGGGGHAGTPHHSTDPILAASAAVISLQNIVSREANPLDAQVVSVAAFNG  304

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G   +VIP + TI GT+RAF+ +SFYS++ RIEE++  Q  V+RC+VEIDF   E+  +P
Sbjct  305   GERLDVIPKSVTIGGTFRAFSNESFYSVRHRIEEVITRQVVVYRCSVEIDF-FEEHGMYP  363

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+NDV +YEH RK +  ++G  +    P  MG+EDF  Y +K+P AF++IGVKNE
Sbjct  364   ----PTVNDVHMYEHVRKVAIDMLGPASYLYVPPMMGAEDFAFYSEKIPAAFYYIGVKNE  419

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                +V   HSP+F +DE+VL VGAAVHAA A  YL  H
Sbjct  420   TIGSVHTGHSPFFMIDEEVLHVGAAVHAAIAERYLSEH  457



>gb|AFR58665.1| jasmonoyl-L-isoleucine hydrolase 1 [Nicotiana attenuata]
Length=441

 Score =   486 bits (1252),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 230/421 (55%), Positives = 306/421 (73%), Gaps = 8/421 (2%)
 Frame = -1

Query  1570  SKLPLAVDGGLKD---RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELD  1400
             S +P+  D  L +     +  A + E  +W+  VRR IH NPEL YEEF TS ++R ELD
Sbjct  17    SAIPIWSDSSLSEIPINFLNFAKKAEVFDWIVGVRRRIHENPELGYEEFETSKIIREELD  76

Query  1399  RLGVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHD  1220
             +LG+ Y++P A TG+V  +GSG  PFVA+RADMDALP+QE+V+WEHKS+  GKMHACGHD
Sbjct  77    KLGISYKYPFATTGIVGFVGSGKSPFVAIRADMDALPMQEMVDWEHKSKNAGKMHACGHD  136

Query  1219  AHTAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAH  1040
             AH AMLLGAAKILQ+ R  LKGTV L+FQPAEE G GAK MI  G L+N+++IFGLHV  
Sbjct  137   AHVAMLLGAAKILQEHRDILKGTVALVFQPAEEGGGGAKKMIDAGALENIESIFGLHVNP  196

Query  1039  KYPVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRET  860
             ++P+G V+SRPG FLAG G F+A I GKGGHAAIPQ S+DPILAAS  ++SLQ +VSRE 
Sbjct  197   QFPLGKVSSRPGPFLAGSGFFEAVISGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREA  256

Query  859   DPFDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRC  680
             DP DSQVV+V+  QGG +FNVIPD+ TI GT+RAF+K+SF  L++RIEE++  QAAV RC
Sbjct  257   DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFQQLRQRIEEVIVGQAAVQRC  316

Query  679   TVEIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYL  500
                +DF   E P FP    PT+ND  +++H ++ +  ++G D+V+     MGSEDF  Y 
Sbjct  317   NATVDFLTKEKPFFP----PTVNDKNLHKHFQRVAGDMLGNDHVKDMEPLMGSEDFAFYQ  372

Query  499   DKVPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL-SHAKPPHS  323
             + +PG F+ +G+++E +  +   HSPYF ++E+ LP+GAA+ A+ A  YLL + ++ P S
Sbjct  373   EVIPGYFYLLGMQDETNEKLVSVHSPYFKINEEALPIGAALQASLAIRYLLEAQSQVPSS  432

Query  322   S  320
             S
Sbjct  433   S  433



>gb|KDO82611.1| hypothetical protein CISIN_1g013395mg [Citrus sinensis]
Length=323

 Score =   481 bits (1239),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 218/318 (69%), Positives = 271/318 (85%), Gaps = 4/318 (1%)
 Frame = -1

Query  1288  IQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRG  1109
             +QELVEWEHKS++DGKMHACGHDAH AMLLGAAKILQ++R+ LKGTV+LIFQPAEERG G
Sbjct  8     LQELVEWEHKSKIDGKMHACGHDAHVAMLLGAAKILQEMRETLKGTVVLIFQPAEERGTG  67

Query  1108  AKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQE  929
             AKDMIQ GVL+NV+AIFGLH+ HKYP GVVASRPG+FLAGCG FKA I GKGGHAAIPQ 
Sbjct  68    AKDMIQEGVLENVEAIFGLHLVHKYPTGVVASRPGDFLAGCGSFKAKISGKGGHAAIPQH  127

Query  928   SVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNK  749
              +DPILA S+SVISLQ+IVSRE DP DSQVVSV+MI GGSS+N+IPD+AT+ GT+RAFNK
Sbjct  128   CIDPILAVSSSVISLQNIVSREIDPLDSQVVSVAMINGGSSYNMIPDSATVAGTFRAFNK  187

Query  748   DSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSL  569
               F +L++RIEEI++ QAAVHRC+ E+DF G E+PT PPT+    NDVRIY+H R+ ++ 
Sbjct  188   KRFNALRERIEEIIKGQAAVHRCSAEVDFSGREHPTLPPTM----NDVRIYQHVRRVTAE  243

Query  568   IVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPV  389
             I+GE+NV+LAP   GSEDF  +LD++PG+F  +G+ N+   +++P HSPYFT+DE VLP+
Sbjct  244   ILGEENVKLAPIFTGSEDFAFFLDEIPGSFLLLGMLNDSVGSLYPLHSPYFTIDEHVLPI  303

Query  388   GAAVHAAFAYTYLLSHAK  335
             GA +HAAFA++YL++  K
Sbjct  304   GAVIHAAFAHSYLVNSGK  321



>ref|XP_009391385.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Musa acuminata 
subsp. malaccensis]
Length=470

 Score =   487 bits (1253),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 233/399 (58%), Positives = 299/399 (75%), Gaps = 5/399 (1%)
 Frame = -1

Query  1537  KDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTG  1358
             +  I+GLA   + VEW+  VRR IH +PELAY+EF TS ++R ELDR+GV+YR+P+A TG
Sbjct  76    RAEILGLARRPQAVEWVTAVRRRIHEHPELAYQEFETSRLIREELDRMGVEYRFPLAGTG  135

Query  1357  VVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQ  1178
             VVATIG+G  PFVALRADMDALPIQE VEW++KS+V GKMHACGHDAH AMLLGAAKIL+
Sbjct  136   VVATIGTGGLPFVALRADMDALPIQEAVEWKYKSKVPGKMHACGHDAHVAMLLGAAKILK  195

Query  1177  QLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEF  998
                 +LKGTV L+FQPAEE G GAK MI++G L++V+AIF +HV+H+ P  V+ SRPG  
Sbjct  196   AREHRLKGTVKLLFQPAEEAGIGAKRMIEDGALEDVEAIFAVHVSHERPTSVIGSRPGPL  255

Query  997   LAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQ  818
             LAGCG F A I+G+ GHA  P  SVDPILAAS  VISLQ+IVSRE +P DSQVVSV+   
Sbjct  256   LAGCGFFHARIRGREGHAGNPHHSVDPILAASAVVISLQNIVSREANPLDSQVVSVASFN  315

Query  817   GGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTF  638
             GG + +VIP++ TI GT+RAF+  SFY L++RIEE++  Q++V+RC   +DF   E   F
Sbjct  316   GGYNLDVIPESVTIGGTFRAFSNTSFYQLRRRIEEVIVEQSSVYRCAASVDF--FEKERF  373

Query  637   PPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKN  458
              P   PT+N+  +YEH +K ++ ++G DN  + P  MG+EDF  Y + +P AF++IGV+N
Sbjct  374   YP---PTVNEESMYEHLKKVATNMLGFDNFMVVPPMMGAEDFSFYSEVIPAAFYYIGVRN  430

Query  457   EKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
             E   +V   HSPYF +DEDVLP GAA+HAA A  YL+ H
Sbjct  431   ETLGSVHTGHSPYFMIDEDVLPTGAAMHAAIAERYLIEH  469



>ref|XP_006426465.1| hypothetical protein CICLE_v10025591mg [Citrus clementina]
 gb|ESR39705.1| hypothetical protein CICLE_v10025591mg [Citrus clementina]
Length=450

 Score =   485 bits (1248),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 232/402 (58%), Positives = 298/402 (74%), Gaps = 7/402 (2%)
 Frame = -1

Query  1543  GLKD---RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWP  1373
             GL D   +++  A   E V WM  +RR+IH+NPEL Y+EF TS ++R ELD++G+KY+ P
Sbjct  36    GLSDIPKKLLNFAKRQELVGWMIGIRRKIHQNPELGYQEFETSQLIRSELDKMGIKYKHP  95

Query  1372  VAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGA  1193
             VA TGVV  IG+G PPFVALRADMD+LP+QE+VEWE+KS++ GKMHACGHD H  MLLGA
Sbjct  96    VAVTGVVGFIGTGEPPFVALRADMDSLPLQEMVEWEYKSKIPGKMHACGHDGHVTMLLGA  155

Query  1192  AKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVAS  1013
             AKILQ+ R++LKGTV+L+FQPAEE G GA  +++ GVL+ V+AIFGLHV    P+G VAS
Sbjct  156   AKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVAS  215

Query  1012  RPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVS  833
             RPG  LAG G F+A I GKGGHAAIPQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+
Sbjct  216   RPGPLLAGSGFFEAVIGGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVT  275

Query  832   VSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGT  653
             V+  QGG +FNVIPD+  I GT+RAF+K+SF  LK+RIEE++  QAAV RC+  +DF   
Sbjct  276   VAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRCSATVDFLSK  335

Query  652   ENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFF  473
             E P FP    PTIN+  ++++ +  +  ++    V++    MGSEDF  Y + +PG FFF
Sbjct  336   EKPFFP----PTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMPGYFFF  391

Query  472   IGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             +G+KNE    V   HSPYFTL+ED LP GAA+HA+ A  YLL
Sbjct  392   LGMKNETLGKVESTHSPYFTLNEDALPYGAALHASLALRYLL  433



>ref|XP_009592954.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Nicotiana tomentosiformis]
Length=484

 Score =   486 bits (1252),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 222/398 (56%), Positives = 298/398 (75%), Gaps = 4/398 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + I+ +A + E V+W++ VRR+IH  PELA+EE+ TS +VR+EL+++ + Y++P+A TG+
Sbjct  89    NEILKIAQKKEHVKWIKSVRRKIHEYPELAFEEYETSELVRQELEKMEIPYQFPLATTGI  148

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IGSG PPFVALRADMDALPIQE VEWEHKS++ GKMHACGHDAH AML+GAAKIL+ 
Sbjct  149   RAMIGSGQPPFVALRADMDALPIQEAVEWEHKSKIAGKMHACGHDAHVAMLIGAAKILKA  208

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
               + LKGTV+LIFQPAEE G GAK MI+NG L+NV+AIF +HV+H++P GV+ SRPG  L
Sbjct  209   REKNLKGTVILIFQPAEEAGNGAKRMIKNGALENVEAIFAVHVSHQHPTGVIGSRPGPLL  268

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I GK G A+ P  S+DP+LAAS +VISLQSIVSRE++P DSQVVSV+    
Sbjct  269   AGCGFFRAVISGKTGQASNPHHSIDPVLAASAAVISLQSIVSRESNPLDSQVVSVTSFNA  328

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G  F+VIP+  T++GT+RAF+  +FY L +RI E+   QA+V RC+  ++F   ++  +P
Sbjct  329   GDKFDVIPEAVTLSGTFRAFSSTNFYQLLRRIREVFTEQASVFRCSATVEFFEDKDTIYP  388

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND R+YEH +K +  +VG  N ++ P  MG+EDF  Y + +P AFF+IG++NE
Sbjct  389   ----PTVNDDRMYEHVKKVAGDLVGPTNFKVVPPMMGAEDFSFYSELIPAAFFYIGIRNE  444

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                +    HSP+F +DEDVLP+GAA HAA A  YL  +
Sbjct  445   TLGSYHTGHSPHFMIDEDVLPIGAATHAAIAERYLYEY  482



>ref|XP_006853919.1| hypothetical protein AMTR_s00036p00189900 [Amborella trichopoda]
 gb|ERN15386.1| hypothetical protein AMTR_s00036p00189900 [Amborella trichopoda]
Length=445

 Score =   485 bits (1248),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 231/408 (57%), Positives = 300/408 (74%), Gaps = 8/408 (2%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
             I+  A + E +EW+R +RR IH +PEL +EEF TS +VRR+LD LGV+Y+WPVA TGVV 
Sbjct  34    ILQRAKQPEMLEWLRHIRRSIHEHPELGFEEFETSKLVRRKLDELGVQYKWPVAVTGVVG  93

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              IGSG PPFVA+RADMDALPI+E VEWEHKS++ GKMHACGHDAH  MLLGAAKILQ+ +
Sbjct  94    FIGSGRPPFVAIRADMDALPIEEAVEWEHKSKIPGKMHACGHDAHITMLLGAAKILQERK  153

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
               L+GTV+L+FQPAEE G GAK MI+ G L+NV+AIFG+HV     +G VAS+PG  +AG
Sbjct  154   DDLQGTVVLLFQPAEEGGGGAKKMIEAGALENVEAIFGMHVVPDIHIGAVASKPGPLMAG  213

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
              G F A I GKGGHAAIPQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+V+  QGG 
Sbjct  214   SGFFDAVISGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFQGGG  273

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
             +FNVIPD+ TI GT+RAF  ++FY LK+RI+E++ +QAAV RC+  ++F  ++ P FP  
Sbjct  274   AFNVIPDSVTIGGTFRAFANNTFYQLKQRIQEVIVSQAAVQRCSASVNFFESDRPFFP--  331

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
               PT+N+  ++E     +  ++G  N++     MG+EDF  Y +K+P  +FF+G+KNE  
Sbjct  332   --PTVNNKDLHELFSGVAIEMLGRTNLQEMQPLMGAEDFSFYGEKIPAYYFFVGMKNESQ  389

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL----LSHAKPPHSSS  317
               +   HSP+FT++EDVLP GAA+HA+ A  YL     S A P H SS
Sbjct  390   GPLASGHSPFFTVNEDVLPYGAALHASLAIRYLNLLQSSQAPPSHVSS  437



>gb|KDO58672.1| hypothetical protein CISIN_1g013076mg [Citrus sinensis]
Length=450

 Score =   484 bits (1247),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 232/402 (58%), Positives = 298/402 (74%), Gaps = 7/402 (2%)
 Frame = -1

Query  1543  GLKD---RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWP  1373
             GL D   +++  A   E V WM  +RR+IH+NPEL Y+EF TS ++R ELD++G+KY+ P
Sbjct  36    GLSDIPKKLLNFAKRQELVGWMIGIRRKIHQNPELGYQEFETSQLIRSELDKMGIKYKHP  95

Query  1372  VAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGA  1193
             VA TGVV  IG+G PPFVALRADMD+LP+QE+VEWE+KS++ GKMHACGHD H  MLLGA
Sbjct  96    VAVTGVVGFIGTGEPPFVALRADMDSLPLQEMVEWEYKSKIPGKMHACGHDGHVTMLLGA  155

Query  1192  AKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVAS  1013
             AKILQ+ R++LKGTV+L+FQPAEE G GA  +++ GVL+ V+AIFGLHV    P+G VAS
Sbjct  156   AKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVAS  215

Query  1012  RPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVS  833
             RPG  LAG G F+A I GKGGHAAIPQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+
Sbjct  216   RPGPLLAGSGFFEAVIGGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVT  275

Query  832   VSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGT  653
             V+  QGG +FNVIPD+  I GT+RAF+K+SF  LK+RIEE++  QAAV RC+  +DF   
Sbjct  276   VAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRCSATVDFLSK  335

Query  652   ENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFF  473
             E P FP    PTIN+  ++++ +  +  ++    V++    MGSEDF  Y + +PG FFF
Sbjct  336   EKPFFP----PTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMPGYFFF  391

Query  472   IGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             +G+KNE    V   HSPYFTL+ED LP GAA+HA+ A  YLL
Sbjct  392   LGMKNETLGKVESIHSPYFTLNEDALPYGAALHASLALRYLL  433



>ref|XP_003523432.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6-like [Glycine 
max]
Length=466

 Score =   485 bits (1248),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 225/396 (57%), Positives = 291/396 (73%), Gaps = 4/396 (1%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
             ++ +A   ET EW++ +RR+IH NPELA+EE  TS ++R ELD + V YR+P+AKTG+ A
Sbjct  74    VLSVARRAETAEWLKNIRRKIHANPELAFEEIETSRLIREELDLMEVSYRYPLAKTGIRA  133

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              IG+G PPFVA+RADMDALPIQE VEWE+KS+V GKMHACGHDAH AML+GAAKIL+   
Sbjct  134   WIGTGGPPFVAIRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKTRE  193

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
               LKGTV+L+FQPAEE G GAK M+Q+G L++V+AIF  HV+H++P G++ SR G  LAG
Sbjct  194   HLLKGTVILLFQPAEEAGNGAKRMMQDGALEDVEAIFAAHVSHEHPTGIIGSRRGPLLAG  253

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
             CG F+A I GK G AA P  SVDP+LAAS +VISLQ IVSRE +P DSQVVSV+   GG+
Sbjct  254   CGFFRAVISGKKGLAADPHRSVDPVLAASAAVISLQGIVSREANPLDSQVVSVTSFNGGN  313

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
               ++IPDT  + GT+RAF+  SFY L +RIE+++  Q +V+RC  E+DF   E   +P  
Sbjct  314   KLDMIPDTVVLLGTFRAFSNTSFYQLLERIEQVIVEQTSVYRCLAEVDFFEKEYTIYP--  371

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
               PT+ND R+YEH +K S  ++G  N  + P  MG+EDF  Y + VP AFF+IGV+NE  
Sbjct  372   --PTVNDDRMYEHVKKVSIDLLGHKNFRVVPPMMGAEDFSFYSEMVPSAFFYIGVRNETL  429

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
              +    HSPYF +DEDVLP+GAA HA+ A  YL+ H
Sbjct  430   GSTHTGHSPYFMIDEDVLPIGAAAHASIAERYLIEH  465



>ref|XP_009630468.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Nicotiana tomentosiformis]
Length=441

 Score =   483 bits (1243),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 232/421 (55%), Positives = 302/421 (72%), Gaps = 7/421 (2%)
 Frame = -1

Query  1564  LPLAVDGGLKD---RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRL  1394
             +P+  D  L +     +  A + E  +W+  VRR IH NPEL YEEF TS ++R ELD+L
Sbjct  19    IPIWSDSSLSEIPINFLNFAKKAEVFDWIVGVRRRIHENPELGYEEFETSKLIREELDKL  78

Query  1393  GVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAH  1214
             G+ Y++P A TGVV  IGSG PPFVA+RADMDALP+QE+V+W HKS+  GKMHACGHDAH
Sbjct  79    GISYKYPFATTGVVGFIGSGKPPFVAIRADMDALPMQEMVDWAHKSKNAGKMHACGHDAH  138

Query  1213  TAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKY  1034
              AMLLGAAKILQ+    LKGTV L+FQPAEE G GAK MI  G L+N++AIFGLHV  ++
Sbjct  139   VAMLLGAAKILQEHPDILKGTVALVFQPAEEGGGGAKKMIDAGALENIEAIFGLHVNPQF  198

Query  1033  PVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDP  854
             P+G V+SRPG FLAG G F+A I GKGGHAAIPQ S+DPILAAS  ++SLQ +VSRE DP
Sbjct  199   PLGKVSSRPGPFLAGSGFFEAVISGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADP  258

Query  853   FDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTV  674
              DSQVV+V+  QGG +FNVIPD+ TI GT+RAF+K+SF  L++RIEE++  QAAV RC  
Sbjct  259   LDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFQQLRQRIEEVIVGQAAVQRCNA  318

Query  673   EIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDK  494
              +DF   E P FP    PT+ND  +++H ++ +  ++G D+V+     MGSEDF  Y + 
Sbjct  319   TVDFLTKEKPFFP----PTVNDKNLHKHFQRVAGDMLGNDHVKDMEPLMGSEDFAFYQEV  374

Query  493   VPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHSSS*  314
             +PG F+ +G+++E +  +   HSPYF ++E+ LP+GAA+ A+ A  YLL       SSS 
Sbjct  375   IPGYFYLLGMQDETNEKLVSVHSPYFKINEEALPIGAALQASLAIRYLLEAQPQVPSSSI  434

Query  313   N  311
             N
Sbjct  435   N  435



>ref|XP_011011908.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Populus euphratica]
Length=490

 Score =   485 bits (1248),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 225/398 (57%), Positives = 294/398 (74%), Gaps = 4/398 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + ++ LA + ETV W++ +RR+IH NPELA+EE  TS +VR ELD +G++Y +P+A+TG+
Sbjct  96    EAVLALARQPETVTWLKSLRRKIHENPELAFEEIKTSELVRDELDGMGIEYMYPLAQTGI  155

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IG+G PPFVA+RADMDALPIQE VEW+HKS+V GKMHACGHDAH AML+GAAKIL+ 
Sbjct  156   RAWIGTGGPPFVAVRADMDALPIQEAVEWKHKSKVAGKMHACGHDAHVAMLMGAAKILKS  215

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+L+FQPAEE G GAK MI +G L++V+AIF +HV+H++P  +V SRPG  L
Sbjct  216   REHLLKGTVILLFQPAEEAGNGAKRMIGDGALEDVEAIFAVHVSHEHPTAIVGSRPGPLL  275

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I GK GHA  P  SVDPILAAS +VISLQSIVSRE +P DSQVVSV+ + G
Sbjct  276   AGCGFFRAIINGKMGHAGTPHHSVDPILAASAAVISLQSIVSREANPLDSQVVSVTTMDG  335

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G+  ++IPDT  + GT+RAF+  SF  L +RIEE++  QA+V RC+  +DF   ++  +P
Sbjct  336   GNDLDMIPDTVILGGTFRAFSNTSFNQLLQRIEEVIVEQASVFRCSATVDFFENQSTVYP  395

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND  +YEH RK +  ++G  N  + P  MG+EDF  Y   VP AF++IGV+NE
Sbjct  396   ----PTVNDDLMYEHVRKVAIDLLGPANFRVVPPMMGAEDFSFYTQVVPAAFYYIGVRNE  451

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                ++   HSPYF +DEDVLP+GAA HA  A  YL+ H
Sbjct  452   TLGSIHTGHSPYFMIDEDVLPIGAATHATIAERYLIEH  489



>gb|KHN35503.1| IAA-amino acid hydrolase ILR1-like 6, partial [Glycine soja]
Length=388

 Score =   481 bits (1238),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 224/388 (58%), Positives = 287/388 (74%), Gaps = 4/388 (1%)
 Frame = -1

Query  1504  ETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSPP  1325
             ET EW++ +RR+IH NPELA+EE  TS ++R ELD + V YR+P+AKTG+ A IG+G PP
Sbjct  4     ETAEWLKNIRRKIHANPELAFEEIETSRLIREELDLMEVSYRYPLAKTGIRAWIGTGGPP  63

Query  1324  FVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVL  1145
             FVA+RADMDALPIQE VEWE+KS+V GKMHACGHDAH AML+GAAKIL+     LKGTV+
Sbjct  64    FVAIRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKTREHLLKGTVI  123

Query  1144  LIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATI  965
             L+FQPAEE G GAK M+Q+G L++V+AIF  HV+H++P G++ SR G  LAGCG F+A I
Sbjct  124   LLFQPAEEAGNGAKRMMQDGALEDVEAIFAAHVSHEHPTGIIGSRRGPLLAGCGFFRAVI  183

Query  964   KGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDT  785
              GK G AA P  SVDP+LAAS +VISLQ IVSRE +P DSQVVSV+   GG+  ++IPDT
Sbjct  184   SGKKGLAADPHRSVDPVLAASAAVISLQGIVSREANPLDSQVVSVTSFNGGNKLDMIPDT  243

Query  784   ATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDV  605
               + GT+RAF+  SFY L +RIE+++  Q +V+RC  E+DF   E   +P    PT+ND 
Sbjct  244   VVLLGTFRAFSNTSFYQLLERIEQVIVEQTSVYRCLAEVDFFEKEYTIYP----PTVNDD  299

Query  604   RIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVFPPHS  425
             R+YEH +K S  ++G  N  + P  MG+EDF  Y + VP AFF+IGV+NE   +    HS
Sbjct  300   RMYEHVKKVSIDLLGHKNFRVVPPMMGAEDFSFYSEMVPSAFFYIGVRNETLGSTHTGHS  359

Query  424   PYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
             PYF +DEDVLP+GAA HA+ A  YL+ H
Sbjct  360   PYFMIDEDVLPIGAAAHASIAERYLIEH  387



>sp|Q84XG9.1|ILL1_ORYSI RecName: Full=IAA-amino acid hydrolase ILR1-like 1; Flags: Precursor 
[Oryza sativa Indica Group]
 gb|AAO25632.1| IAA-amino acid hydrolase [Oryza sativa Indica Group]
 gb|EAY74541.1| hypothetical protein OsI_02433 [Oryza sativa Indica Group]
Length=442

 Score =   483 bits (1242),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 234/396 (59%), Positives = 289/396 (73%), Gaps = 5/396 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A E E   WM  +RR IH NPEL YEEFATS +VRRELD LG+ YR P A TGVVAT+G+
Sbjct  40    AKEAEFAGWMVGLRRRIHENPELGYEEFATSELVRRELDALGIPYRHPFAVTGVVATVGT  99

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G PPFVALRADMDALP+QE VEWEHKS+V GKMH CGHDAH AMLLG+A+ILQ+ R +LK
Sbjct  100   GGPPFVALRADMDALPMQESVEWEHKSKVPGKMHGCGHDAHVAMLLGSARILQEHRDELK  159

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV+L+FQPAEE G GAK MI +G ++N++AIFG+HVA   P+GVVASRPG  +AG G F
Sbjct  160   GTVVLVFQPAEEGGGGAKKMIDDGTVENIEAIFGVHVADVVPIGVVASRPGPVMAGSGFF  219

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGHAA+P  ++DPILAAS  ++SLQ +VSRE DP DSQVV+V   QGG +FNV
Sbjct  220   EAVISGKGGHAALPHHTIDPILAASNVIVSLQQLVSREADPLDSQVVTVGKFQGGGAFNV  279

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+RAF K+SF  LK+RIEE++ +QA+V RC   +DF   + P FP    PT
Sbjct  280   IPDSVTIGGTFRAFLKESFNQLKQRIEEVIVSQASVQRCNAVVDFLDKDRPFFP----PT  335

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIGVKNEKSATV  440
             IN   +++   K +S +VG  NV      MG+EDF  Y D +P   ++F+G+ NE     
Sbjct  336   INSAGLHDFFVKVASEMVGPKNVRDKQPLMGAEDFAFYADAIPATYYYFLGMYNETRGPQ  395

Query  439   FPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKP  332
              P HSPYFT++ED LP GAA+ A+ A  YLL H  P
Sbjct  396   APHHSPYFTINEDALPYGAALQASLATRYLLEHQPP  431



>ref|XP_010999399.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Populus euphratica]
Length=490

 Score =   484 bits (1247),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 225/398 (57%), Positives = 294/398 (74%), Gaps = 4/398 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + ++ LA + ETV W++ +RR+IH NPELA+EE  TS +VR ELD +G++Y +P+A+TG+
Sbjct  96    EAVLALARQPETVTWLKSLRRKIHENPELAFEEIKTSELVRDELDGMGIEYMYPLAQTGI  155

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IG+G PPFVA+RADMDALPIQE VEW+HKS+V GKMHACGHDAH AML+GAAKIL+ 
Sbjct  156   RAWIGTGGPPFVAVRADMDALPIQEAVEWKHKSKVAGKMHACGHDAHVAMLMGAAKILKS  215

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+L+FQPAEE G GAK MI +G L++V+AIF +HV+H++P  +V SRPG  L
Sbjct  216   REHLLKGTVILLFQPAEEAGNGAKRMIGDGALEDVEAIFAVHVSHEHPTAIVGSRPGPLL  275

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I GK GHA  P  SVDPILAAS +VISLQSIVSRE +P DSQVVSV+ + G
Sbjct  276   AGCGFFRAIINGKMGHAGTPHHSVDPILAASAAVISLQSIVSREANPLDSQVVSVTTMDG  335

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G+  ++IPDT  + GT+RAF+  SF  L +RIEE++  QA+V RC+  +DF   ++  +P
Sbjct  336   GNDLDMIPDTVILGGTFRAFSDTSFNQLLQRIEEVIVEQASVFRCSATVDFFENQSTVYP  395

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND  +YEH RK +  ++G  N  + P  MG+EDF  Y   VP AF++IGV+NE
Sbjct  396   ----PTVNDDLMYEHVRKVAIDLLGPANFRVVPPMMGAEDFSFYTQVVPAAFYYIGVRNE  451

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                ++   HSPYF +DEDVLP+GAA HA  A  YL+ H
Sbjct  452   TLGSIHTGHSPYFMIDEDVLPIGAATHATIAERYLIEH  489



>ref|NP_001043347.1| Os01g0560000 [Oryza sativa Japonica Group]
 sp|Q8S9S4.1|ILL1_ORYSJ RecName: Full=IAA-amino acid hydrolase ILR1-like 1; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAB85405.1| putative auxin amidohydrolase [Oryza sativa Japonica Group]
 dbj|BAF05261.1| Os01g0560000 [Oryza sativa Japonica Group]
 gb|EAZ12344.1| hypothetical protein OsJ_02236 [Oryza sativa Japonica Group]
 dbj|BAG97475.1| unnamed protein product [Oryza sativa Japonica Group]
Length=442

 Score =   483 bits (1242),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 234/396 (59%), Positives = 289/396 (73%), Gaps = 5/396 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A E E   WM  +RR IH NPEL YEEFATS +VRRELD LG+ YR P A TGVVAT+G+
Sbjct  40    AKEAEFAGWMVGLRRRIHENPELGYEEFATSELVRRELDALGIPYRHPFAVTGVVATVGT  99

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G PPFVALRADMDALP+QE VEWEHKS+V GKMH CGHDAH AMLLG+A+ILQ+ R +LK
Sbjct  100   GGPPFVALRADMDALPMQESVEWEHKSKVPGKMHGCGHDAHVAMLLGSARILQEHRDELK  159

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV+L+FQPAEE G GAK MI +G ++N++AIFG+HVA   P+GVVASRPG  +AG G F
Sbjct  160   GTVVLVFQPAEEGGGGAKKMIDDGAVENIEAIFGVHVADVVPIGVVASRPGPVMAGSGFF  219

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGHAA+P  ++DPILAAS  ++SLQ +VSRE DP DSQVV+V   QGG +FNV
Sbjct  220   EAVISGKGGHAALPHHTIDPILAASNVIVSLQQLVSREADPLDSQVVTVGKFQGGGAFNV  279

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+RAF K+SF  LK+RIEE++ +QA+V RC   +DF   + P FP    PT
Sbjct  280   IPDSVTIGGTFRAFLKESFNQLKQRIEEVIVSQASVQRCNAVVDFLDKDRPFFP----PT  335

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIGVKNEKSATV  440
             IN   +++   K +S +VG  NV      MG+EDF  Y D +P   ++F+G+ NE     
Sbjct  336   INSAGLHDFFVKVASEMVGPKNVRDKQPLMGAEDFAFYADAIPATYYYFLGMYNETRGPQ  395

Query  439   FPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKP  332
              P HSPYFT++ED LP GAA+ A+ A  YLL H  P
Sbjct  396   APHHSPYFTINEDALPYGAALQASLAARYLLEHQPP  431



>ref|XP_004249219.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Solanum lycopersicum]
Length=485

 Score =   483 bits (1244),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 221/395 (56%), Positives = 297/395 (75%), Gaps = 4/395 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + I+ +A +TE V+W++ VRR+IH +PELA++EF TS +VR+EL+++ + YR+P+A TG+
Sbjct  90    NEILKIAQKTEHVKWIKSVRRKIHEHPELAFQEFETSKLVRQELEKMEISYRFPLATTGI  149

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              ATIGSG PPFVALRADMDALPIQE VEWEHKS++ GKMHACGHDAH AML+GAA+IL+ 
Sbjct  150   RATIGSGQPPFVALRADMDALPIQEAVEWEHKSKIAGKMHACGHDAHVAMLIGAARILKA  209

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
               + LKGTV+LIFQPAEE G GAK M++ G L+NV+AIF  HV+H++P GV+ SR G  L
Sbjct  210   REKNLKGTVVLIFQPAEEAGNGAKRMMKAGALENVEAIFAAHVSHQHPTGVIGSRTGPLL  269

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG FKA I GK G A+ P  S+DP+LAAS +VISLQ+IVSRE++P DSQVVSV+    
Sbjct  270   AGCGFFKAVISGKTGQASNPHHSIDPVLAASAAVISLQTIVSRESNPLDSQVVSVTSFNA  329

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G + +VIP++  ++GT+RAF+  +FY L KRI E+   QA+V RC+  +DF   ++  +P
Sbjct  330   GDNLDVIPESVILSGTFRAFSTINFYQLLKRIREVFTEQASVFRCSATVDFFEDKDTIYP  389

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND  +YEH R  +S +VG  N ++ P  MG+EDF  Y + +P AFF+IG++NE
Sbjct  390   ----PTVNDDTMYEHVRMVASDLVGTTNFKVVPPMMGAEDFSFYSEVIPAAFFYIGIRNE  445

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
                ++   HSP+F +DEDVLP+GAA HAA A  YL
Sbjct  446   TLGSIHTGHSPHFMIDEDVLPIGAATHAAIAERYL  480



>ref|XP_010924947.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Elaeis guineensis]
Length=437

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 229/398 (58%), Positives = 298/398 (75%), Gaps = 6/398 (2%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A E+E ++WM  +RR IH NPEL YEEF TS ++RREL+ +G+ Y++P+A TGVV  +G+
Sbjct  35    AKESEFLDWMVGIRRRIHENPELGYEEFKTSELIRRELEAMGIAYKYPIAVTGVVGFVGT  94

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G+ PFVALRADMDALP+QE VEWEHKS+V GKMHACGHDAH AMLLGAAKILQ+ R +L+
Sbjct  95    GNAPFVALRADMDALPMQENVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILQEHRDELQ  154

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV+L+FQPAEE G GA+ MI+ G ++NVDAIFG H+A   PVGVVASRPG  +AG G F
Sbjct  155   GTVVLLFQPAEEGGGGAQKMIEAGAVENVDAIFGFHIASDLPVGVVASRPGPIMAGSGFF  214

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGHAAIPQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+V+  QGG +FNV
Sbjct  215   EAVISGKGGHAAIPQHTIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFQGGGAFNV  274

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+RAF+K+SF  LK+RIEE++ AQA+V RC+  +DF   E P FP     T
Sbjct  275   IPDSVTIGGTFRAFSKESFSQLKQRIEEVIVAQASVQRCSATVDFIAKERPFFP----VT  330

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIGVKNEKSATV  440
             +N   ++ +  K +  +VG +NV      MG+EDF  + + VP A ++F+G+ +  +   
Sbjct  331   VNSNNLHGYFHKVAEQMVGSNNVRDRQPVMGAEDFAFFTEVVPMAYYYFVGMNDASNGPQ  390

Query  439   FPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL-SHAKPP  329
              PPHSPYFT++E+ LP GAA+HA+ A  YL  +HA  P
Sbjct  391   HPPHSPYFTVNEEALPYGAALHASLAARYLFENHAPSP  428



>ref|XP_010268965.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Nelumbo nucifera]
Length=476

 Score =   483 bits (1242),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 225/395 (57%), Positives = 291/395 (74%), Gaps = 4/395 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + I+ LA   ETVEW++ +RR IH NPELA++E+ TS +VR ELD+L + YR+P+A TG+
Sbjct  82    EEILELAKRPETVEWLKGLRRRIHENPELAFQEYETSRLVRNELDQLQISYRFPLAGTGI  141

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A++G+G PPF+ALRADMDALPIQE VEWEH+S+V GKMHACGHDAHTAMLLGAAKIL+ 
Sbjct  142   RASVGTGGPPFIALRADMDALPIQEAVEWEHRSKVPGKMHACGHDAHTAMLLGAAKILKS  201

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+LIFQPAEE G GAK M+Q+G L++V+AIF +HV+H+ P G + SRPG  L
Sbjct  202   RENNLKGTVILIFQPAEEAGNGAKRMMQDGALEDVEAIFAIHVSHERPTGTIGSRPGPLL  261

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I G+ G A  P  SVDP+LAAS +VISLQ++VSRE +P DSQVVSV+   G
Sbjct  262   AGCGFFRAVISGRKGDAGSPHLSVDPVLAASAAVISLQNLVSREANPLDSQVVSVASFNG  321

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G + + IP + TI GT+RAF+  SFY L KR+EE++  QA+V+RC+  +DF   E   +P
Sbjct  322   GDNLDQIPQSVTIAGTFRAFSNASFYGLLKRVEEVIVEQASVYRCSATVDFFKKETQIYP  381

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND  +YEH +K +  +VG  N  + P  MG+EDF  Y + VP AFF+IGV+NE
Sbjct  382   ----PTVNDEYMYEHVKKVAIDLVGAKNFIVVPPMMGAEDFSFYSEMVPAAFFYIGVRNE  437

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
                +    HSPYF +DE+VLP+GAA H A A  YL
Sbjct  438   TLGSTHSGHSPYFMIDEEVLPIGAAAHVAIAERYL  472



>ref|XP_006466100.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Citrus 
sinensis]
Length=450

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 231/402 (57%), Positives = 297/402 (74%), Gaps = 7/402 (2%)
 Frame = -1

Query  1543  GLKD---RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWP  1373
             GL D   +++  A   E V WM  +RR+IH+NPEL Y+EF TS ++R ELD++G+KY+  
Sbjct  36    GLSDIPKKLLNFAKRQELVGWMIGIRRKIHQNPELGYQEFETSQLIRSELDKMGIKYKHS  95

Query  1372  VAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGA  1193
             VA TGVV  IG+G PPFVALRADMD+LP+QE+VEWE+KS++ GKMHACGHD H  MLLGA
Sbjct  96    VAVTGVVGFIGTGEPPFVALRADMDSLPLQEMVEWEYKSKIPGKMHACGHDGHVTMLLGA  155

Query  1192  AKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVAS  1013
             AKILQ+ R++LKGTV+L+FQPAEE G GA  +++ GVL+ V+AIFGLHV    P+G VAS
Sbjct  156   AKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVAS  215

Query  1012  RPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVS  833
             RPG  LAG G F+A I GKGGHAAIPQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+
Sbjct  216   RPGPLLAGSGFFEAVIGGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVT  275

Query  832   VSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGT  653
             V+  QGG +FNVIPD+  I GT+RAF+K+SF  LK+RIEE++  QAAV RC+  +DF   
Sbjct  276   VAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRCSATVDFLSK  335

Query  652   ENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFF  473
             E P FP    PTIN+  ++++ +  +  ++    V++    MGSEDF  Y + +PG FFF
Sbjct  336   EKPFFP----PTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMPGYFFF  391

Query  472   IGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             +G+KNE    V   HSPYFTL+ED LP GAA+HA+ A  YLL
Sbjct  392   LGMKNETLGKVESIHSPYFTLNEDALPYGAALHASLALRYLL  433



>ref|XP_010268967.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Nelumbo nucifera]
Length=476

 Score =   481 bits (1239),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 230/398 (58%), Positives = 295/398 (74%), Gaps = 4/398 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + I+ LA   ETVEW++ +RR IH NPELA++E+ TS +VR ELDRL + YR+P A+TG+
Sbjct  82    EEILELAKRPETVEWLKGLRRRIHENPELAFQEYETSRLVRSELDRLQISYRFPFAETGI  141

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A+IG+GSPPF+A+RADMDALPIQE VEWEHKS+V GKMHACGHDAHTAMLLGAAKIL+ 
Sbjct  142   RASIGTGSPPFIAIRADMDALPIQEAVEWEHKSKVPGKMHACGHDAHTAMLLGAAKILKS  201

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+L+FQPAEE G GAK M+Q+G L++V+AIF +HV+H+ P G + SRPG  L
Sbjct  202   REHNLKGTVILVFQPAEEAGNGAKRMMQDGALEDVEAIFAIHVSHERPTGTIGSRPGPLL  261

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG FKA I G+ GHA  P  SVDP+LAAS +VISLQS+VSRE +P DSQVVSV+   G
Sbjct  262   AGCGFFKAVISGRKGHAESPHLSVDPVLAASAAVISLQSLVSREANPLDSQVVSVASFNG  321

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G   ++IP + T+ GT+RAF+  SFY L +RIEE++  QA+V+RC+  +DF   +   +P
Sbjct  322   GDDLDLIPQSVTLAGTFRAFSNASFYRLLQRIEEVIVEQASVYRCSATVDFFEKKTQIYP  381

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND  +YEH RK +  +VG  N  + P  MG+EDF  Y + +P AFF+IGV+NE
Sbjct  382   ----PTVNDEYMYEHVRKVAIDLVGAKNFIVVPPMMGAEDFSFYSEMIPAAFFYIGVRNE  437

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                +    HSPYF +DE+VLP+GAA HAA A  YL  H
Sbjct  438   TLGSTHSGHSPYFMIDEEVLPIGAAAHAAIAERYLNEH  475



>ref|XP_007024408.1| Peptidase M20/M25/M40 family protein [Theobroma cacao]
 gb|EOY27030.1| Peptidase M20/M25/M40 family protein [Theobroma cacao]
Length=448

 Score =   480 bits (1236),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 227/403 (56%), Positives = 296/403 (73%), Gaps = 2/403 (0%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + +  A   E V+W+  +RR+IH NPEL YEEF TS ++R ELD++G+ Y++PV+ TGVV
Sbjct  39    KFLHFAKGQELVDWIVGIRRKIHENPELGYEEFETSKLIREELDKMGIPYKYPVSVTGVV  98

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               +G+G PPFVA+RADMDAL ++ELVE+EHKS+  GKMHACGHDAH +MLLGAAKIL++ 
Sbjct  99    GYVGTGKPPFVAIRADMDALAMEELVEFEHKSKNPGKMHACGHDAHVSMLLGAAKILKEH  158

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
              ++LKGTVLL+FQPAEE G GAK M+  GVL NVDAIFGLHV    P+G VASRPG  LA
Sbjct  159   LEELKGTVLLVFQPAEEGGGGAKKMLDAGVLKNVDAIFGLHVVPDQPIGTVASRPGPLLA  218

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I GKGGHAAIPQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+V+  QGG
Sbjct  219   GSGFFEAVISGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFQGG  278

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+K+S   LK+RIEE+++ QAAV RC+  +DF   E P   P
Sbjct  279   GAFNVIPDSVTIGGTFRAFSKESLTQLKQRIEEVIKGQAAVQRCSATVDFYENEKPV--P  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PT+N+  ++EH +  +  ++G D V+     MGSEDF  Y + +PG FF +G++++ 
Sbjct  337   IFPPTVNNKDLHEHFQNVAGDMLGADKVKDMQPLMGSEDFAFYQEAIPGYFFMLGMRDDT  396

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHS  323
                +   HSPYF ++EDVLP GAA+HA+ A  YLL+     HS
Sbjct  397   GPQLKSVHSPYFMINEDVLPYGAALHASLAARYLLAAEPKFHS  439



>ref|XP_004235624.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Solanum lycopersicum]
Length=445

 Score =   479 bits (1234),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 227/405 (56%), Positives = 296/405 (73%), Gaps = 5/405 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + +  A ++E  +WM  VRR IH NPEL YEE  TS ++R ELD +G++Y++P A TG+V
Sbjct  38    KFLDFAKKSEVFDWMVEVRRRIHENPELGYEELETSKLIREELDNMGIQYKYPFANTGIV  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IGSG PPFV +RADMDALP+QE+V+WEHKS+  GKMHACGHDAH AMLLGAAKIL Q 
Sbjct  98    GFIGSGDPPFVGIRADMDALPMQEMVDWEHKSRNPGKMHACGHDAHIAMLLGAAKILLQH  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             +  LKGTV L+FQPAEE G GAK MI+ G L+NV+AIFGLHV   +P+G V+SRPG FLA
Sbjct  158   QNILKGTVALVFQPAEEGGGGAKKMIEAGALENVEAIFGLHVHPNFPLGKVSSRPGPFLA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I G+GGHAAIPQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+V+  QGG
Sbjct  218   GSGFFEAVISGRGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFQGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+K+SF  L++RIEE++  QAAV RC   +DF     P FP 
Sbjct  278   GAFNVIPDSVTIGGTFRAFSKESFLQLRQRIEEVIVGQAAVQRCNATVDFLTNSKPFFP-  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PT+ND  +++H ++ +  ++G D+V+     MGSEDF  Y + +PG F+ +G++ E 
Sbjct  337   ---PTVNDKNLHKHFQRVAGDMLGNDHVKDMEPLMGSEDFAFYQEVIPGYFYMLGMQGET  393

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHSSS  317
             +      HSPYF ++E+ LP+GAA+ A+ A TYLL  A+P   SS
Sbjct  394   NENPASVHSPYFKINEEALPLGAALQASLAITYLLE-AQPQVPSS  437



>ref|XP_003543612.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
 gb|KHN30029.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=444

 Score =   479 bits (1234),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 225/395 (57%), Positives = 292/395 (74%), Gaps = 4/395 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + + LA +    +WM  +RR+IH NPEL YEEF TS ++R ELD+LG+ Y+ PVA TGVV
Sbjct  37    KFLDLAKDPRVFDWMVGIRRKIHENPELGYEEFETSKLIRAELDKLGISYKHPVAVTGVV  96

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDALP+QE+VEWEHKS+V GKMHACGHDAH AMLLGAAKIL++ 
Sbjct  97    GFIGTGLPPFVALRADMDALPMQEMVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILKEH  156

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
               +++GTV+L+FQPAEE G GAK ++  GVL+N+ AIFGLH+A  YP+G VASR G   A
Sbjct  157   ENEIRGTVVLVFQPAEEGGGGAKKILDAGVLENISAIFGLHIAPTYPIGEVASRSGPIFA  216

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+ATI G+GGHAAIPQ S+DPILAAS  ++SLQ IVSRE DP DSQVV+V   QGG
Sbjct  217   GSGFFEATINGRGGHAAIPQHSIDPILAASNVIVSLQHIVSREADPLDSQVVTVGKFQGG  276

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+  I GT+RAF+K+SF  L++RIE+++  QAAV RC   ++F   E P FP 
Sbjct  277   GAFNVIPDSVAIGGTFRAFSKESFMQLRQRIEQVITGQAAVQRCNATVNFLDDEKPFFP-  335

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PT+N+  ++E+ +  +  ++G +NV+     MGSEDF  Y +  PG FF +G++N  
Sbjct  336   ---PTVNNGDLHEYFKSVAGSLLGVNNVKDMQPLMGSEDFAFYQEVFPGYFFLLGMENVS  392

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
                +  PHSPYF ++ED LP GAA+HA+ A +YLL
Sbjct  393   IEHLESPHSPYFKINEDALPYGAALHASLASSYLL  427



>ref|XP_002515893.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
 gb|EEF46313.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
Length=435

 Score =   479 bits (1233),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 231/401 (58%), Positives = 295/401 (74%), Gaps = 5/401 (1%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
              +  A + +   WM  VRR+IH NPEL YEEF TS ++R ELD++GVKY++P A TGVV 
Sbjct  29    FLDYAKKDDIFNWMVGVRRKIHENPELGYEEFETSKLIRAELDKMGVKYKYPFAVTGVVG  88

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              IG+G PPFVALRADMDALP+QE+VEWE+KS+V  KMHACGHDAH  MLLGAAKILQ+ +
Sbjct  89    FIGTGRPPFVALRADMDALPMQEMVEWEYKSKVPEKMHACGHDAHVTMLLGAAKILQEHQ  148

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
             ++LKGTV+L+FQPAEE G GAK MI  G L+NV+AIFGLHV  +  +G VASRPG  LAG
Sbjct  149   EELKGTVVLVFQPAEEGGGGAKKMIDAGALENVEAIFGLHVDSRLLIGQVASRPGPLLAG  208

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
              G F A I GKGGHAAIPQ S+DPILAAS +++SLQ +VSRE DP DSQVV+V+  QGG 
Sbjct  209   SGFFDAVISGKGGHAAIPQHSIDPILAASNAIVSLQHLVSREADPLDSQVVTVAKFQGGG  268

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
             +FNVIPD+ TI GT+RAF+K+SF  L++RIEE++  QA+V RC   +DF   + P FP  
Sbjct  269   AFNVIPDSVTIGGTFRAFSKESFKQLRQRIEEVITGQASVQRCKATVDFLEKDKPPFP--  326

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
               PT+ND +++E     +  ++G D V+     MGSEDF  Y + +PG  FFIG++NE  
Sbjct  327   --PTVNDKKLHEFFATVAGDVLGSDKVKDMQPLMGSEDFAFYQEIMPGYIFFIGMQNETR  384

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPH  326
               +   HSP+F ++EDVLP GAA+HA+ A  YLL+  +P H
Sbjct  385   KKLQSAHSPHFEINEDVLPYGAALHASLATRYLLN-LQPEH  424



>ref|XP_004502492.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6-like [Cicer arietinum]
Length=484

 Score =   481 bits (1237),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 225/396 (57%), Positives = 292/396 (74%), Gaps = 4/396 (1%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
             ++ +A   ET EW++ VRR+IH NPELA+EE  TS ++R ELD + V YR+P+AKTG+ A
Sbjct  92    VLSIARRPETAEWLKSVRRKIHENPELAFEEIETSRLIREELDLMEVSYRFPLAKTGIRA  151

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              IG+G PPFVA+RADMDALPIQE VEWE+KS+V GKMHACGHDAH AML+GAAKIL+   
Sbjct  152   WIGTGGPPFVAVRADMDALPIQEGVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKTRE  211

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
               LKGTV+L+FQPAEE G GAK MIQ+G LD+V+AIF +HV+H++P  ++ SRPG  LAG
Sbjct  212   HLLKGTVILLFQPAEEAGNGAKRMIQDGALDDVEAIFAVHVSHEHPTSIIGSRPGPLLAG  271

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
             CG F+A I GK   AA P  +VDP+LAAS +VISLQ IVSRE++P DSQVVSV+   GG+
Sbjct  272   CGFFRAVISGKRALAANPHHTVDPVLAASAAVISLQGIVSRESNPLDSQVVSVTSFNGGN  331

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
             S+++IPD   I GT+RAF+  SFY L  RI++++  QA+V+RC  E+DF   E   +P  
Sbjct  332   SYDMIPDAVVIGGTFRAFSNTSFYQLLDRIQQVIVEQASVYRCFAEVDFFEKEYTIYP--  389

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
               PT+ND ++YEH +K S  ++G+ N  + P  MG+EDF  Y   VP AFF+IG++NE  
Sbjct  390   --PTVNDDQMYEHVKKVSIDLLGKKNFRVVPPMMGAEDFSFYSQVVPSAFFYIGIRNETL  447

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
              +    HSP+F +DED LP+GAAVHAA A  YL  H
Sbjct  448   GSTHTGHSPHFMIDEDALPIGAAVHAAIAERYLNEH  483



>emb|CDO97948.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   477 bits (1228),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 232/388 (60%), Positives = 290/388 (75%), Gaps = 5/388 (1%)
 Frame = -1

Query  1489  MRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSPPFVALR  1310
             M  +RR+IH NPEL YEEF TS +VR ELD++G+ Y++PVA TGVV  +GSG PPFVALR
Sbjct  1     MVGIRRKIHENPELGYEEFETSKLVREELDKMGIPYKYPVAVTGVVGFVGSGEPPFVALR  60

Query  1309  ADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQP  1130
             ADMDAL +QE++EWEHKS+  GKMHACGHDAH AMLLGAAKILQ+ R+ LKGTV+L+FQP
Sbjct  61    ADMDALAMQEMLEWEHKSKNPGKMHACGHDAHVAMLLGAAKILQEHRKILKGTVVLVFQP  120

Query  1129  AEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIKGKGG  950
             AEE G GAK MI  GV++NV AIFGLHV    PVG V SRPG  LAG G F+A I GKGG
Sbjct  121   AEEGGGGAKKMIDAGVIENVKAIFGLHVKPDLPVGEVESRPGPLLAGSGFFEAVISGKGG  180

Query  949   HAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTATITG  770
             HAAIPQ S+DPI+AAS  ++SLQ +VSRE DP DSQVV+V   QGG +FNVIPD+ TI G
Sbjct  181   HAAIPQHSIDPIVAASNVIVSLQHLVSREADPLDSQVVTVGKFQGGGAFNVIPDSVTIGG  240

Query  769   TYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDVRIYEH  590
             T+RAF+K+S   L++RIEE++  QAAV RC   ++F  TE P FP    PT+N+  ++ H
Sbjct  241   TFRAFSKESLMQLRQRIEEVIVGQAAVQRCNATVNFLSTEKPFFP----PTVNNKDLHNH  296

Query  589   ARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVFPPHSPYFTL  410
               K +S +VG  NV+     MGSEDF  + + +PG F FIGVK+EK+      HSP+F +
Sbjct  297   FLKVASDMVGTANVKEMQPLMGSEDFSFFQEVIPGYFIFIGVKDEKNTKPASVHSPFFKI  356

Query  409   DEDVLPVGAAVHAAFAYTYLL-SHAKPP  329
             +ED LP+GAA+HA+ A  +LL S+A+ P
Sbjct  357   NEDALPLGAALHASLAIRFLLESNAETP  384



>gb|EMT10443.1| IAA-amino acid hydrolase ILR1-like protein 1 [Aegilops tauschii]
Length=437

 Score =   478 bits (1231),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 230/393 (59%), Positives = 288/393 (73%), Gaps = 5/393 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A E E ++WM  VRR IH NPEL YEEF TS +VRRELD +G+ YR P A TGVVAT+G+
Sbjct  35    AKEAEFMDWMVGVRRRIHENPELGYEEFDTSELVRRELDAMGIPYRHPFAVTGVVATVGT  94

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G PPFVALRADMDALP+QE VEWEHKS+V GKMH CGHDAH AMLLG+AKILQ+ R +LK
Sbjct  95    GGPPFVALRADMDALPMQESVEWEHKSKVPGKMHGCGHDAHVAMLLGSAKILQEHRDELK  154

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV L+FQPAEE G GAK M++ G ++N++ +FGLHVA   P+GV+ASRPG  +AG G F
Sbjct  155   GTVALLFQPAEEGGGGAKKMVEAGAVENIEVMFGLHVADSVPIGVLASRPGPIMAGSGFF  214

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGHAA+P  ++DPILAAS  ++SLQ +VSRE DP DSQVV+V   QGG +FNV
Sbjct  215   EAVISGKGGHAALPHHTIDPILAASNVIVSLQQLVSREADPLDSQVVTVGKFQGGGAFNV  274

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+RAF K+SF  LK+RIEE++  QA+V RC+  +DF   + P FP    PT
Sbjct  275   IPDSVTIGGTFRAFMKESFNQLKQRIEEVIVTQASVQRCSAVVDFLDKDKPFFP----PT  330

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIGVKNEKSATV  440
             IN+  +++   K  S +VG +NV      MG+EDF  Y + VP   ++F+G+ NE     
Sbjct  331   INNPELHDFFAKVCSEMVGPNNVREKQPLMGAEDFSFYTEAVPKTYYYFVGMLNETRGPQ  390

Query  439   FPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
              P HSPYFT++ED LP GAA+ A+ A  YLL H
Sbjct  391   APHHSPYFTINEDALPYGAAMQASLAARYLLEH  423



>ref|XP_009396760.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   478 bits (1231),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 235/410 (57%), Positives = 301/410 (73%), Gaps = 9/410 (2%)
 Frame = -1

Query  1534  DRIMGL---ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAK  1364
             D ++G    A E E  +WM  VRR IH NPEL YEEF+TS ++R+ELD LG+ Y  PVA 
Sbjct  27    DGVVGFLERAKEPEFFDWMVGVRRRIHENPELGYEEFSTSELIRKELDALGIPYLHPVAV  86

Query  1363  TGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKI  1184
             TGVV  +G+G PPFVALRADMDAL +QE VEWEHKS+V GKMHACGHDAH A+LLG+AKI
Sbjct  87    TGVVGYVGTGKPPFVALRADMDALAMQEEVEWEHKSKVPGKMHACGHDAHVAILLGSAKI  146

Query  1183  LQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPG  1004
             LQ+ R  L+GTV+LIFQPAEE G GAK MI+ G+++NVDAIFG HVA   PVG VASRPG
Sbjct  147   LQEHRDDLQGTVVLIFQPAEEGGGGAKKMIEAGIVENVDAIFGFHVAVDIPVGTVASRPG  206

Query  1003  EFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSM  824
               +AG G F+A I GKGGHAAIPQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+V+ 
Sbjct  207   PIMAGSGFFEAVISGKGGHAAIPQHTIDPILAASNIIVSLQHLVSREADPLDSQVVTVAK  266

Query  823   IQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENP  644
              QGG +FNVIPD+ TI GT+RAF K+SFY LK+RIEE++ AQA+V RC+  +DF   + P
Sbjct  267   FQGGGAFNVIPDSVTIGGTFRAFTKESFYQLKQRIEEVIVAQASVQRCSASVDFLNKDRP  326

Query  643   TFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIG  467
              FP     T+N   ++ H +K ++ ++G  NV      MG+EDF ++ + +P A ++F+G
Sbjct  327   FFP----VTVNSKDLHGHFQKVAAKMLGVSNVVDRKPVMGAEDFALFGEVIPAAYYYFVG  382

Query  466   VKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHSSS  317
             + NE    ++P HSPYFT++E  LP GAA+HA+ A +Y LS    P SS+
Sbjct  383   MVNETQGPMYPAHSPYFTINEAALPYGAALHASLAMSY-LSEKHTPLSST  431



>ref|XP_009414063.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Musa acuminata 
subsp. malaccensis]
Length=458

 Score =   479 bits (1232),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 228/403 (57%), Positives = 300/403 (74%), Gaps = 5/403 (1%)
 Frame = -1

Query  1546  GGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVA  1367
             G  +  I+ LA + E VEW+  VRR IH +PELAYEEF TS ++R ELDR+GV+YR+P+A
Sbjct  61    GDWRAEILWLARQPEAVEWVTGVRRRIHEHPELAYEEFETSRLIRAELDRMGVEYRFPLA  120

Query  1366  KTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAK  1187
              TG+VATIG+G PPFVALRADMDALPIQE VEW++KS+V GKMHACGHDAH AMLLGAA+
Sbjct  121   ATGLVATIGTGDPPFVALRADMDALPIQEAVEWKYKSKVPGKMHACGHDAHVAMLLGAAR  180

Query  1186  ILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRP  1007
             IL+    +LKGTV L+FQPAEE G GAK MI++G L++V+AIF +HV+H YP  V++SRP
Sbjct  181   ILKTHEHRLKGTVKLLFQPAEEAGIGAKRMIEDGALEDVEAIFAVHVSHGYPTSVISSRP  240

Query  1006  GEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVS  827
             G  LA CG F+A IKG+ GHA  P  SVDPI+AA+  VISLQ+IV+RE+ P DSQVVSV+
Sbjct  241   GPLLAACGFFRAVIKGREGHAGNPHHSVDPIVAAAAVVISLQNIVARESSPLDSQVVSVA  300

Query  826   MIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTEN  647
                GG + ++IP++A++ GT+RAF+  SFY ++ RIEE++  Q++V RC   +DF   E 
Sbjct  301   SFNGGHNLDMIPESASLGGTFRAFSNASFYQVRHRIEEVILEQSSVFRCKASVDF--FEK  358

Query  646   PTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIG  467
               F P   PTIN+  +Y H +K +  ++G DN ++    MG+EDF  Y + +P AFF+IG
Sbjct  359   ERFYP---PTINEHSMYGHVKKVAIELLGADNFKVVEPTMGAEDFSFYSEMIPAAFFYIG  415

Query  466   VKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             V+NE   +V   HSPYF +DEDVLP GAA++AA A  YL+ H+
Sbjct  416   VRNETLGSVHVAHSPYFMIDEDVLPTGAALNAAIAEKYLIDHS  458



>ref|XP_003602066.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
 gb|ABF55223.1| auxin conjugate hydrolase [Medicago truncatula]
 gb|AES72317.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=476

 Score =   479 bits (1233),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 223/396 (56%), Positives = 295/396 (74%), Gaps = 4/396 (1%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
             ++ +A   ETVEW++ VRR+IH NPELA+EE  TS ++R+ELD + V YR+P+AKTG+ A
Sbjct  84    VLSVARLPETVEWLKSVRRKIHENPELAFEEIETSRLIRKELDLMEVSYRYPLAKTGIRA  143

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              IG+G PPFVA+RADMDALPIQE VEWE+KS+V GKMHACGHDAH AML+GAAKIL+   
Sbjct  144   WIGTGGPPFVAVRADMDALPIQEGVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKTRE  203

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
               LKGTV+L+FQPAEE G GAK MIQ+G L++V+AIF +HV+H++P G++ SRPG  LAG
Sbjct  204   HLLKGTVILLFQPAEEAGNGAKRMIQDGALEDVEAIFAVHVSHEHPTGMIGSRPGPLLAG  263

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
             CG F+A I GK   AA P+ S DP+LAAS +VIS+Q IVSRE++P DSQVVSV+   GG+
Sbjct  264   CGFFRAVISGKRASAANPRNSADPVLAASAAVISIQGIVSRESNPLDSQVVSVTSFNGGN  323

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
             S ++IPD+  I GT+RAF+  SFY L +RIE+++  QA+V+ C  E+DF   E   +P  
Sbjct  324   SHDMIPDSVVIGGTFRAFSNTSFYQLLERIEQVIVQQASVYSCFAEVDFFEKEYTIYP--  381

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
               PT+ND ++YEH +K S  ++G+ N  + P  MG+ED+  Y   +P AFF+IG++NE  
Sbjct  382   --PTVNDDQMYEHVKKVSIDLLGQKNFRVVPPMMGAEDYSFYSQVIPSAFFYIGIRNETL  439

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
              +    HSP+FT+DED LP+GAAVHA  A  YL  H
Sbjct  440   GSTHTGHSPHFTIDEDALPIGAAVHATIAERYLNEH  475



>gb|KDP40816.1| hypothetical protein JCGZ_24815 [Jatropha curcas]
Length=441

 Score =   478 bits (1229),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 224/398 (56%), Positives = 294/398 (74%), Gaps = 4/398 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L  R +  A   E V WM  +RR+IH NPEL YEEF TS ++R ELD++G++Y++P+A T
Sbjct  31    LSTRFLNYAKREELVNWMVGIRRKIHENPELGYEEFETSKLIRAELDKMGIEYKYPLAVT  90

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             G+V  IG+G PPFVA+RADMDAL +QE+VEWEHKS+V GKMHACGHDAH  MLLGAAKIL
Sbjct  91    GLVGFIGTGKPPFVAIRADMDALSMQEMVEWEHKSKVPGKMHACGHDAHVTMLLGAAKIL  150

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             ++ +++LKGTV+L+FQPAEE G GAK MI  G L+NV+AIFGLH+    P+G V SRPG 
Sbjct  151   KEHQEELKGTVVLVFQPAEEGGGGAKKMIDEGALENVNAIFGLHIDPSLPIGQVTSRPGP  210

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LAG G F+A I GKGGHAA+PQ+S+DPILAAS  ++SLQ +VSRE DP DSQVV+V+  
Sbjct  211   LLAGSGFFEAVISGKGGHAALPQQSIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKF  270

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             QGG +FNVIPD+ TI GT+RAF+++SF  L++RIEE++  QA+V RC   I+F   + P 
Sbjct  271   QGGGAFNVIPDSVTIGGTFRAFSRESFMQLRQRIEEVITGQASVQRCKATINFLQNDKPF  330

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             FP    PTIND +++++ +  +  + G D V+     MGSEDF  Y + VPG F FIG++
Sbjct  331   FP----PTINDKQLHKYFKVVAGDVFGIDKVKDMQPLMGSEDFAFYQEVVPGYFAFIGMQ  386

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             NE    +   H+P+F ++EDV P GAA+HA+ A  YLL
Sbjct  387   NETRKRLEYVHTPFFEINEDVFPYGAALHASLAARYLL  424



>ref|XP_006343020.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Solanum 
tuberosum]
Length=445

 Score =   478 bits (1229),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 229/417 (55%), Positives = 299/417 (72%), Gaps = 13/417 (3%)
 Frame = -1

Query  1582  AGESSKLPLAVDGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRREL  1403
             +GE S++P         + +  A ++E  +WM  VRR IH NPEL YEE  TS ++R EL
Sbjct  29    SGELSEIP--------SKFLDFAKKSEVFDWMMGVRRRIHENPELGYEELETSKLIREEL  80

Query  1402  DRLGVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGH  1223
             D LG++Y++P A TG+V  IGSG PPFVA+RADMDALP+QE+V+WEHKS+  GKMHACGH
Sbjct  81    DNLGIQYKYPFANTGIVGFIGSGKPPFVAIRADMDALPMQEMVDWEHKSRNPGKMHACGH  140

Query  1222  DAHTAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVA  1043
             DAH AMLLGAAKIL + +  LKGTV L+FQPAEE G GAK MI  G L+NV+AIFGLHV 
Sbjct  141   DAHVAMLLGAAKILLEHQNILKGTVALVFQPAEEGGGGAKKMIDAGALENVEAIFGLHVH  200

Query  1042  HKYPVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRE  863
               +P+G V SRPG FLAG G F+A I G+GGHAAIPQ S+DPILAAS  ++SLQ +VSRE
Sbjct  201   PNFPLGKVCSRPGPFLAGSGFFEAVISGRGGHAAIPQHSIDPILAASNVIVSLQHLVSRE  260

Query  862   TDPFDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHR  683
              DP DSQVV+V+  QGG +FNVIPD+ TI GT+RAF+K+SF  L++RIEE++  QAAV R
Sbjct  261   ADPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFLQLRQRIEEVIVGQAAVQR  320

Query  682   CTVEIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMY  503
             C   +DF   + P FP    PT+ND  +++H ++ +  ++G D+V+     MGSEDF  Y
Sbjct  321   CNATVDFLTNDKPFFP----PTVNDKNLHKHFQRVAGDMLGNDHVKDMEPLMGSEDFAFY  376

Query  502   LDKVPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKP  332
              + +PG F+ +G++ E +      HSPYF ++E+ LP GAA+ A+ A  YLL  A+P
Sbjct  377   QEVIPGYFYMLGMQGETNENPASVHSPYFKINEEALPFGAALQASLAIRYLLE-AQP  432



>ref|XP_010231929.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Brachypodium 
distachyon]
Length=444

 Score =   478 bits (1229),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 229/393 (58%), Positives = 292/393 (74%), Gaps = 5/393 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A E E ++WM  VRR IH NPEL YEEFATS +VRRELD +G+ YR P A TGVVAT+G+
Sbjct  42    AKEAEFMDWMVGVRRRIHENPELGYEEFATSELVRRELDAMGIPYRHPFAVTGVVATVGT  101

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G PPFVALRADMDALP+QE VEWEHKS+V GKMH CGHDAHTAMLLG+AKILQ+ R +L+
Sbjct  102   GGPPFVALRADMDALPMQESVEWEHKSKVPGKMHGCGHDAHTAMLLGSAKILQEHRDELQ  161

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV+L+FQPAEE G GA  M+++G ++N++A+FGLHVA   P+GV+ASRPG  +AG G F
Sbjct  162   GTVVLLFQPAEEGGGGAMKMVEDGAVENIEAMFGLHVADIVPIGVLASRPGPIMAGSGFF  221

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGHAA+P  ++DPILAAS  ++SLQ +VSRE DP DSQVV+V   QGG +FNV
Sbjct  222   EAVISGKGGHAALPHHTIDPILAASNVIVSLQQLVSREADPLDSQVVTVGKFQGGGAFNV  281

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+RAF K+SF  LK+RIEE++ +QA+V RC+  +DF   + P FP    PT
Sbjct  282   IPDSVTIGGTFRAFLKESFNQLKQRIEEVIVSQASVQRCSAVVDFLKKDRPFFP----PT  337

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIGVKNEKSATV  440
             IN   +++   K +S +VG +NV      MG+EDF  Y + VP   ++F+G+ NE     
Sbjct  338   INSPELHDFFGKVASEMVGPNNVRDRQPLMGAEDFSFYAEAVPTTYYYFVGMLNETRGPQ  397

Query  439   FPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
              P HSPYFT++ED +P GAA+  + A  YLL H
Sbjct  398   APHHSPYFTINEDAMPYGAAMQTSLAARYLLEH  430



>ref|XP_009794201.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Nicotiana sylvestris]
Length=445

 Score =   477 bits (1228),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 222/397 (56%), Positives = 293/397 (74%), Gaps = 4/397 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               + LA  T+  +WM ++RR IH NPEL +EEF TS ++R ELD++G+ Y++PVA TGVV
Sbjct  38    NFLNLAKRTDLFDWMVKIRRTIHENPELGFEEFETSKLIRNELDKMGIYYKYPVAVTGVV  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G  PFVALRADMDALP+QE VEWEHKS++ GKMHACGHDAH AMLLGAA+ILQ+ 
Sbjct  98    GFIGTGKSPFVALRADMDALPMQEEVEWEHKSKIPGKMHACGHDAHVAMLLGAARILQEQ  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             R  L+GTVLL+FQPAEE G GAK M+++GVLDNVDAIFGLH++  +P+G V +  G  +A
Sbjct  158   RDYLQGTVLLVFQPAEEGGGGAKKMLESGVLDNVDAIFGLHISAVHPIGTVTANSGPIMA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A IKGKGGHAAIPQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +GG
Sbjct  218   GSGFFEAVIKGKGGHAAIPQHTIDPILAASNIIVSLQHLVSREADPLDSQVVTVAKFKGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+K+SF  LK+RI E++  QAAV RC   +DFD TEN  F P
Sbjct  278   GAFNVIPDSVTIGGTFRAFSKESFTQLKQRIVEVITRQAAVQRCNTTVDFD-TENRPFYP  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                 T+N+  ++EH R  ++ ++G D +      MG+EDF  + +  PG F+ +G+ +E 
Sbjct  337   V---TVNNKALHEHFRDVAAQMLGNDKIIEKKPTMGTEDFSFFAEAFPGYFYLLGMVDET  393

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                    H+P++ ++ED LP GAA+HA+ A TYLL H
Sbjct  394   KGRFESGHNPFYRVNEDALPYGAALHASLATTYLLEH  430



>ref|XP_006434209.1| hypothetical protein CICLE_v10000964mg [Citrus clementina]
 gb|ESR47449.1| hypothetical protein CICLE_v10000964mg [Citrus clementina]
Length=486

 Score =   479 bits (1232),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 227/393 (58%), Positives = 288/393 (73%), Gaps = 4/393 (1%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
             +M LA   ETV+W+R VRR IH+NPELA++EF TS ++R ELDR+ + Y++P+AKTG+ A
Sbjct  87    VMELARRPETVDWLRSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRA  146

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              +G+G PPFVALRADMDALPIQE VEWE+KS+V GKMHACGHDAH AML+GAAKIL+   
Sbjct  147   WVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSRE  206

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
               LKGTV+LIFQPAEE G GAK M+ +G L++V+AIF +HV+H++P GV+ SRPG  LAG
Sbjct  207   HLLKGTVILIFQPAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAG  266

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
             CG F A I GK G AA P  SVDP+LAAS +VISLQ +VSRE +P DSQVVSV+   GG 
Sbjct  267   CGFFHAVISGKKGGAANPHRSVDPVLAASAAVISLQGLVSREANPLDSQVVSVTYFNGGD  326

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
               ++IPD   I GT RAF+  SFY L +RIEE++  QA V RC+  +DF    N  +P  
Sbjct  327   HLDMIPDAVVIGGTLRAFSNTSFYQLLQRIEEVIVEQARVFRCSATVDFFDKGNTVYP--  384

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
               PT+ND  +YEH +K +  ++G  N  + P  MG+EDF  Y + VP AF++IG+KNE  
Sbjct  385   --PTVNDEDMYEHVKKVAIDLLGPMNYRVVPPMMGAEDFSFYSEVVPAAFYYIGIKNETL  442

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
              ++   HSPYF +DEDVLPVGAAVHA  A  +L
Sbjct  443   GSIHTGHSPYFMIDEDVLPVGAAVHATIAERFL  475



>ref|XP_004158429.1| PREDICTED: LOW QUALITY PROTEIN: IAA-amino acid hydrolase ILR1-like 
4-like [Cucumis sativus]
Length=445

 Score =   477 bits (1228),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 227/400 (57%), Positives = 293/400 (73%), Gaps = 6/400 (2%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A   E  +WM  +RR+IH NPEL ++EF TS ++R ELDRLGV Y +PVA TGVV  IG+
Sbjct  43    AQHPEVFDWMVGIRRKIHENPELGFQEFETSKLIRAELDRLGVSYEYPVAITGVVGFIGT  102

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G+PPFVA+RADMDALP+QE VEWEHKS+V GKMHACGHDAH AMLLGAAKILQQ  + ++
Sbjct  103   GNPPFVAIRADMDALPLQEGVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILQQNSRLIQ  162

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV+L+FQPAEE G GAK M++ GVLD VDAIFGLHV+  YP G+  S+PG  LA  G F
Sbjct  163   GTVVLVFQPAEEGGGGAKKMLEAGVLDKVDAIFGLHVSSSYPFGMAISKPGPILAASGFF  222

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGHAA+PQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+++  QGG +FNV
Sbjct  223   EAVIGGKGGHAALPQHTIDPILAASNIIVSLQHLVSREADPLDSQVVTIAKFQGGGAFNV  282

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+RAF+K+SF  LK+RI E++  QA V RC   ++F+  + P FP     T
Sbjct  283   IPDSVTIGGTFRAFSKESFIQLKQRIVEVITNQAKVQRCNATVEFNEDQKPXFP----VT  338

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVF  437
             +N+  +Y+H R  +  ++G  N+      MG+EDFG Y + +PG F+F+G+KNE      
Sbjct  339   VNNQNLYKHFRTVAVDMLGTKNILDMQPLMGAEDFGFYGEVIPGLFYFLGMKNETIGKFE  398

Query  436   PPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHSSS  317
               HSPY+ ++EDVLP GAA+ A+ A  YLL H+  P S+S
Sbjct  399   QGHSPYYIVNEDVLPYGAALQASIATRYLLEHS--PKSTS  436



>dbj|BAJ94305.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score =   477 bits (1227),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 229/393 (58%), Positives = 289/393 (74%), Gaps = 5/393 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A E E ++WM  VRR IH NPEL YEEFATS +VRRELD +G+ YR P A TGVVAT+G+
Sbjct  38    AKEAEFLDWMVGVRRRIHENPELGYEEFATSELVRRELDAMGIPYRHPFALTGVVATVGT  97

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G PPFVALRADMDALP+QE VEWEHKS+V GKMH CGHDAH AMLLG+AKILQ+ R +LK
Sbjct  98    GGPPFVALRADMDALPMQESVEWEHKSKVPGKMHGCGHDAHVAMLLGSAKILQEHRDELK  157

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV+L+FQPAEE G GAK M++ G ++N++ +FG+HVA   P+GV+ASRPG  +AG G F
Sbjct  158   GTVVLLFQPAEEGGGGAKKMVEAGAVENIEVMFGIHVADTVPIGVLASRPGPIMAGSGFF  217

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGHAA+P  ++DPILAAS  ++SLQ +VSRE DP DSQVV+V   QGG +FNV
Sbjct  218   EAVISGKGGHAALPHHTIDPILAASNVIVSLQQLVSREADPLDSQVVTVGKFQGGGAFNV  277

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+RAF K+SF  LK+RIEE++  QA+V RC+  +DF   + P FP    PT
Sbjct  278   IPDSVTIGGTFRAFLKESFNQLKQRIEEVIVTQASVQRCSAVVDFLDKDRPFFP----PT  333

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIGVKNEKSATV  440
             IN+  +++   K  S +VG + V      MG+EDF  Y + VP   ++F+G+ NE     
Sbjct  334   INNPELHDFFVKVGSEMVGPNKVREKQPLMGAEDFSFYTEVVPKTYYYFVGMLNETRGPQ  393

Query  439   FPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
              P HSPYFT++ED LP GAA+ A+ A  YLL H
Sbjct  394   APHHSPYFTINEDTLPYGAAMQASLAARYLLEH  426



>ref|XP_006472793.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6-like [Citrus 
sinensis]
Length=486

 Score =   478 bits (1231),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 226/393 (58%), Positives = 288/393 (73%), Gaps = 4/393 (1%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
             +M LA   ETV+W++ VRR IH+NPELA++EF TS ++R ELDR+ + Y++P+AKTG+ A
Sbjct  87    VMELARRPETVDWLKSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRA  146

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              +G+G PPFVALRADMDALPIQE VEWE+KS+V GKMHACGHDAH AML+GAAKIL+   
Sbjct  147   WVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSRE  206

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
               LKGTV+LIFQPAEE G GAK M+ +G L++V+AIF +HV+H++P GV+ SRPG  LAG
Sbjct  207   HLLKGTVILIFQPAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAG  266

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
             CG F A I GK G AA P  SVDP+LAAS +VISLQ +VSRE +P DSQVVSV+   GG 
Sbjct  267   CGFFHAVISGKKGGAANPHRSVDPVLAASAAVISLQGLVSREANPLDSQVVSVTYFNGGD  326

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
               ++IPD   I GT RAF+  SFY L +RIEE++  QA V RC+  +DF    N  +P  
Sbjct  327   HLDMIPDAVVIGGTLRAFSNTSFYQLLQRIEEVIVEQARVFRCSATVDFFDKGNTVYP--  384

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
               PT+ND  +YEH +K +  ++G  N  + P  MG+EDF  Y + VP AF++IG+KNE  
Sbjct  385   --PTVNDEDMYEHVKKVAIDLLGPTNYRVVPPMMGAEDFSFYSEVVPAAFYYIGIKNETL  442

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
              ++   HSPYF +DEDVLPVGAAVHA  A  +L
Sbjct  443   GSIHTGHSPYFMIDEDVLPVGAAVHATIAERFL  475



>ref|XP_004297620.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Fragaria 
vesca subsp. vesca]
Length=445

 Score =   477 bits (1227),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 220/395 (56%), Positives = 291/395 (74%), Gaps = 4/395 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             +++ LA + +  EWM  +RR+IH NPEL YEEF TS ++R ELD++G+ Y++PVA TGVV
Sbjct  38    KLLTLAQKPQLFEWMVGIRRKIHENPELGYEEFETSKLIRAELDKMGISYKYPVAVTGVV  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
              +IG+G PPFVA+RADMDAL +QE+VEWEHKS++ GKMH CGHD H AMLLGAAKIL++ 
Sbjct  98    GSIGTGKPPFVAIRADMDALAMQEMVEWEHKSKIPGKMHGCGHDGHVAMLLGAAKILKEH  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
              + ++GT++L+FQPAEE G GAK ++  G L+NV AIFGLHVAH  P+  VASRPG F A
Sbjct  158   EKDIQGTIVLVFQPAEEGGGGAKKILDAGALENVTAIFGLHVAHHIPLAEVASRPGPFFA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I GKGGHAA+P  +VDPILA S  V SLQ IVSRE DP DSQVV+V  +QGG
Sbjct  218   GSGFFEAIISGKGGHAALPHHAVDPILAVSNVVTSLQHIVSREVDPLDSQVVTVGKVQGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+K+S   LK+RIE+++  QAAV RC   ++F   E P FP 
Sbjct  278   EAFNVIPDSVTIGGTFRAFSKESLMQLKQRIEKVIIGQAAVQRCNATVNFCEDEKPLFP-  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PT+N   ++ H +  +  ++G   V+  P  MGSEDF  Y + +PG FFF+G+K+++
Sbjct  337   ---PTVNHKELHTHFQNVAGDMLGAHKVKNHPPLMGSEDFAYYQEAIPGFFFFLGMKDDR  393

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
                +  PHSPYF ++ED LP GAA+HA+ A+ YL+
Sbjct  394   LGYLDTPHSPYFRINEDALPYGAALHASLAFRYLI  428



>gb|AAU06081.1| auxin amidohydrolase [Triticum aestivum]
Length=437

 Score =   476 bits (1225),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 230/393 (59%), Positives = 287/393 (73%), Gaps = 5/393 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A E E ++WM  VRR IH NPEL YEEF TS +VRRELD +G+ YR P A TGVVAT+G+
Sbjct  35    AKEAEFMDWMVGVRRRIHENPELGYEEFDTSELVRRELDAMGIPYRHPFAVTGVVATVGT  94

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G PPFVALRADMDALP+QE VEWEHKS+V GKMH CGHDAH AMLLG+AKILQ+ R +LK
Sbjct  95    GGPPFVALRADMDALPMQESVEWEHKSKVPGKMHGCGHDAHVAMLLGSAKILQEHRDELK  154

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV L+FQPAEE G GAK M++ G + N++ +FGLHVA   P+GV+ASRPG  +AG G F
Sbjct  155   GTVALLFQPAEEGGGGAKKMVEAGAVVNIEIMFGLHVADSVPIGVLASRPGPIMAGSGFF  214

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGHAA+P  ++DPILAAS  ++SLQ +VSRE DP DSQVV+V   QGG +FNV
Sbjct  215   EAVISGKGGHAALPHHTIDPILAASNVIVSLQQLVSREADPLDSQVVTVGKFQGGGAFNV  274

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+RAF K+SF  LK+RIEE++  QA+V RC+  +DF   + P FP    PT
Sbjct  275   IPDSVTIGGTFRAFMKESFNQLKQRIEEVIVTQASVQRCSAVVDFLDKDKPFFP----PT  330

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIGVKNEKSATV  440
             IN+  +++   K  S +VG +NV      MG+EDF  Y + VP   ++F+G+ NE     
Sbjct  331   INNPELHDFFAKVCSEMVGPNNVREKQPLMGAEDFSFYTEAVPKTYYYFVGMLNETRGPQ  390

Query  439   FPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
              P HSPYFT++ED LP GAA+ A+ A  YLL H
Sbjct  391   APHHSPYFTINEDALPYGAAMQASLAARYLLEH  423



>ref|XP_006438485.1| hypothetical protein CICLE_v10031540mg [Citrus clementina]
 gb|ESR51725.1| hypothetical protein CICLE_v10031540mg [Citrus clementina]
 gb|KDO82612.1| hypothetical protein CISIN_1g013395mg [Citrus sinensis]
Length=323

 Score =   472 bits (1214),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 214/281 (76%), Positives = 252/281 (90%), Gaps = 0/281 (0%)
 Frame = -1

Query  1549  DGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPV  1370
             +  +K RI+ LAN+ +TV WM+++RR+IH NPELAYEEF TS ++RRELD+LG+ YRWPV
Sbjct  42    NSSIKSRIIELANDQDTVNWMKKMRRQIHENPELAYEEFETSELIRRELDQLGIAYRWPV  101

Query  1369  AKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAA  1190
             AKTGVVAT+GSGSPPFVALRADMDALPIQELVEWEHKS++DGKMHACGHDAH AMLLGAA
Sbjct  102   AKTGVVATVGSGSPPFVALRADMDALPIQELVEWEHKSKIDGKMHACGHDAHVAMLLGAA  161

Query  1189  KILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASR  1010
             KILQ++R+ LKGTV+LIFQPAEERG GAKDMIQ GVL+NV+AIFGLH+ HKYP GVVASR
Sbjct  162   KILQEMRETLKGTVVLIFQPAEERGTGAKDMIQEGVLENVEAIFGLHLVHKYPTGVVASR  221

Query  1009  PGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSV  830
             PG+FLAGCG FKA I GKGGHAAIPQ  +DPILA S+SVISLQ+IVSRE DP DSQVVSV
Sbjct  222   PGDFLAGCGSFKAKISGKGGHAAIPQHCIDPILAVSSSVISLQNIVSREIDPLDSQVVSV  281

Query  829   SMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIV  707
             +MI GGSS+N+IPD+AT+ GT+RAFNK  F +L++RIEE++
Sbjct  282   AMINGGSSYNMIPDSATVAGTFRAFNKKRFNALRERIEEVL  322



>ref|XP_004135685.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cucumis 
sativus]
 gb|KGN66199.1| hypothetical protein Csa_1G575150 [Cucumis sativus]
Length=445

 Score =   476 bits (1226),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 227/400 (57%), Positives = 293/400 (73%), Gaps = 6/400 (2%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A   E  +WM  +RR+IH NPEL ++EF TS ++R ELDRLGV Y +PVA TGVV  IG+
Sbjct  43    AQHPEVFDWMVGIRRKIHENPELGFQEFETSKLIRAELDRLGVSYEYPVAITGVVGFIGT  102

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G+PPFVA+RADMDALP+QE VEWEHKS+V GKMHACGHDAH AMLLGAAKILQQ  + ++
Sbjct  103   GNPPFVAIRADMDALPLQEGVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILQQNSRLIQ  162

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV+L+FQPAEE G GAK M++ GVLD VDAIFGLHV+  YP G+  S+PG  LA  G F
Sbjct  163   GTVVLVFQPAEEGGGGAKKMLEAGVLDKVDAIFGLHVSSSYPFGMAISKPGPILAASGFF  222

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGHAA+PQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+++  QGG +FNV
Sbjct  223   EAVIGGKGGHAALPQHTIDPILAASNIIVSLQHLVSREADPLDSQVVTIAKFQGGGAFNV  282

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+RAF+K+SF  LK+RI E++  QA V RC   ++F+  + P FP     T
Sbjct  283   IPDSVTIGGTFRAFSKESFIQLKQRIVEVITNQAKVQRCNATVEFNEDQKPFFP----VT  338

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVF  437
             +N+  +Y+H R  +  ++G  N+      MG+EDFG Y + +PG F+F+G+KNE      
Sbjct  339   VNNHNLYKHFRTVAVDMLGTKNILDMQPLMGAEDFGFYGEVIPGLFYFLGMKNETVGKFE  398

Query  436   PPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHSSS  317
               HSPY+ ++EDVLP GAA+ A+ A  YLL H+  P S+S
Sbjct  399   QGHSPYYIVNEDVLPYGAALQASIATRYLLEHS--PKSTS  436



>ref|XP_010062569.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Eucalyptus grandis]
 gb|KCW69702.1| hypothetical protein EUGRSUZ_F03096 [Eucalyptus grandis]
Length=446

 Score =   476 bits (1226),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 228/400 (57%), Positives = 295/400 (74%), Gaps = 5/400 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             +++  A   +  EWM  +RR+IH NPEL YEEF TS ++R ELD++G++Y+ P+A TGVV
Sbjct  38    KLLDFAKSRDFSEWMIGIRRKIHENPELGYEEFETSKLIRSELDKMGIRYKHPLAVTGVV  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDAL +QE+VEWEHKS+V GKMHACGHDAH AMLLGAAKIL++ 
Sbjct  98    GFIGTGKPPFVALRADMDALLLQEMVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILREH  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             +++++GTV+L+FQPAEE G GAK MI  G L+NVDAIFGLHVA   P  VVASRPG  LA
Sbjct  158   QEEIRGTVVLVFQPAEEGGGGAKKMIDAGALENVDAIFGLHVAPHLPASVVASRPGPLLA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I+GKGGHAAIP +++DPILAAS  V+SLQ ++SRE DP DSQVV+V+  QGG
Sbjct  218   GSGFFEAVIRGKGGHAAIPHQAIDPILAASRVVVSLQQLISREADPLDSQVVTVAKFQGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIP++ TI GT+RAF+ +SF  LK+RIEE+V +QAAV RC   + F   EN  FP 
Sbjct  278   GAFNVIPESVTIGGTFRAFSNESFMHLKQRIEEVVTSQAAVQRCHATVHFFSEENLFFP-  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PTIND  +++H +K +  ++G   +      MGSEDF  Y + +PG FFF+GV ++ 
Sbjct  337   ---PTINDESLHKHFKKVARELLGPHKINDMQPMMGSEDFSFYQEVIPGYFFFLGVGDDT  393

Query  451   SATV-FPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
                    PHSPYF ++ED LP G+A+HA+ A TYLL   +
Sbjct  394   GERYDSAPHSPYFKINEDGLPYGSALHASLAVTYLLDQQQ  433



>ref|XP_010244354.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Nelumbo nucifera]
Length=452

 Score =   476 bits (1226),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 228/421 (54%), Positives = 302/421 (72%), Gaps = 12/421 (3%)
 Frame = -1

Query  1564  LPLAVDGGLKDR--------IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRR  1409
             +P++ D  L  +         + LA + E  +WM  +RR+IH NPEL Y+EF TS ++R 
Sbjct  26    MPISSDSSLSTKGFAEISANFLNLAKKPELADWMIGIRRKIHENPELGYQEFETSKLIRA  85

Query  1408  ELDRLGVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHAC  1229
             ELD++G+ Y+ PVA TGVV  IG+G PPFVA+RADMDALP+QE VEWEHKS++ GKMHAC
Sbjct  86    ELDKMGIPYKHPVAVTGVVGFIGTGGPPFVAIRADMDALPMQENVEWEHKSKIPGKMHAC  145

Query  1228  GHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLH  1049
             GHDAH A+LLGA KILQ+ +  L+GTV+L+FQPAEE G GAK M+  G+L+NV+AIFGLH
Sbjct  146   GHDAHVAILLGATKILQEHQNNLQGTVVLVFQPAEEGGGGAKKMLDAGILENVEAIFGLH  205

Query  1048  VAHKYPVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVS  869
             V+   P+G VASRPG  +AG G F+A I GKGGHAAIPQ ++DPILAAS  ++SLQ +VS
Sbjct  206   VSVDLPIGKVASRPGPIMAGSGFFEAVISGKGGHAAIPQHTIDPILAASNVIVSLQHLVS  265

Query  868   RETDPFDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAV  689
             RE DP DSQVV+V+  QGG +FNVIPD+ TI GT+RAF+K+SF  LK+RIEE++  QAAV
Sbjct  266   READPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFMQLKQRIEEVITGQAAV  325

Query  688   HRCTVEIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFG  509
              RC+  +DF   + P FP     T+N   ++E+ ++ +  ++G  NV+     MGSEDF 
Sbjct  326   QRCSATVDFFLDQKPHFP----VTVNSQDLHEYFQQVAGDMLGIRNVKDMQPLMGSEDFA  381

Query  508   MYLDKVPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPP  329
              + + VPG +FF+G+KN+    + P HSPYFT++ED LP GAA+ A+ A  YLL      
Sbjct  382   FFSEAVPGYYFFLGMKNDTRGKLEPGHSPYFTINEDALPYGAALQASLAARYLLEFHPKS  441

Query  328   H  326
             H
Sbjct  442   H  442



>ref|XP_008806725.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Phoenix dactylifera]
 ref|XP_008777919.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Phoenix dactylifera]
Length=436

 Score =   476 bits (1224),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 226/396 (57%), Positives = 293/396 (74%), Gaps = 5/396 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A E+E ++WM  +RR IH NPEL YEEF TS ++RRELD +G+ Y+ P+A TGVV  +G+
Sbjct  35    AKESEFLDWMVGIRRRIHENPELGYEEFKTSELIRRELDAMGIAYKHPIAVTGVVGFVGT  94

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G  PFVALRADMDAL +QE VEWEHKS+V GKMHACGHDAH AMLLGAAKILQ+ R +L+
Sbjct  95    GKAPFVALRADMDALAMQENVEWEHKSKVSGKMHACGHDAHVAMLLGAAKILQEHRDELQ  154

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV+L+FQPAEE G GA+ +I+ G ++NVDAIFG HVA   PVGVVASRPG  +AG G F
Sbjct  155   GTVVLLFQPAEEGGGGAQKIIEAGAVENVDAIFGFHVASDLPVGVVASRPGPIMAGSGFF  214

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGHAAIPQ ++DPILAAS  ++SLQ +VSRE DP DSQV++V+  QGG +FNV
Sbjct  215   EAVISGKGGHAAIPQHTIDPILAASNVIVSLQHLVSREADPLDSQVLTVAKFQGGGAFNV  274

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+RAF+K+SF  LK+RIEE++ AQA+V RC+  +DF   E P FP     T
Sbjct  275   IPDSVTIGGTFRAFSKESFSQLKQRIEEVIVAQASVQRCSATVDFLIKERPFFP----VT  330

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIGVKNEKSATV  440
             +N   ++EH +K +  ++G  NV      MG+EDF  + + +P A ++F+G+ N     +
Sbjct  331   VNSNDLHEHFQKVAEEMLGSSNVRDRQPVMGAEDFAFFTEVIPMAYYYFVGMMNASHGPL  390

Query  439   FPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKP  332
              P HSPYFT++E+ LP GAA+HA+ A  YL  +  P
Sbjct  391   HPAHSPYFTVNEEALPYGAALHASLAVWYLFENHAP  426



>gb|KDO80612.1| hypothetical protein CISIN_1g011407mg [Citrus sinensis]
Length=486

 Score =   478 bits (1229),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 226/393 (58%), Positives = 288/393 (73%), Gaps = 4/393 (1%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
             +M LA   ETV+W++ VRR IH+NPELA++EF TS ++R ELDR+ + Y++P+AKTG+ A
Sbjct  87    VMELARRPETVDWLKSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRA  146

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              +G+G PPFVALRADMDALPIQE VEWE+KS+V GKMHACGHDAH AML+GAAKIL+   
Sbjct  147   WVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSRE  206

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
               LKGTV+LIFQPAEE G GAK M+ +G L++V+AIF +HV+H++P GV+ SRPG  LAG
Sbjct  207   HLLKGTVILIFQPAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAG  266

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
             CG F A I GK G AA P  SVDP+LAAS +VISLQ +VSRE +P DSQVVSV+   GG 
Sbjct  267   CGFFHAVISGKKGGAANPHRSVDPVLAASAAVISLQGLVSREANPLDSQVVSVTYFNGGD  326

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
               ++IPD   I GT RAF+  SFY L +RIEE++  QA V RC+  +DF    N  +P  
Sbjct  327   HLDMIPDAVVIGGTLRAFSNTSFYQLLQRIEEVIVEQARVFRCSATVDFFDKGNTVYP--  384

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
               PT+ND  +YEH +K +  ++G  N  + P  MG+EDF  Y + VP AF++IG+KNE  
Sbjct  385   --PTVNDEDMYEHVKKVAIDLLGPMNYRVVPPMMGAEDFSFYSEVVPAAFYYIGIKNETL  442

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
              ++   HSPYF +DEDVLPVGAAVHA  A  +L
Sbjct  443   GSIHTGHSPYFMIDEDVLPVGAAVHATIAERFL  475



>ref|XP_010906094.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Elaeis guineensis]
Length=496

 Score =   478 bits (1230),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 234/399 (59%), Positives = 300/399 (75%), Gaps = 5/399 (1%)
 Frame = -1

Query  1537  KDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTG  1358
             K+ I+ LA   ETVEW++ VRR IH NPELAYEE  T  ++R +LD +GV+YR+PVA TG
Sbjct  102   KEEILWLARRPETVEWLKGVRRRIHENPELAYEEVETGKLIREQLDGMGVEYRFPVALTG  161

Query  1357  VVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQ  1178
             +VATIG+G PPFVA+RADMDALPIQE VEW+HKS+V GKMHACGHDAH AMLLGAAKIL+
Sbjct  162   LVATIGTGDPPFVAIRADMDALPIQEAVEWKHKSKVPGKMHACGHDAHVAMLLGAAKILK  221

Query  1177  QLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEF  998
                  LKGTV L+FQPAEE G GAK MI++G L +V+AIF +HV+H++P  V+ SR G  
Sbjct  222   THEHHLKGTVKLLFQPAEEAGIGAKRMIEDGALKDVEAIFAVHVSHEHPTSVIGSRAGPL  281

Query  997   LAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQ  818
             LAGCG FKA I+G+ GHA  P  SVDPILAAS +VISLQ+IVSRE +P DSQVVSV+   
Sbjct  282   LAGCGFFKAVIRGRQGHAGNPHHSVDPILAASAAVISLQNIVSREANPLDSQVVSVAAFN  341

Query  817   GGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTF  638
             GG+  ++IPD+  I GT+RAF+  SFY L++RIEE++R Q+ V+RCT  +DF   E   F
Sbjct  342   GGNDLDLIPDSVIIAGTFRAFSNASFYQLRQRIEEVIRQQSTVYRCTTLVDF--FEQERF  399

Query  637   PPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKN  458
              P   PT+ND  +YEH +K +  ++G +N ++ P  MG+EDF  Y + +P AFF+IG++N
Sbjct  400   YP---PTVNDEFMYEHVKKVAMDLLGPENYKIVPPMMGAEDFSFYSEVIPAAFFYIGIRN  456

Query  457   EKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
             E   + +  HSPYF +DEDVLP+GAA+HAA A  YL+ H
Sbjct  457   ETLGSTYTGHSPYFMIDEDVLPIGAAIHAAIAERYLIEH  495



>ref|XP_004149796.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6-like [Cucumis 
sativus]
Length=472

 Score =   477 bits (1227),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 225/400 (56%), Positives = 285/400 (71%), Gaps = 4/400 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + I+ LA   E V+W+++VRR IH NPELA+EEF TS ++R ELDR+ + Y   +AKTGV
Sbjct  77    EAILSLAKRPEVVDWLKKVRRRIHENPELAFEEFETSQLIRDELDRMEISYEHMLAKTGV  136

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IG+G PPFVALRADMDALPIQE VEWEHKS+V GKMHACGHDAH  MLLGAAKIL+ 
Sbjct  137   RAWIGTGGPPFVALRADMDALPIQEAVEWEHKSRVAGKMHACGHDAHVTMLLGAAKILKA  196

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+L+FQPAEE G GAK MI +G L +V AIF  HV+H++P  V+ SRPG  L
Sbjct  197   REHLLKGTVILLFQPAEEAGNGAKRMIGDGALRDVQAIFAAHVSHEHPTAVIGSRPGPLL  256

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I GK GHA  P  SVDP+LAAS +V+SLQ IVSRE +P DSQVVSV+   G
Sbjct  257   AGCGFFRAVITGKKGHAGSPHRSVDPVLAASAAVVSLQGIVSREANPLDSQVVSVTSFNG  316

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             GS+ ++IPD   I GT+RAF+  SFY + +RIE+++  QA+V+RC+  +DF   E   +P
Sbjct  317   GSNLDMIPDVVVIGGTFRAFSNSSFYQVLQRIEQVIVEQASVYRCSAMVDFFEKEYTIYP  376

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND  +YEH +K +  + G  N  +    MG+EDF  Y + VP AFF+IGV+NE
Sbjct  377   ----PTVNDKAMYEHVKKVAIDLHGSQNFRIVQPMMGAEDFSFYSEYVPAAFFYIGVRNE  432

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
                ++   HSPYF +DE+VLP+GAA HA  A  YL  H +
Sbjct  433   TLGSIHTGHSPYFMIDENVLPIGAATHATIAERYLYEHGE  472



>ref|XP_007135595.1| hypothetical protein PHAVU_010G142600g [Phaseolus vulgaris]
 gb|ESW07589.1| hypothetical protein PHAVU_010G142600g [Phaseolus vulgaris]
Length=442

 Score =   475 bits (1223),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 226/400 (57%), Positives = 295/400 (74%), Gaps = 4/400 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L    +  A + E  +WM R+RR+IH+NPEL YEEF TS V+R +LD+LG+ Y+ PVA T
Sbjct  32    LPTNFLDAAKKPEVFDWMVRIRRKIHQNPELGYEEFETSKVIREKLDQLGIPYKHPVAIT  91

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GV+  IG+G  PFVA+RADMDALP+QE+VEWEHKS+V GKMHACGHDAH AMLLGAAKIL
Sbjct  92    GVIGFIGTGRSPFVAIRADMDALPMQEMVEWEHKSKVPGKMHACGHDAHVAMLLGAAKIL  151

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             +Q  ++++GTV+L+FQPAEE G GAK ++  G L  V AIFGLHV+  +P+G V SR G 
Sbjct  152   KQHEKEIQGTVVLVFQPAEEGGGGAKKILDAGALGKVSAIFGLHVSRDFPLGEVGSRSGP  211

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LAG G F+A IKGKGGHAAIPQ+S+DPILA S  +ISLQ++VSRE DP DSQVV+V   
Sbjct  212   MLAGNGFFEAIIKGKGGHAAIPQQSIDPILATSNVIISLQNLVSREADPLDSQVVTVGKF  271

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             QGGS+FN+IPD+ TI GT+RAF+K+SF  LK+RIEE+V AQA+V RC   ++F   +NP 
Sbjct  272   QGGSAFNIIPDSVTIGGTFRAFSKESFQQLKQRIEEVVIAQASVQRCNATVNFLQDQNPF  331

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             FP     TIN+  ++EH +  +  ++G + V      MG+EDF  Y + +PG FF +G++
Sbjct  332   FP----VTINNGDLHEHFQSVAGNLLGVNKVNEMQPLMGAEDFSFYQEVIPGYFFMVGMQ  387

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
             N     +   HSP+F ++EDVLP GAA+HA+ A +YLL H
Sbjct  388   NASHEKLEQVHSPHFKINEDVLPYGAALHASLAVSYLLKH  427



>emb|CDM83125.1| unnamed protein product [Triticum aestivum]
Length=435

 Score =   475 bits (1223),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 230/393 (59%), Positives = 287/393 (73%), Gaps = 5/393 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A E E ++WM  VRR IH NPEL YEEFATS +VRRELD + + YR P A TGVVAT+G+
Sbjct  33    AKEAEFMDWMVGVRRRIHENPELGYEEFATSELVRRELDAMEIPYRHPFAVTGVVATVGT  92

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G PPFVALRADMDALP+QE VEWEHKS+V GKMH CGHDAH AMLLG+AKILQ+ R +LK
Sbjct  93    GGPPFVALRADMDALPMQESVEWEHKSKVPGKMHGCGHDAHVAMLLGSAKILQEHRDKLK  152

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV L+FQPAEE G GAK M++ G + N++ +FGLHVA   P+GV+ASRPG  +AG G F
Sbjct  153   GTVALLFQPAEEGGGGAKKMVEAGAVVNIEIMFGLHVADSVPIGVLASRPGPIMAGSGFF  212

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGHAA+P  ++DPILAAS  ++SLQ +VSRE DP DSQVV+V   QGG +FNV
Sbjct  213   EAVISGKGGHAALPHHTIDPILAASNVIVSLQQLVSREADPLDSQVVTVGKFQGGGAFNV  272

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+RAF K+SF  LK+RIEE++  QA+V RC+  +DF   + P FP    PT
Sbjct  273   IPDSVTIGGTFRAFLKESFNQLKQRIEEVIVTQASVQRCSAVVDFLDKDKPFFP----PT  328

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIGVKNEKSATV  440
             IN+  +++   K  S +VG +NV      MG+EDF  Y + VP   ++F+G+ NE     
Sbjct  329   INNPELHDFFAKVGSEMVGPNNVREKQPLMGAEDFSFYTEAVPKTYYYFVGMLNETRGPQ  388

Query  439   FPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
              P HSPYFT++ED LP GAA+ A+ A  YLL H
Sbjct  389   APHHSPYFTINEDALPYGAAMQASLAARYLLEH  421



>gb|KDP33760.1| hypothetical protein JCGZ_07331 [Jatropha curcas]
Length=447

 Score =   475 bits (1223),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 224/394 (57%), Positives = 295/394 (75%), Gaps = 6/394 (2%)
 Frame = -1

Query  1519  LANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIG  1340
             LA + + V +M  +RR IH NPELA+EEF TS ++R ELD LG+ Y++PVA TGVV  +G
Sbjct  44    LARKQDLVNYMVNIRRRIHENPELAFEEFETSKLIRAELDHLGIYYKYPVAVTGVVGYVG  103

Query  1339  SGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQL  1160
             +G PPFVA+RADMDAL ++E VEWEHKS+V GKMHACGHDAH AMLLGAAKILQ  R +L
Sbjct  104   TGEPPFVAIRADMDALALEEAVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILQDHRNEL  163

Query  1159  KGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGM  980
             KGTV+L+FQPAEE   GAK M+ +GVL+N+DAIFGLHV+  +P+G V SR G  LAG G 
Sbjct  164   KGTVVLVFQPAEEGHGGAKRMLDSGVLENIDAIFGLHVSFLHPIGTVGSRAGPLLAGSGF  223

Query  979   FKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFN  800
             F+A I GKGGHAAIPQ S+DPI+AAS  ++SLQ +VSRE DP DSQVV+++  QGG +FN
Sbjct  224   FEAVISGKGGHAAIPQHSIDPIIAASNVIVSLQHLVSREADPLDSQVVTIAKFQGGEAFN  283

Query  799   VIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAP  620
             VIPD+ TI GT+RAF+K+SF  LK+RIEE++  QA+V RC   + F+  E P +P     
Sbjct  284   VIPDSVTIGGTFRAFSKESFIQLKQRIEEVITRQASVQRCNATVMFNSDEKPFYP----A  339

Query  619   TINDVRIYEHARKSSSLIVGEDN-VELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSAT  443
             T+N+  +++H    ++ ++G  N +E+ P  MG+EDF  + + +PG FFF+G+KNE    
Sbjct  340   TVNNQDLHKHFINVATDMLGAQNIIEMQP-VMGAEDFSFFAEAIPGYFFFVGMKNESQGP  398

Query  442   VFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
             +   HSPYFT++EDVLP GAA++A+ A  YLL +
Sbjct  399   IRNGHSPYFTVNEDVLPYGAALYASLATRYLLEY  432



>ref|XP_011077949.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 isoform X2 [Sesamum 
indicum]
Length=446

 Score =   475 bits (1222),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 220/413 (53%), Positives = 297/413 (72%), Gaps = 7/413 (2%)
 Frame = -1

Query  1561  PLAVDGGLKD---RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLG  1391
             P   + GL +   + + LA   E  E+M ++RR +H NPEL YEEF TS  +R ELD +G
Sbjct  26    PFLGEKGLAEIPSKFLNLAKRPEIFEYMVKIRRSLHENPELGYEEFETSRFIRNELDGMG  85

Query  1390  VKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHT  1211
             + Y+ P+A TG+V  IG+G+PPFVA+RADMDAL +QE VEWEHKS+V GKMHACGHDAH 
Sbjct  86    IPYKHPIAVTGIVGYIGTGNPPFVAIRADMDALAMQEAVEWEHKSKVPGKMHACGHDAHV  145

Query  1210  AMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYP  1031
             AMLLGAAK+LQ+ R  L+GTV+L+FQPAEE G GAK M   G+L+NVDAIFG HV+  +P
Sbjct  146   AMLLGAAKMLQEHRSDLEGTVILVFQPAEEGGGGAKKMRDAGILENVDAIFGFHVSSSFP  205

Query  1030  VGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPF  851
             +G VA+R G  +A  G F+A I GKGGHAAIPQ ++DPILA+S  ++SLQ ++SRE DP 
Sbjct  206   LGTVATRAGPLMAASGFFEAKISGKGGHAAIPQHTIDPILASSNIIVSLQHLISREADPL  265

Query  850   DSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVE  671
             DSQVV+++  QGG +FNVIPD+ TI GT+RAF+++SF  LK RIEE++  QA+V RC   
Sbjct  266   DSQVVTIAKFQGGHAFNVIPDSVTIAGTFRAFSQESFMQLKHRIEEVITLQASVQRCNAS  325

Query  670   IDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKV  491
             ++F   E P +P     T+ND  +++H +K +  ++G++NV+     MG+EDF  + + +
Sbjct  326   VNFYADEKPFYP----VTVNDKDLHKHFQKIAGHMLGDENVKEVQPLMGAEDFSFFAEAI  381

Query  490   PGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKP  332
             PG F++IG+ NE    +   HSPYF ++ED LP GAA+HA+ A TYLL H  P
Sbjct  382   PGYFYYIGMFNETEGQLASGHSPYFKVNEDALPYGAALHASIAATYLLEHHSP  434



>ref|XP_006646005.1| PREDICTED: LOW QUALITY PROTEIN: IAA-amino acid hydrolase ILR1-like 
1-like [Oryza brachyantha]
Length=454

 Score =   475 bits (1222),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 229/385 (59%), Positives = 284/385 (74%), Gaps = 5/385 (1%)
 Frame = -1

Query  1492  WMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSPPFVAL  1313
             WM  +RR IH NPEL YEEFATS +VRRELD LG+ YR P A TGVVAT+G+G PPFVAL
Sbjct  60    WMTGLRRRIHENPELGYEEFATSELVRRELDALGIPYRHPFAVTGVVATVGTGGPPFVAL  119

Query  1312  RADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQ  1133
             RADMDAL +QE VEWEHKS+V GKMH CGHDAH AMLLG+A+ILQ+ R +LKGTV+L+FQ
Sbjct  120   RADMDALAMQESVEWEHKSKVPGKMHGCGHDAHVAMLLGSARILQEHRDELKGTVVLVFQ  179

Query  1132  PAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIKGKG  953
             PAEE G GAK MI +G ++N++AIFG+HVA   P+GVVASRPG  +AG G F+A I GKG
Sbjct  180   PAEEGGAGAKKMIDDGAMENIEAIFGVHVADVVPIGVVASRPGPVMAGSGFFEAVISGKG  239

Query  952   GHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTATIT  773
             GHAA+P  ++DPILAAS  ++SLQ +VSRE DP DSQVV+V   QGG +FNVIPD+ TI 
Sbjct  240   GHAALPHHTIDPILAASNVIVSLQQLVSREADPLDSQVVTVGKFQGGGAFNVIPDSVTIG  299

Query  772   GTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDVRIYE  593
             GT+RAF K+SF  LK+RIEE++ +QA+V RC   +DF   + P FP    PTIN   +++
Sbjct  300   GTFRAFLKESFNQLKQRIEEVIVSQASVQRCNAVVDFLNKDRPFFP----PTINHAGLHD  355

Query  592   HARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIGVKNEKSATVFPPHSPYF  416
                K +S +VG  NV      MG+EDF  Y D +P   ++F+G+ NE      P HSPYF
Sbjct  356   FFVKVASEMVGPKNVRDKQPLMGAEDFAFYADAIPATYYYFLGMCNETRGPQAPHHSPYF  415

Query  415   TLDEDVLPVGAAVHAAFAYTYLLSH  341
             T++ED LP GAA+ A+ A  YLL H
Sbjct  416   TINEDTLPYGAALQASLAARYLLEH  440



>ref|XP_006353512.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Solanum 
tuberosum]
Length=446

 Score =   474 bits (1221),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 221/397 (56%), Positives = 290/397 (73%), Gaps = 4/397 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               + LA   E  +W+ R+RR IH NPEL +EEF TS ++R ELD++G+ Y++PVA TGVV
Sbjct  39    NFLNLAKRPELFDWIVRIRRTIHENPELGFEEFETSKLIRNELDKMGIFYKYPVAVTGVV  98

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDAL +QE V+W+HKS++ GKMHACGHDAH AMLLGAAKILQ+ 
Sbjct  99    GFIGTGKPPFVALRADMDALAMQEEVDWKHKSKIPGKMHACGHDAHVAMLLGAAKILQEK  158

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             R  L+GTVLL+FQPAEE G GAK M+++G+LDNVDAIFGLHV+ + P+G VA+  G  +A
Sbjct  159   RDDLQGTVLLVFQPAEEGGGGAKKMLESGILDNVDAIFGLHVSPRSPIGTVAASSGPIMA  218

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A IKGKGGHAAIPQ ++DPILAAS  ++SLQ +VSRETDP DSQVV+V+  +GG
Sbjct  219   GSGFFEAVIKGKGGHAAIPQHAIDPILAASNIIVSLQHLVSRETDPLDSQVVTVAKFKGG  278

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+K+SF  LK+RI E++  QAAV RC   +DFD    P +P 
Sbjct  279   GAFNVIPDSVTIGGTFRAFSKESFTQLKQRIVEVITRQAAVQRCNATVDFDTKNRPFYP-  337

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                 T+N+  ++EH R  +  ++G D +      MGSEDF  + +  PG F+ +G+ +E 
Sbjct  338   ---VTVNNKALHEHFRNVAGQMLGIDKILEKKPTMGSEDFSFFAEAFPGYFYLLGMVDET  394

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                    HSP++ ++ED LP G A+HA+ A TYLL H
Sbjct  395   KGRFESGHSPFYRVNEDALPYGVALHASLATTYLLEH  431



>ref|XP_007012935.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
 gb|EOY30554.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
Length=444

 Score =   474 bits (1219),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 227/409 (56%), Positives = 298/409 (73%), Gaps = 12/409 (3%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               +  A + E ++WM  +RR+IH NPEL +EE+ TS ++R ELD++G+ Y++PVA TGV+
Sbjct  38    NFLEFAKKPEILDWMVGLRRKIHENPELGFEEYETSKLIRAELDQMGIPYKYPVAVTGVI  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDAL ++ELVEWEHKS+V GKMHACGHDAH AMLLGAAK+LQ+ 
Sbjct  98    GYIGTGQPPFVALRADMDALAMEELVEWEHKSKVPGKMHACGHDAHVAMLLGAAKMLQEH  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             +  L+GT++L+FQPAEE G GAK M+  G L+NVDAIF LHV+ ++PVGVVASRPG  LA
Sbjct  158   QNDLQGTIVLVFQPAEEGGGGAKKMLDAGALENVDAIFALHVSSRFPVGVVASRPGPILA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
                 F+A I GKGGHAAIPQ +VDPILAAS  ++SLQ ++SRE DP DSQVVS+   QGG
Sbjct  218   ATSFFEAVINGKGGHAAIPQHTVDPILAASNVIVSLQHLISREADPLDSQVVSIGKFQGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+K+SF  LK+RIEE++  QA+V RC   + FD  E  ++P 
Sbjct  278   GAFNVIPDSVTIGGTFRAFSKESFVQLKQRIEEVIMKQASVQRCNATVIFD--EKSSYPV  335

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDN-VELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
             +L    N+  ++E+ RK +  ++G +N VE+ P  MG EDF  + + +PG FFF+G+KNE
Sbjct  336   SL----NNKELHEYFRKVAGDMLGLENIVEMQP-IMGGEDFAFFSEAIPGLFFFLGMKNE  390

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL----SHAKPPHSS  320
                     HSPY+ ++EDVLP GA +HA+ A  YLL     H  PP  S
Sbjct  391   TQGQFHSGHSPYYRVNEDVLPYGAVLHASLATRYLLENLPKHTSPPKGS  439



>ref|XP_010536843.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2 [Tarenaya hassleriana]
Length=446

 Score =   474 bits (1219),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 230/417 (55%), Positives = 297/417 (71%), Gaps = 5/417 (1%)
 Frame = -1

Query  1579  GESSKLPLAVDGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELD  1400
             G SS+LP     G   R + LA + E  +WM  +RR+IH NPEL YEEF TS ++R ELD
Sbjct  22    GVSSELPWVHSDGDSSRFLQLAKKPEVFDWMVGIRRKIHENPELGYEEFETSKLIRSELD  81

Query  1399  RLGVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHD  1220
             R+GV YR+PVA TGVV  IG+G PPFVALRADMDALPIQE V+WEHKS+V GKMHACGHD
Sbjct  82    RIGVPYRFPVAVTGVVGFIGTGKPPFVALRADMDALPIQEAVDWEHKSKVPGKMHACGHD  141

Query  1219  AHTAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAH  1040
             AH AMLLGAAK+LQ+ R  L+GTV+LIFQPAEE G GAK MI+ GVL++V+AIFGLHV  
Sbjct  142   AHVAMLLGAAKMLQEHRHDLQGTVVLIFQPAEEGGAGAKRMIEEGVLNDVEAIFGLHVTS  201

Query  1039  KYPVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRET  860
             ++P+G  ASR G  LAG G F+A I GKGGHAA PQ ++DPILAAS+ ++SLQ +VSRET
Sbjct  202   RFPIGKAASRAGPLLAGTGAFEAVIIGKGGHAAFPQHALDPILAASSVILSLQHLVSRET  261

Query  859   DPFDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRC  680
             DP  SQVV+V+ + GG +FNVIP + T+ GT R+F+ +    L++RIEE++  Q+AVHRC
Sbjct  262   DPLGSQVVTVASVHGGDAFNVIPGSVTMNGTSRSFSAEGLSQLQRRIEEVITKQSAVHRC  321

Query  679   TVEIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYL  500
                ++        +PPT+    ND  +YE  +  +  ++G D V +A   MG EDF  Y 
Sbjct  322   NATVNMKPNGQEVYPPTM----NDDHLYERVKNVAREMLGLDGVVVAEPLMGGEDFSFYA  377

Query  499   DKVPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPP  329
              ++PG F F+G+++E  +     HSPY+ ++EDVLP GAA+HAA A  YL   A+ P
Sbjct  378   QEIPGHFLFLGMQDETKSFAM-THSPYYRVNEDVLPYGAALHAATAVQYLTDKARLP  433



>ref|XP_002281321.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Vitis vinifera]
 emb|CBI35990.3| unnamed protein product [Vitis vinifera]
Length=441

 Score =   473 bits (1218),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 226/403 (56%), Positives = 296/403 (73%), Gaps = 4/403 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               +  A + E V+W+  VRR+IH NPEL +EE  TS +VR ELD++G+ Y++PVA TGV+
Sbjct  34    NFLSFARKQEVVDWLVGVRRKIHENPELGFEEVETSKLVRAELDKMGIPYKYPVAVTGVL  93

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               +G+G PPFVA+RADMDAL +QE+VEWEHKS++ GKMHACGHD+H AMLLGAAKILQ+ 
Sbjct  94    GFVGTGEPPFVAIRADMDALAMQEMVEWEHKSKIPGKMHACGHDSHVAMLLGAAKILQEH  153

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             R++L+GTV+L+FQPAEE G GAK ++  GVL+NV+AIFGLHV+   P+G VASR G  LA
Sbjct  154   REELQGTVILVFQPAEEGGGGAKKILDAGVLENVNAIFGLHVSPDLPIGEVASRSGPLLA  213

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I GKGGHAAIPQ S+DPILAAS  ++SLQ +VSRE DP +SQVV+V+  QGG
Sbjct  214   GSGFFEAVISGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLESQVVTVAKFQGG  273

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+K+S   LK+RIEE++  QAAV RC   +DF   E P FP 
Sbjct  274   GAFNVIPDSVTIGGTFRAFSKESIMQLKQRIEEVITRQAAVQRCNATVDFHEKEKPLFP-  332

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                 TIN+  +++H +     ++G  NV+     MGSEDF  Y +++PG FFF+G+K+E 
Sbjct  333   ---ATINNPNLHKHFQNVVGNMLGVHNVKDMQPLMGSEDFSFYQEEMPGYFFFLGMKDEA  389

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHS  323
                +   HSP+F ++ED LP GAA+HA+ A TYLL     P S
Sbjct  390   LGRLPSVHSPHFKINEDALPYGAALHASLAATYLLEIQPQPSS  432



>ref|XP_008466723.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Cucumis melo]
Length=470

 Score =   474 bits (1220),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 223/398 (56%), Positives = 284/398 (71%), Gaps = 4/398 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + I+ LA   E V+W+++VRR IH NPELA+EEF TS ++R ELDR+ + Y   +AKTGV
Sbjct  77    EAILSLAKRPEVVDWLKKVRRRIHENPELAFEEFETSQLIRDELDRMEISYEHTLAKTGV  136

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IG+G PPFVALRADMDALPIQE VEWEHKS+V GKMHACGHDAH  MLLGAAKIL+ 
Sbjct  137   RAWIGTGGPPFVALRADMDALPIQEAVEWEHKSRVAGKMHACGHDAHVTMLLGAAKILKA  196

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+L+FQPAEE G GAK MI +G L +V AIF  HV+H++P  V+ SRPG  L
Sbjct  197   REHLLKGTVILLFQPAEEAGNGAKRMIADGALRDVQAIFAAHVSHEHPTAVIGSRPGPLL  256

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I GK GHA  P  SVDP+LAAS +V+SLQ IVSRE +P DSQVVSV+   G
Sbjct  257   AGCGFFRAVITGKKGHAGSPHRSVDPVLAASAAVVSLQGIVSREANPLDSQVVSVTSFNG  316

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             GS+ ++IPD   I GT+RAF+  SFY + +RIE+++  QA+V+RC+  +DF   E   +P
Sbjct  317   GSNLDMIPDAVVIGGTFRAFSNSSFYQVLQRIEQVIVEQASVYRCSAMVDFFEKEYTIYP  376

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND  +YEH ++ +  + G  N  +    MG+EDF  Y + VP AF++IGV+NE
Sbjct  377   ----PTVNDEAMYEHVKQVAIDLHGSQNFRIVQPMMGAEDFSFYSEFVPAAFYYIGVRNE  432

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                ++   HSPYF +DE+VLP+GAA HA  A  YL  H
Sbjct  433   TLGSIHTGHSPYFMIDENVLPIGAATHATIAERYLYEH  470



>ref|XP_003546640.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
Length=444

 Score =   473 bits (1218),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 222/395 (56%), Positives = 289/395 (73%), Gaps = 4/395 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + + LA +    +WM  +RR+IH NPEL YEEF TS ++R ELD+LG+ Y++PVA TGVV
Sbjct  37    KFLDLAKDPLVFDWMIGIRRKIHENPELGYEEFETSKLIRTELDKLGISYKYPVAVTGVV  96

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDALP+QE+VEWEHKS+V GKMHACGHDAH AMLLGAAKIL++ 
Sbjct  97    GFIGTGLPPFVALRADMDALPLQEMVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILKRH  156

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
               +++GTV+L+FQPAEE G GAK ++  GVL+N+ AIFGLH+   YP+G VASR G   A
Sbjct  157   ENEIRGTVVLVFQPAEEGGGGAKKILDAGVLENISAIFGLHIVPTYPIGEVASRSGPIFA  216

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+ATI G+GGHAAIPQ S+DPILAAS  ++SLQ IVSRE DP DSQVV+V   QGG
Sbjct  217   GSGFFEATINGRGGHAAIPQHSIDPILAASNVIVSLQHIVSREVDPLDSQVVTVGKFQGG  276

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+K+SF  L++RIE+++  QAAV RC   ++F   E P  P 
Sbjct  277   GAFNVIPDSVTIGGTFRAFSKESFMQLRQRIEQVITGQAAVQRCNATVNFLDDEKPFSP-  335

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PT+N+  ++ +    +  ++G +NV+     MGSEDF  Y +  PG FF +G+ N  
Sbjct  336   ---PTVNNGDLHGYFESVAGSLLGVNNVKEMQPLMGSEDFAFYQEVFPGYFFLLGMDNAS  392

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             +  +  PHSPYF ++ED LP GAA+H + A +YLL
Sbjct  393   NEHLESPHSPYFKINEDALPYGAALHVSLASSYLL  427



>ref|XP_002284503.2| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Vitis vinifera]
Length=489

 Score =   475 bits (1222),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 230/400 (58%), Positives = 292/400 (73%), Gaps = 4/400 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + I+ +A   ETVEW++ +RR IH NPELA+EEF TS ++RRELD++ + YR+P+AKTG+
Sbjct  94    EEILRIAKRPETVEWLKGIRRRIHENPELAFEEFNTSRLIRRELDQMDISYRFPLAKTGI  153

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              ATIG+G PPFVA+RADMDALPIQE VEWEHKS+V GKMHACGHDAH AMLLGAA+IL+ 
Sbjct  154   RATIGTGGPPFVAVRADMDALPIQEAVEWEHKSKVAGKMHACGHDAHVAMLLGAARILKA  213

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+L+FQPAEE G GAK MI +G L+NV+AIF +HV+H++P  ++ SRPG  L
Sbjct  214   REHHLKGTVVLVFQPAEEAGNGAKRMIGDGALENVEAIFAVHVSHEHPTSIIGSRPGPLL  273

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I GK G A  P  SVDP+LAAS +VISLQ IVSRE +P DSQVVSV+ + G
Sbjct  274   AGCGFFRAVITGKEGDAGNPHRSVDPVLAASAAVISLQGIVSREANPLDSQVVSVTSLNG  333

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G S ++I DT  + GT+RAF+  SFY L +RIEE++  QA V RC+  +DF   E   +P
Sbjct  334   GDSLDMIADTVVLGGTFRAFSNTSFYQLLQRIEEVIVEQARVFRCSATVDFFEKEYTIYP  393

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND  +YEH RK +  + G  N  + P  MG+EDF  Y + VP AFF+IGV+NE
Sbjct  394   ----PTVNDEGMYEHVRKVAIDLFGPTNFRVVPPMMGAEDFSFYSEVVPAAFFYIGVRNE  449

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
                ++   HSPYF +DED LP+GAA HAA A  YL  H +
Sbjct  450   TLGSIHTGHSPYFMIDEDALPMGAAAHAAIAERYLNEHRR  489



>emb|CBI19006.3| unnamed protein product [Vitis vinifera]
Length=487

 Score =   474 bits (1221),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 230/400 (58%), Positives = 292/400 (73%), Gaps = 4/400 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + I+ +A   ETVEW++ +RR IH NPELA+EEF TS ++RRELD++ + YR+P+AKTG+
Sbjct  92    EEILRIAKRPETVEWLKGIRRRIHENPELAFEEFNTSRLIRRELDQMDISYRFPLAKTGI  151

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              ATIG+G PPFVA+RADMDALPIQE VEWEHKS+V GKMHACGHDAH AMLLGAA+IL+ 
Sbjct  152   RATIGTGGPPFVAVRADMDALPIQEAVEWEHKSKVAGKMHACGHDAHVAMLLGAARILKA  211

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+L+FQPAEE G GAK MI +G L+NV+AIF +HV+H++P  ++ SRPG  L
Sbjct  212   REHHLKGTVVLVFQPAEEAGNGAKRMIGDGALENVEAIFAVHVSHEHPTSIIGSRPGPLL  271

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I GK G A  P  SVDP+LAAS +VISLQ IVSRE +P DSQVVSV+ + G
Sbjct  272   AGCGFFRAVITGKEGDAGNPHRSVDPVLAASAAVISLQGIVSREANPLDSQVVSVTSLNG  331

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G S ++I DT  + GT+RAF+  SFY L +RIEE++  QA V RC+  +DF   E   +P
Sbjct  332   GDSLDMIADTVVLGGTFRAFSNTSFYQLLQRIEEVIVEQARVFRCSATVDFFEKEYTIYP  391

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND  +YEH RK +  + G  N  + P  MG+EDF  Y + VP AFF+IGV+NE
Sbjct  392   ----PTVNDEGMYEHVRKVAIDLFGPTNFRVVPPMMGAEDFSFYSEVVPAAFFYIGVRNE  447

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
                ++   HSPYF +DED LP+GAA HAA A  YL  H +
Sbjct  448   TLGSIHTGHSPYFMIDEDALPMGAAAHAAIAERYLNEHRR  487



>ref|XP_002283047.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Vitis vinifera]
Length=439

 Score =   472 bits (1215),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 219/399 (55%), Positives = 295/399 (74%), Gaps = 7/399 (2%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
              +  A E E  EWM  +RR IH NPEL +EEF TS ++R ELD++ + YR+PVA TGVV 
Sbjct  35    FLDYAREPEISEWMVGIRRIIHENPELGFEEFETSKLIRTELDKMDIPYRFPVAVTGVVG  94

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              IG+G PPFVA+RADMDALP+QE VEWEHKS++ GKMHACGHDAH AMLLGAAK+LQ+ R
Sbjct  95    FIGTGEPPFVAIRADMDALPMQEGVEWEHKSKIPGKMHACGHDAHVAMLLGAAKMLQKHR  154

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
               L+GTV+L+FQPAEER  GAK M++ G+L+N+DAIFGLHV+ + P+G VASR G  LA 
Sbjct  155   HDLQGTVVLVFQPAEERDGGAKKMLETGILENIDAIFGLHVSPRVPIGSVASRSGPVLAA  214

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
             CG F A I GKGGHAA+PQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +GG 
Sbjct  215   CGFFDAVISGKGGHAALPQHSIDPILAASNVIVSLQQLVSREADPLDSQVVTVAKFKGGG  274

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
             +FNVIPD+ TI GT+RAF+K+SF  LK+RIEE++  Q++V RC   + F+   +P +P  
Sbjct  275   AFNVIPDSVTIGGTFRAFSKESFLQLKQRIEEVITLQSSVQRCNATVHFN---DPFYP--  329

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
                T N+  +++H +  +  ++G  N++  P  MG+EDF  + + +PG F+++G+KNE  
Sbjct  330   --VTANNKDLHKHFQNVAGDMLGTQNIKEMPLVMGAEDFSFFAEAIPGYFYYLGMKNETR  387

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKP  332
               +   H+PY+T++ED LP GAA+HA+ A  YLL + +P
Sbjct  388   GQLELGHTPYYTVNEDALPYGAALHASLATRYLLEYQQP  426



>ref|XP_008450808.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Cucumis melo]
Length=445

 Score =   472 bits (1215),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 223/400 (56%), Positives = 294/400 (74%), Gaps = 6/400 (2%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A   E  +WM  +RR+IH NPEL ++EF TS ++R ELDRLG+ Y +PVA TGVV  IG+
Sbjct  43    AKHPEVFDWMVDIRRKIHENPELGFQEFETSKLIRAELDRLGISYEYPVAVTGVVGFIGT  102

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G+PPFVA+RADMDAL +QE VEWEHKS+V GKMHACGHDAH AMLLGAAKILQQ  + ++
Sbjct  103   GNPPFVAIRADMDALALQEGVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILQQNSRLIQ  162

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV+L+FQPAEE G GAK +++ GVLDNVDAIFGLH++ +YP G+  S+PG  LA  G F
Sbjct  163   GTVVLVFQPAEEGGGGAKKILEAGVLDNVDAIFGLHLSSRYPFGLAISKPGPILAASGFF  222

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             ++ I GKGGHAA+PQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+++  QGG +FNV
Sbjct  223   ESVIGGKGGHAALPQHTIDPILAASNIIVSLQHLVSREADPLDSQVVTIAKFQGGGAFNV  282

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+RAF+K+SF  LK+RI E++  QA V RC   ++F+  + P FP TL   
Sbjct  283   IPDSVTIGGTFRAFSKESFIQLKQRIVEVITKQAKVQRCNATVEFNEDQKPFFPVTL---  339

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVF  437
              ND  +Y+H R  +  ++G  N+      MG+EDFG Y + +PG F+F+G+KNE      
Sbjct  340   -NDQNLYKHFRTVAVDMLGTKNILDMQPLMGAEDFGFYGEVIPGLFYFLGMKNETIGKFE  398

Query  436   PPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHSSS  317
               HSPY+ ++EDVLP GAA+ A+ A  YL+ ++  P S+S
Sbjct  399   QGHSPYYIVNEDVLPYGAALQASIAARYLIEYS--PKSTS  436



>ref|XP_010911155.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Elaeis guineensis]
Length=437

 Score =   472 bits (1215),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 227/410 (55%), Positives = 296/410 (72%), Gaps = 9/410 (2%)
 Frame = -1

Query  1543  GLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAK  1364
             GL +R    A E+E  +WM  +RR IH NPEL YEEF TS ++RRELD +G+ Y+ P+A 
Sbjct  30    GLLER----AKESELSDWMVGIRRRIHENPELGYEEFKTSEIIRRELDDMGIAYKHPIAV  85

Query  1363  TGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKI  1184
             TGV   +G+G PPFVALRADMDAL +QE VEWEHKS+V GKMHACGHDAH AMLLGAAK+
Sbjct  86    TGVAGFVGTGRPPFVALRADMDALAMQESVEWEHKSKVPGKMHACGHDAHVAMLLGAAKL  145

Query  1183  LQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPG  1004
             LQ+ R +L+GTV+L+FQPAEERG GAK MI+ G ++NVDAIFG HV  ++PVGVVASRPG
Sbjct  146   LQEYRDELQGTVVLLFQPAEERGSGAKKMIEAGAVENVDAIFGFHVTPEFPVGVVASRPG  205

Query  1003  EFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSM  824
               LAG G F+A I GKGGH A+PQE++DPILAAS  V+SLQ +VSRETDP DSQVV+V+ 
Sbjct  206   PILAGSGFFEAVISGKGGHGALPQETIDPILAASNVVVSLQHLVSRETDPMDSQVVTVAK  265

Query  823   IQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENP  644
              QGG++FNVIPD+ T+ GT+R+ +   F  LK+RIEE++ AQA+V RC    DF   E+P
Sbjct  266   FQGGTAFNVIPDSVTLGGTFRSLSNRGFSQLKQRIEEVIVAQASVQRCNATTDFMNKEHP  325

Query  643   TFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIG  467
               P     T+N   ++EH +K +  ++G +NV       G +DF  + + VP A ++F+G
Sbjct  326   FLP----ATVNSKDLHEHFQKVAGEMLGSNNVIEKQPVTGGDDFAFFSEAVPRAYYYFLG  381

Query  466   VKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHSSS  317
             +KN+      P HSPYFT++E+ L  GAA+HA+ A  YL  +  P  S++
Sbjct  382   MKNDSGGPHHPAHSPYFTINEEALSYGAALHASLAVRYLSENRSPSTSNA  431



>ref|XP_004251653.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Solanum lycopersicum]
Length=446

 Score =   472 bits (1215),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 220/397 (55%), Positives = 289/397 (73%), Gaps = 4/397 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               + LA   E  +W+ R+RR IH NPEL +EEF TS ++R ELD++G+ Y++PVA TGVV
Sbjct  39    NFLNLAKRPELFDWIVRIRRTIHENPELGFEEFETSKLIRNELDKMGIFYKYPVAVTGVV  98

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
                G+G PPFVALRADMDAL +QE V+WEHKS++ GKMHACGHDAH AMLLGAAKILQ+ 
Sbjct  99    GFSGTGKPPFVALRADMDALAMQEEVDWEHKSKIPGKMHACGHDAHVAMLLGAAKILQEQ  158

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             R  L+GTVLL+FQPAEE G GAK M+++G+LDNVDAIFGLH++   P+G VA+  G  +A
Sbjct  159   RDILQGTVLLVFQPAEEGGGGAKKMLESGILDNVDAIFGLHISPMSPIGTVAASSGPIMA  218

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A IKGKGGHAAIPQ ++DPILAAS  V+SLQ +VSRETDP DSQVV+V+  +GG
Sbjct  219   GSGFFEAVIKGKGGHAAIPQHTIDPILAASNIVVSLQHLVSRETDPLDSQVVTVAKFKGG  278

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+K+SF  LK+RI E++  QAAV RC   +DFD    P +P 
Sbjct  279   GAFNVIPDSVTIGGTFRAFSKESFAQLKQRIVEVITRQAAVQRCNATVDFDTKNRPFYP-  337

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                 T+N+  ++E  R  +  ++G D +      MG+EDF  + + +PG F+ +G+ +E 
Sbjct  338   ---VTVNNKALHEQFRNVAGQMLGIDKIIAMKPTMGTEDFSFFAEAIPGCFYLLGMVDET  394

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                    HSP++ ++EDVLP G A+HA+ A TYLL H
Sbjct  395   KGRFESGHSPFYRVNEDVLPYGVALHASLATTYLLEH  431



>ref|XP_002306640.1| hypothetical protein POPTR_0005s20110g [Populus trichocarpa]
 gb|EEE93636.1| hypothetical protein POPTR_0005s20110g [Populus trichocarpa]
Length=509

 Score =   474 bits (1221),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 226/414 (55%), Positives = 292/414 (71%), Gaps = 20/414 (5%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + ++ LA + ETV W++ VRR+IH NPELA+EE  TS +VR ELDR+G++YR+P+A+TG+
Sbjct  99    EAVLALARQPETVTWLKSVRRKIHENPELAFEEVKTSELVRDELDRMGIEYRYPLAQTGI  158

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IG+G PPFVA+RADMDALPIQE VEWEHKS+V GKMHACGHDAH AML+GAAKIL+ 
Sbjct  159   RAWIGTGGPPFVAVRADMDALPIQEAVEWEHKSKVAGKMHACGHDAHVAMLMGAAKILKS  218

Query  1174  LRQQLK----------------GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVA  1043
                 LK                GTV+L+FQPAEE G GAK MI +G L+ V+AIF +HV+
Sbjct  219   REHLLKTPEQLKWVFDVPKESVGTVILLFQPAEEAGNGAKRMIGDGALEEVEAIFAVHVS  278

Query  1042  HKYPVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRE  863
             H++P  ++ SRPG  LAGCG F+A I GK G A  P  SVDPILAAS +VISLQ IVSRE
Sbjct  279   HEHPTAIIGSRPGPLLAGCGFFRAVINGKMGRAGTPHHSVDPILAASAAVISLQGIVSRE  338

Query  862   TDPFDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHR  683
              +P DSQVVSV+ + GG+  ++IPDT  + GT+RAF+  SF  L +RIEE++  QA+V R
Sbjct  339   ANPLDSQVVSVTTMDGGNDLDMIPDTVILGGTFRAFSNTSFNQLLQRIEEVIVEQASVFR  398

Query  682   CTVEIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMY  503
             C+  +DF   ++  +P    PT+ND  +YEH RK +  ++G  N  + P  MG+EDF  Y
Sbjct  399   CSATVDFFENQSTVYP----PTVNDDHMYEHVRKVAIDLLGPANFRVVPPMMGAEDFSFY  454

Query  502   LDKVPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                VP AF++IGV+NE   +    HSPYF +DEDVLP+GAA HA  A  YL+ H
Sbjct  455   TQVVPAAFYYIGVRNETLGSTHTGHSPYFMIDEDVLPIGAATHATIAERYLIEH  508



>gb|ABB16358.1| IAA hydrolase [Phalaenopsis hybrid cultivar]
Length=444

 Score =   472 bits (1215),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 229/391 (59%), Positives = 291/391 (74%), Gaps = 5/391 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A E++  EWM  +RR IH  PEL YEEF TS +VR ELD LG+ Y+ PVA TGVV  +G+
Sbjct  39    ARESKFFEWMVGIRRRIHEKPELGYEEFETSELVRNELDLLGISYKHPVAVTGVVGFVGT  98

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G PPFVALRADMDAL ++E VEWEHKS+V GKMHACGHDAH  MLLGAAKILQ+ + +LK
Sbjct  99    GKPPFVALRADMDALAMEESVEWEHKSKVPGKMHACGHDAHVGMLLGAAKILQEHKGELK  158

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV+L+FQPAEE G GAK MI+ G +DNVDAIFG HV+   P+GVVASRPG  +AG G F
Sbjct  159   GTVVLLFQPAEEGGGGAKKMIEAGAVDNVDAIFGFHVSTDTPIGVVASRPGPIMAGSGFF  218

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGHAAIPQ ++DPI+AAS  ++SLQ +VSRE DP DSQVV+V+  QGG +FNV
Sbjct  219   EAVISGKGGHAAIPQHTIDPIVAASNVIVSLQHLVSREADPLDSQVVTVAKFQGGGAFNV  278

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+RAF+K+SFY LK+RIEE++ AQA+V RC+  ++F   E P FP     T
Sbjct  279   IPDSVTIGGTFRAFSKESFYQLKQRIEEVIVAQASVQRCSATVNFLEKERPFFP----VT  334

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIGVKNEKSATV  440
             +N+  ++ H  K +  IVG  NV      MG+EDF  + + VP   ++F+G+++E    +
Sbjct  335   VNNETLHAHFLKVAGGIVGPGNVRDRHPVMGAEDFAFFTEIVPRTYYYFLGMQSESGELL  394

Query  439   FPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
              P HSPYFT++EDVLP GAA+HA+ A  +LL
Sbjct  395   RPGHSPYFTVNEDVLPYGAALHASLAQQFLL  425



>emb|CAN70580.1| hypothetical protein VITISV_033718 [Vitis vinifera]
Length=441

 Score =   472 bits (1214),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 225/403 (56%), Positives = 296/403 (73%), Gaps = 4/403 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               +  A + E V+W+  VRR+IH NPEL +EE  TS +VR ELD++G+ Y++PVA TGV+
Sbjct  34    NFLSFARKQEVVDWLVGVRRKIHENPELGFEEVETSKLVRAELDKMGIPYKYPVAVTGVL  93

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               +G+G PPFVA+RADMDAL +QE+VEWEHKS++ GKMHACGHD+H AMLLGAAKILQ+ 
Sbjct  94    GFVGTGEPPFVAIRADMDALAMQEMVEWEHKSKIPGKMHACGHDSHVAMLLGAAKILQEH  153

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             R++L+GTV+L+FQPAEE G GAK ++  GVL+NV+AIFGLHV+   P+G VASR G  LA
Sbjct  154   REELQGTVILVFQPAEEGGGGAKKILDAGVLENVNAIFGLHVSPDLPIGEVASRSGPLLA  213

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I GKGGHAAIPQ S+DPILAAS  ++SLQ +VSRE DP +SQVV+V+  QGG
Sbjct  214   GSGFFEAVISGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLESQVVTVAKFQGG  273

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+K+S   LK+RIEE++  QAAV RC   +DF   E P FP 
Sbjct  274   GAFNVIPDSVTIGGTFRAFSKESIMQLKQRIEEVITRQAAVQRCNATVDFHEKEKPLFP-  332

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                 TIN+  +++H +  +  ++G  NV+     MGSEDF  Y +++PG FFF+G+K+E 
Sbjct  333   ---ATINNPNLHKHFQNVAGNMLGVHNVKDMQPLMGSEDFSFYQEEMPGYFFFLGMKDEA  389

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHS  323
                +   HSP+F ++E  LP GAA+HA+ A TYLL     P S
Sbjct  390   LGRLPSVHSPHFKINEGALPYGAALHASLAATYLLEIQPQPSS  432



>ref|XP_009624362.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Nicotiana tomentosiformis]
Length=445

 Score =   472 bits (1214),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 216/398 (54%), Positives = 289/398 (73%), Gaps = 4/398 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             +    + LA  T+  +WM ++RR IH NPEL +EEF TS ++R ELD++G+ Y +PVA T
Sbjct  35    ISTNFLNLAKRTDLFDWMVKIRRTIHENPELGFEEFETSKLIRNELDKMGIYYEYPVAVT  94

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVV  IG+G  PFVALRADMDALP+QE VEWEHKS++ GKMHACGHDAH AMLLGAAKIL
Sbjct  95    GVVGFIGTGKSPFVALRADMDALPLQEEVEWEHKSKIPGKMHACGHDAHIAMLLGAAKIL  154

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q+   +L+GT+LL+FQPAEE G GAK M+++G+LDNVDAIFGLH++   P+G V +  G 
Sbjct  155   QERSTELQGTILLVFQPAEEGGGGAKKMLESGILDNVDAIFGLHISATCPIGTVTANSGP  214

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              +AG G F+A IKGKGGHAAIPQ ++DPILAAS  ++SLQ +VSRE +P DSQVV+V M 
Sbjct  215   IMAGSGFFEAVIKGKGGHAAIPQHTIDPILAASNIIVSLQHLVSREANPLDSQVVTVGMF  274

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             +GG +FNVIPD+ TI GT+RAF+K+SF  LK+RI E++  QAAV RC   +DFD    P 
Sbjct  275   KGGGAFNVIPDSVTIGGTFRAFSKESFTQLKQRIVEVITRQAAVQRCNATVDFDTKNRPF  334

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             +P     T+N+  ++EH R  ++ ++G D +      MG+EDF  + +  PG F+ +G+ 
Sbjct  335   YP----VTVNNKALHEHFRDVAAQMLGNDKIIEKKPTMGTEDFSFFAEAFPGYFYLLGMV  390

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             +E        H+P++ ++ED LP GAA+HA+ A TYLL
Sbjct  391   DETKGRFESGHNPFYRVNEDALPYGAALHASLATTYLL  428



>gb|KGN47720.1| hypothetical protein Csa_6G384060 [Cucumis sativus]
Length=558

 Score =   476 bits (1224),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 225/400 (56%), Positives = 285/400 (71%), Gaps = 4/400 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + I+ LA   E V+W+++VRR IH NPELA+EEF TS ++R ELDR+ + Y   +AKTGV
Sbjct  163   EAILSLAKRPEVVDWLKKVRRRIHENPELAFEEFETSQLIRDELDRMEISYEHMLAKTGV  222

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IG+G PPFVALRADMDALPIQE VEWEHKS+V GKMHACGHDAH  MLLGAAKIL+ 
Sbjct  223   RAWIGTGGPPFVALRADMDALPIQEAVEWEHKSRVAGKMHACGHDAHVTMLLGAAKILKA  282

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+L+FQPAEE G GAK MI +G L +V AIF  HV+H++P  V+ SRPG  L
Sbjct  283   REHLLKGTVILLFQPAEEAGNGAKRMIGDGALRDVQAIFAAHVSHEHPTAVIGSRPGPLL  342

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I GK GHA  P  SVDP+LAAS +V+SLQ IVSRE +P DSQVVSV+   G
Sbjct  343   AGCGFFRAVITGKKGHAGSPHRSVDPVLAASAAVVSLQGIVSREANPLDSQVVSVTSFNG  402

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             GS+ ++IPD   I GT+RAF+  SFY + +RIE+++  QA+V+RC+  +DF   E   +P
Sbjct  403   GSNLDMIPDVVVIGGTFRAFSNSSFYQVLQRIEQVIVEQASVYRCSAMVDFFEKEYTIYP  462

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND  +YEH +K +  + G  N  +    MG+EDF  Y + VP AFF+IGV+NE
Sbjct  463   ----PTVNDKAMYEHVKKVAIDLHGSQNFRIVQPMMGAEDFSFYSEYVPAAFFYIGVRNE  518

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
                ++   HSPYF +DE+VLP+GAA HA  A  YL  H +
Sbjct  519   TLGSIHTGHSPYFMIDENVLPIGAATHATIAERYLYEHGE  558



>emb|CAN61999.1| hypothetical protein VITISV_007874 [Vitis vinifera]
Length=416

 Score =   470 bits (1209),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 218/393 (55%), Positives = 292/393 (74%), Gaps = 7/393 (2%)
 Frame = -1

Query  1510  ETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGS  1331
             E E  EWM  +RR IH NPEL +EEF TS ++R ELD++ + YR+PVA TGVV  IG+G 
Sbjct  18    EPEISEWMVGIRRIIHENPELGFEEFETSKLIRTELDKMDIPYRFPVAVTGVVGFIGTGE  77

Query  1330  PPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGT  1151
             PPFVA+RADMDALP+QE VEWEHKS++ GKMHACGHDAH AMLLGAAK+LQ+ R  L+GT
Sbjct  78    PPFVAIRADMDALPMQEGVEWEHKSKIPGKMHACGHDAHVAMLLGAAKMLQKHRHDLQGT  137

Query  1150  VLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKA  971
             V+L+FQPAEER  GAK M++ G+L+N+DAIFGLHV+ + P+G VASR G  LA CG F A
Sbjct  138   VVLVFQPAEERDGGAKKMLETGILENIDAIFGLHVSPRVPIGSVASRSGPVLAACGFFDA  197

Query  970   TIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIP  791
              I GKGGHAA+PQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +GG +FNVIP
Sbjct  198   VISGKGGHAALPQHSIDPILAASNVIVSLQQLVSREADPLDSQVVTVAKFKGGGAFNVIP  257

Query  790   DTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTIN  611
             D+ TI GT+RAF+K+SF  LK+RIEE++  Q++V RC   + F+   +P +P     T N
Sbjct  258   DSVTIGGTFRAFSKESFLQLKQRIEEVITLQSSVQRCNATVHFN---DPFYP----VTAN  310

Query  610   DVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVFPP  431
             +  +++H +  +  ++G  N++  P  MG+EDF  + + +PG F+++G+KNE    +   
Sbjct  311   NKDLHKHFQNVAGDMLGTQNIKEMPLVMGAEDFSFFAEAIPGYFYYLGMKNETRGQLELG  370

Query  430   HSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKP  332
             H PY+T++ED LP GAA+HA+ A  YLL + +P
Sbjct  371   HXPYYTVNEDALPYGAALHASLATRYLLEYQQP  403



>ref|XP_010500762.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Camelina sativa]
Length=441

 Score =   471 bits (1211),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 220/399 (55%), Positives = 296/399 (74%), Gaps = 6/399 (2%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             +  + + LA   +  +WM  +RR IH NPEL YEE  TS +VR EL+++GV +++PVA T
Sbjct  32    IPSKFLTLAQRNDFFDWMVGIRRRIHENPELGYEEVETSKLVRAELEKMGVAFKYPVAVT  91

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GV+  +G+G PPFVALRADMDALP+QE+VEWEHKS+V GKMHACGHDAHT MLLGAAK+L
Sbjct  92    GVIGYVGTGQPPFVALRADMDALPMQEMVEWEHKSKVPGKMHACGHDAHTTMLLGAAKLL  151

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             ++   +L+GTV+L+FQPAEE G GAK +++ GVL+NV AIFGLHV ++  +G V+SR G 
Sbjct  152   KEHEDELQGTVVLVFQPAEEGGGGAKKIVEAGVLENVSAIFGLHVTNQLVLGQVSSREGP  211

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LAG G FKA I GKGGHAA+PQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+V+  
Sbjct  212   LLAGSGFFKAKISGKGGHAALPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKF  271

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             +GG +FNVIPD+ TI GT+RAF+  SF  LKKRIE+++  QA+VH C   +DF   E P 
Sbjct  272   EGGGAFNVIPDSVTIGGTFRAFSTKSFMQLKKRIEQVITRQASVHMCNATVDFIEEEKPF  331

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDN-VELAPGQMGSEDFGMYLDKVPGAFFFIGV  464
             FP    PT+ND  +++  +  S  ++G +N VE+ P  MGSEDF  Y + +PG F F+G+
Sbjct  332   FP----PTVNDKELHKFFKNVSGDMLGTENYVEMQP-LMGSEDFSFYQEAIPGHFSFVGM  386

Query  463   KNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             +N+  + +  PHSP+F ++E++LP GA++HA+ A  YLL
Sbjct  387   QNKAHSPMASPHSPFFEVNEELLPYGASLHASMATRYLL  425



>ref|XP_010104509.1| IAA-amino acid hydrolase ILR1-like 6 [Morus notabilis]
 gb|EXC01110.1| IAA-amino acid hydrolase ILR1-like 6 [Morus notabilis]
Length=478

 Score =   472 bits (1215),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 228/397 (57%), Positives = 289/397 (73%), Gaps = 9/397 (2%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + ++ LA   ETVEW+R VRR IH NPELA+EEF TS ++R ELDR+ + YR+P+AKTG+
Sbjct  84    EEVLSLARRPETVEWLRTVRRRIHENPELAFEEFETSRLIRNELDRMEIAYRFPLAKTGI  143

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IG+G PPFVA+RADMDA PIQE V+WEHKS+V GKMHACGHDAH  ML+GAAKIL+ 
Sbjct  144   RAWIGTGGPPFVAIRADMDAPPIQEAVDWEHKSKVAGKMHACGHDAHVTMLIGAAKILKS  203

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+L+FQPAEE G GAK MI +G L++V+AIF  HV+H++P G++ SRPG  L
Sbjct  204   REHLLKGTVILLFQPAEEAGNGAKRMIGDGALEDVEAIFAAHVSHEHPTGIIGSRPGPLL  263

Query  994   AGCGMFKATIK--GKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             AGCG F+A I    KGG+A   Q S DPILAAS +VISLQ IVSRE +P DSQVVSV+  
Sbjct  264   AGCGFFRAVISTGNKGGNA---QYSGDPILAASAAVISLQGIVSREANPLDSQVVSVTTF  320

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
              GGS+ + IP T  I GT+RAF+  SFY L +RIEE++  QA V+RC+ E+DF   E   
Sbjct  321   NGGSNLDEIPHTVVIGGTFRAFSNTSFYQLLQRIEEVIVKQARVYRCSAEVDFFEKEYTI  380

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             +P    PT+ND ++YEH RK +  +VG  N  + P  MG+EDF  + + VP AFF+IGV+
Sbjct  381   YP----PTVNDEKMYEHVRKVAVDLVGPANFRVVPPMMGAEDFSFFSEVVPAAFFYIGVR  436

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             NE   ++   HSP+F +DEDVLPVGAA HA  +  YL
Sbjct  437   NETLGSIHTGHSPHFMIDEDVLPVGAATHATISERYL  473



>ref|XP_002891660.1| IAA-alanine resistant 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67919.1| IAA-alanine resistant 3 [Arabidopsis lyrata subsp. lyrata]
Length=440

 Score =   470 bits (1210),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 222/399 (56%), Positives = 296/399 (74%), Gaps = 6/399 (2%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             +  + + LA   +  +WM R+RR IH NPEL YEE  TS +VR EL+++GV +++PVA T
Sbjct  31    IPSKFLTLAKSNDFFDWMVRIRRRIHENPELGYEEVETSKLVRAELEKMGVSFKYPVAVT  90

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVV  +G+G  PFVALRADMDALPIQE+VEWEHKS+V GKMHACGHDAHT MLLGAAK+L
Sbjct  91    GVVGYVGTGQAPFVALRADMDALPIQEMVEWEHKSKVPGKMHACGHDAHTTMLLGAAKLL  150

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             ++  ++L+GTV+L+FQPAEE G GAK +++ GVL+NV AIFGLHV ++  +G V+SR G 
Sbjct  151   KEHEEELQGTVILVFQPAEEGGGGAKKIVEAGVLENVSAIFGLHVTNQLALGQVSSREGP  210

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LAG G FKA I GKGGHAA+PQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+V+  
Sbjct  211   MLAGSGFFKAKISGKGGHAALPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKF  270

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             +GG +FNVIPD+ TI GT+RAF+  SF  LKKRIE+++  QA+V+ C   +DF   E P 
Sbjct  271   EGGGAFNVIPDSVTIGGTFRAFSTKSFMQLKKRIEQVITRQASVNMCNATVDFIEEEKPF  330

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVG-EDNVELAPGQMGSEDFGMYLDKVPGAFFFIGV  464
             FP    PT+ND  +++  +  S  ++G E+ VE+ P  MGSEDF  Y   +PG F F+G+
Sbjct  331   FP----PTVNDKDLHQFFKNVSGDMLGIENYVEMQP-LMGSEDFSFYQQAIPGHFSFVGM  385

Query  463   KNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             +N+  + +  PHSPYF ++E++LP GA++HA+ A  YLL
Sbjct  386   QNKAHSPMANPHSPYFEVNEELLPYGASLHASMATRYLL  424



>gb|EYU30670.1| hypothetical protein MIMGU_mgv1a006375mg [Erythranthe guttata]
Length=446

 Score =   470 bits (1209),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 217/390 (56%), Positives = 288/390 (74%), Gaps = 4/390 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A   E  ++M ++RR +H NPEL +EEF TS ++R ELDR+G+ Y+ P+A TGVV  IG+
Sbjct  44    AKTPEIFDYMVKIRRTLHENPELGFEEFETSKLIRNELDRMGIPYKHPIAVTGVVGYIGT  103

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G+PPFVA+RADMDAL +QE VEWEHKS+V GKMHACGHDAH AMLLGAAKILQ+    L+
Sbjct  104   GNPPFVAIRADMDALAMQEAVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILQEHYSHLE  163

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV+L+FQPAEE G GAK M   G+L+NVDAIFGLHV+ +YPVGVVA++ G  +A  G F
Sbjct  164   GTVMLVFQPAEEGGGGAKKMRDEGILENVDAIFGLHVSSRYPVGVVATKEGPVMAASGFF  223

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGHAAIPQ+++DPILA+S  ++SLQ +VSRE DP DSQVV+++  +GG +FNV
Sbjct  224   EAKISGKGGHAAIPQQTIDPILASSNIIVSLQQLVSREADPLDSQVVTIAKFRGGHAFNV  283

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+RAF+K  F  LK RIEE++  QAAV RC   ++F G E P +P     T
Sbjct  284   IPDSVTIGGTFRAFSKQGFIELKHRIEEVITLQAAVQRCNASVNFYGEEKPFYP----VT  339

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVF  437
              ND  +++H  K +  ++G++ ++     MGSEDF  + + +PG F+++G+ NE    + 
Sbjct  340   SNDKELHQHFLKIARSMIGDEKIQELQPSMGSEDFSFFAESIPGYFYYVGMVNETEGQME  399

Query  436   PPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
               HSPYF ++ED LP GAA+HA+ A TYLL
Sbjct  400   TGHSPYFRVNEDALPYGAALHASLAATYLL  429



>ref|XP_008797894.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 isoform X1 [Phoenix 
dactylifera]
Length=438

 Score =   469 bits (1208),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 222/390 (57%), Positives = 288/390 (74%), Gaps = 5/390 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A E+E  +WM  +RR IH NPEL YEEF TS +VRRELD +G+ Y+ P+A TGV   +G+
Sbjct  36    AKESEFSDWMVGIRRRIHENPELGYEEFETSELVRRELDAMGIAYKHPIAVTGVSGFVGT  95

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G PPFVALRADMDALP+QE VEWEHKS+V GKMH CGHDAH AMLLGAAKILQ+ R +L+
Sbjct  96    GKPPFVALRADMDALPMQESVEWEHKSKVPGKMHGCGHDAHVAMLLGAAKILQECRDELQ  155

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV+L+FQPAEE G GA+ MI+ G ++NVDAIFG HV H+ P+GVVASRPG  +AG G F
Sbjct  156   GTVVLLFQPAEEGGGGAQKMIEAGAVENVDAIFGFHVTHELPIGVVASRPGPIMAGSGFF  215

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGH A+PQE++DPILAAS  V+SLQ ++SRE DP DSQVV+V+  QGG  FNV
Sbjct  216   EAVISGKGGHGALPQETIDPILAASNVVVSLQHLISREADPLDSQVVTVAKFQGGGLFNV  275

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IP++ TI GT+RA +K+SF  LK+RIEE++ AQA+V RC    DF   ++P +P     T
Sbjct  276   IPNSVTIGGTFRALSKESFSQLKQRIEEVIVAQASVQRCNATTDFLDRKHPFYP----TT  331

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIGVKNEKSATV  440
             +N   ++EH +K +  ++G ++V      MG EDF  +   VP A ++F+G+KN+     
Sbjct  332   VNSKDLHEHFQKVAEEMLGSNSVIERQPVMGGEDFAFFAAAVPRAYYYFVGIKNDSRGPQ  391

Query  439   FPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             +P HSPYF ++E+ LP GAA+HA+ A  YL
Sbjct  392   YPVHSPYFAINEEALPYGAALHASLAVRYL  421



>ref|XP_002513747.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
 gb|EEF48330.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
Length=474

 Score =   471 bits (1211),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 221/399 (55%), Positives = 291/399 (73%), Gaps = 4/399 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + ++ LA   ETV W++ VRR+IH NPELA+EEF TS +VR ELD++ + Y+ P+AKTG+
Sbjct  80    EAVLSLAWRPETVSWLKSVRRKIHENPELAFEEFKTSELVRNELDKMDISYKHPLAKTGI  139

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IG+G PPFVA+RADMDALPIQE VEWE+KS+V GKMHACGHDAH AML+GAAKIL+ 
Sbjct  140   RAWIGTGGPPFVAIRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKS  199

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+L+FQPAEE G GAK MI +G L++V+AIF +HV+H++   ++ SRPG  L
Sbjct  200   REHLLKGTVVLLFQPAEEAGNGAKRMIGDGALEDVEAIFAVHVSHEHRTAMIGSRPGPLL  259

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I GK G A  P  SVD ILAAS +VISLQ IVSRE++P DSQVVSV+ + G
Sbjct  260   AGCGFFRAVISGKKGGAGSPHHSVDTILAASAAVISLQGIVSRESNPLDSQVVSVTTMDG  319

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G++ ++IPDT  + GT+RAF+  SFY L +RI E++  QA V RC+  +DF   E   +P
Sbjct  320   GNNVDMIPDTVVLGGTFRAFSNTSFYQLLRRINEVIVEQARVFRCSATVDFFEQEYTIYP  379

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+N+ ++YEH RK +  ++G  N ++ P  MG+EDF  Y   VP AF++IG++NE
Sbjct  380   ----PTVNNDKMYEHVRKVAIDLLGPANFKVVPPMMGAEDFSFYSQVVPAAFYYIGIRNE  435

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
                +    HSPYF +DEDVLP+GAA HA  A  YL+ H+
Sbjct  436   TLGSTHTGHSPYFMIDEDVLPIGAAAHATIAERYLIEHS  474



>ref|XP_007012939.1| Peptidase M20/M25/M40 family protein isoform 5 [Theobroma cacao]
 gb|EOY30558.1| Peptidase M20/M25/M40 family protein isoform 5 [Theobroma cacao]
Length=445

 Score =   469 bits (1208),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 227/410 (55%), Positives = 298/410 (73%), Gaps = 13/410 (3%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               +  A + E ++WM  +RR+IH NPEL +EE+ TS ++R ELD++G+ Y++PVA TGV+
Sbjct  38    NFLEFAKKPEILDWMVGLRRKIHENPELGFEEYETSKLIRAELDQMGIPYKYPVAVTGVI  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDAL ++ELVEWEHKS+V GKMHACGHDAH AMLLGAAK+LQ+ 
Sbjct  98    GYIGTGQPPFVALRADMDALAMEELVEWEHKSKVPGKMHACGHDAHVAMLLGAAKMLQEH  157

Query  1171  RQQLK-GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
             +  L+ GT++L+FQPAEE G GAK M+  G L+NVDAIF LHV+ ++PVGVVASRPG  L
Sbjct  158   QNDLQQGTIVLVFQPAEEGGGGAKKMLDAGALENVDAIFALHVSSRFPVGVVASRPGPIL  217

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             A    F+A I GKGGHAAIPQ +VDPILAAS  ++SLQ ++SRE DP DSQVVS+   QG
Sbjct  218   AATSFFEAVINGKGGHAAIPQHTVDPILAASNVIVSLQHLISREADPLDSQVVSIGKFQG  277

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G +FNVIPD+ TI GT+RAF+K+SF  LK+RIEE++  QA+V RC   + FD  E  ++P
Sbjct  278   GGAFNVIPDSVTIGGTFRAFSKESFVQLKQRIEEVIMKQASVQRCNATVIFD--EKSSYP  335

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDN-VELAPGQMGSEDFGMYLDKVPGAFFFIGVKN  458
              +L    N+  ++E+ RK +  ++G +N VE+ P  MG EDF  + + +PG FFF+G+KN
Sbjct  336   VSL----NNKELHEYFRKVAGDMLGLENIVEMQP-IMGGEDFAFFSEAIPGLFFFLGMKN  390

Query  457   EKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL----SHAKPPHSS  320
             E        HSPY+ ++EDVLP GA +HA+ A  YLL     H  PP  S
Sbjct  391   ETQGQFHSGHSPYYRVNEDVLPYGAVLHASLATRYLLENLPKHTSPPKGS  440



>ref|XP_008244751.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Prunus mume]
Length=445

 Score =   469 bits (1207),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 221/395 (56%), Positives = 289/395 (73%), Gaps = 4/395 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             +++  A + +  +WM  +RR+IH NPEL YEEF TS +VR ELD++G+ Y++P+A TGVV
Sbjct  38    KLLDFAQKPQVFDWMVGIRRKIHENPELGYEEFQTSKLVRAELDKMGIDYKYPIAITGVV  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+  PPFVA+RADMDAL +QE+VEWEHKS+V GKMHACGHDAH AMLLGAAKIL++ 
Sbjct  98    GFIGTRKPPFVAIRADMDALAMQEMVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILKEH  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
              + L+GTV+L+FQPAEE G GAK MI  G L+NV+AIFGLHVA+  P+  VASRPG F A
Sbjct  158   EKDLQGTVVLLFQPAEEGGAGAKKMIDGGALENVNAIFGLHVANHVPIAEVASRPGPFFA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+ATI GKGGHAAIPQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+V   QGG
Sbjct  218   GSGFFEATISGKGGHAAIPQHAIDPILAASNVIVSLQHLVSREADPLDSQVVTVGKFQGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+  I GT+RAF ++S   LK+RI+E++  QA+V RC+  ++F   E P  P 
Sbjct  278   DAFNVIPDSVRIGGTFRAFTRESLMQLKQRIKEVIMGQASVQRCSATVNFLEDEKPLSP-  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PTIN   ++EH R  +  ++G   V+     MGSEDF  Y + +PG FF +G+ ++K
Sbjct  337   ---PTINHKDLHEHFRNVAGDMLGIHRVKDHQPLMGSEDFAYYQEAIPGYFFLLGMADDK  393

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
                +  PHSP+F ++ED LP GAA+HA+ A  YLL
Sbjct  394   LGPLHMPHSPHFQINEDALPFGAALHASLAIRYLL  428



>ref|XP_011077948.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 isoform X1 [Sesamum 
indicum]
Length=450

 Score =   469 bits (1208),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 297/417 (71%), Gaps = 11/417 (3%)
 Frame = -1

Query  1561  PLAVDGGLKD---RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLG  1391
             P   + GL +   + + LA   E  E+M ++RR +H NPEL YEEF TS  +R ELD +G
Sbjct  26    PFLGEKGLAEIPSKFLNLAKRPEIFEYMVKIRRSLHENPELGYEEFETSRFIRNELDGMG  85

Query  1390  VKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHT  1211
             + Y+ P+A TG+V  IG+G+PPFVA+RADMDAL +QE VEWEHKS+V GKMHACGHDAH 
Sbjct  86    IPYKHPIAVTGIVGYIGTGNPPFVAIRADMDALAMQEAVEWEHKSKVPGKMHACGHDAHV  145

Query  1210  AMLLGAAKILQQLRQQL----KGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVA  1043
             AMLLGAAK+LQ+ R  L    +GTV+L+FQPAEE G GAK M   G+L+NVDAIFG HV+
Sbjct  146   AMLLGAAKMLQEHRSDLELAFQGTVILVFQPAEEGGGGAKKMRDAGILENVDAIFGFHVS  205

Query  1042  HKYPVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRE  863
               +P+G VA+R G  +A  G F+A I GKGGHAAIPQ ++DPILA+S  ++SLQ ++SRE
Sbjct  206   SSFPLGTVATRAGPLMAASGFFEAKISGKGGHAAIPQHTIDPILASSNIIVSLQHLISRE  265

Query  862   TDPFDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHR  683
              DP DSQVV+++  QGG +FNVIPD+ TI GT+RAF+++SF  LK RIEE++  QA+V R
Sbjct  266   ADPLDSQVVTIAKFQGGHAFNVIPDSVTIAGTFRAFSQESFMQLKHRIEEVITLQASVQR  325

Query  682   CTVEIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMY  503
             C   ++F   E P +P     T+ND  +++H +K +  ++G++NV+     MG+EDF  +
Sbjct  326   CNASVNFYADEKPFYP----VTVNDKDLHKHFQKIAGHMLGDENVKEVQPLMGAEDFSFF  381

Query  502   LDKVPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKP  332
              + +PG F++IG+ NE    +   HSPYF ++ED LP GAA+HA+ A TYLL H  P
Sbjct  382   AEAIPGYFYYIGMFNETEGQLASGHSPYFKVNEDALPYGAALHASIAATYLLEHHSP  438



>ref|XP_011072466.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Sesamum indicum]
Length=445

 Score =   469 bits (1207),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 223/394 (57%), Positives = 287/394 (73%), Gaps = 4/394 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               +  A +TE  +WM  +RR+IH NPEL YEEF TS ++R ELD++G+ YR+PVA TGV+
Sbjct  38    NFLNFAKQTEVFDWMVGIRRQIHENPELGYEEFETSKLIREELDKMGIPYRYPVAVTGVL  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IGSG PPFVA+RADMDAL +QE+VEW+HKS+  GKMHACGHD HTAMLLGAA+ILQ+ 
Sbjct  98    GYIGSGKPPFVAIRADMDALSLQEMVEWDHKSKNPGKMHACGHDTHTAMLLGAARILQEH  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             R  +KGTV+L+FQPAEE G GAK M++ G L+NV+AIFG+H     PVG VASR G FLA
Sbjct  158   RDLVKGTVVLVFQPAEEGGGGAKKMVEAGALENVEAIFGIHSTTFLPVGEVASRSGPFLA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I GKGGHAAIPQ SVDPIL+AS  ++SLQ +VSRE DP DSQV++V+  QGG
Sbjct  218   GSGSFEAVISGKGGHAAIPQHSVDPILSASNVIMSLQHLVSREADPLDSQVLTVAKFQGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+K+S   LK+RIEE++  QAAV RC   + F+  + P FP 
Sbjct  278   GAFNVIPDSVTIGGTFRAFSKESLMKLKQRIEEVIVGQAAVQRCNATVTFESKDRPFFP-  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PT+N+  +++  ++ +  ++G   V      MGSEDF  Y + +PG FFF+G+K+E 
Sbjct  337   ---PTVNEGGLHKLFQRVAGDMLGTAGVNDMQPLMGSEDFSFYQEIIPGYFFFLGMKDET  393

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
                   PHSPYF +DE  LP GAA+HA+ A  YL
Sbjct  394   LEQPVMPHSPYFRIDEGGLPYGAALHASLAVRYL  427



>ref|XP_002275866.2| PREDICTED: IAA-amino acid hydrolase ILR1-like [Vitis vinifera]
Length=440

 Score =   468 bits (1205),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 222/401 (55%), Positives = 289/401 (72%), Gaps = 4/401 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L   ++  A E + +EW+R VRR IH  PEL +EE+ TS ++R EL+ LG++Y WPVAKT
Sbjct  34    LGRELLESAREADLLEWIRGVRRSIHEYPELGFEEYRTSQLIRDELNSLGIRYEWPVAKT  93

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVATIGSG+ P  ALRADMDALP+QELVEWEH+S++DGKMHACGHD H AMLLGAA++L
Sbjct  94    GVVATIGSGAQPIFALRADMDALPLQELVEWEHRSKIDGKMHACGHDLHVAMLLGAARLL  153

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q  R+ LKGTV L+FQP EE   GA  M+Q+G LDN++AIFGLHV      G++ASRPG 
Sbjct  154   QGKREILKGTVKLVFQPGEEGYAGAYHMLQHGALDNINAIFGLHVMPSILTGMIASRPGP  213

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LAG G+F AT+KG GGHAA P ++ DPILAAS ++++LQ IVSRETDP +++VV+V  I
Sbjct  214   MLAGAGLFLATVKGIGGHAAGPHQTRDPILAASLAIVALQQIVSRETDPLEARVVTVGFI  273

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             +GG + NVIP++    GTYR+        +++RI+EI+ +QAAVHRCT  ++F       
Sbjct  274   KGGQAANVIPESVEFGGTYRSLTSQGLSYIQERIQEIIESQAAVHRCTAVVEF----REE  329

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT ND  +YEHA++   +++GE NV+L P  MG+EDF  Y  KVP   F +G+K
Sbjct  330   IPLPYPPTDNDEELYEHAKRVGEILLGEPNVQLVPITMGAEDFSFYSQKVPAVMFELGIK  389

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             NE   +  P HSPYF +DE  LP+GAA+HAA A +YL SHA
Sbjct  390   NETLKSDQPLHSPYFVIDETALPIGAALHAAVAISYLDSHA  430



>ref|XP_003531633.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
 gb|KHN11319.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=442

 Score =   468 bits (1205),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 226/402 (56%), Positives = 291/402 (72%), Gaps = 4/402 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L    +  A + E  +WM R+RR+IH NPEL YEEF TS ++R ELD+L + Y+ PVA T
Sbjct  32    LPTNFLDAAKKPEVFDWMVRIRRKIHENPELGYEEFETSKLIREELDKLRIPYKHPVAIT  91

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GV+  IG+   PFVA+RADMDALP+QE+VEWEHKS+V GKMHACGHDAH  MLLGAAKIL
Sbjct  92    GVIGFIGTKRSPFVAIRADMDALPMQEMVEWEHKSKVPGKMHACGHDAHVTMLLGAAKIL  151

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             +Q  ++++GTV+L+FQPAEE G GAK ++  G L+NV AIFGLHV   +P+G VASR G 
Sbjct  152   KQHEKEIQGTVVLVFQPAEEGGGGAKKILDAGALENVAAIFGLHVTPNFPIGEVASRSGP  211

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LAG G F+A I GKGGHAAIPQ+S+DPILA S  +ISLQ +VSRE DP DSQVV+V   
Sbjct  212   LLAGSGFFEAIISGKGGHAAIPQQSIDPILATSNVIISLQHLVSREADPLDSQVVTVGKF  271

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             QGG++FNVIPD+ TI GT+RAF+K+SF  L++RIE++V AQAAV RC   ++F   E P 
Sbjct  272   QGGNAFNVIPDSVTIGGTFRAFSKESFQQLRQRIEQVVIAQAAVLRCNATVNFFEGEKPF  331

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             FP     TIN+  ++EH    +  ++G + V   P  MG+EDF  Y + +PG F FIG++
Sbjct  332   FP----ATINNNDLHEHFGTVAVNLLGINKVNDMPPLMGAEDFSFYQEVMPGYFAFIGIQ  387

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
             N     +   HSPYF ++EDVLP GAA+HA+ A +YLL H +
Sbjct  388   NPSHEKLEQVHSPYFKINEDVLPYGAALHASLAVSYLLKHPQ  429



>ref|XP_007215385.1| hypothetical protein PRUPE_ppa005752mg [Prunus persica]
 gb|EMJ16584.1| hypothetical protein PRUPE_ppa005752mg [Prunus persica]
Length=445

 Score =   468 bits (1203),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 221/395 (56%), Positives = 288/395 (73%), Gaps = 4/395 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             +++  A + +  +WM  +RR+IH NPEL YEEF TS +VR ELD+LG+ Y++P+A TGVV
Sbjct  38    KLLDFAQKPQVFDWMVGIRRKIHENPELGYEEFETSELVRAELDKLGIDYKYPIAVTGVV  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+  PPFVA+RADMDAL +QE+VEWEHKS+V GKMHACGHDAH AMLLGAAKIL++ 
Sbjct  98    GFIGTRKPPFVAIRADMDALAMQEMVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILKEH  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
              Q L+GTV+L+FQPAEE G GAK MI  G L+NV+AIFGLHVA+  P+  VASRPG F A
Sbjct  158   EQDLQGTVVLLFQPAEEGGAGAKKMIDGGALENVNAIFGLHVANHVPIAEVASRPGPFFA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+ATI GKGGHAAIPQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+V   QGG
Sbjct  218   GSGFFEATISGKGGHAAIPQHAIDPILAASNVIVSLQHLVSREADPLDSQVVTVGKFQGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+  I GT+RAF ++S   L++RI+E++  QA+V RC+  ++F   E P  P 
Sbjct  278   DAFNVIPDSVRIGGTFRAFTRESLMQLQQRIKEVIMGQASVQRCSATVNFLEDEKPLSP-  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PTIN   + EH +  +  ++G   V+     MGSEDF  Y + +PG FF +G+ ++K
Sbjct  337   ---PTINHKDLQEHFQNVAGDMLGIHRVKDHQPLMGSEDFAYYQEAIPGYFFLLGMADDK  393

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
                +  PHSP+F ++ED LP GAA+HA+ A  YLL
Sbjct  394   LGPLHMPHSPHFQINEDALPFGAALHASLAIRYLL  428



>ref|XP_010462018.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 isoform X1 [Camelina 
sativa]
 ref|XP_010462019.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 isoform X2 [Camelina 
sativa]
Length=441

 Score =   467 bits (1202),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 220/397 (55%), Positives = 293/397 (74%), Gaps = 6/397 (2%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
              + + LA   +  +WM  +RR IH NPEL YEE  TS +VR EL+++GV ++ PVA TGV
Sbjct  34    SKFLTLAKRNDFFDWMVGIRRRIHENPELGYEEVETSKLVRAELEKMGVAFKHPVAVTGV  93

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
             +  +G+G  PFVALRADMDALP+QE+VEWEHKS+V GKMHACGHDAHT MLLGAAK+L+Q
Sbjct  94    IGYVGTGQAPFVALRADMDALPMQEMVEWEHKSKVPGKMHACGHDAHTTMLLGAAKLLKQ  153

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                +L+GTV+L+FQPAEE G GAK +++ GVL+NV AIFGLHV ++  +G V+SR G  L
Sbjct  154   HEDELQGTVVLVFQPAEEGGGGAKKIVEAGVLENVSAIFGLHVTNQLVLGQVSSREGPLL  213

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AG G FKA I GKGGHAA+PQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +G
Sbjct  214   AGSGFFKAKISGKGGHAALPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFEG  273

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G +FNVIPD+ TI GT+RAF+  SF  LKKRIE+++  QA+VH C   +DF   E P FP
Sbjct  274   GGAFNVIPDSVTIGGTFRAFSTKSFMQLKKRIEQVITRQASVHMCNATVDFIEEEKPFFP  333

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDN-VELAPGQMGSEDFGMYLDKVPGAFFFIGVKN  458
                 PT+ND  +++  +  S  ++G +N VE+ P  MGSEDF  Y + +PG F F+G++N
Sbjct  334   ----PTVNDKELHKFFKNVSGDMLGTENYVEMQP-LMGSEDFSFYQETIPGHFSFVGMQN  388

Query  457   EKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             +  + +  PHSP+F ++E++LP GA++HA+ A  YLL
Sbjct  389   KAHSPMASPHSPFFEVNEELLPYGASLHASMATRYLL  425



>ref|XP_010535205.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Tarenaya hassleriana]
Length=444

 Score =   467 bits (1201),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 225/408 (55%), Positives = 296/408 (73%), Gaps = 10/408 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + + LA   E  +WM  +RR+IH NPEL YEE  TS ++R ELD++GV Y++PVA TGV+
Sbjct  38    KFINLAKRDEFFDWMVGIRRKIHENPELGYEEIETSKLIRAELDKMGVSYKYPVAVTGVI  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               +G+G PPFVALRADMDALP+QE+VEWEH+S++ GKMHACGHDAHTAMLLGAAK+L++ 
Sbjct  98    GYVGTGQPPFVALRADMDALPMQEMVEWEHRSKIPGKMHACGHDAHTAMLLGAAKLLKEH  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
               +LKGTV+L+FQPAEE G GAK +++ GVLDNVDAIFG HV++   +G VASR G  LA
Sbjct  158   EGELKGTVVLVFQPAEEGGGGAKKVLEAGVLDNVDAIFGFHVSNFLKLGQVASREGHLLA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I GKGGHAA+PQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +GG
Sbjct  218   GSGFFEAKISGKGGHAALPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFEGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDF-DGTENPTFP  635
              +FNVIPD+ TI GT+RAF+K+SF  LK RIE+++  QA+V RC   +DF +G   P FP
Sbjct  278   GAFNVIPDSVTIGGTFRAFSKESFKQLKTRIEQVITRQASVQRCNATVDFLEG--KPFFP  335

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND  ++   +  +  ++G +N       MGSEDF  Y +  PG F+F+G++N+
Sbjct  336   ----PTVNDKDLHRFFKNVAGDVLGTENYSEMKPLMGSEDFSSYQEVKPGFFYFVGMQNK  391

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLS---HAKPPHSS  320
                 +  PHSPYF ++ED LP GAA+HA+ A  YLL    +   PH S
Sbjct  392   GHPPMDNPHSPYFRVNEDSLPYGAALHASLATRYLLESRPNGSSPHMS  439



>ref|XP_010690089.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Beta vulgaris 
subsp. vulgaris]
Length=450

 Score =   467 bits (1201),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 227/394 (58%), Positives = 287/394 (73%), Gaps = 5/394 (1%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
              +    + E  +WM  +RR++H NPEL +EEF TS V+R ELD+LG+ Y++P+A TGV+ 
Sbjct  43    FLNQTQKAEVFDWMVNIRRKLHENPELGFEEFETSRVIREELDKLGISYKYPLAVTGVLG  102

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              IG+G+PPFVALRADMDALPI+E+VEWEHKS+V GKMHACGHDAH AMLLGAA+ILQ+ +
Sbjct  103   FIGTGNPPFVALRADMDALPIEEMVEWEHKSKVPGKMHACGHDAHVAMLLGAARILQENQ  162

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
              +L+GTV+L+FQP EE   GAK MI+ G L+NV+AIF LHV    PVG V+SRPG  LAG
Sbjct  163   HKLQGTVVLVFQPGEEGYGGAKKMIEAGALENVEAIFALHVNSGLPVGQVSSRPGPLLAG  222

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
              G F+A I GKGGHAAIP  SVDPILAAS  ++SLQ IVSRE DP DSQVV+V   QGG 
Sbjct  223   SGFFQAVINGKGGHAAIPHHSVDPILAASNVIVSLQHIVSREADPLDSQVVTVGKFQGGG  282

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
             +FNVIPD+ TI GT+RA  K+S   LK+RI E++ +QAAV RCT  IDF  +EN  F P 
Sbjct  283   AFNVIPDSVTIGGTFRALLKESLLRLKQRIGEVIISQAAVQRCTATIDFYDSEN--FYP-  339

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
               PTIND  ++E   + +S ++G  NV+ A    GSEDF  Y + +PG  FF+G+KNE  
Sbjct  340   --PTINDENLHELFTRVASDMLGSRNVKEAKPLTGSEDFAFYQEVIPGYLFFVGLKNETR  397

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
                   H+P F ++EDVLP GA++HA+ A  YLL
Sbjct  398   GISGSEHNPKFMVNEDVLPYGASLHASLAVRYLL  431



>ref|XP_004968975.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1-like [Setaria 
italica]
Length=445

 Score =   466 bits (1199),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 228/396 (58%), Positives = 288/396 (73%), Gaps = 5/396 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A E +   WM  VRR IH NPEL YEEF TSA+VRRELD +G+ Y+ P A TGVVAT+G+
Sbjct  41    AKEPDFAGWMVGVRRRIHENPELGYEEFETSALVRRELDAMGIPYKHPFAVTGVVATVGT  100

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G PPFVALRADMDALP+QE VEWEH+S+V GKMH CGHDAH AMLLG+AKILQ+ R +LK
Sbjct  101   GGPPFVALRADMDALPMQESVEWEHRSKVPGKMHGCGHDAHVAMLLGSAKILQEHRDELK  160

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV+L+FQPAEE G GA+ MI+ G ++N+DAIFG+H+A   P+GV+ASRPG  +AG G F
Sbjct  161   GTVVLVFQPAEEGGGGAQKMIEAGAVENIDAIFGIHIADSIPIGVLASRPGPIMAGSGFF  220

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGHAA+P  ++DPILAAS  ++SLQ +VSRE DP DSQVV++   QGG +FNV
Sbjct  221   EAVISGKGGHAALPHHTIDPILAASNVIVSLQQLVSREADPLDSQVVTIGKFQGGGAFNV  280

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+RAF K+SF  LK+RIEE++ +QA+V RCT  +DF   + P FP    PT
Sbjct  281   IPDSVTIGGTFRAFLKESFNQLKQRIEEVIVSQASVQRCTATVDFLTKDRPFFP----PT  336

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIGVKNEKSATV  440
             IN   +++     +S +VG  NV      MG+EDF  Y + +P   ++F+G+ NE     
Sbjct  337   INSPELHDFFVNVASEMVGSKNVRDRQPLMGAEDFAFYAEAIPSTYYYFVGMYNETRGPQ  396

Query  439   FPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKP  332
              P HSPYFT++ED LP GAA  AA A  YL  H +P
Sbjct  397   APHHSPYFTINEDALPYGAAAQAAMAARYLHEHQQP  432



>ref|XP_008219626.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Prunus mume]
Length=478

 Score =   467 bits (1202),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 218/398 (55%), Positives = 286/398 (72%), Gaps = 7/398 (2%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + ++  A   E VEW++ +RR IH +PELA+EEF TS +VR ELDRL + YR+P+AKTG+
Sbjct  87    EEVLSFAKRPENVEWLKMIRRRIHEHPELAFEEFETSRLVREELDRLDIGYRFPLAKTGI  146

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IG+G PPFVA+RADMDALPIQE VEWEHKS+V GKMHACGHDAH  ML+GAAKIL+ 
Sbjct  147   RAWIGTGGPPFVAVRADMDALPIQEAVEWEHKSKVAGKMHACGHDAHVTMLIGAAKILKS  206

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+LIFQPAEE G GAK MI +G L++V+AIF  HV+H++P G++ SR G  L
Sbjct  207   REHLLKGTVVLIFQPAEEAGNGAKRMIGDGALEDVEAIFAAHVSHEHPTGIIGSRSGALL  266

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG FKA I G+ G+   P  SV+P+LAA+ +VISLQ IVSRE++P DSQVVSV+   G
Sbjct  267   AGCGFFKAVITGRAGN---PHSSVEPVLAAAAAVISLQGIVSRESNPLDSQVVSVTAFNG  323

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G    +IP+T  + GT RAF+  SFY L +RIEE++  QA+V+RC+  +DF   ++  +P
Sbjct  324   GDDLGMIPNTVVLGGTLRAFSNTSFYRLLQRIEEVIVEQASVYRCSATVDFFKNQSTIYP  383

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND +++EH RK +  ++G  N  + P  MG+EDF  Y + +P  FF+IG++NE
Sbjct  384   ----PTVNDDKMHEHVRKVAMGLLGPANFRVVPPMMGAEDFSFYSEVIPAGFFYIGIRNE  439

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                +    HSPYF +DEDVLP+GAA HA  A  YL  H
Sbjct  440   TLGSTHTGHSPYFFIDEDVLPIGAATHATIAERYLNEH  477



>emb|CDM83724.1| unnamed protein product [Triticum aestivum]
Length=433

 Score =   465 bits (1196),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 227/395 (57%), Positives = 287/395 (73%), Gaps = 6/395 (2%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
             ++  A   E   WM  VRR IH  PELA+EE  TS +VRRELD +GV+Y  P+A TGVVA
Sbjct  30    VLSRAKRPEFAAWMAGVRRAIHERPELAFEEHETSRLVRRELDAMGVRYEHPIAGTGVVA  89

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              +G+G PPFVALRADMDALP+QE VEWEH+S+V GKMHACGHDAHTAMLLGAA+IL + R
Sbjct  90    AVGTGRPPFVALRADMDALPLQEEVEWEHRSKVGGKMHACGHDAHTAMLLGAARILHEHR  149

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
               L+GTV+L+FQPAEE G GAK M++ GV++NV+AIFG HV    P GVV SR G  LAG
Sbjct  150   HVLQGTVILLFQPAEEVGTGAKKMVEAGVVNNVEAIFGFHVTVILPTGVVGSRAGPLLAG  209

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
             CG F+A I GKGGHAAIPQ SVDP++AAS+ V++LQ++VSRE DP DSQVV+V+  +GG 
Sbjct  210   CGFFEAVITGKGGHAAIPQSSVDPVVAASSVVLALQNLVSREADPLDSQVVTVTRFRGGG  269

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
             +FNVIPD+ TI GT+R F+ D F  LK+RIEE++ AQ+AVHRC   +DF         P 
Sbjct  270   AFNVIPDSVTIGGTFRCFSNDGFMRLKQRIEEVIVAQSAVHRCAAAVDFHAGGR----PL  325

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELA-PGQMGSEDFGMYLDKVPGA-FFFIGVKNE  455
             LAPTIN   ++ H    ++ ++G   V  A    MGSEDF  + + VPG+ F+FIG++NE
Sbjct  326   LAPTINSPALHAHFEAVATDMLGAGGVRGAMEPCMGSEDFAAFSEAVPGSHFYFIGIRNE  385

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
              + +V   HSP+F +DE  LP GAA+HA+ A  YL
Sbjct  386   AAGSVHDAHSPHFLVDEGALPYGAAMHASLAMAYL  420



>ref|XP_010479682.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Camelina sativa]
Length=441

 Score =   465 bits (1196),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 219/396 (55%), Positives = 292/396 (74%), Gaps = 6/396 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               + LA   +  +WM  +RR IH NPEL YEE  TS +VR EL+++GV ++ PVA TGV+
Sbjct  35    NFLTLAKRNDFFDWMVGIRRRIHENPELGYEEVETSKLVRAELEKMGVAFKHPVAVTGVI  94

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               +G+G  PFVALRADMDALP+QE+VEWEHKS+V GKMHACGHDAHT MLLGAAK+L++ 
Sbjct  95    GYVGTGQAPFVALRADMDALPMQEMVEWEHKSKVPGKMHACGHDAHTTMLLGAAKLLKEH  154

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
               +L+GTV+L+FQPAEE G GAK +++ GVL+NV AIFGLHV ++  +G V+SR G  LA
Sbjct  155   EDELQGTVVLVFQPAEEGGGGAKKIVEAGVLENVSAIFGLHVTNQLVLGQVSSREGPLLA  214

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G FKA I GKGGHAA+PQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +GG
Sbjct  215   GSGFFKAKISGKGGHAALPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFEGG  274

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+  SF  LKKRIE+++  QA+VH C   +DF   E P FP 
Sbjct  275   GAFNVIPDSVTIGGTFRAFSTKSFMQLKKRIEQVITRQASVHMCNATVDFIEEEKPFFP-  333

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDN-VELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                PT+ND  +++  +  S  ++G +N VE+ P  MGSEDF  Y + +PG F F+G++N+
Sbjct  334   ---PTVNDKELHKFFKNVSGDMLGTENYVEMQP-LMGSEDFSFYQETIPGHFSFVGMQNK  389

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
               + +  PHSP+F ++E++LP GA++HA+ A  YLL
Sbjct  390   AHSPMASPHSPFFEVNEELLPYGASLHASMATRYLL  425



>ref|XP_010063397.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Eucalyptus grandis]
Length=488

 Score =   466 bits (1200),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 228/398 (57%), Positives = 289/398 (73%), Gaps = 4/398 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + +M  A E ETV W+R VRR IH  PELA+EE  TS +VR EL+R+G++YR P+A+TGV
Sbjct  94    ESVMRAAREPETVRWLRSVRRRIHERPELAFEEHETSLLVREELERMGIEYRHPLAETGV  153

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A +G+G PPFVA+RADMDALPIQE VEWEHKS+V GKMHACGHD H AMLLGAAKIL+ 
Sbjct  154   RAWVGTGGPPFVAIRADMDALPIQEAVEWEHKSKVAGKMHACGHDVHVAMLLGAAKILKS  213

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+L+FQPAEE G GAK MI++G L+NV+AIF LHV+H++P GV+ SRPG  L
Sbjct  214   REHFLKGTVVLLFQPAEEAGNGAKRMIRDGALENVEAIFALHVSHEHPTGVIGSRPGPLL  273

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG FKATI  K   A  P+ SVDP+LAAS +VISLQ IVSRE +P DSQVVSV+   G
Sbjct  274   AGCGFFKATITRKAASAGSPRPSVDPVLAASAAVISLQGIVSREANPLDSQVVSVTSFNG  333

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             GS  N +P++  + GT+RAF+  S Y + +RIEE++  QA V RC   +DF   E+  + 
Sbjct  334   GSDLNALPESVVLGGTFRAFSNTSLYQVMRRIEEVIVEQAGVFRCEASVDFFEEEDMIY-  392

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND R+YEH RK  + +VG  N  + P  MG+EDF  Y  +VP AFF+IG++NE
Sbjct  393   ---LPTVNDDRMYEHVRKVGADLVGRGNFRVVPPMMGAEDFSFYSHEVPAAFFYIGIRNE  449

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                ++   HSP+F +DE+VLPVGAA HAA A  YL+ +
Sbjct  450   AVGSIHTGHSPHFMVDEEVLPVGAAAHAAIAERYLIEY  487



>ref|XP_008242448.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Prunus mume]
Length=445

 Score =   464 bits (1195),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 218/397 (55%), Positives = 287/397 (72%), Gaps = 4/397 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + +  A   E  ++M  VRR+IH NPEL +EEF TS ++R ELD++G+ Y++P+A+TG+V
Sbjct  38    KFLDHAKRQELFDFMVGVRRKIHENPELGFEEFETSKLIRAELDQMGIPYKYPLAETGIV  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVA+RADMDAL +QE VEWEHKS+V GKMHACGHDAH AMLLGAAKILQ+ 
Sbjct  98    GFIGTGGPPFVAIRADMDALAMQESVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILQEH  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
               +L+GTV+L+FQPAEE G GAK M+  G L++V AIFGLHVA  YP+G V +R G F A
Sbjct  158   HHELQGTVVLVFQPAEEGGGGAKKMLDEGALEHVGAIFGLHVAADYPIGSVVTRSGPFFA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
               G F+A I GKGGHAAIPQ ++DPILAAS  ++SLQ +VSRE DP +SQVV+V   QGG
Sbjct  218   ASGFFEAVISGKGGHAAIPQHTIDPILAASNVIVSLQHLVSREADPLESQVVTVGKFQGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+K+SF  LK+RIEE++  QA+V RC   + F+  + P +P 
Sbjct  278   GAFNVIPDSVTIGGTFRAFSKESFIQLKQRIEEVITRQASVQRCNATVLFNERDKPFYP-  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                  +ND  ++EH R  +  ++G  N+      MG+EDF  Y + +PG FFF+G+KNE 
Sbjct  337   ---VAVNDKNLHEHFRNVAGDLLGPQNILERQPMMGAEDFSFYQEAIPGYFFFVGMKNES  393

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                    HSP+F ++EDVLP GAA+HA+ A  YLL +
Sbjct  394   QGKFESGHSPFFRVNEDVLPYGAALHASLATRYLLEN  430



>ref|XP_006307542.1| hypothetical protein CARUB_v10009165mg [Capsella rubella]
 gb|EOA40440.1| hypothetical protein CARUB_v10009165mg [Capsella rubella]
Length=440

 Score =   464 bits (1193),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 218/396 (55%), Positives = 292/396 (74%), Gaps = 6/396 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + +  A   +  +WM  +RR IH NPEL YEE  TS +VR EL+++GV +++PVA TGV+
Sbjct  34    KFLTFAKRNDFFDWMVGIRRRIHENPELGYEEVETSKLVRAELEKMGVAFKYPVAVTGVI  93

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               +G+G  PFVALRADMDAL +QE+VEWEHKS+V GKMHACGHDAHT MLLGAAK+L++ 
Sbjct  94    GYVGTGQAPFVALRADMDALAMQEMVEWEHKSKVPGKMHACGHDAHTTMLLGAAKLLKEH  153

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
              ++L+GTV+L+FQPAEE G GAK +++ GVL+NV AIFGLHV ++  +G V+SR G  LA
Sbjct  154   EEELQGTVILVFQPAEEGGGGAKQIVEAGVLENVSAIFGLHVTNQLALGQVSSREGPLLA  213

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G FKA I GKGGHAA+PQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +GG
Sbjct  214   GSGFFKAKISGKGGHAALPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFEGG  273

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+  SF  LKKRIE+++  QA+VH C   +DF   E P FP 
Sbjct  274   GAFNVIPDSVTIGGTFRAFSTKSFLQLKKRIEQVITRQASVHMCNATVDFIEDEKPFFP-  332

Query  631   TLAPTINDVRIYEHARKSSSLIVG-EDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                PT+ND  +++  +  S  ++G E+ VE+ P  MGSEDF  Y + +PG F F+G++N+
Sbjct  333   ---PTVNDKDLHKFFKNVSGDMLGIENYVEMQP-LMGSEDFSFYQETIPGHFSFVGMQNK  388

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
               A +  PHSP+F ++E +LP GA++HA+ A  YLL
Sbjct  389   AHAPMASPHSPFFEVNEQLLPYGASLHASMATRYLL  424



>ref|NP_175587.1| IAA-amino acid hydrolase IAR3 [Arabidopsis thaliana]
 sp|O04373.2|ILL4_ARATH RecName: Full=IAA-amino acid hydrolase ILR1-like 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG50883.1|AC025294_21 IAA-Ala hydrolase (IAR3) [Arabidopsis thaliana]
 gb|AAK53028.1|AF375444_1 At1g51760/F19C24_4 [Arabidopsis thaliana]
 gb|AAC32192.1| IAA-Ala hydrolase [Arabidopsis thaliana]
 gb|AAN28900.1| At1g51760/F19C24_4 [Arabidopsis thaliana]
 gb|AEE32712.1| IAA-amino acid hydrolase ILR1-like 4 [Arabidopsis thaliana]
Length=440

 Score =   464 bits (1193),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 219/397 (55%), Positives = 293/397 (74%), Gaps = 6/397 (2%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
              + + LA   +  +WM  +RR IH NPEL YEE  TS +VR EL+++GV Y++PVA TGV
Sbjct  33    SKFLTLAKRNDFFDWMVGIRRRIHENPELGYEEVETSKLVRAELEKMGVSYKYPVAVTGV  92

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
             V  +G+G  PFVALRADMDAL +QE+VEWEHKS+V GKMHACGHDAHT MLLGAAK+L++
Sbjct  93    VGYVGTGHAPFVALRADMDALAMQEMVEWEHKSKVPGKMHACGHDAHTTMLLGAAKLLKE  152

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
               ++L+GTV+L+FQPAEE G GAK +++ GVL+NV AIFGLHV ++  +G V+SR G  L
Sbjct  153   HEEELQGTVVLVFQPAEEGGGGAKKIVEAGVLENVSAIFGLHVTNQLALGQVSSREGPML  212

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AG G FKA I GKGGHAA+PQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +G
Sbjct  213   AGSGFFKAKISGKGGHAALPQHTIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFEG  272

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G +FNVIPD+ TI GT+RAF+  SF  LKKRIE+++  QA+V+ C   +DF   E P FP
Sbjct  273   GGAFNVIPDSVTIGGTFRAFSTKSFMQLKKRIEQVITRQASVNMCNATVDFIEEEKPFFP  332

Query  634   PTLAPTINDVRIYEHARKSSSLIVG-EDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKN  458
                 PT+ND  +++  +  S  ++G E+ VE+ P  MGSEDF  Y   +PG F F+G++N
Sbjct  333   ----PTVNDKALHQFFKNVSGDMLGIENYVEMQP-LMGSEDFSFYQQAIPGHFSFVGMQN  387

Query  457   EKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             +  + +  PHSPYF ++E++LP GA++HA+ A  YLL
Sbjct  388   KARSPMASPHSPYFEVNEELLPYGASLHASMATRYLL  424



>emb|CDY22869.1| BnaA06g02080D [Brassica napus]
Length=442

 Score =   464 bits (1193),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 220/396 (56%), Positives = 292/396 (74%), Gaps = 6/396 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + + LA   +  EWM  +RR IH NPEL YEE  TS +VR EL+++GV Y++PVA TGVV
Sbjct  38    KFLALAKRNDFFEWMVGIRRRIHENPELGYEEVDTSKLVRTELEKMGVSYKYPVAVTGVV  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               +G+G  PFVALRADMDALP+QE+VEWEHKS+V GKMHACGHDAHT MLLGAAK+L++ 
Sbjct  98    GYVGTGQAPFVALRADMDALPMQEMVEWEHKSKVPGKMHACGHDAHTTMLLGAAKLLKEH  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             + +L+GTV+L+FQPAEE G GAK +++ GVL +V AIFGLHV ++  +G+V+SR G  LA
Sbjct  158   QDELQGTVILVFQPAEEGGGGAKKIVEAGVLKDVSAIFGLHVTNQLGLGLVSSREGPLLA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I GKGGHAA+PQ ++DPILAAS  +++LQ +VSRE DP DSQVV+V+  +GG
Sbjct  218   GSGFFEAKISGKGGHAALPQHAIDPILAASNIIVTLQHLVSREADPLDSQVVTVAKFEGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+  SF  LKKRIE+++  QA+VH C   +DF   E P FP 
Sbjct  278   GAFNVIPDSVTIGGTFRAFSTKSFTQLKKRIEQVITRQASVHMCNATVDFLQEEKPFFP-  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDN-VELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                PT+ND  ++   +  S  ++G +N  E+ P  MG+EDF  Y   +PG F F+G++NE
Sbjct  337   ---PTVNDKALHMFFKNVSGDMLGTENYFEMQP-LMGAEDFSFYQVSMPGHFSFVGMQNE  392

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
               + +  PHSPYF ++E+VLP GAA+HA+ A  YLL
Sbjct  393   AHSPMASPHSPYFEVNEEVLPYGAALHASMATRYLL  428



>ref|XP_010246176.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Nelumbo nucifera]
Length=430

 Score =   463 bits (1191),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 222/407 (55%), Positives = 291/407 (71%), Gaps = 4/407 (1%)
 Frame = -1

Query  1546  GGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVA  1367
             G L   ++  A E +  +W+RRVRR IH+NPEL+++E+ TS ++R ELD LG+ Y WPVA
Sbjct  28    GLLTQELLESAREPQFFDWLRRVRRAIHQNPELSFQEYETSELIRSELDSLGIGYSWPVA  87

Query  1366  KTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAK  1187
             KTGV+ ++GSG  P+ +LRADMDALPIQELV+WE KS+ +GKMHACGHDAH  MLLGAAK
Sbjct  88    KTGVIGSVGSGRQPWFSLRADMDALPIQELVDWEFKSKNNGKMHACGHDAHVTMLLGAAK  147

Query  1186  ILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRP  1007
             +LQQ R +LKGTV L+FQPAEE   GA  +++ GVL+   AIFGLHV+     GV+ASRP
Sbjct  148   LLQQRRDELKGTVKLVFQPAEEGQSGAYHILKEGVLEKNQAIFGLHVSPYLHTGVIASRP  207

Query  1006  GEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVS  827
             G  LAG G F A I+GKGGHAA P + +DPI+AAS+ +++LQ I+SRETDP DS+V+SV 
Sbjct  208   GGLLAGSGRFLAIIQGKGGHAASPHKIIDPIIAASSVILALQQIISRETDPLDSRVISVG  267

Query  826   MIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTEN  647
              I GG + NVIP++    GT+R+   ++   L+KRI EI+  QAAVHRCT  +DF   ++
Sbjct  268   FIDGGQAENVIPESVKFGGTFRSLTSEAHSHLRKRIGEIIETQAAVHRCTAIVDFMEEKS  327

Query  646   PTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIG  467
               +P     T+ND  +YEH ++    ++G+ NV+L    MG+EDF  Y  K+P AFF IG
Sbjct  328   IPYP----ATVNDEAMYEHVKRVGESLLGQPNVQLESLTMGAEDFSFYSQKMPAAFFSIG  383

Query  466   VKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPH  326
             +KNE   +  P HSPYF LDE+VLP+GAA+HAA A TYL SH    H
Sbjct  384   IKNETLKSDQPLHSPYFYLDEEVLPIGAALHAAVAITYLDSHVADTH  430



>ref|NP_001142151.1| hypothetical protein precursor [Zea mays]
 gb|ACF78304.1| unknown [Zea mays]
 gb|ACF87764.1| unknown [Zea mays]
 gb|ACF87830.1| unknown [Zea mays]
 gb|ACN26345.1| unknown [Zea mays]
 tpg|DAA58585.1| TPA: hypothetical protein ZEAMMB73_870331 [Zea mays]
Length=450

 Score =   464 bits (1193),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 230/400 (58%), Positives = 288/400 (72%), Gaps = 5/400 (1%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
             ++ LA E    +WM  VRR IH NPEL YEEF TS +VRREL  +G+ YR P A TGVVA
Sbjct  41    LLRLAKEPAFADWMVGVRRRIHENPELGYEEFQTSELVRRELHAMGIPYRHPFAVTGVVA  100

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
             T+G+G PPFVALRADMDALP+QE VEWEHKS+V GKMH CGHDAH AMLLG+AKILQ+ R
Sbjct  101   TVGTGGPPFVALRADMDALPLQESVEWEHKSKVPGKMHGCGHDAHVAMLLGSAKILQEHR  160

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
              +LKGTV+L+FQPAEE G GAK MI++  ++N+DAIFGLH+A   P+GV+ASRPG  +AG
Sbjct  161   DELKGTVVLVFQPAEEGGGGAKKMIEDRAVENIDAIFGLHIADSVPIGVLASRPGPIMAG  220

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
              G F+A I GKGGHAA+P  ++DPILAAS  ++SLQ +VSRE DP DSQVV+V   QGG 
Sbjct  221   SGFFEAVISGKGGHAALPHHTIDPILAASNVIVSLQQLVSREADPLDSQVVTVGKFQGGG  280

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
             +FNVIPD+ TI GT+RAF K+SF  LK+RIEE++ +QA+V RC+  +DF   + P FP  
Sbjct  281   AFNVIPDSVTIGGTFRAFLKESFNQLKQRIEEVIVSQASVQRCSAAVDFLSKDRPFFP--  338

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIGVKNEK  452
               PTIN   +++     +  +VG  NV      MG+EDF  Y + VP   ++F+G+ NE 
Sbjct  339   --PTINSPELHDFFVNVAGEMVGSRNVRDRQPLMGAEDFAFYAEAVPSTYYYFVGMYNET  396

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKP  332
                  P HSPYFT++ED LP GAA  AA A  YLL   +P
Sbjct  397   RGPQAPHHSPYFTINEDALPYGAAGQAALAARYLLERQQP  436



>ref|XP_007202052.1| hypothetical protein PRUPE_ppa005751mg [Prunus persica]
 gb|EMJ03251.1| hypothetical protein PRUPE_ppa005751mg [Prunus persica]
Length=445

 Score =   463 bits (1191),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 218/397 (55%), Positives = 287/397 (72%), Gaps = 4/397 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + +  A   E  ++M  VRR+IH NPEL +EEF TS ++R ELD++G+ Y++P+A+TG+V
Sbjct  38    KFLDHAKRQELFDFMVGVRRKIHENPELGFEEFETSKLIRAELDQMGIPYKYPLAETGIV  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVA+RADMDAL +QE VEWEHKS+V GKMHACGHDAH AMLLGAAKILQ+ 
Sbjct  98    GFIGTGGPPFVAIRADMDALAMQESVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILQEH  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
               +L+GTV+L+FQPAEE G GAK M+  G L++V AIFGLHVA  YP+G V +R G F A
Sbjct  158   HHELQGTVVLVFQPAEEGGGGAKKMLDEGALEHVGAIFGLHVAADYPIGSVVTRCGPFFA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
               G F+A I GKGGHAAIPQ ++DPILAAS  ++SLQ +VSRE DP +SQVV+V   QGG
Sbjct  218   ASGFFEAVISGKGGHAAIPQHTIDPILAASNVIVSLQHLVSREADPLESQVVTVGKFQGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+K+SF  LK+RIEE++  QA+V RC   + F+  + P +P 
Sbjct  278   GAFNVIPDSVTIGGTFRAFSKESFIQLKQRIEEVITRQASVQRCNATVLFNERDKPFYP-  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                  +ND  ++EH R  +  ++G  N+      MG+EDF  Y + +PG FFF+G+KNE 
Sbjct  337   ---VAVNDKNLHEHFRNVAGDLLGPQNILERQPMMGAEDFSFYQEAIPGYFFFVGMKNES  393

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                    HSP+F ++EDVLP GAA+HA+ A  YLL +
Sbjct  394   QGKFESGHSPFFRVNEDVLPYGAALHASLATRYLLEN  430



>ref|XP_008378480.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Malus domestica]
Length=494

 Score =   464 bits (1194),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 217/395 (55%), Positives = 284/395 (72%), Gaps = 4/395 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + ++  A   E +EW++ VRR IH +PELA+EEF TS +VR ELDRL + YR+P+AKTG+
Sbjct  94    EAVLSFAKLPENMEWLKTVRRRIHEHPELAFEEFETSRLVRDELDRLDIGYRFPLAKTGI  153

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IG+G PPFVA+RADMDALPIQE VEWEHKS+V GKMHACGHDAH AML+GAAKIL+ 
Sbjct  154   RAWIGTGGPPFVAVRADMDALPIQEAVEWEHKSKVAGKMHACGHDAHVAMLIGAAKILKS  213

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+L+FQPAEE G GAK MI +G L++V+AIF  HV+H++P GV+ SR G  L
Sbjct  214   REHLLKGTVILLFQPAEEAGNGAKRMIGDGALEDVEAIFAAHVSHEHPTGVIGSRAGPLL  273

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I G  G A  P  S DP+LAA+ +VISLQ IVSRE++P DSQVVSV+   G
Sbjct  274   AGCGFFRAVISGTTGQAESPPISTDPVLAAAAAVISLQGIVSRESNPLDSQVVSVTAFNG  333

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G    +IP+T  + GT+RAF+  SFY + +RIEE++  QA+V+RC+  +DF   +N  +P
Sbjct  334   GDDLGMIPNTVVLGGTFRAFSNTSFYRILQRIEEVIVEQASVYRCSATVDFFKNQNTIYP  393

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND +++EH  K +  ++G  N  + P  MG+EDF  Y + +P  FF+IG++NE
Sbjct  394   ----PTVNDEKMHEHVTKVAVDLLGPTNFRVVPPMMGAEDFSFYSEVIPAGFFYIGIRNE  449

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
                +    HSPYF +DEDVLP+GAA HA  A  YL
Sbjct  450   TLGSTHTGHSPYFFIDEDVLPIGAATHATIAERYL  484



>ref|XP_009147731.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Brassica rapa]
Length=442

 Score =   462 bits (1188),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 220/396 (56%), Positives = 290/396 (73%), Gaps = 6/396 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + + LA   +  EWM  +RR IH NPEL YEE  TS +VR EL+++GV Y++PVA TGVV
Sbjct  38    KFLALAKRNDFFEWMVGIRRRIHENPELGYEEVDTSKLVRTELEKMGVSYKYPVAVTGVV  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
                G+G  PFVALRADMDALP+QE+VEWEHKS+V GKMHACGHDAHT MLLGAAK+L++ 
Sbjct  98    GYFGTGQAPFVALRADMDALPMQEMVEWEHKSKVPGKMHACGHDAHTTMLLGAAKLLKEH  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             + +L+GTV+L+FQPAEE G GAK +++ GVL +V AIFGLHV ++  +G+V+SR G  LA
Sbjct  158   QDELQGTVILVFQPAEEGGGGAKKIVEAGVLKDVSAIFGLHVTNQLGLGLVSSREGPLLA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I GKGGHAA+PQ ++DPILAAS  +++LQ +VSRE DP DSQVV+V+  +GG
Sbjct  218   GSGFFEAKISGKGGHAALPQHAIDPILAASNIIVTLQHLVSREADPLDSQVVTVAKFEGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+  SF  LKKRIE+++  QA+VH C   +DF   E P FP 
Sbjct  278   GAFNVIPDSVTIGGTFRAFSTKSFTQLKKRIEQVITRQASVHMCNATVDFLQEEKPFFP-  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDN-VELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                PT+ND  ++   +  S  ++G  N  E+ P  MG+EDF  Y   +PG F F+G++NE
Sbjct  337   ---PTVNDKALHMFFKNVSGDMLGTKNYFEMQP-LMGAEDFSFYQVSMPGHFSFVGMQNE  392

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
               + +  PHSPYF ++E+VLP GAA+HA+ A  YLL
Sbjct  393   AHSPMASPHSPYFEVNEEVLPYGAALHASMATRYLL  428



>ref|XP_004287508.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Fragaria 
vesca subsp. vesca]
Length=473

 Score =   462 bits (1190),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 227/400 (57%), Positives = 289/400 (72%), Gaps = 4/400 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A   E  + M  +RR+IH NPEL YEEF TS ++R ELDRLG+ YR+P+A+TGVV  +G+
Sbjct  61    AKRPELFDRMVSIRRKIHENPELCYEEFETSKLIRAELDRLGIPYRYPLAETGVVGVVGT  120

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G PPFVA+RADMDAL +QE VEWEHKS+  GKMH CGHD H AMLLGAA +LQ+ R  L+
Sbjct  121   GGPPFVAIRADMDALAMQESVEWEHKSKFAGKMHGCGHDGHVAMLLGAASLLQEYRHVLQ  180

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV+L+FQPAEE G GAK MI+NG L++V AIFGLH+A  +P+G VASRPG  LA  G F
Sbjct  181   GTVVLVFQPAEEGGAGAKKMIENGALEHVSAIFGLHLASDHPIGSVASRPGPLLAASGFF  240

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGHAAIPQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+V   QGG +FNV
Sbjct  241   EALISGKGGHAAIPQHTIDPILAASNVIVSLQHLVSREADPLDSQVVTVGKFQGGGAFNV  300

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+RAF+KDSF+ LK+RIEE++  QA+V RC   + F+    P +P     T
Sbjct  301   IPDSVTIGGTFRAFSKDSFFQLKERIEEVITRQASVQRCNATVLFNEIAKPFYP----AT  356

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVF  437
             IND  ++EH +K +  ++G  NV      MG+EDF  Y + +PG +FF+G+KN+      
Sbjct  357   INDKNLHEHFQKVAGDLLGSQNVLEKKPLMGAEDFSFYQEVIPGYYFFLGMKNDSQGQFK  416

Query  436   PPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHSSS  317
             P HSPYF ++EDVLP GAA HA+ A  YLL +     S+S
Sbjct  417   PMHSPYFRINEDVLPYGAAFHASLATRYLLENQPKSTSTS  456



>ref|XP_011043650.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Populus euphratica]
Length=430

 Score =   461 bits (1185),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 220/401 (55%), Positives = 287/401 (72%), Gaps = 4/401 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L   ++  A E E  EW++R+RR IH +PELA+EE+ TS ++R ELD LG++Y+WP AKT
Sbjct  30    LTRELLQSAREPEFFEWLKRIRRRIHEDPELAFEEYNTSQLIRSELDSLGIEYKWPFAKT  89

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVV +IGSG  P+  LRADMDALPIQE+VEWEHKS+ +GKMHACGHDAH  MLLGAAK+L
Sbjct  90    GVVGSIGSGLQPWFGLRADMDALPIQEMVEWEHKSKNNGKMHACGHDAHVTMLLGAAKLL  149

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             ++++ +LKGTV L+FQP EE   GA  M++ G LDN   IFGLHVA + PVG V SRPG 
Sbjct  150   ERMKDELKGTVKLVFQPGEESYGGAYHMLKEGALDNFQGIFGLHVAPEIPVGTVDSRPGP  209

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LA  G F ATIKGKGGHAA PQ++ DP++AAS ++++LQ IVSRETDP D++VVSV  +
Sbjct  210   MLAASGRFIATIKGKGGHAARPQDTRDPVVAASFAILALQQIVSRETDPLDARVVSVGFV  269

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             + G + NVIP+T    G+ R+   +   SL++R+ +IV  QAAVH+CT  +DF   +   
Sbjct  270   EAGQAGNVIPETVRFGGSIRSLTTEGLVSLQQRVMQIVEMQAAVHQCTGSLDFLEEKMRP  329

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             +P     T+ND  +Y+HA++    ++GE NV LAP  MG+EDF  Y  K+  AFFFIG K
Sbjct  330   YP----STVNDEAMYKHAKQVGEALLGESNVLLAPMTMGAEDFSFYSQKMKAAFFFIGTK  385

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             NE   +V   HSPYF +DE+VL +GAA HAA A +YL  HA
Sbjct  386   NETVKSVKRVHSPYFVIDEEVLSIGAAFHAAVAISYLDGHA  426



>gb|KDO55917.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
Length=443

 Score =   461 bits (1186),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 214/397 (54%), Positives = 291/397 (73%), Gaps = 6/397 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + +  A + E   WM  +RR+IH NPEL ++EF TS ++R ELD++G+ Y++PVA TGVV
Sbjct  38    KFLDFAKKPEIFYWMVNIRRKIHENPELGFQEFETSKLIRAELDQMGIPYKFPVAVTGVV  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDAL ++E VEWEHKS+V GKMHACGHDAH AMLLGAAK+LQ  
Sbjct  98    GYIGTGQPPFVALRADMDALAMEESVEWEHKSKVPGKMHACGHDAHVAMLLGAAKMLQVF  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             R ++KGT++L+FQPAEE G GAK M+  G L+NV+AIFGLHV+  +PVG VASRPG  LA
Sbjct  158   RHEIKGTIVLVFQPAEEGGGGAKKMLDAGALENVEAIFGLHVSSLFPVGTVASRPGPTLA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
               G F+A I GKGGHAAIPQ ++DPI+AAS  ++SLQ +VSRE DP DSQV++V+  +GG
Sbjct  218   AGGFFEAVINGKGGHAAIPQHTIDPIVAASNVIVSLQHLVSREADPLDSQVLTVAKFEGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FN+IPD+ TI GT+RAF+K+S   LK+RIEE+V  QA+V RC   + FD   + +F P
Sbjct  278   GAFNIIPDSVTIGGTFRAFSKESIIQLKQRIEEVVMKQASVQRCNATVTFD---DKSFYP  334

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                 T+N+  ++EH +K ++ ++G  N++     MG+EDF  + + +PG F+++G+ +E 
Sbjct  335   V---TVNNKNLHEHFQKVAADMLGVQNIKENRPLMGTEDFSFFAEAIPGYFYYLGMNDET  391

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                    HSPYF ++ED LP GAA+HA+ A  YLL +
Sbjct  392   KGKFETGHSPYFRVNEDALPYGAALHASLATRYLLEN  428



>ref|XP_006392998.1| hypothetical protein EUTSA_v10011481mg [Eutrema salsugineum]
 gb|ESQ30284.1| hypothetical protein EUTSA_v10011481mg [Eutrema salsugineum]
Length=444

 Score =   461 bits (1185),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 216/396 (55%), Positives = 294/396 (74%), Gaps = 6/396 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + + LA   +  +WM  +RR+IH NPEL YEE  TS +VR EL+++GV Y++PVA TGV+
Sbjct  38    KFLALAKRADFFDWMVGIRRKIHENPELGYEEVETSKLVRTELEKMGVSYKYPVAVTGVI  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G  PFVALRADMDAL +QE+VEWEHKS++ GKMHACGHDAHT MLLGAA++L++ 
Sbjct  98    GYIGTGQAPFVALRADMDALSMQEMVEWEHKSKIPGKMHACGHDAHTTMLLGAARLLKEH  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             + +L+GTV+L+FQPAEE G GAK +++ GVL+NV AIFGLHV ++  +G V+SR G  LA
Sbjct  158   QDELQGTVILVFQPAEEGGGGAKKIVEAGVLENVSAIFGLHVTNQLALGQVSSREGPLLA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I GKGGHAA+PQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +GG
Sbjct  218   GSGFFEAKISGKGGHAALPQHAIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFEGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+  SF  L+KRIE+++  QA+VH C   +DF     P FP 
Sbjct  278   GAFNVIPDSVTIGGTFRAFSTKSFKQLQKRIEQVITRQASVHMCNATVDFLQEVKPFFP-  336

Query  631   TLAPTINDVRIYEHARKSSSLIVG-EDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                PT+ND  +++  +  S  ++G E+ VE+ P  MGSEDF  Y + +PG F F+G++NE
Sbjct  337   ---PTVNDKGLHQFFKNVSGDMLGIENYVEMQP-LMGSEDFSFYQESMPGHFSFVGMQNE  392

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
               + +  PHSPYF ++E++LP GA++HA+ A  YLL
Sbjct  393   AHSPMASPHSPYFEVNEELLPYGASLHASMATRYLL  428



>ref|XP_008243485.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Prunus mume]
Length=437

 Score =   460 bits (1184),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 216/397 (54%), Positives = 284/397 (72%), Gaps = 4/397 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L   ++  A + E  +W++RVRR IH NPELA+EE  TS ++R ELD LG++Y WPVAKT
Sbjct  36    LNRGLLDSARQPEFFDWLKRVRRRIHENPELAFEEHETSQLIRSELDSLGIQYTWPVAKT  95

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             G+VA+IGSGS P+ ALRADMDALPIQELVEWEHKS+  GKMHACGHDAH  MLLGAAK+L
Sbjct  96    GLVASIGSGSQPWFALRADMDALPIQELVEWEHKSKNSGKMHACGHDAHVTMLLGAAKLL  155

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q   +++KGT+ L+FQPAEE   GA  MI+ G LDN+  IFGLH+    PVG + SRPG 
Sbjct  156   QSKSKEIKGTIKLVFQPAEEGHGGAYHMIKEGALDNIQGIFGLHIQPLMPVGTIGSRPGP  215

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LAG G F  TI GKGGHAA P  + DPILAA ++VI+LQ ++SRETDP +++VV+V M+
Sbjct  216   ILAGSGRFSVTIHGKGGHAAFPHLATDPILAACSAVIALQQLISRETDPLEARVVTVGMV  275

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             +GG + NVIP+T  + GT+R+ + +  Y L++RI+E++  QA+VHRC   +DF   +   
Sbjct  276   EGGQAGNVIPETVRLGGTFRSMSSEGLYYLQQRIQEVIEMQASVHRCMATVDFMLEKMRP  335

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             +P     T+ND  +Y+HA+     ++GE NV+L P  MG+EDF  Y +K+  AFF IG K
Sbjct  336   YP----ATVNDEAMYKHAKNVGETLLGEPNVKLLPMSMGAEDFSFYTEKMAAAFFMIGTK  391

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             NE        HSPY  +DE+VLP+GAA+HAA A +YL
Sbjct  392   NETLDPKRLWHSPYLVIDEEVLPIGAALHAAVAISYL  428



>ref|XP_003597644.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
 gb|ABF55220.1| auxin conjugate hydrolase [Medicago truncatula]
 gb|AES67895.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=447

 Score =   461 bits (1185),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 221/395 (56%), Positives = 284/395 (72%), Gaps = 4/395 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               + LA E +  +WM  +RR+IH NPEL+Y+EF TS ++R +LD LGV+Y+ PVA TGV+
Sbjct  40    NFLDLAKEPKVFDWMVSIRRKIHENPELSYQEFETSKLIRTKLDELGVQYKHPVAVTGVI  99

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDAL IQE+VEWEHKS+V GKMHACGHDAH AMLLGAAKIL+  
Sbjct  100   GYIGTGLPPFVALRADMDALLIQEMVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILKDR  159

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
              + L GT++L+FQPAEE G GAK ++  G L+ V AIFGLHV +  P+G VASR G   A
Sbjct  160   EKHLHGTIVLVFQPAEEGGGGAKKILDAGALEKVSAIFGLHVLNNLPLGEVASRSGPIFA  219

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G FKA I G+GGHAAIPQ S+DPILA S  ++SLQ IVSRE DP DSQV++V+MIQGG
Sbjct  220   GNGFFKAVISGRGGHAAIPQHSIDPILATSNVIVSLQQIVSREIDPLDSQVLTVAMIQGG  279

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+ +SF  L+ RIE+I+  QAAV RC   + F   E P FP 
Sbjct  280   GAFNVIPDSVTIGGTFRAFSNESFTQLRHRIEQIITGQAAVQRCHATVSFLEEEKPFFP-  338

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PT+ND  ++++ +  +  ++G D V+     MGSEDF  Y + +PG  F +G+++  
Sbjct  339   ---PTVNDGGLHDYFQSVAGSLLGADKVKGMQPMMGSEDFAFYQEAIPGYIFLLGMEDVS  395

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
                +   HSPYF ++EDVLP GAA+HA+ A  YLL
Sbjct  396   VERLPSGHSPYFKVNEDVLPYGAALHASLASRYLL  430



>emb|CDX87841.1| BnaC06g09030D [Brassica napus]
Length=444

 Score =   460 bits (1183),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 218/396 (55%), Positives = 291/396 (73%), Gaps = 6/396 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + + LA   +  +WM  +RR+IH NPEL YEE  TS +VR EL+++GV Y++PVA TGV+
Sbjct  38    KFLALAKRDDFFDWMIGIRRKIHENPELGYEEVETSRLVRTELEKMGVSYKYPVAVTGVI  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               +G+G  PFVALRADMDAL +QE+VEWEHKS+V GKMHACGHDAHT MLLGAAK+L++ 
Sbjct  98    GYVGTGQAPFVALRADMDALAMQEMVEWEHKSKVPGKMHACGHDAHTTMLLGAAKLLKEH  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             + +L+GTV+L+FQPAEE G GAK +++ GVL +V AIFGLHV ++  +G V+SR G  LA
Sbjct  158   QDELQGTVILVFQPAEEGGGGAKKIVEAGVLKDVSAIFGLHVTNQLSLGQVSSREGPLLA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I GKGGHAA+PQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +GG
Sbjct  218   GSGFFEAKISGKGGHAALPQHAIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFEGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+  SF  LKKRIE+++  QA+VH C   +DF   E P FP 
Sbjct  278   GAFNVIPDSVTIGGTFRAFSTKSFTQLKKRIEQVITRQASVHMCNATVDFLEEEKPFFP-  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDN-VELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                PT+ND  ++   +  S  ++G  N VE+ P  MGSEDF  Y   +PG F F+G++NE
Sbjct  337   ---PTVNDKDLHMFFKNVSGDMLGTQNYVEMQP-LMGSEDFSFYQQAMPGHFSFVGMQNE  392

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
               + +  PHSPYF ++E++LP GA++HA+ A  YLL
Sbjct  393   AHSPMASPHSPYFEVNEELLPYGASLHASMATRYLL  428



>ref|XP_009338136.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Pyrus x bretschneideri]
Length=473

 Score =   461 bits (1185),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 220/395 (56%), Positives = 281/395 (71%), Gaps = 4/395 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             +++  A   +  +WM  +RR+IH NPEL YEEF TS ++R ELD++G+KY+ P+  TGVV
Sbjct  66    KLLNRAQRPQVFDWMVGIRRKIHENPELGYEEFETSELIRAELDKMGIKYKHPIGVTGVV  125

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+  PPFVA+RADMDAL +QE+VEWEHKS+  GKMHACGHDAH AMLLGAAKIL+  
Sbjct  126   GFIGTRKPPFVAIRADMDALAMQEMVEWEHKSKNAGKMHACGHDAHVAMLLGAAKILKDH  185

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
              + L+GTV+L+FQPAEE G GAK MI  G L+NV AIFGLHVA+  PV  VASRPG F A
Sbjct  186   EKDLQGTVVLVFQPAEEGGAGAKKMIAGGALENVSAIFGLHVANHIPVAEVASRPGPFFA  245

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+ATI GKGGHAA+P  +VDPILAAS  ++SLQ +VSRE DP DSQVV+V   QGG
Sbjct  246   GSGFFEATISGKGGHAALPHHAVDPILAASNVIVSLQHLVSREADPLDSQVVTVGKFQGG  305

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+  I GT+RAF   S   LK+RI++++  QA+VHRC   ++F   E P  P 
Sbjct  306   DAFNVIPDSVKIGGTFRAFTMKSLMQLKQRIKQVITGQASVHRCIATVNFFEDEKPISP-  364

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PTIN   ++EH R  +  ++G   V+     MGSEDF  Y + +PG FF +G+ ++ 
Sbjct  365   ---PTINHNDLHEHFRNVAGDMLGFQKVKDHQPLMGSEDFAYYQEAIPGYFFLLGMADDA  421

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
                +  PHSP+F ++ED LP GAA+HAAFA  YLL
Sbjct  422   LGPLPTPHSPHFRINEDALPFGAALHAAFAVRYLL  456



>ref|XP_007204388.1| hypothetical protein PRUPE_ppa005836mg [Prunus persica]
 gb|EMJ05587.1| hypothetical protein PRUPE_ppa005836mg [Prunus persica]
Length=441

 Score =   459 bits (1182),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 216/397 (54%), Positives = 284/397 (72%), Gaps = 4/397 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L   ++  A + E  +W++RVRR IH NPELA+EE  TS ++R ELD LG++Y WPVAKT
Sbjct  36    LNRGLLDSARQPEFFDWLKRVRRRIHENPELAFEEHETSQLIRSELDSLGIQYTWPVAKT  95

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             G+VA+IGSGS P+ ALRADMDALPIQELVEWEHKS+  GKMHACGHDAH  MLLGAAK+L
Sbjct  96    GLVASIGSGSQPWFALRADMDALPIQELVEWEHKSKNPGKMHACGHDAHVTMLLGAAKLL  155

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q   +++KGT+ L+FQPAEE   GA  MI+ G LDN+  IFGLH+    PVG + SRPG 
Sbjct  156   QSKSKEIKGTIKLVFQPAEEGHGGAYHMIKEGALDNIQGIFGLHIQPLMPVGTIGSRPGP  215

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LAG G F  TI GKGGHAA P  + DPILAA ++VI+LQ ++SRETDP +++VV+V M+
Sbjct  216   ILAGSGRFTVTIHGKGGHAAFPHLATDPILAACSAVIALQQLISRETDPLEARVVTVGMV  275

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             +GG + NVIP+T  + GT+R+ + +  Y L++RI+E++  QA+VHRC   +DF   +   
Sbjct  276   EGGQAGNVIPETVRLGGTFRSMSSEGLYYLQQRIQEVIEMQASVHRCMATVDFMLEKMRP  335

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             +P     T+ND  +Y+HA+     ++GE NV+L P  MG+EDF  Y +K+  AFF IG K
Sbjct  336   YP----ATVNDEAMYKHAKNVGETLLGEPNVKLLPMSMGAEDFSFYTEKMAAAFFMIGTK  391

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             NE        HSPY  +DE+VLP+GAA+HAA A +YL
Sbjct  392   NETLDPKRLWHSPYLVIDEEVLPIGAALHAAVAISYL  428



>ref|XP_002322806.1| hypothetical protein POPTR_0016s07500g [Populus trichocarpa]
 gb|EEF04567.1| hypothetical protein POPTR_0016s07500g [Populus trichocarpa]
Length=478

 Score =   461 bits (1185),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 220/403 (55%), Positives = 287/403 (71%), Gaps = 4/403 (1%)
 Frame = -1

Query  1546  GGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVA  1367
             G L   ++  A E E   W++R+RR IH +PELA+EE+ TS ++R ELD LG++Y+WP A
Sbjct  76    GYLTRELLESAREPEFFGWLKRIRRRIHEDPELAFEEYNTSQLIRSELDSLGIEYKWPFA  135

Query  1366  KTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAK  1187
             KTGVV +IGSG  P+  LRADMDALPIQE+VEWEHKS+ +GKMHACGHDAH  MLLGAAK
Sbjct  136   KTGVVGSIGSGLQPWFGLRADMDALPIQEMVEWEHKSKNNGKMHACGHDAHVTMLLGAAK  195

Query  1186  ILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRP  1007
             +L++++ +LKGTV L+FQP EE   GA  M++ G LDN   IFGLHVA + PVG V SRP
Sbjct  196   LLERMKDELKGTVKLVFQPGEESYGGAYHMLKEGALDNFQGIFGLHVAPEIPVGTVDSRP  255

Query  1006  GEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVS  827
             G  LA  G F ATIKGKGGHAA PQ++ DP++AAS ++++LQ IVSRETDP D++VVSV 
Sbjct  256   GPMLAASGRFIATIKGKGGHAARPQDTRDPVVAASFAILALQQIVSRETDPLDARVVSVG  315

Query  826   MIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTEN  647
              ++ G + NVIP+T    G+ R+   +   SL++R+ +IV  QAAVH+CT  +DF   + 
Sbjct  316   FVEAGQAGNVIPETVRFGGSIRSMTTEGLVSLQQRVMQIVEMQAAVHQCTASLDFMEEKM  375

Query  646   PTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIG  467
               +P     T+ND  +Y+HA++    ++GE NV LAP  MG+EDF  Y  K+  AFFFIG
Sbjct  376   RPYP----STVNDEAMYKHAKQVGEALLGESNVLLAPMTMGAEDFSFYSQKMKAAFFFIG  431

Query  466   VKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
              KNE   +V   HSPYF +DE+VL +GAA HAA A +YL  HA
Sbjct  432   TKNETVKSVKRLHSPYFVIDEEVLSIGAAFHAAVAISYLDGHA  474



>gb|ACZ56437.1| IAA-amino acid hydrolase [Populus tomentosa]
Length=430

 Score =   458 bits (1179),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 221/401 (55%), Positives = 285/401 (71%), Gaps = 4/401 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L   ++  A E E  EW++R+RR IH +PELA+EE  TS ++R ELD LG++Y+WP AKT
Sbjct  30    LTRELLESAREPEFFEWLKRIRRRIHEDPELAFEEHNTSQLIRSELDSLGIEYKWPFAKT  89

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVV +IGSG  P+  LRADMDALPIQE+VEWEHKS+ +GKMHACGHDAH  MLLGAAK+L
Sbjct  90    GVVGSIGSGLQPWFGLRADMDALPIQEMVEWEHKSKNNGKMHACGHDAHVTMLLGAAKLL  149

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             ++++ +LKGTV L+FQP EE   GA  MI+ G LDN   IFGLHVA + PVG V SRPG 
Sbjct  150   ERMKDELKGTVKLVFQPGEESYGGAYHMIKEGALDNFQGIFGLHVAPEIPVGTVDSRPGP  209

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LA  G F ATIKGKGGHAA PQ++ DP++AAS ++++LQ IVSRETDP  ++VVSV  +
Sbjct  210   MLAASGRFIATIKGKGGHAARPQDTRDPVVAASFAILALQQIVSRETDPLYARVVSVGFV  269

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             + G + NVIP+T    G+ R+   +   SL++R+ +IV  QAAVH+CT  +DF   +   
Sbjct  270   EAGQAGNVIPETVRFGGSVRSITTEGLVSLQQRVMQIVEMQAAVHQCTASLDFMEEKMRP  329

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             +P     T+ND  +Y+HA++    ++GE NV LAP  MG+EDF  Y  K+  AFFFIG K
Sbjct  330   YP----STVNDEAMYKHAKQVGEALLGESNVLLAPMTMGAEDFSFYSQKMKAAFFFIGTK  385

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             NE   TV   HSPYF +DE+VL +GAA HAA A +YL  HA
Sbjct  386   NETVKTVKRLHSPYFVIDEEVLSIGAAFHAAVAISYLDRHA  426



>ref|XP_006451368.1| hypothetical protein CICLE_v100084061mg, partial [Citrus clementina]
 gb|ESR64608.1| hypothetical protein CICLE_v100084061mg, partial [Citrus clementina]
Length=421

 Score =   458 bits (1178),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 213/397 (54%), Positives = 289/397 (73%), Gaps = 6/397 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + +  A + E   WM  +RR+IH NPEL ++EF TS ++R ELD++G+ Y++PVA TGVV
Sbjct  16    KFLDFAKKPEIFYWMVNIRRKIHENPELGFQEFETSKLIRAELDQMGIPYKFPVAVTGVV  75

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDAL ++E VEWEHKS+V GKMHACGHDAH AMLLGAAK+LQ  
Sbjct  76    GYIGTGQPPFVALRADMDALAMEESVEWEHKSKVPGKMHACGHDAHVAMLLGAAKMLQVF  135

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             R ++KGT++L+FQPAEE G GAK M+  G L+NV+AIFGLHV+  +PVG VASRPG  LA
Sbjct  136   RHEIKGTIVLVFQPAEEGGGGAKKMLDAGALENVEAIFGLHVSSLFPVGTVASRPGPTLA  195

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
               G F+A I GKGGHAAIPQ ++DPI+AAS  ++SLQ +VSRE DP DSQV++V+  +GG
Sbjct  196   AGGFFEAVINGKGGHAAIPQHTIDPIVAASNVIVSLQHLVSREADPLDSQVLTVAKFEGG  255

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FN+IPD+ TI GT+RAF+K+S   LK+RIEE+V  QA+V RC   + FD   + +F P
Sbjct  256   GAFNIIPDSVTIGGTFRAFSKESIIQLKQRIEEVVMKQASVQRCNATVTFD---DKSFYP  312

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                 T+N+  ++EH +K +  ++G  N++     MG+EDF  + + +PG F+++G+ +E 
Sbjct  313   V---TVNNKNLHEHFQKVAGDMLGIQNIKENRPLMGTEDFSFFAEAIPGYFYYLGMNDET  369

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                    HSPYF ++ED LP GA +HA+ A  YLL +
Sbjct  370   KGKFETGHSPYFRVNEDALPYGAVLHASLATRYLLEN  406



>gb|KFK27232.1| hypothetical protein AALP_AA8G354700 [Arabis alpina]
Length=438

 Score =   458 bits (1179),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 218/408 (53%), Positives = 291/408 (71%), Gaps = 7/408 (2%)
 Frame = -1

Query  1573  SSKLPLAVDGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRL  1394
             SS+ PL   G +K+  +  A   E  +WM R+RR++H NPEL +EEF TS ++R ELD L
Sbjct  20    SSESPLTTGGDVKNNFLESAKNPEVFDWMVRIRRKLHENPELGFEEFETSKLIRSELDLL  79

Query  1393  GVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAH  1214
             GVKYR+PVA TGV+  IG+G PPFVALRADMDAL IQE VEWEHKS++ GKMHACGHD H
Sbjct  80    GVKYRYPVAITGVIGYIGTGEPPFVALRADMDALLIQEAVEWEHKSKIPGKMHACGHDGH  139

Query  1213  TAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKY  1034
               MLLGAAK+LQ+ R +L+GTV+LIFQPAEE   GAK M++ G L NV+AIFG+H++++ 
Sbjct  140   VTMLLGAAKMLQEHRHELQGTVVLIFQPAEEGLGGAKKMVEEGALKNVEAIFGIHLSNRI  199

Query  1033  PVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDP  854
             P G  A+R G  LAG G F+A I GKGGHAAIPQ ++DP++AAS+ V+SLQ +VSRE DP
Sbjct  200   PFGKAATRAGPILAGAGSFEAVITGKGGHAAIPQHTIDPVIAASSIVLSLQQLVSREADP  259

Query  853   FDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTV  674
              DS VV+VSM+QGG++ NVIPD+ TI GT RAF    F  L++RI+E++  QA VHRC  
Sbjct  260   LDSNVVTVSMVQGGNALNVIPDSVTIGGTLRAFT--GFTQLQQRIKEVITKQATVHRCNA  317

Query  673   EIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDK  494
              ++        +P    PT+N+V +Y+  +     ++G++ VE A   MGSEDF  + + 
Sbjct  318   SVNLTPQGIEPYP----PTVNNVDLYKQFKSVVRDLLGQEAVEEAAQVMGSEDFSFFAEA  373

Query  493   VPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             +PG F  +G+++E  +    PHSP+F ++ED LP GAA+HA+ A  YL
Sbjct  374   IPGHFTLLGMQDETKSYAM-PHSPHFRINEDALPYGAAIHASMAVQYL  420



>ref|XP_006475371.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Citrus 
sinensis]
Length=443

 Score =   458 bits (1178),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 213/397 (54%), Positives = 289/397 (73%), Gaps = 6/397 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + +  A + E   WM  +RR+IH NPEL ++EF TS ++R ELD++G+ Y++PVA TGVV
Sbjct  38    KFLDFAKKPEIFYWMVNIRRKIHENPELGFQEFETSKLIRAELDQMGIPYKFPVAVTGVV  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDAL ++E VEWEHKS+V GKMHACGHDAH AMLLGAAK+LQ  
Sbjct  98    GYIGTGQPPFVALRADMDALAMEESVEWEHKSKVPGKMHACGHDAHVAMLLGAAKMLQVF  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             R ++KGT++L+FQPAEE G GAK M+  G L+NV+AIFGLHV+  +PVG VASRPG  LA
Sbjct  158   RHEIKGTIVLVFQPAEEGGGGAKKMLDAGALENVEAIFGLHVSSLFPVGTVASRPGPTLA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
               G F+A I GKGGHAAIPQ ++DPI+AAS  ++SLQ +VSRE DP DSQV++V+  +GG
Sbjct  218   AGGFFEAVINGKGGHAAIPQHTIDPIVAASNVIVSLQHLVSREADPLDSQVLTVAKFEGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FN+IPD+ TI GT+RAF+K+S   LK+RIEE+V  QA+V RC   + FD   + +F P
Sbjct  278   GAFNIIPDSVTIGGTFRAFSKESIIQLKQRIEEVVMKQASVQRCNATVTFD---DKSFYP  334

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                 T+N+  ++EH +K +  ++G  N++     MG+EDF  + + +PG F+++G+ +E 
Sbjct  335   V---TVNNKNLHEHFQKVAGDMLGIQNIKENRPLMGTEDFSFFAEAIPGYFYYLGMNDET  391

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                    HSPYF ++ED LP GA +HA+ A  YLL +
Sbjct  392   KGKFETGHSPYFRVNEDALPYGAVLHASLATRYLLEN  428



>gb|KFK35825.1| hypothetical protein AALP_AA4G042000 [Arabis alpina]
Length=393

 Score =   456 bits (1173),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 215/383 (56%), Positives = 287/383 (75%), Gaps = 6/383 (2%)
 Frame = -1

Query  1489  MRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSPPFVALR  1310
             M  +RR+IH NPEL YEE  TS +VR ELD++GV +++P+A TGVV  IG+G  PFVALR
Sbjct  1     MVGIRRKIHENPELGYEEVETSKLVRTELDKIGVSFKYPIAVTGVVGYIGTGLAPFVALR  60

Query  1309  ADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQP  1130
             ADMDALP+QE+VEWEHKS++ GKMHACGHDAHT MLLGAAK+L++  ++L+GTV+L+FQP
Sbjct  61    ADMDALPMQEMVEWEHKSKIPGKMHACGHDAHTTMLLGAAKLLKEHEEELQGTVILVFQP  120

Query  1129  AEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIKGKGG  950
             AEE G GAK +++ GVL+NV AIFGLHV ++  +G V+SR G  LAG G F+A I GKGG
Sbjct  121   AEEGGGGAKKIVEAGVLENVSAIFGLHVTNQLGIGQVSSREGPLLAGSGFFEAKISGKGG  180

Query  949   HAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTATITG  770
             HAA+PQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +GG +FNVIPD+ TI G
Sbjct  181   HAALPQHAIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFEGGGAFNVIPDSVTIGG  240

Query  769   TYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDVRIYEH  590
             T+RAF+  SF  LKKRIE+++  QA+VH C   +DF     P FP    PT+ND  +++ 
Sbjct  241   TFRAFSPKSFAQLKKRIEQVITRQASVHMCNATVDFLEDNKPFFP----PTVNDKDLHQF  296

Query  589   ARKSSSLIVGEDN-VELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVFPPHSPYFT  413
              +  S  ++G +N  E+ P  MGSEDF  Y + +PG F F+G++NE  + +  PHSPYF 
Sbjct  297   FKNVSGDLLGTENYFEMQP-LMGSEDFSFYQESMPGHFSFVGMQNEAHSPMASPHSPYFE  355

Query  412   LDEDVLPVGAAVHAAFAYTYLLS  344
             ++E+ LP GA++HA+ A  +LLS
Sbjct  356   VNEETLPYGASLHASMATRFLLS  378



>emb|CDY43926.1| BnaA05g15360D [Brassica napus]
Length=444

 Score =   457 bits (1177),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 217/396 (55%), Positives = 290/396 (73%), Gaps = 6/396 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + + LA   +  +WM  +RR+IH NPEL YEE  TS +VR EL+++GV Y++PVA TGV+
Sbjct  38    KFLALAKRDDFFDWMVGIRRKIHENPELGYEEVETSRLVRTELEKMGVSYKYPVAVTGVI  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               +G+G  PFVALRADMDAL +QE+VEWEHKS+V GKMHACGHDAHT MLLGAAK+L++ 
Sbjct  98    GYVGTGQAPFVALRADMDALAMQEMVEWEHKSKVPGKMHACGHDAHTTMLLGAAKLLKEH  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             + +L+GTV+L+FQPAEE G GAK +++ GVL +V AIFGLHV ++  +G V+SR G  LA
Sbjct  158   QDELQGTVILVFQPAEEGGGGAKKIVEAGVLKDVSAIFGLHVTNQLSLGQVSSREGPLLA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I GKGGHAA+PQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +GG
Sbjct  218   GSGFFEAKISGKGGHAALPQHAIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFEGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+  SF  LKKRIE+++  QA+VH C   +DF   E P FP 
Sbjct  278   GAFNVIPDSVTIGGTFRAFSTKSFTQLKKRIEQVITRQASVHMCNATVDFLEEEKPFFP-  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDN-VELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                PT+N   ++   +  S  ++G  N VE+ P  MGSEDF  Y   +PG F F+G++NE
Sbjct  337   ---PTVNHKDLHMFFKNVSGDMLGTQNYVEMQP-LMGSEDFSFYQQSMPGHFSFVGMQNE  392

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
               + +  PHSPYF ++E++LP GA++HA+ A  YLL
Sbjct  393   AHSPMASPHSPYFEVNEELLPYGASLHASMATRYLL  428



>gb|ABB60090.1| IAA-amino acid hydrolase 3 [Brassica rapa]
Length=441

 Score =   457 bits (1177),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 217/396 (55%), Positives = 290/396 (73%), Gaps = 6/396 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + + LA   +  +WM  +RR+IH NPEL YEE  TS +VR EL+++GV Y++PVA TGV+
Sbjct  35    KFLALAKRDDFFDWMVGIRRKIHENPELGYEEVETSRLVRTELEKMGVSYKYPVAVTGVI  94

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               +G+G  PFVALRADMDAL +QE+VEWEHKS+V GKMHACGHDAHT MLLGAAK+L++ 
Sbjct  95    GYVGTGQAPFVALRADMDALAMQEMVEWEHKSKVPGKMHACGHDAHTTMLLGAAKLLKEH  154

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             + +L+GTV+L+FQPAEE G GAK +++ GVL +V AIFGLHV ++  +G V+SR G  LA
Sbjct  155   QDELQGTVILVFQPAEEGGGGAKKIVEAGVLKDVSAIFGLHVTNQLSLGQVSSREGPLLA  214

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I GKGGHAA+PQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +GG
Sbjct  215   GSGFFEAKISGKGGHAALPQHAIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFEGG  274

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+  SF  LKKRIE+++  QA+VH C   +DF   E P FP 
Sbjct  275   GAFNVIPDSVTIGGTFRAFSTKSFTQLKKRIEQVITRQASVHMCNATVDFLEEEKPFFP-  333

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDN-VELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                PT+N   ++   +  S  ++G  N VE+ P  MGSEDF  Y   +PG F F+G++NE
Sbjct  334   ---PTVNHKDLHMFFKNVSGDMLGTQNYVEMQP-LMGSEDFSFYQQSMPGHFSFVGMQNE  389

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
               + +  PHSPYF ++E++LP GA++HA+ A  YLL
Sbjct  390   AHSPMASPHSPYFEVNEELLPYGASLHASMATRYLL  425



>ref|XP_010545642.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Tarenaya hassleriana]
Length=445

 Score =   457 bits (1177),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 221/407 (54%), Positives = 293/407 (72%), Gaps = 5/407 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             +  R +  A     V+WM  +RR+IH +PEL +EE  TS +VR ELD++GV Y++PVA T
Sbjct  35    IPQRFLNFAQRDGFVDWMVGIRRKIHEHPELGFEEIETSKLVRAELDKMGVSYKYPVAVT  94

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVV  +G+G PPFVALRADMDALPIQE+VEWEHKS++ GKMHACGHDAHTAMLLGA K+L
Sbjct  95    GVVGYVGTGQPPFVALRADMDALPIQEMVEWEHKSKIPGKMHACGHDAHTAMLLGATKLL  154

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             ++  ++LKGTV+L+FQPAEE   GAK +++ GVLDNV+AIFGLHVA+++  G VAS+ G 
Sbjct  155   KEHEEELKGTVVLVFQPAEEGRGGAKKVMEAGVLDNVEAIFGLHVANRWESGKVASKEGP  214

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LA  G F+A I GKGGHAA+PQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+V+  
Sbjct  215   MLAASGTFEAKIHGKGGHAALPQFSIDPILAASHVIVSLQQLVSREADPLDSQVVTVAKF  274

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             +GG +FNVIPD+ TI GT+RAF+ +SF  LKKRIE+++ +QA+V RC   +DF     P 
Sbjct  275   KGGDAFNVIPDSVTIGGTFRAFSSESFNQLKKRIEQVITSQASVQRCNATVDFFEEGRPF  334

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             FP    PT+ND  ++   +  +  ++G +N E     MG+EDF  Y +  PG F+F+G++
Sbjct  335   FP----PTVNDKELHRFFKNVTGEMLGMENYEETQPVMGAEDFAFYQEAKPGLFYFLGME  390

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHSS  320
              E    +   HSPYF ++E  LP GAA+ A+ A  YLL   +P HSS
Sbjct  391   KEGHPRLEGGHSPYFRVNEGSLPYGAALQASLATRYLLE-PRPLHSS  436



>ref|NP_001288913.1| IAA-amino acid hydrolase ILR1-like 4 precursor [Brassica rapa]
 gb|ABB60091.1| IAA-amino acid hydrolase 3 [Brassica rapa]
Length=444

 Score =   457 bits (1177),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 217/396 (55%), Positives = 290/396 (73%), Gaps = 6/396 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + + LA   +  +WM  +RR+IH NPEL YEE  TS +VR EL+++GV Y++PVA TGV+
Sbjct  38    KFLALAKRDDFFDWMVGIRRKIHENPELGYEEVETSRLVRTELEKMGVSYKYPVAVTGVI  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               +G+G  PFVALRADMDAL +QE+VEWEHKS+V GKMHACGHDAHT MLLGAAK+L++ 
Sbjct  98    GYVGTGQAPFVALRADMDALAMQEMVEWEHKSKVPGKMHACGHDAHTTMLLGAAKLLKEH  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             + +L+GTV+L+FQPAEE G GAK +++ GVL +V AIFGLHV ++  +G V+SR G  LA
Sbjct  158   QDELQGTVILVFQPAEEGGGGAKKIVEAGVLKDVSAIFGLHVTNQLSLGQVSSREGPLLA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I GKGGHAA+PQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +GG
Sbjct  218   GSGFFEAKISGKGGHAALPQHAIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFEGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+  SF  LKKRIE+++  QA+VH C   +DF   E P FP 
Sbjct  278   GAFNVIPDSVTIGGTFRAFSTKSFTQLKKRIEQVITRQASVHMCNATVDFLEEEKPFFP-  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDN-VELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                PT+N   ++   +  S  ++G  N VE+ P  MGSEDF  Y   +PG F F+G++NE
Sbjct  337   ---PTVNHKDLHMFFKNVSGDMLGTQNYVEMQP-LMGSEDFSFYQQSMPGHFSFVGMQNE  392

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
               + +  PHSPYF ++E++LP GA++HA+ A  YLL
Sbjct  393   AHSPMASPHSPYFEVNEELLPYGASLHASMATRYLL  428



>ref|XP_002981614.1| hypothetical protein SELMODRAFT_421067 [Selaginella moellendorffii]
 gb|EFJ17429.1| hypothetical protein SELMODRAFT_421067 [Selaginella moellendorffii]
Length=405

 Score =   456 bits (1173),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 226/400 (57%), Positives = 289/400 (72%), Gaps = 6/400 (2%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
             I+  AN+  TVEW+R VRR IHRNPEL +EE  TSA++RRELD +G+ YRWPVAKTGVVA
Sbjct  8     ILEAANDPGTVEWVRSVRRCIHRNPELGFEEHQTSALIRRELDGMGIPYRWPVAKTGVVA  67

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
             TIGSG  P VALRADMD LPIQE+VEWEHKSQVDGKMHACGHDAH AMLLGAA+IL Q R
Sbjct  68    TIGSGDRPIVALRADMDGLPIQEMVEWEHKSQVDGKMHACGHDAHLAMLLGAARILSQRR  127

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
               LKGTVLL+FQPAEE   GA+ M+Q+G L + +AIFGLHVA + P G++A R G  LAG
Sbjct  128   HLLKGTVLLLFQPAEEGKAGAQVMVQDGALGDAEAIFGLHVAPEAPTGIIALRRGPCLAG  187

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
                F+A IKG+GGHA  P  + DPI+AAS +VISLQ +VSRE DP  +QVVSV+ I GG 
Sbjct  188   SRAFEAEIKGRGGHAGCPDHTADPIVAASFAVISLQPLVSREMDPLGNQVVSVTSISGGH  247

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
             +FNVIPD+ T+ G++R+F+K+    LK+RI++I+ +QAAVH+CT  + FDG + P +P  
Sbjct  248   TFNVIPDSVTLKGSFRSFSKEGMAKLKERIQQIIESQAAVHKCTARVVFDG-DRPMYP--  304

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
                TIND ++++HA   ++ + G   V      M +EDF  YL+++PG F  +G+ +E  
Sbjct  305   --ATINDDKLHDHASWVATSLFGSHCVRNIKPVMAAEDFSFYLERIPGMFTGLGIHSEAK  362

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPP  329
              T    HS  F +DED+LP G A  AA A  Y ++  +PP
Sbjct  363   GTTHFVHSGLFRMDEDMLPWGVAFQAAVAEAY-INELQPP  401



>ref|XP_006281445.1| hypothetical protein CARUB_v10027523mg [Capsella rubella]
 gb|EOA14343.1| hypothetical protein CARUB_v10027523mg [Capsella rubella]
Length=441

 Score =   457 bits (1176),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 224/396 (57%), Positives = 288/396 (73%), Gaps = 11/396 (3%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + + LA   E  + M R+RR+IH NPEL YEEF TS ++R ELD +GVKYR+PVA TGV+
Sbjct  39    KYLELARSPEVFDSMVRIRRKIHENPELGYEEFETSKLIRSELDLIGVKYRYPVAITGVI  98

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IGSG PPFVALRADMDALPIQE VEWEH+S++ GKMHACGHD H AMLLGAAKILQ+ 
Sbjct  99    GYIGSGEPPFVALRADMDALPIQEAVEWEHRSKIPGKMHACGHDGHVAMLLGAAKILQKH  158

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             R  L+GTV+LIFQPAEE  RGAK MI+ G L NV+AIFG+H+ ++ P G VASR G  LA
Sbjct  159   RHDLQGTVVLIFQPAEEGLRGAKKMIEEGALKNVEAIFGIHLTNRIPFGKVASRAGPMLA  218

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I GKGGHAAIPQ ++DP++AAS+ V+SLQ +VSRETDP DS+VV+VS + GG
Sbjct  219   GAGFFEAVITGKGGHAAIPQHTIDPVVAASSIVLSLQHLVSRETDPLDSKVVTVSKVLGG  278

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDF--DGTENPTF  638
             ++FNVIPD+ TI GT RAF    F  L++RI+E++  QA VHRC   ++   DG E    
Sbjct  279   NAFNVIPDSITIGGTLRAFT--GFSQLQQRIKEVITKQATVHRCNASVNLTPDGKE----  332

Query  637   PPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKN  458
                L PT+ND+ +Y+  +K    ++G++ VE A   MGSEDF  + + +PG F F+G+++
Sbjct  333   --PLPPTVNDIDLYKQYKKVVRDLLGQEAVEEAQPLMGSEDFSKFAEVIPGHFSFLGMQD  390

Query  457   EKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             E        HSP + ++EDVLP GAA+HA+ A  YL
Sbjct  391   ETKGYA-SSHSPLYRVNEDVLPYGAAIHASMAVQYL  425



>ref|XP_004510337.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cicer arietinum]
Length=442

 Score =   456 bits (1174),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 216/391 (55%), Positives = 286/391 (73%), Gaps = 5/391 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A   E  +WM  +RR+IH NPEL Y+EF TS ++R ELD+LG+ Y+ PVA TGV+  IG+
Sbjct  38    AKSPEVFDWMISIRRKIHENPELGYQEFETSELIRSELDKLGISYKHPVAVTGVIGFIGN  97

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G  PFVALRADMDAL +QE+VEWEHKS+V GKMHACGHDAH  MLLGAAKIL++  ++++
Sbjct  98    GMSPFVALRADMDALAMQEMVEWEHKSKVPGKMHACGHDAHVTMLLGAAKILKEHEKEIQ  157

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV+L+FQPAEE G GAK ++  G L+NV AIFGLH+A + P+G VAS+ G  LAG G F
Sbjct  158   GTVVLVFQPAEEGGGGAKKIVDAGALENVTAIFGLHIAPELPIGEVASKSGPILAGSGRF  217

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I GKGGHAAIPQ+S+DPILAAS  +ISLQ +VSRE DP DSQVV+++M QGGS+FNV
Sbjct  218   EAKINGKGGHAAIPQKSIDPILAASNVIISLQHLVSREADPLDSQVVTIAMFQGGSAFNV  277

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD  TI GT+RAF+K SF  L++RIEE++  QAAV RC   ++F     P++P    PT
Sbjct  278   IPDYVTIGGTFRAFSKQSFNQLRQRIEEVIVGQAAVQRCNATVNFFDESKPSYP----PT  333

Query  616   INDVRIYEHARKSSSLIVGEDNVE-LAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATV  440
             +N+  ++EH    +  ++G + V+ +    MG+EDF  Y + +PG FF +G++N  +   
Sbjct  334   VNNGDLHEHFVNVAVDMLGINKVDSVTQPSMGAEDFSFYQEVIPGYFFMLGMQNASNNRF  393

Query  439   FPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
                HSPY T++ED LP G  +HA+ A +YLL
Sbjct  394   DSLHSPYLTINEDGLPYGVPLHASLASSYLL  424



>gb|AFK37903.1| unknown [Medicago truncatula]
Length=447

 Score =   456 bits (1174),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 219/395 (55%), Positives = 282/395 (71%), Gaps = 4/395 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               + LA E +  +WM  +RR+IH NPEL+Y+EF TS ++R +LD LGV+Y+ PVA TG +
Sbjct  40    NFLDLAKEPKVFDWMVSIRRKIHENPELSYQEFETSKLIRTKLDELGVQYKHPVAVTGAI  99

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDAL IQE+VEWEHKS+V GKMHACGHDAH AMLLGAAKIL+  
Sbjct  100   GYIGTGLPPFVALRADMDALLIQEMVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILKDR  159

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
              + L GT++L+FQPAEE G GAK ++  G L+ V AIFGLHV +  P+G VASR G   A
Sbjct  160   EKHLHGTIVLVFQPAEEGGGGAKKILDAGALEKVSAIFGLHVLNNLPLGEVASRSGPIFA  219

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G FKA I G+GGHAAIPQ S+DPILA S  ++SLQ IVSRE DP DSQV++V+MIQGG
Sbjct  220   GNGFFKAVISGRGGHAAIPQHSIDPILATSNVIVSLQQIVSREIDPLDSQVLTVAMIQGG  279

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+ +SF  L+ RIE+I+  QAAV RC   + F   E P FP 
Sbjct  280   GAFNVIPDSVTIGGTFRAFSNESFTQLRHRIEQIITGQAAVQRCHATVSFLEEEKPFFP-  338

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PT+ND  ++++ +  +  ++G D V+     MGSEDF  Y + +PG  F +G+++  
Sbjct  339   ---PTVNDGGLHDYFQSVAGSLLGADKVKGMQPMMGSEDFAFYQEAIPGYIFLLGMEDVS  395

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
                +   HSPYF ++E VLP GAA+HA+ A  YLL
Sbjct  396   VERLPSGHSPYFKVNEGVLPYGAALHASLASRYLL  430



>ref|XP_004969701.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2-like [Setaria 
italica]
Length=458

 Score =   457 bits (1175),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 226/395 (57%), Positives = 281/395 (71%), Gaps = 6/395 (2%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
             ++  A   E   WM  VRR IH  PELA++E  TSA+VRREL  +GV YR+PVA TGVVA
Sbjct  52    VLRRAQRPEFAAWMADVRRAIHERPELAFQEHETSALVRRELHAMGVAYRYPVAGTGVVA  111

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              +G+G PPFVALRADMDALP+QE VEWEHKS+   KMHACGHDAHTAMLLGAAKIL + R
Sbjct  112   AVGTGGPPFVALRADMDALPLQEEVEWEHKSKEARKMHACGHDAHTAMLLGAAKILHERR  171

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
              +L+GTV+L+FQP EE G GAK M++ G +DNV+AIFG HV    P GVV SR G  LAG
Sbjct  172   HELQGTVVLLFQPGEEVGIGAKKMVEAGAVDNVEAIFGFHVTVMLPTGVVGSRAGPLLAG  231

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
             CG F+A I G GGHAAIP  SVDP++AAS+ V+SLQS+VSRE DP DSQVV+V+  +GG 
Sbjct  232   CGFFEAVITGVGGHAAIPHSSVDPVVAASSVVLSLQSLVSREADPLDSQVVTVTRFRGGG  291

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
             +FNVIPD+ TI GT+R F+ + F  LK+RIEE+V AQAAVHRC   +DF    +P  P  
Sbjct  292   AFNVIPDSVTIGGTFRCFSAEGFTRLKRRIEEVVVAQAAVHRCAASVDFGVGGSPLLP--  349

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELA-PGQMGSEDFGMYLDKVPGA-FFFIGVKNE  455
               PT+N   ++ H    ++  VG  NV  A    MGSEDF  + + VP + F+F+G+ NE
Sbjct  350   --PTVNTPSLHAHFEAVAAETVGAGNVRGAMEPCMGSEDFAAFSEAVPASHFYFVGIGNE  407

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             +  +V   HSP+F +D+D LP GAA+HA  A  YL
Sbjct  408   EVGSVHAAHSPHFLIDDDALPYGAAMHANLATGYL  442



>gb|EYU21408.1| hypothetical protein MIMGU_mgv1a006385mg [Erythranthe guttata]
Length=446

 Score =   456 bits (1174),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 217/399 (54%), Positives = 286/399 (72%), Gaps = 4/399 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               +  A + E  +WM  VRR+IH NPEL YEEF TS ++R+ELD++G+ Y++P+A TGV+
Sbjct  38    NFLSFARKAEIFDWMVGVRRKIHENPELGYEEFETSKLIRQELDQMGIPYKYPLAVTGVL  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IGSG PPFVA+RADMDAL +QE+VEW+HKS+ DGKMHACGHDAH AMLLGAAKILQ+ 
Sbjct  98    GFIGSGEPPFVAIRADMDALLLQEMVEWDHKSKNDGKMHACGHDAHVAMLLGAAKILQEN  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             R  LKGTV+L FQPAEE   GAK MI++G L+ V+AIFG+HV    P+G V+SR G  LA
Sbjct  158   RHLLKGTVVLFFQPAEEGYGGAKKMIEDGALEKVEAIFGIHVDTLLPLGEVSSRSGPILA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G F+A I GKGGHAAIPQ+S+DPILAAS  ++SLQ +VSRE DP DSQV++V+   GG
Sbjct  218   GSGFFEAVISGKGGHAAIPQQSIDPILAASNVIVSLQQLVSREADPLDSQVLTVAKFHGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+ +SF  LK+RI+E++  QAAV RC   + F+  +   FP 
Sbjct  278   GAFNVIPDSVTIGGTFRAFSNESFLQLKQRIKEVIIGQAAVQRCNASVSFESKDKIFFP-  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PT+ND  +++  ++ +  ++    V+     MGSEDF  Y +K+PG FF +G+K+E 
Sbjct  337   ---PTVNDKDLHKLFQRVAGDMLSISGVKEMQPLMGSEDFSFYQEKIPGYFFLLGMKDET  393

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
             +      HSPYF ++ED LP GAA+HA+    YL    K
Sbjct  394   AEKPAHAHSPYFRINEDGLPFGAALHASMVVRYLFDSHK  432



>gb|KDO55915.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
Length=423

 Score =   455 bits (1171),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 211/390 (54%), Positives = 287/390 (74%), Gaps = 6/390 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + +  A + E   WM  +RR+IH NPEL ++EF TS ++R ELD++G+ Y++PVA TGVV
Sbjct  38    KFLDFAKKPEIFYWMVNIRRKIHENPELGFQEFETSKLIRAELDQMGIPYKFPVAVTGVV  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDAL ++E VEWEHKS+V GKMHACGHDAH AMLLGAAK+LQ  
Sbjct  98    GYIGTGQPPFVALRADMDALAMEESVEWEHKSKVPGKMHACGHDAHVAMLLGAAKMLQVF  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             R ++KGT++L+FQPAEE G GAK M+  G L+NV+AIFGLHV+  +PVG VASRPG  LA
Sbjct  158   RHEIKGTIVLVFQPAEEGGGGAKKMLDAGALENVEAIFGLHVSSLFPVGTVASRPGPTLA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
               G F+A I GKGGHAAIPQ ++DPI+AAS  ++SLQ +VSRE DP DSQV++V+  +GG
Sbjct  218   AGGFFEAVINGKGGHAAIPQHTIDPIVAASNVIVSLQHLVSREADPLDSQVLTVAKFEGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FN+IPD+ TI GT+RAF+K+S   LK+RIEE+V  QA+V RC   + FD   + +F P
Sbjct  278   GAFNIIPDSVTIGGTFRAFSKESIIQLKQRIEEVVMKQASVQRCNATVTFD---DKSFYP  334

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                 T+N+  ++EH +K ++ ++G  N++     MG+EDF  + + +PG F+++G+ +E 
Sbjct  335   V---TVNNKNLHEHFQKVAADMLGVQNIKENRPLMGTEDFSFFAEAIPGYFYYLGMNDET  391

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFA  362
                    HSPYF ++ED LP GAA+HA+ A
Sbjct  392   KGKFETGHSPYFRVNEDALPYGAALHASLA  421



>emb|CBI27959.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   454 bits (1169),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 210/381 (55%), Positives = 286/381 (75%), Gaps = 7/381 (2%)
 Frame = -1

Query  1489  MRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSPPFVALR  1310
             M  +RR IH NPEL +EEF TS ++R ELD++ + YR+PVA TGVV  IG+G PPFVA+R
Sbjct  1     MVGIRRIIHENPELGFEEFETSKLIRTELDKMDIPYRFPVAVTGVVGFIGTGEPPFVAIR  60

Query  1309  ADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQP  1130
             ADMDALP+QE VEWEHKS++ GKMHACGHDAH AMLLGAAK+LQ+ R  L+GTV+L+FQP
Sbjct  61    ADMDALPMQEGVEWEHKSKIPGKMHACGHDAHVAMLLGAAKMLQKHRHDLQGTVVLVFQP  120

Query  1129  AEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIKGKGG  950
             AEER  GAK M++ G+L+N+DAIFGLHV+ + P+G VASR G  LA CG F A I GKGG
Sbjct  121   AEERDGGAKKMLETGILENIDAIFGLHVSPRVPIGSVASRSGPVLAACGFFDAVISGKGG  180

Query  949   HAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTATITG  770
             HAA+PQ S+DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +GG +FNVIPD+ TI G
Sbjct  181   HAALPQHSIDPILAASNVIVSLQQLVSREADPLDSQVVTVAKFKGGGAFNVIPDSVTIGG  240

Query  769   TYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDVRIYEH  590
             T+RAF+K+SF  LK+RIEE++  Q++V RC   + F+   +P +P     T N+  +++H
Sbjct  241   TFRAFSKESFLQLKQRIEEVITLQSSVQRCNATVHFN---DPFYP----VTANNKDLHKH  293

Query  589   ARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVFPPHSPYFTL  410
              +  +  ++G  N++  P  MG+EDF  + + +PG F+++G+KNE    +   H+PY+T+
Sbjct  294   FQNVAGDMLGTQNIKEMPLVMGAEDFSFFAEAIPGYFYYLGMKNETRGQLELGHTPYYTV  353

Query  409   DEDVLPVGAAVHAAFAYTYLL  347
             +ED LP GAA+HA+ A +++ 
Sbjct  354   NEDALPYGAALHASLATSFVF  374



>ref|XP_004486800.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cicer arietinum]
Length=445

 Score =   456 bits (1172),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 217/396 (55%), Positives = 281/396 (71%), Gaps = 4/396 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             ++ + LA   +  +WM  +RR+IH NPE+ YEEF TS ++R +LD LG+ Y+ PVA TGV
Sbjct  36    NKFLDLAKNPQVFDWMVDIRRKIHENPEMGYEEFETSELIRAKLDELGIPYKHPVAVTGV  95

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
             +  IG+G PPFVA+RADMDAL ++ELVEWEHKS+V GKMHACGHDAH AMLLGAAKIL++
Sbjct  96    IGYIGTGLPPFVAIRADMDALLMEELVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILKE  155

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
             L + L GTV+L+FQPAEE G GAK ++  GVL NV AIFGLHV H   +G VASR G   
Sbjct  156   LEKDLPGTVVLVFQPAEEGGGGAKKIVDAGVLKNVSAIFGLHVNHDTSLGAVASRSGPLF  215

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AG G F+A I GKGGHAAIPQ ++DPI+AAS  ++SLQ IVSRE DP D+QVV+V   QG
Sbjct  216   AGSGFFEAIISGKGGHAAIPQHAIDPIVAASNVIVSLQHIVSREADPLDTQVVTVGNFQG  275

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G +FNVIPD+ TI GT+RAF+ +SF  L+ RIE+++  QAAVHRC   ++F   E   FP
Sbjct  276   GGAFNVIPDSVTIGGTFRAFSHESFMHLRNRIEQVITGQAAVHRCNATVNFLQEEKIFFP  335

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PTIND  ++++ R  +  ++G D V      MG EDF  Y   +PG  F +G++N 
Sbjct  336   ----PTINDAGLHDYFRSVAGSLLGVDKVNDMQPVMGGEDFAFYQQALPGYIFLLGMRNP  391

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
              +  +   HSPYF ++ED LP GAA+HA+ A  YL+
Sbjct  392   SAEPLHIVHSPYFKINEDALPYGAALHASLAARYLV  427



>gb|KDO55916.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
Length=445

 Score =   455 bits (1171),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 214/399 (54%), Positives = 291/399 (73%), Gaps = 8/399 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + +  A + E   WM  +RR+IH NPEL ++EF TS ++R ELD++G+ Y++PVA TGVV
Sbjct  38    KFLDFAKKPEIFYWMVNIRRKIHENPELGFQEFETSKLIRAELDQMGIPYKFPVAVTGVV  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDAL ++E VEWEHKS+V GKMHACGHDAH AMLLGAAK+LQ  
Sbjct  98    GYIGTGQPPFVALRADMDALAMEESVEWEHKSKVPGKMHACGHDAHVAMLLGAAKMLQVF  157

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             R ++KGT++L+FQPAEE G GAK M+  G L+NV+AIFGLHV+  +PVG VASRPG  LA
Sbjct  158   RHEIKGTIVLVFQPAEEGGGGAKKMLDAGALENVEAIFGLHVSSLFPVGTVASRPGPTLA  217

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
               G F+A I GKGGHAAIPQ ++DPI+AAS  ++SLQ +VSRE DP DSQV++V+  +GG
Sbjct  218   AGGFFEAVINGKGGHAAIPQHTIDPIVAASNVIVSLQHLVSREADPLDSQVLTVAKFEGG  277

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEE--IVRAQAAVHRCTVEIDFDGTENPTF  638
              +FN+IPD+ TI GT+RAF+K+S   LK+RIEE  +V  QA+V RC   + FD   + +F
Sbjct  278   GAFNIIPDSVTIGGTFRAFSKESIIQLKQRIEEWQVVMKQASVQRCNATVTFD---DKSF  334

Query  637   PPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKN  458
              P    T+N+  ++EH +K ++ ++G  N++     MG+EDF  + + +PG F+++G+ +
Sbjct  335   YPV---TVNNKNLHEHFQKVAADMLGVQNIKENRPLMGTEDFSFFAEAIPGYFYYLGMND  391

Query  457   EKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
             E        HSPYF ++ED LP GAA+HA+ A  YLL +
Sbjct  392   ETKGKFETGHSPYFRVNEDALPYGAALHASLATRYLLEN  430



>gb|ACF84306.1| unknown [Zea mays]
 tpg|DAA58584.1| TPA: hypothetical protein ZEAMMB73_870331 [Zea mays]
Length=397

 Score =   454 bits (1167),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 226/387 (58%), Positives = 281/387 (73%), Gaps = 5/387 (1%)
 Frame = -1

Query  1489  MRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSPPFVALR  1310
             M  VRR IH NPEL YEEF TS +VRREL  +G+ YR P A TGVVAT+G+G PPFVALR
Sbjct  1     MVGVRRRIHENPELGYEEFQTSELVRRELHAMGIPYRHPFAVTGVVATVGTGGPPFVALR  60

Query  1309  ADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQP  1130
             ADMDALP+QE VEWEHKS+V GKMH CGHDAH AMLLG+AKILQ+ R +LKGTV+L+FQP
Sbjct  61    ADMDALPLQESVEWEHKSKVPGKMHGCGHDAHVAMLLGSAKILQEHRDELKGTVVLVFQP  120

Query  1129  AEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIKGKGG  950
             AEE G GAK MI++  ++N+DAIFGLH+A   P+GV+ASRPG  +AG G F+A I GKGG
Sbjct  121   AEEGGGGAKKMIEDRAVENIDAIFGLHIADSVPIGVLASRPGPIMAGSGFFEAVISGKGG  180

Query  949   HAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTATITG  770
             HAA+P  ++DPILAAS  ++SLQ +VSRE DP DSQVV+V   QGG +FNVIPD+ TI G
Sbjct  181   HAALPHHTIDPILAASNVIVSLQQLVSREADPLDSQVVTVGKFQGGGAFNVIPDSVTIGG  240

Query  769   TYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDVRIYEH  590
             T+RAF K+SF  LK+RIEE++ +QA+V RC+  +DF   + P FP    PTIN   +++ 
Sbjct  241   TFRAFLKESFNQLKQRIEEVIVSQASVQRCSAAVDFLSKDRPFFP----PTINSPELHDF  296

Query  589   ARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGA-FFFIGVKNEKSATVFPPHSPYFT  413
                 +  +VG  NV      MG+EDF  Y + VP   ++F+G+ NE      P HSPYFT
Sbjct  297   FVNVAGEMVGSRNVRDRQPLMGAEDFAFYAEAVPSTYYYFVGMYNETRGPQAPHHSPYFT  356

Query  412   LDEDVLPVGAAVHAAFAYTYLLSHAKP  332
             ++ED LP GAA  AA A  YLL   +P
Sbjct  357   INEDALPYGAAGQAALAARYLLERQQP  383



>emb|CBI30348.3| unnamed protein product [Vitis vinifera]
Length=814

 Score =   468 bits (1204),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 222/401 (55%), Positives = 289/401 (72%), Gaps = 4/401 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L   ++  A E + +EW+R VRR IH  PEL +EE+ TS ++R EL+ LG++Y WPVAKT
Sbjct  398   LGRELLESAREADLLEWIRGVRRSIHEYPELGFEEYRTSQLIRDELNSLGIRYEWPVAKT  457

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVATIGSG+ P  ALRADMDALP+QELVEWEH+S++DGKMHACGHD H AMLLGAA++L
Sbjct  458   GVVATIGSGAQPIFALRADMDALPLQELVEWEHRSKIDGKMHACGHDLHVAMLLGAARLL  517

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q  R+ LKGTV L+FQP EE   GA  M+Q+G LDN++AIFGLHV      G++ASRPG 
Sbjct  518   QGKREILKGTVKLVFQPGEEGYAGAYHMLQHGALDNINAIFGLHVMPSILTGMIASRPGP  577

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LAG G+F AT+KG GGHAA P ++ DPILAAS ++++LQ IVSRETDP +++VV+V  I
Sbjct  578   MLAGAGLFLATVKGIGGHAAGPHQTRDPILAASLAIVALQQIVSRETDPLEARVVTVGFI  637

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             +GG + NVIP++    GTYR+        +++RI+EI+ +QAAVHRCT  ++F       
Sbjct  638   KGGQAANVIPESVEFGGTYRSLTSQGLSYIQERIQEIIESQAAVHRCTAVVEF----REE  693

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT ND  +YEHA++   +++GE NV+L P  MG+EDF  Y  KVP   F +G+K
Sbjct  694   IPLPYPPTDNDEELYEHAKRVGEILLGEPNVQLVPITMGAEDFSFYSQKVPAVMFELGIK  753

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             NE   +  P HSPYF +DE  LP+GAA+HAA A +YL SHA
Sbjct  754   NETLKSDQPLHSPYFVIDETALPIGAALHAAVAISYLDSHA  794


 Score =   436 bits (1120),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 210/387 (54%), Positives = 272/387 (70%), Gaps = 10/387 (3%)
 Frame = -1

Query  1489  MRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSPPFVALR  1310
             MR VRR+IH+ PEL +EE  TS ++R EL+ LG+ Y+WPVAKTGVVA+IGSG  P  ALR
Sbjct  1     MRGVRRKIHQYPELGFEEHKTSELIRAELNSLGIGYKWPVAKTGVVASIGSGDQPTFALR  60

Query  1309  ADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQP  1130
             ADMDALP+QELVEWE+KS+++GKMHACGHD+H AMLLGAAK+LQ  R  LKGTV L+FQP
Sbjct  61    ADMDALPLQELVEWEYKSKIEGKMHACGHDSHVAMLLGAAKLLQAKRGMLKGTVKLVFQP  120

Query  1129  AEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIKGKGG  950
              EE   GA  M++ G L++V  + GLHV    P G +ASR G  LAG G+F ATI+GKGG
Sbjct  121   GEEGYAGAYHMLKEGALEDVKGMLGLHVIPTVPTGGIASRAGPLLAGVGLFSATIQGKGG  180

Query  949   HAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTATITG  770
             H A P  + DP+LAAS ++++LQ IVSRETDP +++VV+V ++ GG + NVIP++  I G
Sbjct  181   HGASPHTAKDPVLAASFAILALQQIVSRETDPLEARVVTVGLVDGGEAGNVIPESVKIGG  240

Query  769   TYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDF---DGTENPTFPPTLAPTINDVRI  599
             T+R+        L++RI+E++  QAAVH C   +DF    G  +P         IND  +
Sbjct  241   TFRSLTSQGLLYLQERIKEVIETQAAVHGCDAAVDFMEERGMPHPVM-------INDETL  293

Query  598   YEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVFPPHSPY  419
             YEHA+K   ++VGE NVEL P  MG+EDF  Y  + P A F +G+KNE   + +P HSPY
Sbjct  294   YEHAKKVGEILVGEPNVELLPITMGAEDFSFYTKRFPAAMFTVGIKNETLKSDYPLHSPY  353

Query  418   FTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             F +DED  PVGAA +AA A +YL  HA
Sbjct  354   FFIDEDAFPVGAAFYAAVAISYLDDHA  380



>ref|XP_010049762.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Eucalyptus grandis]
Length=454

 Score =   455 bits (1171),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 215/399 (54%), Positives = 288/399 (72%), Gaps = 6/399 (2%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               + LA + E V++M  +RR IH  PEL +EEF TS +VR ELDR+G++Y+ P+A TGVV
Sbjct  40    EFLNLAQKPEIVDYMVGIRRRIHEYPELGFEEFETSKLVRSELDRMGIQYKHPLAVTGVV  99

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVA+RADMDAL ++E VEWEHKS+V GKMHACGHD H AMLLGAAK+LQ  
Sbjct  100   GYIGTGKPPFVAIRADMDALEMEESVEWEHKSKVPGKMHACGHDGHVAMLLGAAKLLQGR  159

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
               +L+GTV+L+FQPAEE G GAK MI +G L+NVDAIFGLH++ K+P+G VA+RPG  LA
Sbjct  160   LDELQGTVVLVFQPAEEGGGGAKKMIDDGALENVDAIFGLHLSVKFPIGAVATRPGPILA  219

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
              CG F+A I GKGGHAAIPQ ++DP++AAS  +ISLQ ++SRE DP DSQVV+V+ I+GG
Sbjct  220   ACGFFEAVISGKGGHAAIPQHTIDPVVAASNVIISLQHLISREADPLDSQVVTVAKIEGG  279

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+R F+ D    LK+RIEE++  QA+V RC   + F  +  P +P 
Sbjct  280   GAFNVIPDSVTIGGTFRVFSMDGLIQLKQRIEEVIMRQASVQRCNATVSF--SVKPFYP-  336

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PT N   ++EH +  +  ++G DN+      MGSEDF  Y + +PG F+++G+K+E 
Sbjct  337   ---PTANHKALHEHFKNVARDMLGPDNILGMEPLMGSEDFSFYTEVIPGYFYYVGMKDES  393

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
                +   HSP++ L+ED L  GAA+HAA A  Y+L + +
Sbjct  394   LGKMEAGHSPHYRLNEDALSYGAALHAALATRYILENQQ  432



>ref|XP_010451360.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Camelina sativa]
Length=444

 Score =   454 bits (1169),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 230/417 (55%), Positives = 291/417 (70%), Gaps = 10/417 (2%)
 Frame = -1

Query  1579  GESSKLPLAVDGGLKD---RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRR  1409
             G SS+ P    G +     + + LA   E  + M  +RR+IH NPEL YEEF TS ++R 
Sbjct  23    GVSSESPWITAGDVTQVPKKYLELAKSPEVFDRMVSIRRKIHENPELGYEEFETSKLIRS  82

Query  1408  ELDRLGVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHAC  1229
             ELD +GVKYR+PVA TGV+  IGSG PPFVALRADMDALPIQE VEWEHKS+  GKMHAC
Sbjct  83    ELDLIGVKYRYPVAITGVIGYIGSGEPPFVALRADMDALPIQEAVEWEHKSKNPGKMHAC  142

Query  1228  GHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLH  1049
             GHD H AMLLGAAKILQ+ R  L+GTV+LIFQPAEE  RGAK MI+ G L NV+AIFGLH
Sbjct  143   GHDGHVAMLLGAAKILQEHRHDLQGTVVLIFQPAEEGLRGAKKMIEEGALKNVEAIFGLH  202

Query  1048  VAHKYPVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVS  869
             + ++ P G  ASR G  LAG G F+A I GKGGHAAIPQ +VDP++AAS+ V+SLQ IVS
Sbjct  203   LTNRVPFGKAASRAGPMLAGAGFFEAVITGKGGHAAIPQHTVDPVVAASSIVLSLQHIVS  262

Query  868   RETDPFDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAV  689
             RETDP DS+VV+VS + GG++FNVIPD+ TI GT RAF    F  L++RI+E++  QA V
Sbjct  263   RETDPLDSKVVTVSKVNGGNAFNVIPDSITIGGTLRAFT--GFSQLQQRIKEVITKQATV  320

Query  688   HRCTVEIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFG  509
             HRC   ++      P     L PT+ND+ +Y+  +K    ++G++ VE A   MGSEDF 
Sbjct  321   HRCNASVNL----TPNGKEPLPPTVNDMDLYKQFKKVVGDLLGQEAVEEAQPLMGSEDFS  376

Query  508   MYLDKVPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
              + + +PG F F+G+++E S      HSP + ++EDV P GAA+HA+ A  YL   A
Sbjct  377   KFAEVIPGHFSFLGMQDE-SKGYASSHSPLYRINEDVFPYGAAIHASMAMQYLKEKA  432



>gb|KDO80611.1| hypothetical protein CISIN_1g011407mg [Citrus sinensis]
Length=478

 Score =   456 bits (1172),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 219/393 (56%), Positives = 280/393 (71%), Gaps = 12/393 (3%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
             +M LA   ETV+W++ VRR IH+NPELA++EF TS ++R ELDR+ + Y++P+AKTG+ A
Sbjct  87    VMELARRPETVDWLKSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRA  146

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              +G+G PPFVALRADMDALPIQE VEWE+KS+V GKMHACGHDAH AML+GAAKIL+   
Sbjct  147   WVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSRE  206

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
               LK        PAEE G GAK M+ +G L++V+AIF +HV+H++P GV+ SRPG  LAG
Sbjct  207   HLLK--------PAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAG  258

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
             CG F A I GK G AA P  SVDP+LAAS +VISLQ +VSRE +P DSQVVSV+   GG 
Sbjct  259   CGFFHAVISGKKGGAANPHRSVDPVLAASAAVISLQGLVSREANPLDSQVVSVTYFNGGD  318

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
               ++IPD   I GT RAF+  SFY L +RIEE++  QA V RC+  +DF    N  +P  
Sbjct  319   HLDMIPDAVVIGGTLRAFSNTSFYQLLQRIEEVIVEQARVFRCSATVDFFDKGNTVYP--  376

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
               PT+ND  +YEH +K +  ++G  N  + P  MG+EDF  Y + VP AF++IG+KNE  
Sbjct  377   --PTVNDEDMYEHVKKVAIDLLGPMNYRVVPPMMGAEDFSFYSEVVPAAFYYIGIKNETL  434

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
              ++   HSPYF +DEDVLPVGAAVHA  A  +L
Sbjct  435   GSIHTGHSPYFMIDEDVLPVGAAVHATIAERFL  467



>gb|EPS67015.1| hypothetical protein M569_07761, partial [Genlisea aurea]
Length=418

 Score =   453 bits (1166),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 219/408 (54%), Positives = 288/408 (71%), Gaps = 5/408 (1%)
 Frame = -1

Query  1570  SKLPLAVDG-GLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRL  1394
             SK P++V   G+    +  A   +  +WM  +RR +H NPEL Y+EF TS ++R+ELD +
Sbjct  15    SKNPVSVSSEGVPKFFLDAAKGADVFDWMVGIRRRLHENPELGYQEFETSKLIRQELDEI  74

Query  1393  GVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAH  1214
             G+ Y  PVA TGV+  +GSG PPFVALRADMDALP+QE VEW+HKS+  G MHACGHD+H
Sbjct  75    GIPYEHPVAATGVIGFVGSGEPPFVALRADMDALPLQESVEWKHKSKNPGVMHACGHDSH  134

Query  1213  TAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKY  1034
              AMLLGAAK+L + R  LKGTV+L+FQPAEE G GAK M+++G L NV+AIFG+H +   
Sbjct  135   VAMLLGAAKLLHRNRHLLKGTVVLVFQPAEEGGGGAKRMVESGALKNVEAIFGIHSSGVT  194

Query  1033  PVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDP  854
             PVG V +R G  LAG G F+A I GKGGHAAIPQ+++DPILA S  V+SLQ IVSRE DP
Sbjct  195   PVGFVETRAGPILAGSGSFEAVITGKGGHAAIPQQAIDPILAGSNVVVSLQQIVSREADP  254

Query  853   FDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTV  674
              DSQV++VS+ +GG++FNVIPD+ TI GT+RAF+ +S   +++RIE+IVR QA+VHRC  
Sbjct  255   LDSQVITVSVFEGGAAFNVIPDSVTIKGTFRAFSMESMLQIRRRIEQIVRGQASVHRCNA  314

Query  673   EIDFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDK  494
              + F+  + P FP    P  ND  ++E     +  +VG   V   P  MG+EDF  Y +K
Sbjct  315   SLVFETEDKPLFP----PLANDGALHEFFVGVAEEVVGAGRVREMPPLMGAEDFSFYREK  370

Query  493   VPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             +PG FFF+G+K+E      P HSP+F ++E  LP GAA+HA+ A  YL
Sbjct  371   MPGYFFFLGMKDETVDPPAPAHSPFFRINESGLPFGAALHASLAVKYL  418



>ref|XP_008655104.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 isoform X1 [Zea 
mays]
 gb|ACF85872.1| unknown [Zea mays]
 gb|AFW83701.1| hypothetical protein ZEAMMB73_592458 [Zea mays]
Length=443

 Score =   454 bits (1168),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 224/406 (55%), Positives = 281/406 (69%), Gaps = 8/406 (2%)
 Frame = -1

Query  1546  GGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVA  1367
             G   D ++  A   E   WM  VRR IH  PELA+EE  TSA+VRRELD +GV YR PVA
Sbjct  29    GAGSDDVLRRAQRDEFAAWMAGVRRAIHERPELAFEEHETSALVRRELDAMGVAYRHPVA  88

Query  1366  KTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAK  1187
              TGVVA +G+G PPFVALRADMDALP+QE VEW+HKS+   KMHACGHDAHTAMLLGAA+
Sbjct  89    GTGVVAAVGTGGPPFVALRADMDALPLQEEVEWDHKSKETRKMHACGHDAHTAMLLGAAR  148

Query  1186  ILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRP  1007
             IL + R  L+GTV+L+FQP EE G GAK M++ G ++NV+AIFG HV    P GVV SR 
Sbjct  149   ILHERRHDLQGTVVLLFQPGEEVGIGAKKMVEAGAVENVEAIFGFHVTVMLPTGVVGSRA  208

Query  1006  GEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVS  827
             G  LAGCG F+A I G GGHAA P   VDP++AAS+ V+SLQS+VSRE DP DSQVV+V+
Sbjct  209   GPLLAGCGFFEAVITGAGGHAATPHNIVDPVVAASSVVLSLQSLVSREADPLDSQVVTVT  268

Query  826   MIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTEN  647
               QGG +FNVIPD+  I GT+R F+ D F  LK+RIEE++ +Q+AVHRC   +DF    +
Sbjct  269   RFQGGGAFNVIPDSVAIGGTFRCFSSDGFMRLKRRIEEVIVSQSAVHRCAASVDFGAGGS  328

Query  646   PTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVE--LAPGQMGSEDFGMYLDKVPGA-FF  476
             P  P    PT+N   ++ H    ++  VG   V   +AP  MGSEDF  + + VP + F+
Sbjct  329   PLLP----PTVNAASLHAHFEAVAAETVGASAVRAAMAP-CMGSEDFASFSEAVPASHFY  383

Query  475   FIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             F+G++NE    V   HSP+F +D+D LP GAA+HA  A  YL + A
Sbjct  384   FVGIRNEGIGAVHAAHSPHFLVDDDALPYGAAMHANLAIGYLRNRA  429



>ref|XP_002963174.1| hypothetical protein SELMODRAFT_141529 [Selaginella moellendorffii]
 gb|EFJ35045.1| hypothetical protein SELMODRAFT_141529 [Selaginella moellendorffii]
Length=405

 Score =   452 bits (1163),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 224/400 (56%), Positives = 288/400 (72%), Gaps = 6/400 (2%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
             I+  AN+  TVEW+R VRR IHRNPEL +EE  TSA++RRELD +G+ YRWPVAKTGVVA
Sbjct  8     ILEAANDPGTVEWVRSVRRCIHRNPELGFEEHQTSALIRRELDGMGIPYRWPVAKTGVVA  67

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
             TIGSG  P VALRADMD LPIQE+VEWEHKSQVDGKMHACGHDAH AMLLGAA+IL + R
Sbjct  68    TIGSGDRPIVALRADMDGLPIQEMVEWEHKSQVDGKMHACGHDAHLAMLLGAARILSRRR  127

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
               LKGTVLL+FQPAEE   GA+ M+Q+G L + +AIFGLHVA + P G++A R G  LAG
Sbjct  128   HLLKGTVLLLFQPAEEGKAGAQVMVQDGALGDAEAIFGLHVAPEAPTGIIALRRGPCLAG  187

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
                F+A IKG+GGHA  P  + DPI+AAS +VISLQ +VSRE DP  +QVVSV+ I GG 
Sbjct  188   SRAFEAEIKGRGGHAGCPDHTADPIVAASFAVISLQPLVSREMDPLGNQVVSVTSISGGH  247

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
             +FNVIPD+ T+ G++R+F+K+    LK+RI++I+ +QAAVH+CT  + FD  + P +P  
Sbjct  248   TFNVIPDSVTLKGSFRSFSKEGMAKLKERIQQIIESQAAVHKCTARVVFD-ADRPMYP--  304

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
                TIND ++++HA   ++ + G   V      M +EDF  YL+++PG F  +G+ +E  
Sbjct  305   --ATINDDKLHDHASWVATSLFGSHCVRNIKPVMAAEDFSFYLERIPGMFTGLGIHSEAK  362

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPP  329
              T    HS  F +DED+LP G A  AA A  Y ++  +PP
Sbjct  363   GTTHFVHSGLFRMDEDMLPWGVAFQAAVAEAY-INELQPP  401



>ref|XP_004955918.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 9-like isoform 
X2 [Setaria italica]
Length=434

 Score =   453 bits (1165),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 224/389 (58%), Positives = 284/389 (73%), Gaps = 8/389 (2%)
 Frame = -1

Query  1492  WMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSP---PF  1322
             W+R VRR IH+ PELA++E+ TS +VR ELD +GV YRWPVA+TGVVATI  G+    P 
Sbjct  48    WLRGVRRRIHQRPELAFQEYRTSELVRAELDAIGVPYRWPVAQTGVVATIVGGAGDNGPI  107

Query  1321  VALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLL  1142
             VALRADMDALP+QELV+WE+KSQ  GKMHACGHDAHTAMLLGAAKILQ  +  LKGTV  
Sbjct  108   VALRADMDALPVQELVDWEYKSQEKGKMHACGHDAHTAMLLGAAKILQDHKSDLKGTVKF  167

Query  1141  IFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIK  962
             +FQPAEE   GA  ++Q G+LD+V AIFGLHV    PVGVVASRPG F A    F+AT+ 
Sbjct  168   VFQPAEEGQGGAYYILQEGLLDDVSAIFGLHVDPVLPVGVVASRPGPFAATAARFQATVT  227

Query  961   GKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTA  782
             GKGGHAA+P ++ DPI+AAS++++SLQ IVSRE DP    VVSV+ ++GG ++NVIP++ 
Sbjct  228   GKGGHAALPHQAFDPIVAASSAILSLQQIVSREIDPLQGAVVSVTFVKGGDAYNVIPESV  287

Query  781   TITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDVR  602
             T  GT R+   +    L KRI+EIV  Q+A+H CT  +DF   +  T+P      IND  
Sbjct  288   TFGGTLRSMTNEGLLYLMKRIKEIVEGQSAIHHCTGTVDFMEGKMRTYP----AVINDEG  343

Query  601   IYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS-ATVFPPHS  425
             +Y+HA+  +  ++GE+NV++AP  MG+EDFG Y  K+ GAFF IGV N+ +  TV   HS
Sbjct  344   MYDHAKAVAQSLLGEENVKVAPQLMGAEDFGFYAQKMAGAFFTIGVGNKSTMVTVHSTHS  403

Query  424   PYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             P+F +DEDVLP+GAA+HAA A  YL  HA
Sbjct  404   PHFVIDEDVLPIGAALHAAVATEYLKKHA  432



>gb|KCW82520.1| hypothetical protein EUGRSUZ_C03922 [Eucalyptus grandis]
Length=539

 Score =   456 bits (1174),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 215/398 (54%), Positives = 288/398 (72%), Gaps = 6/398 (2%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
              + LA + E V++M  +RR IH  PEL +EEF TS +VR ELDR+G++Y+ P+A TGVV 
Sbjct  126   FLNLAQKPEIVDYMVGIRRRIHEYPELGFEEFETSKLVRSELDRMGIQYKHPLAVTGVVG  185

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              IG+G PPFVA+RADMDAL ++E VEWEHKS+V GKMHACGHD H AMLLGAAK+LQ   
Sbjct  186   YIGTGKPPFVAIRADMDALEMEESVEWEHKSKVPGKMHACGHDGHVAMLLGAAKLLQGRL  245

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
              +L+GTV+L+FQPAEE G GAK MI +G L+NVDAIFGLH++ K+P+G VA+RPG  LA 
Sbjct  246   DELQGTVVLVFQPAEEGGGGAKKMIDDGALENVDAIFGLHLSVKFPIGAVATRPGPILAA  305

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
             CG F+A I GKGGHAAIPQ ++DP++AAS  +ISLQ ++SRE DP DSQVV+V+ I+GG 
Sbjct  306   CGFFEAVISGKGGHAAIPQHTIDPVVAASNVIISLQHLISREADPLDSQVVTVAKIEGGG  365

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
             +FNVIPD+ TI GT+R F+ D    LK+RIEE++  QA+V RC   + F  +  P +P  
Sbjct  366   AFNVIPDSVTIGGTFRVFSMDGLIQLKQRIEEVIMRQASVQRCNATVSF--SVKPFYP--  421

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
               PT N   ++EH +  +  ++G DN+      MGSEDF  Y + +PG F+++G+K+E  
Sbjct  422   --PTANHKALHEHFKNVARDMLGPDNILGMEPLMGSEDFSFYTEVIPGYFYYVGMKDESL  479

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
               +   HSP++ L+ED L  GAA+HAA A  Y+L + +
Sbjct  480   GKMEAGHSPHYRLNEDALSYGAALHAALATRYILENQQ  517



>ref|XP_003597649.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=448

 Score =   453 bits (1165),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 215/395 (54%), Positives = 283/395 (72%), Gaps = 4/395 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               + LA E +  +WM  +RR+IH NPEL+Y+EF TS ++R +LD LGV+Y+ PVA TGV+
Sbjct  41    NFLDLAKEPKVFDWMVSIRRKIHENPELSYQEFETSKLIRTKLDELGVQYKHPVAVTGVI  100

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDAL +QEL+EWEHKS+V GKMHACGHDAH AMLLGAAKIL+Q 
Sbjct  101   GYIGTGLPPFVALRADMDALLMQELLEWEHKSKVPGKMHACGHDAHVAMLLGAAKILKQH  160

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
              ++L+GTV+L+FQPAEE G GAK ++  G L+NV AIFGLHV    P+G VASR G   A
Sbjct  161   EKELQGTVVLVFQPAEEGGAGAKQILDTGALENVSAIFGLHVLSNLPLGEVASRSGPMAA  220

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             GCG F+A I G GGH AIP  ++DPILAAS  V+SLQ IVSRE DP DSQVV+V   QGG
Sbjct  221   GCGFFEAVISGMGGHGAIPHHAIDPILAASNVVVSLQQIVSREVDPVDSQVVTVGKFQGG  280

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+++SF  L+ RIE+++  QAAVHRC   ++F   E P  P 
Sbjct  281   GAFNVIPDSVTIGGTFRAFSRESFTHLRHRIEQVITGQAAVHRCNATVNFLEEETPFIP-  339

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PT+N+  ++++    +  ++G D ++     +GSEDF  Y + +PG  F +G+++  
Sbjct  340   ---PTVNNGGLHDYFESVAGRLLGVDKIKDQQPTVGSEDFAFYQEAIPGYIFLLGMEDVS  396

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
                +   HSPYF ++ED LP GAA+HA+ A  YL+
Sbjct  397   VERLPSGHSPYFKVNEDALPYGAALHASLASRYLV  431



>emb|CAA73905.1| JR3 protein [Arabidopsis thaliana]
Length=444

 Score =   453 bits (1165),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 217/400 (54%), Positives = 291/400 (73%), Gaps = 8/400 (2%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
              + + LA   +  +WM  +RR IH NPEL YEE  TS +VR EL+++GV Y++PVA TGV
Sbjct  33    SKFLTLAKRNDFFDWMVGIRRRIHENPELGYEEVETSKLVRAELEKMGVSYKYPVAVTGV  92

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
             V  +G+G  PFVALRADMDAL +QE+VEWEHKS+V GKMHACGHDAHT MLLGAAK+L++
Sbjct  93    VGYVGTGHAPFVALRADMDALAMQEMVEWEHKSKVPGKMHACGHDAHTTMLLGAAKLLKE  152

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
               ++L+GTV+L+FQPAEE G GAK +++ GVL+NV AIFGLHV ++  +G V+SR G  L
Sbjct  153   HEEELQGTVVLVFQPAEEGGGGAKKIVEAGVLENVSAIFGLHVTNQLALGQVSSREGPIL  212

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AG G FKA I GKGGHAA+PQ ++DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +G
Sbjct  213   AGSGFFKAKISGKGGHAALPQHTIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFEG  272

Query  814   GSSFNVIPDTATITGTYRA---FNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENP  644
             G +FNVIPD+ TI GT+RA   F+  SF  LKKRIE+++  QA+V+ C   +DF      
Sbjct  273   GGAFNVIPDSVTIGGTFRAFSTFSTKSFMQLKKRIEQVITRQASVNMCNATVDFIARGET  332

Query  643   TFPPTLAPTINDVRIYEHARKSSSLIVG-EDNVELAPGQMGSEDFGMYLDKVPGAFFFIG  467
              F P   PT+ND  +++  +  S  ++G E+ VE+ P  MGSEDF  Y   +PG F F+G
Sbjct  333   FFXP---PTVNDKALHQFFKNVSGDMLGIENYVEMQP-LMGSEDFSFYQQAIPGHFSFVG  388

Query  466   VKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             ++N+  + +  PHSPYF ++E++LP GA++HA+ A  YLL
Sbjct  389   MQNKARSPMASPHSPYFEVNEELLPYGASLHASMATRYLL  428



>ref|XP_004290879.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6-like [Fragaria 
vesca subsp. vesca]
Length=478

 Score =   454 bits (1168),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 218/398 (55%), Positives = 286/398 (72%), Gaps = 4/398 (1%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             + ++  A + E VEW++R+RR IH +PELA+EE  TS +VR ELDRL + YR+P+A TG+
Sbjct  84    ESVLSFAKQPENVEWLKRIRRRIHEHPELAFEEVETSRLVRAELDRLDIDYRFPLATTGI  143

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A IG+G PPFVA+RADMDALPIQE VEWEHKS+V GKMHACGHDAH  MLLGAAKIL+ 
Sbjct  144   RAWIGTGGPPFVAVRADMDALPIQEAVEWEHKSKVAGKMHACGHDAHVTMLLGAAKILKS  203

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+LIFQPAEE G GAK MI +G L++V+AIF  HV+H++P G++ SR G  L
Sbjct  204   REHLLKGTVVLIFQPAEEAGNGAKRMIGDGALEDVEAIFAAHVSHEHPTGIIGSRSGPLL  263

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AGCG F+A I G+ GH   P  SVD +LAA+ +VISLQ IVSRE +P DSQVVSV+   G
Sbjct  264   AGCGFFRAVITGRTGHGESPHHSVDAVLAAAAAVISLQGIVSREANPLDSQVVSVTAFNG  323

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             G   ++IP++  I GT RAF+  SFY L +RIEE++  QA+V+RC+  +DF   ++  +P
Sbjct  324   GDKLDMIPNSVVIGGTLRAFSNTSFYHLLQRIEEVIVEQASVYRCSGTVDFFKDKHTIYP  383

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                 PT+ND +++EH RK +  ++G  N  + P  MG+EDF  Y + +P  FF+IG++NE
Sbjct  384   ----PTVNDEKMHEHVRKVAMDLLGPTNFRVVPPMMGAEDFSFYSEVIPAGFFYIGIRNE  439

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
                +    HSPYF +DEDVLP+GAA HA  A  YL+ H
Sbjct  440   TLGSFHTGHSPYFFIDEDVLPIGAATHATIAERYLIEH  477



>ref|XP_008380826.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Malus domestica]
Length=446

 Score =   453 bits (1165),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 215/398 (54%), Positives = 281/398 (71%), Gaps = 4/398 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             +  +++  A   +  +WM  +RR+IH NPEL YEEF TS ++R ELD++ ++Y+ PV  T
Sbjct  36    IXKKLLSFAQNPQVFDWMVGIRRKIHANPELGYEEFETSELIRAELDQMSIEYKHPVGVT  95

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVV  IG+  PPFVA+RADMDAL +QE+ EW HKS+  GKMHACGHDAH AMLLGAAKIL
Sbjct  96    GVVGFIGTQKPPFVAIRADMDALTMQEMXEWVHKSKNAGKMHACGHDAHVAMLLGAAKIL  155

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             ++  Q L+GTV+L+FQPAEE G GAK MI  G L+NV AIFGLHVA+  P+  VASRPG 
Sbjct  156   KEHEQDLQGTVVLVFQPAEEGGAGAKKMIAGGALENVSAIFGLHVANHVPIAEVASRPGP  215

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLAG G F+ATI GKGGHAA+P  +VDPILAAS  ++SLQ +VSRE DP D QV++V   
Sbjct  216   FLAGAGFFEATISGKGGHAALPHHAVDPILAASNVIVSLQHLVSREADPLDXQVITVGKF  275

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             QGG +FNVIPD+  I GT+RAF  +S   LK+RI++++  QA+VHRC   ++F   E P 
Sbjct  276   QGGDAFNVIPDSVKIDGTFRAFTTESLMQLKQRIKQVITGQASVHRCLATVNFFEDEKPL  335

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
              P    PT+N   + EH R  +  ++G + V+     MGSEDF  Y + +PG F F+G+ 
Sbjct  336   SP----PTVNHKDLREHFRNVAGDMLGFEKVKDHQRWMGSEDFAYYQEAIPGYFSFLGMA  391

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
             ++    +  PHSPYF ++ED LP GAA+HA+FA  YLL
Sbjct  392   DDALGPLPMPHSPYFRINEDALPYGAALHASFAARYLL  429



>gb|AES67900.2| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=452

 Score =   453 bits (1165),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 215/395 (54%), Positives = 283/395 (72%), Gaps = 4/395 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               + LA E +  +WM  +RR+IH NPEL+Y+EF TS ++R +LD LGV+Y+ PVA TGV+
Sbjct  45    NFLDLAKEPKVFDWMVSIRRKIHENPELSYQEFETSKLIRTKLDELGVQYKHPVAVTGVI  104

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDAL +QEL+EWEHKS+V GKMHACGHDAH AMLLGAAKIL+Q 
Sbjct  105   GYIGTGLPPFVALRADMDALLMQELLEWEHKSKVPGKMHACGHDAHVAMLLGAAKILKQH  164

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
              ++L+GTV+L+FQPAEE G GAK ++  G L+NV AIFGLHV    P+G VASR G   A
Sbjct  165   EKELQGTVVLVFQPAEEGGAGAKQILDTGALENVSAIFGLHVLSNLPLGEVASRSGPMAA  224

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             GCG F+A I G GGH AIP  ++DPILAAS  V+SLQ IVSRE DP DSQVV+V   QGG
Sbjct  225   GCGFFEAVISGMGGHGAIPHHAIDPILAASNVVVSLQQIVSREVDPVDSQVVTVGKFQGG  284

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+++SF  L+ RIE+++  QAAVHRC   ++F   E P  P 
Sbjct  285   GAFNVIPDSVTIGGTFRAFSRESFTHLRHRIEQVITGQAAVHRCNATVNFLEEETPFIP-  343

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PT+N+  ++++    +  ++G D ++     +GSEDF  Y + +PG  F +G+++  
Sbjct  344   ---PTVNNGGLHDYFESVAGRLLGVDKIKDQQPTVGSEDFAFYQEAIPGYIFLLGMEDVS  400

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
                +   HSPYF ++ED LP GAA+HA+ A  YL+
Sbjct  401   VERLPSGHSPYFKVNEDALPYGAALHASLASRYLV  435



>ref|XP_011094270.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Sesamum indicum]
Length=436

 Score =   452 bits (1163),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 216/397 (54%), Positives = 280/397 (71%), Gaps = 4/397 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L   ++  A + + ++W+RRVRR IH  PELA++E  TS ++R ELD LG++Y WPVAKT
Sbjct  34    LTRELLESARDPDFLDWLRRVRRRIHEYPELAFQEELTSELIRSELDSLGIEYAWPVAKT  93

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVATIGSG+ P+  LRADMDALPIQELVEWEHKS++DGKMHACGHDAH  MLLGAAK+L
Sbjct  94    GVVATIGSGAQPWFGLRADMDALPIQELVEWEHKSKIDGKMHACGHDAHVTMLLGAAKLL  153

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q  R +LKGTV L+FQP EE   GA  MIQ+G LD V AIF LHV    P G ++ +PG 
Sbjct  154   QNNRDKLKGTVKLVFQPGEEGYAGAHYMIQDGALDGVQAIFALHVDPALPTGSLSGKPGP  213

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LAG G F   I+GKGGHAA P ++ DPI+A S ++++LQ IVSRETDP +++VVS+  +
Sbjct  214   MLAGSGRFSVIIQGKGGHAASPHKTRDPIVALSMTILALQHIVSRETDPLEARVVSIGFV  273

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             QGG + NVIP+T    GT+R  N +S+  LK+RI+E++  QA VH CT  +DF   +   
Sbjct  274   QGGEALNVIPETVKFGGTFRFMNSESYSYLKQRIKEVIETQATVHHCTAVVDFMEDKLKP  333

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             +P     TIN   +YEHA++    ++GE N++L    M +EDF  Y  K+P AFF IG +
Sbjct  334   YP----ATINHPTMYEHAKRVGENLLGEQNMQLHTMIMAAEDFSFYAQKIPAAFFMIGTR  389

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             NE   +V   HSP+F +DEDVLPVGA++HAA A  YL
Sbjct  390   NETMKSVKGLHSPHFVMDEDVLPVGASLHAAVALAYL  426



>gb|ABF55219.1| auxin conjugate hydrolase [Medicago truncatula]
Length=452

 Score =   453 bits (1165),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 215/395 (54%), Positives = 283/395 (72%), Gaps = 4/395 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               + LA E +  +WM  +RR+IH NPEL+Y+EF TS ++R +LD LGV+Y+ PVA TGV+
Sbjct  45    NFLDLAKEPKVFDWMVSIRRKIHENPELSYQEFETSKLIRTKLDELGVQYKHPVAVTGVI  104

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDAL +QEL+EWEHKS+V GKMHACGHDAH AMLLGAAKIL+Q 
Sbjct  105   GYIGTGLPPFVALRADMDALLMQELLEWEHKSKVPGKMHACGHDAHVAMLLGAAKILKQH  164

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
              ++L+GTV+L+FQPAEE G GAK ++  G L+NV AIFGLHV    P+G VASR G   A
Sbjct  165   EKELQGTVVLVFQPAEEGGAGAKQILDTGALENVSAIFGLHVLSNLPLGEVASRSGPMAA  224

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             GCG F+A I G GGH AIP  ++DPILAAS  V+SLQ IVSRE DP DSQVV+V   QGG
Sbjct  225   GCGFFEAVISGMGGHGAIPHHAIDPILAASNVVVSLQQIVSREVDPVDSQVVTVGKFQGG  284

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+++SF  L+ RIE+++  QAAVHRC   ++F   E P  P 
Sbjct  285   GAFNVIPDSVTIGGTFRAFSRESFTHLRHRIEQVITGQAAVHRCNATVNFLEEETPFIP-  343

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PT+N+  ++++    +  ++G D ++     +GSEDF  Y + +PG  F +G+++  
Sbjct  344   ---PTVNNGGLHDYFESVAGRLLGVDKIKDQQPTVGSEDFAFYQEAIPGYIFLLGMEDVS  400

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLL  347
                +   HSPYF ++ED LP GAA+HA+ A  YL+
Sbjct  401   IERLPSGHSPYFKVNEDALPYGAALHASLASRYLV  435



>ref|XP_010049575.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Eucalyptus grandis]
 gb|KCW82275.1| hypothetical protein EUGRSUZ_C03691 [Eucalyptus grandis]
Length=445

 Score =   452 bits (1164),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 214/398 (54%), Positives = 287/398 (72%), Gaps = 6/398 (2%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
              + LA + E V++M  +RR IH  PEL +EEF TS +VR ELDR+G++Y+ P+A TGVV 
Sbjct  41    FLNLAQKPEIVDYMVGIRRRIHEYPELGFEEFETSKLVRSELDRMGIQYKHPLAVTGVVG  100

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              IG+G PPFVA+RADMDAL ++E VEWEHKS+V GKMHACGHD H AMLLGAAK+LQ   
Sbjct  101   YIGTGKPPFVAIRADMDALEMEESVEWEHKSKVPGKMHACGHDGHVAMLLGAAKLLQGRL  160

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
              +L+GTV+L+FQPAEE G GAK MI +G L+NVDAIFGLH++ K+P+G VA+RPG  LA 
Sbjct  161   DELQGTVVLVFQPAEEGGGGAKKMIDDGALENVDAIFGLHLSVKFPIGAVATRPGPILAA  220

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGS  809
             CG F+A I GKGGHAAIPQ ++DP++AAS  +ISLQ ++SRE DP DSQVV+V+ I+GG 
Sbjct  221   CGFFEAVISGKGGHAAIPQHTIDPVVAASNVIISLQHLISREADPLDSQVVTVAKIEGGG  280

Query  808   SFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPT  629
             +FNVIPD+ TI GT+R F+ D    LK+RIEE++  QA+V RC   + F  +  P +P  
Sbjct  281   AFNVIPDSVTIGGTFRVFSMDGLIQLKQRIEEVIMRQASVQRCNATVSF--SVKPFYP--  336

Query  628   LAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS  449
               PT N   ++EH +  +  ++G D +      MGSEDF  Y + +PG F+++G+K+E  
Sbjct  337   --PTANHKALHEHFKNVARDMLGPDKILGMEPLMGSEDFSFYTEVIPGYFYYVGMKDESL  394

Query  448   ATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
               +   HSP++ L+ED L  GAA+HAA A  Y+L + +
Sbjct  395   GKMEAGHSPHYRLNEDALSYGAALHAALATRYILENQQ  432



>ref|XP_009608199.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Nicotiana tomentosiformis]
Length=438

 Score =   452 bits (1162),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 214/405 (53%), Positives = 286/405 (71%), Gaps = 6/405 (1%)
 Frame = -1

Query  1546  GGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVA  1367
             G L   ++  A + E ++W+RRVRR IH  PEL+++E  TS +VR ELD LGVKY WPVA
Sbjct  37    GSLTRELLESARQPEFLDWLRRVRRRIHEYPELSFQEHQTSQLVRNELDSLGVKYMWPVA  96

Query  1366  KTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAK  1187
             KTGVV TIGSG+ P+  LRADMDALP+QELV+WE+KS++DGKMHACGHDAH  MLLGAA+
Sbjct  97    KTGVVGTIGSGAQPWFGLRADMDALPLQELVDWEYKSKIDGKMHACGHDAHVTMLLGAAR  156

Query  1186  ILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRP  1007
             ++Q  R +LKGTV L+FQPAEE   GA  M++ G LD    IFGLHV    PVG + SRP
Sbjct  157   LIQNRRDKLKGTVKLVFQPAEEGYAGASYMLEEGALDGFKGIFGLHVWPFMPVGTIGSRP  216

Query  1006  GEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVS  827
             G  +AG   F A ++GKGGHAA P ++ DP+LAAS +V++LQ ++SRETDP + +VVSV+
Sbjct  217   GPIMAGSSRFTAVVQGKGGHAATPHKTKDPMLAASMAVLALQQLISRETDPLEPRVVSVT  276

Query  826   MIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTEN  647
              + GG + NVIP +    GT+R    + +  LK+RI+EI+  QA VH+C+  IDF     
Sbjct  277   FVDGGQAGNVIPASVRFGGTFRFMTLEGYSYLKQRIKEIIETQAGVHQCSATIDFMEEMR  336

Query  646   PTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIG  467
             P       PTIND  IY+H ++   +++GE+NV+ +P  M +EDFG Y  K+  AFFFIG
Sbjct  337   PYL-----PTINDPTIYDHGKRVGEILLGENNVQHSPALMAAEDFGFYSQKMATAFFFIG  391

Query  466   VKNEKSATVFPP-HSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
              +N+   +     HSPYFT+DE+VLP+GAA+HAA A +YL +H++
Sbjct  392   TQNKTDVSAIKGLHSPYFTIDEEVLPIGAALHAAVAISYLDTHSE  436



>ref|XP_010943800.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 isoform X1 [Elaeis 
guineensis]
Length=456

 Score =   452 bits (1164),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 210/392 (54%), Positives = 276/392 (70%), Gaps = 4/392 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A E E  +WM  +RR IH++PEL +EE+ TS ++R ELD LG++Y WPVAKTG+VA++GS
Sbjct  65    AREPEFFDWMTSIRRRIHQHPELGFEEYKTSELIRSELDALGIEYSWPVAKTGIVASVGS  124

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G+ P  ALRADMDALP+QELV+WE++S+  GKMHACGHDAH  MLLGAA++LQ    +LK
Sbjct  125   GASPLFALRADMDALPLQELVDWEYRSKQSGKMHACGHDAHVTMLLGAARLLQHCENKLK  184

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV LIFQP EE   GA  M+Q G L++V AIFG+HV      G +ASRPG  LA  G F
Sbjct  185   GTVKLIFQPGEEGRAGAYHMLQEGALEDVQAIFGIHVEPSLSTGAIASRPGPLLAASGRF  244

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
              ATIKGKGGHAA P  ++DPIL AS +++SLQ +VSRE+DP +S+VVSV  ++ G + NV
Sbjct  245   TATIKGKGGHAAFPHTTIDPILPASFAILSLQQLVSRESDPLESRVVSVGFVRAGEALNV  304

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ T  GT+R+   + F  L KRI+E++  QAAVHRCT  ++F       +P     T
Sbjct  305   IPDSVTFGGTFRSMKTEGFTHLSKRIKEVIETQAAVHRCTAIVEFSEKTGMPYP----AT  360

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVF  437
             +ND  +Y HA++    +VG  +V   P  MG+EDF  Y  K+P AFF++G+KNE   + +
Sbjct  361   VNDEGMYAHAKRVGEDLVGVTSVRHCPPTMGAEDFSFYSQKMPSAFFWLGIKNETLGSTY  420

Query  436   PPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
             P HSPYF +DE  LP+GAA+HAA A  YL +H
Sbjct  421   PLHSPYFFMDEQALPIGAALHAAVAMVYLDNH  452



>ref|XP_010246184.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Nelumbo nucifera]
Length=432

 Score =   452 bits (1162),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 219/407 (54%), Positives = 289/407 (71%), Gaps = 4/407 (1%)
 Frame = -1

Query  1546  GGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVA  1367
             G L   ++  A E + ++W++ +RR IH  PELA+EE+ TS ++R ELD LG+ Y WPVA
Sbjct  30    GWLTRELLESAREPQFLDWLKSIRRRIHEYPELAFEEYKTSELIRSELDSLGIAYSWPVA  89

Query  1366  KTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAK  1187
             KTGVV ++GSG  P+ +LRADMDALP+QELVEWE+KS+ +GKMHACGHDAH  MLLGAAK
Sbjct  90    KTGVVGSVGSGQQPWFSLRADMDALPLQELVEWEYKSKNNGKMHACGHDAHVTMLLGAAK  149

Query  1186  ILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRP  1007
             +LQ+ + +LKGTV L+FQPAEE   GA  M+Q G LDN+ AIFGLHV    P G +AS+P
Sbjct  150   LLQRQKNELKGTVKLVFQPAEEGRAGAYHMLQEGALDNIPAIFGLHVLPSLPSGTIASKP  209

Query  1006  GEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVS  827
             G+ LAG G F A I+GKGGHAA P ++ DP+LAAS ++++LQ I+SRETDP DS+VVSV+
Sbjct  210   GQLLAGSGRFLAIIQGKGGHAATPHKTTDPVLAASLAILALQQIISRETDPLDSKVVSVT  269

Query  826   MIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTEN  647
              I+GG + NVIP+     GT+R+   +    L++RI+E++  QAAVHRCT  +DF   E 
Sbjct  270   FIEGGQAGNVIPEAVKFGGTFRSMTSEGLCDLQERIKEVIETQAAVHRCTAVVDFMEKER  329

Query  646   PTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIG  467
               +P T     ND  +YEHA++    ++GE  V+L+P  MG+EDF  Y  K+  A F IG
Sbjct  330   RPYPATF----NDEEMYEHAKRVGESLLGEPYVQLSPMTMGAEDFSFYSQKMATALFLIG  385

Query  466   VKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPH  326
             +KNE   +  P HSP+F +DEDVLP+GAA +AA A TYL SH    H
Sbjct  386   IKNESVKSDQPLHSPHFFIDEDVLPIGAAFNAAVAITYLDSHVADTH  432



>ref|XP_002864473.1| hypothetical protein ARALYDRAFT_495757 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40732.1| hypothetical protein ARALYDRAFT_495757 [Arabidopsis lyrata subsp. 
lyrata]
Length=436

 Score =   452 bits (1162),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 220/402 (55%), Positives = 289/402 (72%), Gaps = 9/402 (2%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             ++  ++  A   +  +WM R+RR+IH NPEL YEEF TS ++R ELD LG+KYR+PVA T
Sbjct  31    IQKNLLESAKSPDVFDWMVRIRRKIHENPELGYEEFETSKLIRSELDLLGIKYRYPVAIT  90

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             G++  IG+G PPFVALRADMDALPIQE VEWEHKS++ GKMHACGHD H AMLLGAAKIL
Sbjct  91    GIIGYIGTGEPPFVALRADMDALPIQEAVEWEHKSKIPGKMHACGHDGHVAMLLGAAKIL  150

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q+ R  L+GTV+LIFQPAEE   GAK M + G L NV+AIFG+H++ + P G  ASR G 
Sbjct  151   QEHRHDLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSPRTPFGKAASRAGS  210

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             F+AG G+F+A I GKGGHAAIPQ ++DP+ AAS+ VISLQ +VSRETDP DS+VV+VS +
Sbjct  211   FMAGAGVFEAVITGKGGHAAIPQHTIDPVFAASSIVISLQQLVSRETDPLDSKVVTVSKV  270

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
              GG++FNVIPD+ TI GT RAF    F  L++RI+EI+  QAAVHRC   ++      P 
Sbjct  271   NGGNAFNVIPDSITIGGTLRAFT--GFTQLQQRIKEIITKQAAVHRCNASVNL----TPK  324

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDN-VELAPGQMGSEDFGMYLDKVPGAFFFIGV  464
                 + PT+N++ +Y+  +K    ++G++  VE AP +MGSEDF  + + +PG F  +G+
Sbjct  325   GREPMPPTVNNMDLYKQFKKVVRDLLGQEAFVEAAP-EMGSEDFSYFAETIPGHFSLLGM  383

Query  463   KNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             ++E +A     HSP + + EDVLP GAA+HA  A  YL   A
Sbjct  384   QDETNAYA-SSHSPLYRIKEDVLPYGAAIHATMAVQYLKEKA  424



>ref|XP_010483143.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2 [Camelina sativa]
Length=442

 Score =   452 bits (1162),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 222/401 (55%), Positives = 285/401 (71%), Gaps = 7/401 (2%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             +  + + LA   E  + M R+RR+IH NPEL YEEF TS ++R ELD +GVKYR+PVA T
Sbjct  37    VSKKYLELAKSPEVFDRMVRIRRKIHENPELGYEEFETSKLIRSELDLIGVKYRYPVATT  96

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GV+  IGSG PPFVALRADMDALPIQE VEWE+KS+  GKMHACGHD H AMLLGAAKIL
Sbjct  97    GVIGYIGSGEPPFVALRADMDALPIQEAVEWEYKSKNPGKMHACGHDGHVAMLLGAAKIL  156

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q+ R  L+GTV+LIFQPAEE  RGAK MI+ G L NV+AIFGLH+ ++   G  ASR G 
Sbjct  157   QEHRGDLQGTVVLIFQPAEEGLRGAKKMIEEGALKNVEAIFGLHLTNRVAFGKAASRAGP  216

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LAG G F+A I GKGGHAAIPQ ++DP++AAS+ V+SLQ +VSRETDP DS+VV+VS +
Sbjct  217   LLAGAGFFEAVISGKGGHAAIPQHTIDPVVAASSIVLSLQHLVSRETDPLDSKVVTVSKV  276

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
              GG++FNVIPD+ TI GT RAF    F  L++RI+E++  QA VHRC   ++      P 
Sbjct  277   HGGNAFNVIPDSITIGGTLRAFT--GFSQLQQRIKEVITKQATVHRCNASVNL----TPN  330

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
                 L PT+ND+ +Y+  +K    ++G++ VE A   MGSEDF  + + +PG F F+G++
Sbjct  331   GKEPLPPTVNDMDLYKQFKKVVGDLLGQEAVEEAQPLMGSEDFSKFAEVIPGHFSFLGMQ  390

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             +E        HSP + ++EDVLP GAA+HA+ A  YL   A
Sbjct  391   DETKGYA-SSHSPLYRINEDVLPYGAAIHASMAVQYLKEKA  430



>ref|XP_010037299.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Eucalyptus grandis]
 gb|KCW48985.1| hypothetical protein EUGRSUZ_K02598 [Eucalyptus grandis]
Length=440

 Score =   451 bits (1161),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 219/400 (55%), Positives = 277/400 (69%), Gaps = 4/400 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L   ++  A E E   W+R VRR IH  PELA++E  TS +VR ELD LG++Y+WPVA+T
Sbjct  41    LGRELLAAAREPEFFGWLRSVRRRIHERPELAFQEHETSRLVRSELDALGIEYKWPVAET  100

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVA+IGSG  P+ ALRADMDALP+QELVEWEHKS+ DGKMHACGHDAHT MLLGAA++L
Sbjct  101   GVVASIGSGDQPWFALRADMDALPVQELVEWEHKSKNDGKMHACGHDAHTTMLLGAARLL  160

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
                +  LKGT+ L+FQP EE   GA  M++ G LD   AIFGLHV      G V SRPG 
Sbjct  161   SGKKHSLKGTIKLVFQPGEEGRAGAYHMLREGALDQFQAIFGLHVLPLMETGSVGSRPGP  220

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LAG G F ATI+GKGGHAA P  +VDPILAA++++ +LQ I+SRETDP  +QV++V  I
Sbjct  221   MLAGAGRFSATIQGKGGHAANPHVTVDPILAAASAITALQHIISRETDPLVAQVITVGFI  280

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             +GG + NVIP+     GT+R+   D  YSLK+RI+E++  QAAVHRC   +DF   +   
Sbjct  281   EGGQALNVIPEIVRFAGTFRSMTSDGLYSLKQRIKEVIELQAAVHRCNATVDFMEEKMRP  340

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             +P     T+ND  +Y HA+  S  ++GE  V L P  MG+EDF  Y +K+  AFF IG+K
Sbjct  341   YP----ATVNDETMYGHAKGVSEALLGESRVHLLPMTMGAEDFSFYSEKMRTAFFMIGMK  396

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
             N    +    HSPYF LDE+VLP+GAA+HAA A +YL  H
Sbjct  397   NATLGSDKALHSPYFFLDEEVLPIGAALHAAVAISYLDGH  436



>ref|XP_004969012.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1-like [Setaria 
italica]
Length=447

 Score =   452 bits (1162),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 230/413 (56%), Positives = 286/413 (69%), Gaps = 8/413 (2%)
 Frame = -1

Query  1558  LAVDGGLKDRIMGL---ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGV  1388
             L     L D   GL   A E    +WM  VRR IH NPEL YEEF TS +VRRELD +G+
Sbjct  26    LGAGASLLDDPAGLLRRAKEPAFADWMVAVRRRIHENPELGYEEFETSELVRRELDAMGI  85

Query  1387  KYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTA  1208
              YR P A TGVVATIG+G PPFVALRADMDALP+QE VEWEHKS+V GKMH CGHDA+ A
Sbjct  86    PYRHPFAVTGVVATIGTGGPPFVALRADMDALPMQESVEWEHKSKVPGKMHGCGHDANVA  145

Query  1207  MLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPV  1028
             MLLG+AKILQ+   +LKGTV+L+FQPAEE G GA+ MI+ G L+NVDAIFG+HVA   P+
Sbjct  146   MLLGSAKILQEHHDELKGTVVLVFQPAEEGGGGAQKMIEAGALENVDAIFGVHVADSVPI  205

Query  1027  GVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFD  848
             GV+ASRPG  +AG G F+A I GKGGHAA+P  ++DPILAAS  ++SLQ ++SRE DP D
Sbjct  206   GVLASRPGPIMAGSGCFEAVISGKGGHAALPHHTIDPILAASNVIVSLQQLISREADPLD  265

Query  847   SQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEI  668
             SQVV++   QGG +FNVIPD+ TI GT+RAF K+SF  LK+RIE+++ +QA+V RC   +
Sbjct  266   SQVVTIGKFQGGGAFNVIPDSVTIGGTFRAFLKESFNQLKQRIEQVIVSQASVQRCNATV  325

Query  667   DFDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVP  488
             DF     P FP    PTIN   ++      +  +VG  NV      MG+EDF  Y + +P
Sbjct  326   DFLTNRIPFFP----PTINSPELHSFFVNMAGEMVGSKNVRDRQPLMGAEDFAFYAEVIP  381

Query  487   GA-FFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKP  332
                ++F+G+ N+        HS YFT++ED LP GAA  AA A  YLL H +P
Sbjct  382   STYYYFVGMYNKTRGPQASHHSTYFTVNEDALPYGAAAQAALAAHYLLEHEQP  434



>gb|KHN11323.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=444

 Score =   451 bits (1161),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 216/396 (55%), Positives = 290/396 (73%), Gaps = 6/396 (2%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A + E  +WM ++RR+IH NPEL YEEF TS ++R ELD+LG+ Y+ PVA TGV+  IG+
Sbjct  40    AKKPEVFDWMVKIRRKIHENPELGYEEFETSKLIREELDKLGISYKHPVAVTGVIGYIGT  99

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             GS PFVA+R DMDALPIQE+VEWEHKS+V GKMHAC HDAH AMLLGAAKIL+Q  +QL+
Sbjct  100   GSSPFVAIRTDMDALPIQEMVEWEHKSKVPGKMHACAHDAHVAMLLGAAKILKQHEKQLQ  159

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GT++L+FQPAEE G GAK ++  G LDNV AIFGLHV  + PVG VASR G  LAG G+F
Sbjct  160   GTIVLVFQPAEEGGAGAKKILDTGALDNVIAIFGLHVKPEIPVGEVASRSGPLLAGSGVF  219

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I+GKGGHAA+PQ S+DP++AA+  +ISLQ++VSRE DP D QV++++ +QGG +FNV
Sbjct  220   EAIIRGKGGHAALPQLSIDPVMAATNVIISLQNLVSREADPLDPQVLTIAKLQGGDAFNV  279

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD  TI GT+RAF++++   LK+RIE+++  QAAV RC   ++F   ENP +P    PT
Sbjct  280   IPDYVTIGGTFRAFSRETLEHLKQRIEQVIIGQAAVLRCNASVNFFEEENPLYP----PT  335

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQ-MGSEDFGMYLDKVPGAFFFIGVKNEKS-AT  443
             IN+  +++     +  ++G + V+    Q M +EDF  Y + +PG +F +G+KN  S   
Sbjct  336   INNGDLHKLFVDVAGNLLGINKVDTNMEQDMAAEDFAFYQEVIPGYYFTLGMKNASSFEP  395

Query  442   VFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
             V P HSPY  ++ED LP GAA+HA+ A  YL  + +
Sbjct  396   VAPLHSPYLVINEDGLPYGAALHASLATGYLTKYQR  431



>ref|XP_002459630.1| hypothetical protein SORBIDRAFT_02g007730 [Sorghum bicolor]
 gb|EER96151.1| hypothetical protein SORBIDRAFT_02g007730 [Sorghum bicolor]
Length=446

 Score =   451 bits (1161),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 226/406 (56%), Positives = 283/406 (70%), Gaps = 10/406 (2%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L D ++G A       W+R +RR IH  PELA++E  TS +VR ELD +GV Y WPVA+T
Sbjct  40    LGDDLLGAAGAPGFAAWLRGLRRRIHERPELAFQEHRTSELVRAELDAIGVPYAWPVAQT  99

Query  1360  GVVATIGSGSP------PFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLL  1199
             GVVATI  G        P VALRADMDALP+QELV+WEHKS+  GKMHACGHDAHT MLL
Sbjct  100   GVVATIAPGGGGRASDGPVVALRADMDALPLQELVDWEHKSKESGKMHACGHDAHTTMLL  159

Query  1198  GAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVV  1019
             GAAK+L   +  LKGTV LIFQP EE   GA  +I+ GVLD+V AIFGLHV  + PVG V
Sbjct  160   GAAKLLHARKDDLKGTVRLIFQPGEEGHAGAYHVIKEGVLDDVSAIFGLHVDPRLPVGTV  219

Query  1018  ASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQV  839
             +SRPG FLA  G F  TI GKGGHAA PQ++VDPI+AAS++++SLQ +V+RE DP  + V
Sbjct  220   SSRPGPFLAASGRFLVTINGKGGHAAGPQDAVDPIVAASSAIVSLQMLVAREIDPLQAAV  279

Query  838   VSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFD  659
             VSV+ ++GG + NVIP+  +  GT+R+   + F  L KRI+EI+ AQA VHRCT  IDF 
Sbjct  280   VSVTFMKGGDAHNVIPEKVSFGGTFRSLTTEGFSYLMKRIKEIIEAQATVHRCTAVIDFM  339

Query  658   GTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAF  479
               E   +P     T+ND  +Y HAR+ +  ++G++NV +    MG+EDF  Y  K  GAF
Sbjct  340   EEELRPYP----ATVNDEGMYHHAREVAETMLGQENVRVGAQLMGAEDFSFYAQKFAGAF  395

Query  478   FFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
             FFIGV+N+    ++P HSPYF +DEDVLPVGAA HAA A  YL+ H
Sbjct  396   FFIGVRNKSMEAMYPLHSPYFVIDEDVLPVGAAFHAAVAMEYLIKH  441



>ref|XP_008243486.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Prunus mume]
Length=438

 Score =   451 bits (1160),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 212/397 (53%), Positives = 279/397 (70%), Gaps = 4/397 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L   ++  A + E  +W++RVRR IH NPELA+EE  TS ++R ELD LG++Y WPVAKT
Sbjct  37    LSRELLDSARQPEFFDWLKRVRRRIHENPELAFEEHETSQLIRSELDSLGIQYTWPVAKT  96

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             G+VA+IGSG+ P+ ALRADMDALPIQELVEWEHKS+  GKMHACGHDAH  MLLGAAK+L
Sbjct  97    GLVASIGSGAQPWFALRADMDALPIQELVEWEHKSRNPGKMHACGHDAHVTMLLGAAKLL  156

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q   +++KGT+ L+FQP EE   GA  MI+ G LDN+  IFGLH+    PVG + SRPG 
Sbjct  157   QSKSKEIKGTIKLVFQPGEEEHAGAYHMIKEGALDNIQGIFGLHIQPLMPVGTIGSRPGP  216

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LAG G F  TI GKGGHAA P  + DPILAA ++V++LQ ++SRETDP D++VV+V MI
Sbjct  217   ILAGSGRFAVTIHGKGGHAAFPHLATDPILAACSAVLALQQLISRETDPLDARVVTVGMI  276

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             +GG + N+IP+T  + GT+R+   +    L++RI+E++  QA VH CT  +DF   +   
Sbjct  277   EGGQAANIIPETVRLLGTFRSMTSEGLNYLQQRIQEVIEIQALVHGCTATVDFMLEKMKP  336

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             +P     T+ND  +Y+HA+     ++GE NV+L P  MG+EDF  Y +K+  AFF IG K
Sbjct  337   YP----ATVNDEAMYKHAKNVGETLLGEPNVKLFPMSMGAEDFSFYTEKMAAAFFMIGTK  392

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             NE        HSP   +DE+VLP+GAA+HAA A +YL
Sbjct  393   NETLDPNTIWHSPNLVIDEEVLPIGAALHAAVALSYL  429



>ref|XP_009794644.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Nicotiana sylvestris]
Length=438

 Score =   451 bits (1159),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 213/403 (53%), Positives = 288/403 (71%), Gaps = 6/403 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L   ++  A E E ++W+RRVRR IH  PEL+++E  TS ++R ELD LGVKY WPVAKT
Sbjct  39    LTRELLESAREPEFLDWLRRVRRRIHEYPELSFQEHQTSQLIRNELDSLGVKYSWPVAKT  98

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             G+V +IGSG+ P+  LRADMDALP+QELV+WE+KS++DGKMHACGHDAH  MLLGAA+++
Sbjct  99    GLVGSIGSGAQPWFGLRADMDALPLQELVDWEYKSKIDGKMHACGHDAHVTMLLGAARLI  158

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q  R +LKGTV L+FQPAEE   GA  M++ G LD   AIFGLHV    PVG + SRPG 
Sbjct  159   QNRRDKLKGTVKLVFQPAEEGYAGASYMLEEGALDGFKAIFGLHVWPFMPVGTIGSRPGP  218

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              +AG   F A ++GKGGHAA P ++ DP+LAAS +V++LQ I+SRETDP + +VVSV+ +
Sbjct  219   IMAGSSRFTAVVQGKGGHAATPHKTRDPMLAASMAVLALQQIISRETDPLEPRVVSVTFV  278

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
              GG + NVIP +    GT+R    + +  LK+RI+EI+  QA VH+C+  IDF     P 
Sbjct  279   DGGQAGNVIPASVRFGGTFRFMTLEGYSYLKQRIKEIIETQAGVHQCSATIDFMEEMRP-  337

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             +P    PTIND  IY+H ++   +++GE NV+ +P  M +EDFG Y  K+  AFFFIG +
Sbjct  338   YP----PTINDPTIYDHGKRVGEILLGESNVQHSPALMAAEDFGFYSQKMATAFFFIGTQ  393

Query  460   NEKSATVFPP-HSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
             N+ + +     HSPYFT+DE+VLP+GAA+HAA A +Y+ +H++
Sbjct  394   NKTAVSAIKGLHSPYFTIDEEVLPIGAALHAAVAISYMDTHSE  436



>ref|XP_009798014.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 isoform X2 [Nicotiana 
sylvestris]
Length=433

 Score =   450 bits (1158),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 217/395 (55%), Positives = 281/395 (71%), Gaps = 5/395 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A + E  +W++RVRR IH  PELA++E  T+ ++R ELD LG+KY  PVAKTG+V TIGS
Sbjct  40    ARQPEFYDWLKRVRRRIHEYPELAFQEHRTNQLIRDELDALGIKYLSPVAKTGLVGTIGS  99

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G  P+  LRADMDALPIQELV+WE+KS++DGKMHACGHDAH  MLLGAA++LQ  R +LK
Sbjct  100   GGQPWFGLRADMDALPIQELVDWEYKSKIDGKMHACGHDAHVTMLLGAARLLQNRRDKLK  159

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV L+FQP EE   GA  M++ G LD V AIFG+HV    P G + SRPG  +AG G F
Sbjct  160   GTVKLVFQPGEEGYAGASYMLEEGALDEVQAIFGMHVWPYMPTGTIGSRPGPIMAGAGRF  219

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
              AT++GKGGHAA+P  + DPILA S +V++LQ +VSRETDP DS+VVSV+ + GG + NV
Sbjct  220   TATMQGKGGHAAMPHTTRDPILAVSMAVLALQQLVSRETDPLDSRVVSVAFVDGGQAGNV  279

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IP +    GT+R    + +  LK+RI+E++  QA VHRC+  IDF       +P    PT
Sbjct  280   IPASVQFGGTFRFLTFEDYSYLKQRIKEVIETQAGVHRCSATIDFSEELMRPYP----PT  335

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK-SATV  440
             IND  IYEHA+K   +++GE NV  AP  MG+EDF  Y  K   AFF+IG +N+  ++TV
Sbjct  336   INDPMIYEHAKKVGEVLLGEQNVHYAPITMGAEDFSFYSQKKSAAFFYIGAQNKTVTSTV  395

Query  439   FPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
                HSPYFT+DEDVLP+GAA+HAA A ++  +H +
Sbjct  396   RGLHSPYFTIDEDVLPIGAALHAAVAISHFDTHVQ  430



>ref|NP_001152128.1| IAA-amino acid hydrolase ILR1-like 4 precursor [Zea mays]
 gb|ACG45994.1| IAA-amino acid hydrolase ILR1-like 4 precursor [Zea mays]
 gb|AFW83700.1| IAA-amino acid hydrolase ILR1-like 4 [Zea mays]
Length=442

 Score =   450 bits (1158),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 224/406 (55%), Positives = 281/406 (69%), Gaps = 9/406 (2%)
 Frame = -1

Query  1546  GGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVA  1367
             G   D ++  A   E   WM  VRR IH  PELA+EE  TSA+VRRELD +GV YR PVA
Sbjct  29    GAGSDDVLRRAQRDEFAAWMAGVRRAIHERPELAFEEHETSALVRRELDAMGVAYRHPVA  88

Query  1366  KTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAK  1187
              TGVVA +G+G PPFVALRADMDALP+QE VEW+HKS+   KMHACGHDAHTAMLLGAA+
Sbjct  89    GTGVVAAVGTGGPPFVALRADMDALPLQE-VEWDHKSKETRKMHACGHDAHTAMLLGAAR  147

Query  1186  ILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRP  1007
             IL + R  L+GTV+L+FQP EE G GAK M++ G ++NV+AIFG HV    P GVV SR 
Sbjct  148   ILHERRHDLQGTVVLLFQPGEEVGIGAKKMVEAGAVENVEAIFGFHVTVMLPTGVVGSRA  207

Query  1006  GEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVS  827
             G  LAGCG F+A I G GGHAA P   VDP++AAS+ V+SLQS+VSRE DP DSQVV+V+
Sbjct  208   GPLLAGCGFFEAVITGAGGHAATPHNIVDPVVAASSVVLSLQSLVSREADPLDSQVVTVT  267

Query  826   MIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTEN  647
               QGG +FNVIPD+  I GT+R F+ D F  LK+RIEE++ +Q+AVHRC   +DF    +
Sbjct  268   RFQGGGAFNVIPDSVAIGGTFRCFSSDGFMRLKRRIEEVIVSQSAVHRCAASVDFGAGGS  327

Query  646   PTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVE--LAPGQMGSEDFGMYLDKVPGA-FF  476
             P  P    PT+N   ++ H    ++  VG   V   +AP  MGSEDF  + + VP + F+
Sbjct  328   PLLP----PTVNAASLHAHFEAVAAETVGASAVRAAMAP-CMGSEDFASFSEAVPASHFY  382

Query  475   FIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             F+G++NE    V   HSP+F +D+D LP GAA+HA  A  YL + A
Sbjct  383   FVGIRNEGIGAVHAAHSPHFLVDDDALPYGAAMHANLAIGYLRNRA  428



>ref|XP_004136498.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 7-like [Cucumis 
sativus]
 ref|XP_004169730.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 7-like [Cucumis 
sativus]
 gb|KGN59167.1| hypothetical protein Csa_3G778240 [Cucumis sativus]
Length=433

 Score =   450 bits (1157),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 214/394 (54%), Positives = 279/394 (71%), Gaps = 5/394 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A   +  +W+ R RR++H NPEL++EEF TS  +R EL+ LG+ + WPVAKTG+VA+IGS
Sbjct  40    ARNPKFFDWLVRARRKLHENPELSFEEFETSQFIRTELESLGINFTWPVAKTGIVASIGS  99

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G+ P+ ALRADMDALPIQE+VEWEHKS+ DGKMHACGHDAH  MLLGAAK+LQQ R +LK
Sbjct  100   GAHPWFALRADMDALPIQEMVEWEHKSKKDGKMHACGHDAHVTMLLGAAKLLQQRRNELK  159

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV L+FQP EE   GA  M++ G LD    IFGLH+    P+G + SR G F+AG G F
Sbjct  160   GTVKLVFQPGEEGRAGAYHMLKEGALDKFQGIFGLHIIPDLPIGTIGSRAGPFMAGSGRF  219

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +ATI+G GGHAA P ++ DP+LA S++++SLQ I+SRETDP DS+V++V  ++GG + NV
Sbjct  220   QATIQGIGGHAAWPHKARDPVLAMSSAIVSLQHIISRETDPLDSRVITVGFVKGGQAGNV  279

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IP+TAT  GT+R+   +    L+KRI+E++  QAAVH+C   +DF   +   +P     T
Sbjct  280   IPETATFGGTFRSMTVEGLSYLQKRIQEVIEVQAAVHQCNATVDFMEDKLIFYP----AT  335

Query  616   INDVRIYEHARK-SSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATV  440
             +ND  +Y HA+K    L+ GE NV      M +EDF  Y  K+P AFF IGVKNE   + 
Sbjct  336   VNDEGLYSHAKKVGEHLLGGESNVHHLSMVMAAEDFSFYSQKMPAAFFMIGVKNETMKSG  395

Query  439   FPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
              P HSPY T+DE VLPVGAA+HAA A +YL  H+
Sbjct  396   TPLHSPYITIDERVLPVGAALHAAVAISYLDEHS  429



>ref|XP_002458379.1| hypothetical protein SORBIDRAFT_03g032500 [Sorghum bicolor]
 gb|EES03499.1| hypothetical protein SORBIDRAFT_03g032500 [Sorghum bicolor]
Length=447

 Score =   450 bits (1158),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 222/395 (56%), Positives = 277/395 (70%), Gaps = 6/395 (2%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A   E   WM  VRR IH  PELA++E  TSA+VRRELD +GV YR+PVA TGVVA +G+
Sbjct  45    AQREEFAAWMTGVRRAIHERPELAFQEHETSALVRRELDAMGVAYRYPVAGTGVVAAVGT  104

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G  PFVALRADMDALP+QE VEWEHKS+   +MHACGHDAHTAMLLGAAKIL + R  L+
Sbjct  105   GGAPFVALRADMDALPLQEEVEWEHKSKEARRMHACGHDAHTAMLLGAAKILHERRHDLQ  164

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV+L+FQP EE G GAK M++ G ++NV+AIFG HV+   P GVV SR G  LAGCG F
Sbjct  165   GTVVLLFQPGEEVGMGAKQMVEAGAVENVEAIFGFHVSVMLPTGVVGSRSGPLLAGCGFF  224

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
             +A I G GGHAA P  +VDP++AAS+ V+SLQS+VSRE DP DSQVV+V+  QGG +FNV
Sbjct  225   EAVITGVGGHAAAPHITVDPVVAASSVVLSLQSLVSREADPLDSQVVTVTRFQGGGAFNV  284

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IPD+ TI GT+R F+ + F  LK+RIEE+V AQ+AVHRC   +DF    +P  P    PT
Sbjct  285   IPDSVTIGGTFRCFSSEGFLRLKRRIEEVVVAQSAVHRCAASVDFGAGGSPLLP----PT  340

Query  616   INDVRIYEHARKSSSLIVGEDNVELA-PGQMGSEDFGMYLDKVPGA-FFFIGVKNEKSAT  443
             +N   ++ H    ++  VG   V  A    MGSEDF  + + VP + F+F+G+ NE    
Sbjct  341   VNAASLHAHFEAVAAETVGAGAVRGAMEPCMGSEDFASFSEAVPASHFYFVGIGNEAIGA  400

Query  442   VFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             V   HSP+F +D+  LP GAA+HA  A  YL +HA
Sbjct  401   VHAAHSPHFFIDDGALPYGAAMHANLAIGYLRNHA  435



>gb|EYU22976.1| hypothetical protein MIMGU_mgv1a005140mg [Erythranthe guttata]
Length=495

 Score =   452 bits (1162),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 218/398 (55%), Positives = 284/398 (71%), Gaps = 8/398 (2%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             D IM +A + E V+W++ VRR IH NPELA+EE  TS ++RREL+ L + YR+P+AKTG+
Sbjct  88    DEIMRIAKKPENVKWIKSVRRRIHENPELAFEEHETSRLIRRELNELDISYRFPLAKTGI  147

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
              A +G+G+PPFVA+RADMDALPIQE VEWEHKS+  GKMHACGHDAH AMLLGAA+IL+ 
Sbjct  148   RAVVGTGAPPFVAVRADMDALPIQEAVEWEHKSKNPGKMHACGHDAHVAMLLGAARILKA  207

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
                 LKGTV+L+FQPAEE G GAK M+++G L+NV+AIF +H++H  P GV+ SR G  L
Sbjct  208   REHHLKGTVILVFQPAEEAGNGAKRMMEDGALENVEAIFAMHISHHLPTGVIGSRSGPLL  267

Query  994   AGCGMFKATIK--GKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             AGCG FKA I   G G H  I   S DP+LAAS SVISLQ IVSRE++P DSQVVSV+ +
Sbjct  268   AGCGFFKAVITTGGNGLHRNI-HNSGDPLLAASASVISLQGIVSRESNPLDSQVVSVTFL  326

Query  820   QGG-SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENP  644
             + G  + +  P +    GT RAF+  SF+ + +RIEE++ AQA V+RC+  +DF  + + 
Sbjct  327   KSGDDNLDTQPTSVEFGGTLRAFSNTSFHHILRRIEEVIIAQAKVYRCSATVDFFKSSDS  386

Query  643   TFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGV  464
              +P    P +ND R+YEH RK++  +VG  N  +    MG+EDF  Y + VP  FF+IG+
Sbjct  387   MYP----PMVNDDRMYEHLRKTAIDLVGPTNFRVVQPVMGAEDFSFYSEVVPATFFYIGI  442

Query  463   KNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             KNE   +V   HSP+F +DE+ LPVGAA HAA A  YL
Sbjct  443   KNETLGSVHSAHSPHFMIDENALPVGAATHAAVAERYL  480



>ref|XP_008442881.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Cucumis melo]
Length=433

 Score =   449 bits (1156),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 215/417 (52%), Positives = 288/417 (69%), Gaps = 16/417 (4%)
 Frame = -1

Query  1564  LPLAVDGGLKDR-----------IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAV  1418
             LP  +  G+K             ++  A + E  EW+ R RR++H NPELA+EEF TS  
Sbjct  13    LPFCISSGMKAEPPLELSRLTRDLLESARDPEFFEWLVRTRRKLHENPELAFEEFETSEF  72

Query  1417  VRRELDRLGVKYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKM  1238
             +R EL+ +G+ + WPVAKTG+VA++GSG+ P+ ALRADMDALPIQE+VEWEHKS+ DGKM
Sbjct  73    IRTELESVGINFNWPVAKTGIVASVGSGAHPWFALRADMDALPIQEMVEWEHKSKKDGKM  132

Query  1237  HACGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIF  1058
             HACGHD H  MLLGAAK+LQQ R +LKGTV L+FQP EE   GA  M++ G ++NV  IF
Sbjct  133   HACGHDVHVTMLLGAAKLLQQRRNELKGTVKLVFQPGEEGRGGAYHMVKEGAIENVKGIF  192

Query  1057  GLHVAHKYPVGVVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQS  878
             GLHVA    +G + SRPG F A  G F AT++G GGHAA+P ++ DP+LA S+++ISLQ 
Sbjct  193   GLHVAQDMTLGAIGSRPGPFTASSGRFLATVQGVGGHAALPHQAKDPLLAVSSAIISLQH  252

Query  877   IVSRETDPFDSQVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQ  698
             I+SRETDPFDS+V+SV++++GG + NVIP+T T  GT+R+   +  Y+LK+RI++++  Q
Sbjct  253   IISRETDPFDSRVISVALVKGGEAGNVIPETVTFGGTFRSKTLEGLYNLKQRIQQVIEFQ  312

Query  697   AAVHRCTVEIDFDGTENPTFPPTLAPTINDVRIYEHARK-SSSLIVGEDNVELAPGQMGS  521
              AV+ C+V +DF   E+  F P   PTIND  +Y+H       L+ G  NV   P  MG+
Sbjct  313   VAVYDCSVIVDF-MEESARFYP---PTINDQSLYDHVNNVGQHLLGGPSNVLHLPNTMGA  368

Query  520   EDFGMYLDKVPGAFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             EDF  Y  ++P  FF IG KN+   +  P HSPY  LDE+VLP+GAA+HA  A +YL
Sbjct  369   EDFSFYSQQIPAVFFMIGAKNDTMDSRIPLHSPYLILDEEVLPLGAALHAVVAISYL  425



>ref|XP_003567041.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2 [Brachypodium 
distachyon]
Length=437

 Score =   449 bits (1156),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 224/398 (56%), Positives = 279/398 (70%), Gaps = 10/398 (3%)
 Frame = -1

Query  1528  IMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVA  1349
             ++  A   E   WM  VRR IH  PELA+EE  TSA+VRRELD +GV+Y  PVA TGVVA
Sbjct  32    VLRWAKRPEFAAWMAGVRRAIHERPELAFEERETSALVRRELDAMGVRYEHPVAGTGVVA  91

Query  1348  TIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLR  1169
              +G+G PPFVALRADMDALP+QE VEWEH+S+V GKMHACGHDAHTAMLLGAA+IL + R
Sbjct  92    AVGTGRPPFVALRADMDALPLQEEVEWEHRSKVAGKMHACGHDAHTAMLLGAARILHEHR  151

Query  1168  QQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAG  989
               L+GTV+L+FQP EE G GA+ M++ G +D V+AIFG HV    P GVV SR G  LAG
Sbjct  152   HDLQGTVILLFQPGEEIGIGARKMVEAGAVDKVEAIFGFHVTVMLPTGVVGSRAGPLLAG  211

Query  988   CGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQ-GG  812
             CG F+A I GKGGHAA PQ SVDP+LAAS+ V++LQS+VSRE DP D+QVV+V+  + GG
Sbjct  212   CGFFEAVITGKGGHAATPQSSVDPVLAASSVVLALQSLVSREADPLDAQVVTVTRFRGGG  271

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              + NVIPD+ TI GT+R F+ + F  LK+RIEE++ AQAAVHRC   +DF         P
Sbjct  272   GALNVIPDSVTIGGTFRCFSNEGFARLKRRIEEVIVAQAAVHRCAAGVDFHAGGR----P  327

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVE--LAPGQMGSEDFGMYLDKVPGA--FFFIGV  464
              LAPT N   ++ H    ++  VG   V   + P  MGSEDF  + + V G   F+F+G+
Sbjct  328   LLAPTTNSAALHAHFVAVATGTVGAGGVRGGMEP-CMGSEDFAAFSEAVQGGSHFYFVGI  386

Query  463   KNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             +NE + +V   HSP F +DE  LP GAA+HA  A TYL
Sbjct  387   RNESAGSVHDAHSPLFRVDEGALPYGAAMHATLAMTYL  424



>ref|XP_002281507.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Vitis vinifera]
Length=438

 Score =   449 bits (1156),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 218/403 (54%), Positives = 282/403 (70%), Gaps = 6/403 (1%)
 Frame = -1

Query  1543  GLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAK  1364
             GL   ++  A E E  EWMR VRR+IH+ PEL +EE  TS ++R EL+ LG+ Y+WPVAK
Sbjct  32    GLSRELLESAREREFFEWMRGVRRKIHQYPELGFEEHKTSELIRAELNSLGIGYKWPVAK  91

Query  1363  TGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKI  1184
             TGVVA+IGSG  P  ALRADMDALP+QELVEWE+KS+++GKMHACGHD+H AMLLGAAK+
Sbjct  92    TGVVASIGSGDQPTFALRADMDALPLQELVEWEYKSKIEGKMHACGHDSHVAMLLGAAKL  151

Query  1183  LQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPG  1004
             LQ  R  LKGTV L+FQP EE   GA  M++ G L++V  + GLHV    P G +ASR G
Sbjct  152   LQAKRGMLKGTVKLVFQPGEEGYAGAYHMLKEGALEDVKGMLGLHVIPTVPTGGIASRAG  211

Query  1003  EFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSM  824
               LAG G+F ATI+GKGGH A P  + DP+LAAS ++++LQ IVSRETDP +++VV+V +
Sbjct  212   PLLAGVGLFSATIQGKGGHGASPHTAKDPVLAASFAILALQQIVSRETDPLEARVVTVGL  271

Query  823   IQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENP  644
             + GG + NVIP++  I GT+R+        L++RI+E++  QAAVH C   +DF   E  
Sbjct  272   VDGGEAGNVIPESVKIGGTFRSLTSQGLLYLQERIKEVIETQAAVHGCDAAVDF--MEER  329

Query  643   TFP-PTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIG  467
               P P +   IND  +YEHA+K   ++VGE NVEL P  MG+EDF  Y  + P A F +G
Sbjct  330   GMPHPVM---INDETLYEHAKKVGEILVGEPNVELLPITMGAEDFSFYTKRFPAAMFTVG  386

Query  466   VKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             +KNE   + +P HSPYF +DED  PVGAA +AA A +YL  HA
Sbjct  387   IKNETLKSDYPLHSPYFFIDEDAFPVGAAFYAAVAISYLDDHA  429



>ref|XP_006392997.1| hypothetical protein EUTSA_v10011481mg [Eutrema salsugineum]
 gb|ESQ30283.1| hypothetical protein EUTSA_v10011481mg [Eutrema salsugineum]
Length=402

 Score =   448 bits (1152),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 211/377 (56%), Positives = 284/377 (75%), Gaps = 6/377 (2%)
 Frame = -1

Query  1474  REIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSPPFVALRADMDA  1295
             R+IH NPEL YEE  TS +VR EL+++GV Y++PVA TGV+  IG+G  PFVALRADMDA
Sbjct  15    RKIHENPELGYEEVETSKLVRTELEKMGVSYKYPVAVTGVIGYIGTGQAPFVALRADMDA  74

Query  1294  LPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQPAEERG  1115
             L +QE+VEWEHKS++ GKMHACGHDAHT MLLGAA++L++ + +L+GTV+L+FQPAEE G
Sbjct  75    LSMQEMVEWEHKSKIPGKMHACGHDAHTTMLLGAARLLKEHQDELQGTVILVFQPAEEGG  134

Query  1114  RGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIKGKGGHAAIP  935
              GAK +++ GVL+NV AIFGLHV ++  +G V+SR G  LAG G F+A I GKGGHAA+P
Sbjct  135   GGAKKIVEAGVLENVSAIFGLHVTNQLALGQVSSREGPLLAGSGFFEAKISGKGGHAALP  194

Query  934   QESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTATITGTYRAF  755
             Q ++DPILAAS  ++SLQ +VSRE DP DSQVV+V+  +GG +FNVIPD+ TI GT+RAF
Sbjct  195   QHAIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAF  254

Query  754   NKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDVRIYEHARKSS  575
             +  SF  L+KRIE+++  QA+VH C   +DF     P FP    PT+ND  +++  +  S
Sbjct  255   STKSFKQLQKRIEQVITRQASVHMCNATVDFLQEVKPFFP----PTVNDKGLHQFFKNVS  310

Query  574   SLIVG-EDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVFPPHSPYFTLDEDV  398
               ++G E+ VE+ P  MGSEDF  Y + +PG F F+G++NE  + +  PHSPYF ++E++
Sbjct  311   GDMLGIENYVEMQP-LMGSEDFSFYQESMPGHFSFVGMQNEAHSPMASPHSPYFEVNEEL  369

Query  397   LPVGAAVHAAFAYTYLL  347
             LP GA++HA+ A  YLL
Sbjct  370   LPYGASLHASMATRYLL  386



>ref|XP_002891662.1| hypothetical protein ARALYDRAFT_892161 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67921.1| hypothetical protein ARALYDRAFT_892161 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score =   449 bits (1154),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 212/404 (52%), Positives = 291/404 (72%), Gaps = 4/404 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
             + + LA   +  +WM  +RR IH NPEL YEE  TS +VR EL+++GV Y++PVA TGV+
Sbjct  34    KFLSLAKRDDFFDWMVGIRRRIHENPELGYEEVETSKLVRTELEKIGVSYKYPVAVTGVI  93

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               +G+G  PFVALRADMDALPIQE+VEWEHKS++ GKMHACGHDAHT MLLGAAK+L++ 
Sbjct  94    GYVGTGHAPFVALRADMDALPIQEMVEWEHKSKIPGKMHACGHDAHTTMLLGAAKLLKEH  153

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             +++L+GTV+L+FQPAEE G GAK +++ GVL+NV AIFGLHV++   +G V+SR G  +A
Sbjct  154   QEELQGTVILVFQPAEEGGAGAKKIVEAGVLENVGAIFGLHVSNLLGLGQVSSREGLLMA  213

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G FKATI GKGGHAA+PQ ++DP+LAAS  ++SLQ +VSRE DP DSQVV+V+  +G 
Sbjct  214   GSGRFKATISGKGGHAALPQFAIDPVLAASNVILSLQHLVSREADPLDSQVVTVAKFEGS  273

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RA +  SF  LK+RIE+++  QA+V+ C   +DF   E P FP 
Sbjct  274   DAFNVIPDSVTIGGTFRALSPKSFEQLKQRIEQVITTQASVNMCNATVDFLEDETPPFP-  332

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PT+ND  ++      S  ++G +N       M SEDF  Y + +PG F F+G++N+ 
Sbjct  333   ---PTVNDKALHLFYENVSVDMLGIENYAETLPVMVSEDFAFYQEAMPGHFSFVGMQNKS  389

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHSS  320
              + +  PHSPYF ++E++LP GA++ A+ A  YLL  +  P+ S
Sbjct  390   HSPMANPHSPYFEVNEELLPYGASLLASLATRYLLESSSSPNKS  433



>gb|ABF55222.1| auxin conjugate hydrolase [Medicago truncatula]
 gb|KEH18272.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=447

 Score =   449 bits (1155),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 225/404 (56%), Positives = 293/404 (73%), Gaps = 10/404 (2%)
 Frame = -1

Query  1534  DRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGV  1355
             +  +  A   E  +WM  +RR+IH NPEL YEEF TS ++R ELD+L + Y++PVA TGV
Sbjct  36    NNFLDSAKNPEVYDWMINIRRKIHENPELGYEEFETSELIRTELDKLSIPYKYPVAITGV  95

Query  1354  VATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQ  1175
             +  IG+G  PFVALRADMDAL +QE+VEWEH+S+V GKMHACGHDAH  MLLGAAKIL+Q
Sbjct  96    IGFIGTGLSPFVALRADMDALSMQEMVEWEHRSKVPGKMHACGHDAHVTMLLGAAKILKQ  155

Query  1174  LRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFL  995
               ++++GT++L+FQPAEE G GAK ++  G L+NV AIFGLH+    P+G V+SR G  L
Sbjct  156   HEKEIQGTIVLVFQPAEEGGGGAKKILDAGALENVTAIFGLHIVPDLPIGEVSSRSGPIL  215

Query  994   AGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQG  815
             AG G F+A I GKGGHAAIPQ+S+DPILAAS ++ISLQ +VSRE DP DSQVV+++ IQG
Sbjct  216   AGSGFFEAKISGKGGHAAIPQQSIDPILAASGAIISLQHLVSREADPLDSQVVTIAKIQG  275

Query  814   GSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFP  635
             GS+FNVIPD  TI GT+RAF+K+SF  L++RIEE++  QAAVHRC   +DF     P +P
Sbjct  276   GSAFNVIPDHVTIGGTFRAFSKESFNQLRQRIEEVIIGQAAVHRCNATVDFLHGVKPFYP  335

Query  634   PTLAPTINDVRIYEHARKSSSLIVGEDNVE--LAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
                 PT+N+  ++EH    +  ++G D V+  + P  MGSEDF  Y + +PG FF +GVK
Sbjct  336   ----PTVNNADLHEHFVNVAVNMLGIDKVDSVMTP-YMGSEDFSFYQEVIPGYFFMLGVK  390

Query  460   NEKSATVFPP--HSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
             N  S   F    HSPY  ++ED LP GAA+HA+ A +YLL H +
Sbjct  391   N-ASHKRFESLLHSPYLEINEDGLPYGAALHASLAASYLLKHQR  433



>dbj|BAK01726.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   448 bits (1153),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/386 (58%), Positives = 275/386 (71%), Gaps = 5/386 (1%)
 Frame = -1

Query  1492  WMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSPPFVAL  1313
             W+R VRR IH+ PELA++E  TS +VRRELD +GV Y WPVA+TGVVATIGSG+ P VAL
Sbjct  53    WLRGVRRRIHQRPELAFQEHRTSELVRRELDAIGVPYAWPVARTGVVATIGSGAGPVVAL  112

Query  1312  RADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQ  1133
             RADMDALP+QELV+WE+KS  DGKMHACGHDAHTAMLLGAAK+LQ  ++ LKGTV L+FQ
Sbjct  113   RADMDALPVQELVDWEYKSLEDGKMHACGHDAHTAMLLGAAKLLQSRKEDLKGTVKLVFQ  172

Query  1132  PAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIKGKG  953
             PAEE   GA  +++ GVLD+V AIFGLHV    PVGVV+SRPG F A  G F AT+ GKG
Sbjct  173   PAEEGSGGAYYILEEGVLDDVSAIFGLHVDPALPVGVVSSRPGPFAATSGRFLATVTGKG  232

Query  952   GHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTATIT  773
             GHAA P +++DPI AAS +V+S+Q IVSRE DP    VVS++ ++GG ++NVIP++    
Sbjct  233   GHAAGPHDAIDPIAAASAAVLSIQQIVSREIDPLQGAVVSITFVKGGDAYNVIPESVAFG  292

Query  772   GTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDVRIYE  593
             GT R+   +    L KRI EIV  QAAVHRC+  +DF       +P      +N   +Y 
Sbjct  293   GTLRSMTDEGLSYLMKRITEIVEGQAAVHRCSASVDFMEETMRPYP----AVVNAEGMYA  348

Query  592   HARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSA-TVFPPHSPYF  416
             HA++    ++GE NV +AP  MG+EDFG Y  ++ GAFF IGV NE S   +   HSPYF
Sbjct  349   HAKEVGGRLLGEGNVRVAPQLMGAEDFGFYAQRMAGAFFTIGVGNESSMEQLRTTHSPYF  408

Query  415   TLDEDVLPVGAAVHAAFAYTYLLSHA  338
              +DED LPVGAA HAA A  Y+  HA
Sbjct  409   VIDEDALPVGAAFHAAVAIEYMEKHA  434



>ref|XP_009414583.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=434

 Score =   448 bits (1153),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 206/393 (52%), Positives = 281/393 (72%), Gaps = 4/393 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A E E  +W+  +RR IH++PELA+EE+ TS ++R ELD LG++Y WP++ TG+VA++GS
Sbjct  43    AREPEFFDWLTAIRRRIHQHPELAFEEYKTSELIRSELDALGIEYAWPISGTGIVASVGS  102

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G  P  +LRADMDALP+QELV+WE+KS+V GKMHACGHDAH  MLLGAAK+LQ  +  LK
Sbjct  103   GGGPVFSLRADMDALPLQELVDWEYKSKVSGKMHACGHDAHVTMLLGAAKLLQHRKNTLK  162

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV L+FQPAEERG GA  M+Q+G +D V+AIF LHV  +   G +ASRPG  LA  G F
Sbjct  163   GTVKLVFQPAEERGAGAYHMLQSGAIDGVEAIFTLHVDSRLTTGAIASRPGPLLAASGRF  222

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
               TIKGKGGHAA+P  +VDPI+ AS +++SLQ +VSRE+DP +S+VVS+  ++ G ++NV
Sbjct  223   VVTIKGKGGHAALPHLTVDPIIPASFAILSLQLLVSRESDPLESRVVSIGFMKAGEAYNV  282

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IP++ T  GTYR+   +  + L +RI+E++  QAAVHRCT  +DF   E   +P     T
Sbjct  283   IPESVTFGGTYRSMTTEGLFELSRRIKEVIETQAAVHRCTATVDFMEQELRPYP----AT  338

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVF  437
             +ND RIY HAR+    ++G+DNV  +   M +EDF  +  ++P A F++G+KN+     +
Sbjct  339   VNDERIYAHARRVGESLLGKDNVHESLPTMAAEDFSFFSQRMPSALFWLGIKNQTLGPGY  398

Query  436   PPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             P HSP+F LDE  LP+GAA HA+ A  YL  H+
Sbjct  399   PLHSPHFFLDEQALPIGAAFHASVAKAYLDHHS  431



>ref|XP_010558596.1| PREDICTED: IAA-amino acid hydrolase ILR1 [Tarenaya hassleriana]
Length=436

 Score =   448 bits (1153),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 218/393 (55%), Positives = 273/393 (69%), Gaps = 4/393 (1%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A E E  EWMR +RR IH NPEL +EEF TS +VR ELD LGVKY+WPVAKTGVVA IGS
Sbjct  44    AKEPEFFEWMRGLRRRIHENPELGFEEFKTSQLVRDELDSLGVKYKWPVAKTGVVAWIGS  103

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             GS P   LRADMDALP+QELVEW  KS++DGKMHACGHD H AMLLGAAK+LQ  R QLK
Sbjct  104   GSKPVFGLRADMDALPLQELVEWGSKSKIDGKMHACGHDTHVAMLLGAAKLLQSRRHQLK  163

Query  1156  GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMF  977
             GTV L+FQP EE   GA  M+Q+G+LD++D I  +HV    P G + SRPG  LAG G+F
Sbjct  164   GTVKLVFQPGEEGYAGAYHMLQDGILDDLDGILSIHVLPTLPSGGIGSRPGRILAGAGLF  223

Query  976   KATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNV  797
                I+G+GGHAA P  + DPILAAS+SV++LQ IVSRE DP +S VV+V  I+GG + NV
Sbjct  224   TVRIQGQGGHAATPHLAKDPILAASSSVVALQQIVSREMDPLESGVVTVGYIEGGHAQNV  283

Query  796   IPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPT  617
             IP+TA   GTYR+ + +    ++KRI+EIV AQA+VH+C  E+DF+  + P+  P +   
Sbjct  284   IPETAKFGGTYRSLSNEGLLHIQKRIKEIVEAQASVHQCRAEVDFE-EKMPSLHPVM---  339

Query  616   INDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVF  437
             +ND  +YEH ++ +  +VGE N       MG EDF  +  K     F +G+KNE   +  
Sbjct  340   MNDEGLYEHGKEVAEALVGEKNFHDFKVTMGGEDFSFFTQKTSAVIFVVGIKNETLGSGK  399

Query  436   PPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
               HSPYF +DE+ LPVGAA HA  A +YL  H+
Sbjct  400   SLHSPYFFVDEEALPVGAAFHAEMAMSYLDKHS  432



>ref|XP_003530010.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
Length=441

 Score =   448 bits (1152),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 214/398 (54%), Positives = 287/398 (72%), Gaps = 5/398 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L    + +A + E  +WM ++RR+IH NPEL YEEF TS ++R ELD+LGV Y+ PVA T
Sbjct  32    LSTNFLEIAKKPEVFDWMVKIRRKIHENPELGYEEFETSKLIREELDKLGVPYKHPVAVT  91

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             G++  IG+G  PFVA+R DMDALPIQE+VEWEHKS+V GKMHACGHDAH AMLLGAAKIL
Sbjct  92    GIIGFIGTGKSPFVAIRTDMDALPIQEMVEWEHKSKVPGKMHACGHDAHVAMLLGAAKIL  151

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             +Q  +QL+GTV+L+FQPAEE G GAK ++  G LDNV AIFGLHV    PVG VASR G 
Sbjct  152   KQHEKQLQGTVVLVFQPAEEGGAGAKKILDAGALDNVTAIFGLHVTPDIPVGEVASRCGP  211

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
               AG G+F+A I+GKGGHAA+PQ S+DP++AA+  +ISLQ++VSRE DP D QV++++ +
Sbjct  212   LSAGSGVFEAIIRGKGGHAALPQLSIDPVMAATNVIISLQNLVSREADPLDPQVLTIAKL  271

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             QGG +FNVIPD  TI GT+RAF+++    LK+RIE+++  QAAV RC   ++F   ENP 
Sbjct  272   QGGDAFNVIPDYVTIGGTFRAFSRERLEHLKQRIEQVIIGQAAVQRCNATVNFLDEENPL  331

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQ-MGSEDFGMYLDKVPGAFFFIGV  464
             +P    PT+N+  +++     +  ++G + V+    Q M +EDF  Y + +PG +F +G+
Sbjct  332   YP----PTVNNGDLHKFFVDVAGNLLGINKVDTNMEQDMAAEDFAFYQEFIPGYYFTLGM  387

Query  463   KNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             +   S  V P HSPY  ++ED LP GAA+HA+ A  YL
Sbjct  388   EIASSEPVAPLHSPYLVINEDGLPYGAALHASLATGYL  425



>ref|XP_010088385.1| IAA-amino acid hydrolase ILR1-like 4 [Morus notabilis]
 gb|EXB34859.1| IAA-amino acid hydrolase ILR1-like 4 [Morus notabilis]
Length=445

 Score =   448 bits (1152),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 217/405 (54%), Positives = 293/405 (72%), Gaps = 6/405 (1%)
 Frame = -1

Query  1558  LAVDGG--LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVK  1385
             L+ DG   +  + +  A + E  +WM  +RR+IH NPEL YEE  TS ++R ELD+LG+ 
Sbjct  27    LSSDGQSQIPSKFLNFAKKGEVFDWMVGIRRKIHENPELGYEEIETSKLIRAELDKLGIP  86

Query  1384  YRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAM  1205
             Y++P+A TGV   +G+G PPFVA+RADMDAL +QE+VEWEHKS++ GKMHACGHDAH AM
Sbjct  87    YKYPLAITGVTGYVGTGKPPFVAIRADMDALSMQEMVEWEHKSKIPGKMHACGHDAHVAM  146

Query  1204  LLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVG  1025
             LLGAAKIL++  ++L+GTV+L+FQPAEE G GAK M+  G L+NV+AIFGLHV  K  +G
Sbjct  147   LLGAAKILKEHEKELQGTVVLVFQPAEEGGGGAKKMLDAGTLENVNAIFGLHVDPKLALG  206

Query  1024  VVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDS  845
              VASR G  LAG G F+A I G+GGHAA+PQ S+DP+LAAS  ++SLQ +VSRE DP DS
Sbjct  207   EVASRSGPMLAGSGFFEAVISGRGGHAALPQHSIDPVLAASNVIVSLQHLVSREADPLDS  266

Query  844   QVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEID  665
             QVV+V+  QGG +FNVIPD+ TI GT+RAF+K+SF  L+ RIEE++  QA+V RC   +D
Sbjct  267   QVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFMQLRHRIEEVITGQASVQRCNATVD  326

Query  664   FDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPG  485
             F   E P FP    PT+N   ++++ R+ +  ++G   V+     MGSEDF  Y + +PG
Sbjct  327   FLENEKPFFP----PTVNHEDLHDYFRRVAGELLGIHKVKDMQPLMGSEDFSFYQEAIPG  382

Query  484   AFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
              FF +G++++    +   HSP+F ++EDV P GAA+HAA A +YL
Sbjct  383   YFFLLGMEDKTLGKLESVHSPFFQINEDVFPYGAALHAALAASYL  427



>gb|KCW48983.1| hypothetical protein EUGRSUZ_K02598 [Eucalyptus grandis]
Length=440

 Score =   447 bits (1151),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 218/400 (55%), Positives = 276/400 (69%), Gaps = 4/400 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L   ++  A E E   W+R VRR IH  PELA++E  TS +VR ELD LG++Y+WPVA+T
Sbjct  41    LGRELLAAAREPEFFGWLRSVRRRIHERPELAFQEHETSRLVRSELDALGIEYKWPVAET  100

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVA+IGSG  P+ ALRADMDALP+QELVEWEHKS+ DGKMHACGHDAHT MLLGAA++L
Sbjct  101   GVVASIGSGDQPWFALRADMDALPVQELVEWEHKSKNDGKMHACGHDAHTTMLLGAARLL  160

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
                +  LKGT+ L+FQP EE   GA  M++ G LD   AIFGLHV      G V SRPG 
Sbjct  161   SGKKHSLKGTIKLVFQPGEEGRAGAYHMLREGALDQFQAIFGLHVLPLMETGSVGSRPGP  220

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LAG G F ATI+GKGGHAA P  +VDPILAA++++ +LQ I+SRETDP  +QV++V  I
Sbjct  221   MLAGAGRFSATIQGKGGHAANPHVTVDPILAAASAITALQHIISRETDPLVAQVITVGFI  280

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             +GG + NVIP+     GT+R+   D  YSLK+RI+E++  QAAVHRC   ++F   +   
Sbjct  281   EGGQALNVIPEIVRFAGTFRSMTSDGLYSLKQRIKEVIELQAAVHRCNATVNFMEEKMRP  340

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             +P TL    ND  +Y HA+  S  ++GE  V L    M +EDFG Y +K+  AFF IG+K
Sbjct  341   YPATL----NDETMYGHAKGVSEALLGESRVHLLLMTMAAEDFGFYSEKMRTAFFMIGMK  396

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSH  341
             N    +    HSPYF LDE+VLP+GAA+HAA A +YL  H
Sbjct  397   NATLGSDKALHSPYFFLDEEVLPIGAALHAAVAISYLDGH  436



>ref|XP_002275838.2| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Vitis vinifera]
Length=429

 Score =   447 bits (1149),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 221/409 (54%), Positives = 283/409 (69%), Gaps = 7/409 (2%)
 Frame = -1

Query  1555  AVDGGLKDRI---MGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVK  1385
             AV+ GL   +   M  A E E   WMR VRR IH  PELA+EE  TS ++R ELD LG++
Sbjct  21    AVENGLGSEVGLLMDTAKEAEFFGWMRSVRRRIHEYPELAFEEHKTSQIIRSELDSLGIE  80

Query  1384  YRWPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAM  1205
             Y WPVAKTGVVA+IGSG  P+ +LRADMDALPIQELVEWEHKS+ +GKMHACGHDAH  M
Sbjct  81    YSWPVAKTGVVASIGSGKQPWFSLRADMDALPIQELVEWEHKSKYNGKMHACGHDAHVTM  140

Query  1204  LLGAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVG  1025
             LLGAA++LQ  R +LKGTV L+FQP EE   GA  +++ G LD+  AIFGLHV+   P G
Sbjct  141   LLGAARLLQNKRDELKGTVKLVFQPGEEGHAGAYHVLKEGALDDFQAIFGLHVSPGMPTG  200

Query  1024  VVASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDS  845
              V S+PG  LAG   F A IKGKGGHAA P    DP+LAAS ++++LQ IVSRETDP ++
Sbjct  201   TVGSKPGPLLAGAARFSAVIKGKGGHAASPHVGRDPVLAASLAILALQQIVSRETDPLEA  260

Query  844   QVVSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEID  665
             +V++V  I+ G + NVIP+T    GT R+   +    +++R+ +++  QAAVHRCT  ID
Sbjct  261   RVITVGFIEAGQAANVIPETVRFGGTLRSLTTEGLLYIQQRVRQVIEMQAAVHRCTATID  320

Query  664   FDGTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPG  485
             F   +   +P     T+ND  +YEHA+  + +++G+ NV L P  MG+EDF  Y  K+P 
Sbjct  321   FMEEKLTPYP----ATVNDEAMYEHAKSIAEILLGQPNVHLLPATMGAEDFSFYAQKMPA  376

Query  484   AFFFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             AFFFIG KNE   +  P HSP F +DE+ LP+GAA+HAA A +YL SHA
Sbjct  377   AFFFIGTKNETLKSDKPLHSPLFVMDEEALPIGAALHAAVAISYLESHA  425



>ref|XP_008387047.1| PREDICTED: LOW QUALITY PROTEIN: IAA-amino acid hydrolase ILR1-like 
3 [Malus domestica]
Length=435

 Score =   447 bits (1150),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 214/397 (54%), Positives = 276/397 (70%), Gaps = 4/397 (1%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L   +M  A E E  +W++RVRR IH NPELA+EE  TS ++R ELD L + Y WPVAKT
Sbjct  34    LTRELMDSAREPEFFDWLKRVRRTIHENPELAFEEEETSRLIRSELDSLEIGYTWPVAKT  93

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             G VA+IGSGS P+ ALRADMDALPIQE+VEWEHKS+  G MHACGHDAH  MLLGAAK+L
Sbjct  94    GXVASIGSGSQPWFALRADMDALPIQEMVEWEHKSKNPGXMHACGHDAHATMLLGAAKLL  153

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q+  +++KGT+ L+FQPAEE   GA  MI+ G LDN+  I GLH++ + PVG + SRPG 
Sbjct  154   QRKSKEIKGTIKLVFQPAEEGRGGAYHMIKEGALDNIQGILGLHISPEMPVGTIGSRPGP  213

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
              LA  G F  TI GKGGHAA P  + DPILAA  ++ISLQ IVSRET+P +S+VV+V  +
Sbjct  214   MLAAAGRFLVTIHGKGGHAASPHLATDPILAACLTIISLQQIVSRETNPLESRVVTVGFV  273

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
              GG + NVIP+T T+ GT+R+   +  Y L++RI+E+   QA+VHRCT  +DF   +   
Sbjct  274   DGGQAGNVIPETVTLKGTFRSMTSEGLYYLQQRIKEVTEMQASVHRCTATVDFMLEKMRP  333

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             +P     T+ND  +Y+HA+     ++GE NV+L P  MG+EDF  Y +K   AFF IG K
Sbjct  334   YP----ATVNDEAMYKHAKSVGETLLGEPNVKLLPMGMGAEDFSFYAEKXAAAFFMIGTK  389

Query  460   NEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
             N    +    HSP+  +DE+VLP+GAA HAA A +YL
Sbjct  390   NATFVSKTDLHSPFLVIDEEVLPIGAAFHAAVALSYL  426



>gb|KDP37575.1| hypothetical protein JCGZ_08266 [Jatropha curcas]
Length=438

 Score =   447 bits (1150),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 205/390 (53%), Positives = 282/390 (72%), Gaps = 4/390 (1%)
 Frame = -1

Query  1519  LANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIG  1340
             L++  +  +W+  +RR+IH+NPEL +EE  TSA++R ELDRLG+ Y +PVAKTGVVA IG
Sbjct  36    LSSAQQDKDWLVSIRRQIHQNPELRFEEHNTSALIRSELDRLGIPYEYPVAKTGVVAKIG  95

Query  1339  SGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQL  1160
              GS P VALRADMDALP+QELVEWEHKS++DGKMHACGHDAHT MLLGAA++L Q + +L
Sbjct  96    YGSRPAVALRADMDALPLQELVEWEHKSKIDGKMHACGHDAHTTMLLGAARLLNQRKHKL  155

Query  1159  KGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGM  980
             KGTV L+FQPAEE G GA  MI+ G L N +AIF +H++ + P G ++S PG  LA   +
Sbjct  156   KGTVRLLFQPAEEGGAGASHMIKEGALGNAEAIFSMHISTQLPTGKISSLPGPLLAAVSI  215

Query  979   FKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFN  800
             F+A I+GKGGHAA P  +VDP+LA S ++++LQ ++SRE DP  S+V+SV+ ++GG++ N
Sbjct  216   FEAKIEGKGGHAAEPHNNVDPVLAVSFAILALQQLISREADPLYSEVLSVTYVRGGTALN  275

Query  799   VIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAP  620
             VIP      GT R+   +  + L++R++E++  QAAVHRC   ID    E P++P     
Sbjct  276   VIPPYVQFGGTLRSLTTEGLHRLQRRMKEVIEGQAAVHRCNAYIDTKEEEYPSYP----A  331

Query  619   TINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATV  440
             T+ND ++  H ++  SL++G +NV+L    M  EDF  Y + +PG  F +G++NEK  ++
Sbjct  332   TVNDEKLNLHVQRIGSLLLGAENVKLGERVMAGEDFAFYQEMIPGVMFSVGIRNEKLGSI  391

Query  439   FPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
               PHSP+F LDED LPVGAA++AA A TYL
Sbjct  392   HSPHSPHFFLDEDALPVGAALYAALAETYL  421



>gb|KHN32672.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=687

 Score =   456 bits (1172),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 215/372 (58%), Positives = 276/372 (74%), Gaps = 4/372 (1%)
 Frame = -1

Query  1489  MRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSPPFVALR  1310
             M  +RR+IH NPEL YEEF TS ++R ELD+LG+ Y++PVA TGVV  IG+G PPFVALR
Sbjct  1     MIGIRRKIHENPELGYEEFETSKLIRTELDKLGISYKYPVAVTGVVGFIGTGLPPFVALR  60

Query  1309  ADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLLIFQP  1130
             ADMDALP+QE+VEWEHKS+V GKMHACGHDAH AMLLGAAKIL++   +++GTV+L+FQP
Sbjct  61    ADMDALPLQEMVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILKRHENEIRGTVVLVFQP  120

Query  1129  AEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIKGKGG  950
             AEE G GAK ++  GVL+N+ AIFGLH+   YP+G VASR G   AG G F+ATI G+GG
Sbjct  121   AEEGGGGAKKILDAGVLENISAIFGLHIVPTYPIGEVASRSGPIFAGSGFFEATINGRGG  180

Query  949   HAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTATITG  770
             HAAIPQ S+DPILAAS  ++SLQ IVSRE DP DSQVV+V   QGG +FNVIPD+ TI G
Sbjct  181   HAAIPQHSIDPILAASNVIVSLQHIVSREVDPLDSQVVTVGKFQGGGAFNVIPDSVTIGG  240

Query  769   TYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDVRIYEH  590
             T+RAF+K+SF  L++RIE+++  QAAV RC   ++F   E P  P    PT+N+  ++ +
Sbjct  241   TFRAFSKESFMQLRQRIEQVITGQAAVQRCNATVNFLDDEKPFSP----PTVNNGDLHGY  296

Query  589   ARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSATVFPPHSPYFTL  410
                 +  ++G +NV+     MGSEDF  Y +  PG FF +G+ N  +  +  PHSPYF +
Sbjct  297   FESVAGSLLGVNNVKEMQPLMGSEDFAFYQEVFPGYFFLLGMDNASNEHLESPHSPYFKI  356

Query  409   DEDVLPVGAAVH  374
             +ED LP GAA+H
Sbjct  357   NEDALPYGAALH  368



>sp|Q8H3C9.1|ILL7_ORYSJ RecName: Full=IAA-amino acid hydrolase ILR1-like 7; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAC20814.1| putative IAA amidohydrolase [Oryza sativa Japonica Group]
Length=455

 Score =   447 bits (1150),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 224/390 (57%), Positives = 278/390 (71%), Gaps = 9/390 (2%)
 Frame = -1

Query  1492  WMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSP----P  1325
             W+R +RR IHR+PELA+EE  TS +VR ELD +GV Y WPVA+TGVVATI  G       
Sbjct  65    WLRGLRRSIHRHPELAFEEVRTSELVRAELDAIGVPYEWPVARTGVVATIAGGDGAGAGT  124

Query  1324  FVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVL  1145
               ALRADMDALP+QELV+WEHKS+  GKMHACGHDAHT MLLGAAK+LQ  +  LKGTV 
Sbjct  125   VFALRADMDALPLQELVDWEHKSEESGKMHACGHDAHTTMLLGAAKLLQSQKDDLKGTVK  184

Query  1144  LIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATI  965
             L+FQPAEE   GA+ ++Q GVLD+V AIFGLHV  +  VG V SRPG FLA  G F ATI
Sbjct  185   LVFQPAEEGYAGARYVLQEGVLDDVSAIFGLHVDPRIQVGTVTSRPGPFLAASGRFLATI  244

Query  964   KGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDT  785
              GKGGHAA P  +VDPIL AS++++SLQ IV+RETDP ++ V+SV+ ++GG ++NVIP++
Sbjct  245   TGKGGHAAGPHNAVDPILTASSAIVSLQQIVARETDPLEAAVISVTFMKGGDAYNVIPES  304

Query  784   ATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDV  605
              +  GT+R+   +    LKKRI+EIV A A VHRCT  +DF   E   +P     T+ND 
Sbjct  305   VSFGGTFRSLTSEGLSYLKKRIKEIVEAHATVHRCTATVDFMEEERIPYP----ATVNDE  360

Query  604   RIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKSA-TVFPPH  428
              +Y HAR  +  ++GED V++    MGSEDF  Y  + P AFF IGV NE +   V+P H
Sbjct  361   GMYRHARAVAVDVLGEDGVKVGTPFMGSEDFAFYAQRFPAAFFMIGVGNETTMRKVYPLH  420

Query  427   SPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             SP+F +DEDVLPVGAA+HAA A  YL  HA
Sbjct  421   SPHFVVDEDVLPVGAALHAAVAMEYLNKHA  450



>ref|XP_003597384.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
 gb|AES67635.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=443

 Score =   447 bits (1149),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 216/394 (55%), Positives = 284/394 (72%), Gaps = 4/394 (1%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               + LA E +  +WM  +RR+IH NPEL YEEF TS ++R +LD LGV Y+ PVA TGV+
Sbjct  36    NFLELAKEPQVFDWMVDIRRKIHENPELGYEEFETSKLIRTKLDELGVTYKHPVAVTGVI  95

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRA+MDAL +QELVEWEHKS+V GKMHACGHDAH AMLLGAAKIL++ 
Sbjct  96    GYIGTGLPPFVALRAEMDALLMQELVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILKEH  155

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
              +QL+GTV+L+FQPAEE G GAK ++ +G L+NV AIFGLH+    P+G VASR G  LA
Sbjct  156   EKQLQGTVVLVFQPAEEGGGGAKKILDSGALENVSAIFGLHIGPNIPLGEVASRSGPMLA  215

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
             G G FKA I+GKGGHAA PQ ++DPILAAS  ++SLQ IVSRE DP D+QVV+V  IQGG
Sbjct  216   GGGFFKAVIRGKGGHAANPQHAIDPILAASNVIVSLQHIVSREADPLDTQVVTVGNIQGG  275

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIP+  TI GT+RAF ++SF  L++RIE+++  QAAVHRC   + F   +  ++P 
Sbjct  276   GAFNVIPNFVTIGGTFRAFLRESFTQLRQRIEQVIIGQAAVHRCNATVSFLEDKISSYP-  334

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK  452
                PTIN+  ++++ +  +  ++G D V+     MGSEDF  Y + +PG  F +G+++  
Sbjct  335   ---PTINNDSLHDYFQSVAGSLLGVDKVKGHHLLMGSEDFAFYQEAMPGYVFIVGMEDVS  391

Query  451   SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYL  350
                +   HSPYF ++EDVLP G A+H + A  YL
Sbjct  392   VERLRSWHSPYFKVNEDVLPYGVALHVSLATRYL  425



>gb|EYU18085.1| hypothetical protein MIMGU_mgv1a006848mg [Erythranthe guttata]
Length=429

 Score =   446 bits (1147),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 219/408 (54%), Positives = 282/408 (69%), Gaps = 4/408 (1%)
 Frame = -1

Query  1558  LAVDGGLKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYR  1379
             L  D  L   ++  A+++E   W+R VRR IH  PEL++EE  TS ++R ELD LG++Y 
Sbjct  26    LEFDSALARELLESASDSEFSGWLRSVRRRIHEYPELSFEERRTSQLIRSELDSLGIEYV  85

Query  1378  WPVAKTGVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLL  1199
             WPVA+TGVVAT+GSG+ P+ ALRADMDALP+QELVEWEHKS++DGKMH+CGHDAH  MLL
Sbjct  86    WPVAETGVVATVGSGAQPWFALRADMDALPMQELVEWEHKSKIDGKMHSCGHDAHVTMLL  145

Query  1198  GAAKILQQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVV  1019
             GAAK+LQ+ R +LKGTV LIFQP EE   GA  MI+ G LD V AIFGLHV    P G V
Sbjct  146   GAAKLLQKNRDKLKGTVKLIFQPGEEGHAGAYYMIKEGALDGVQAIFGLHVDPMIPTGTV  205

Query  1018  ASRPGEFLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQV  839
             +SR G  LAG G F   I+GKGGHAA P ++ DPI   S ++++LQ IVSRETDP + +V
Sbjct  206   SSRVGPLLAGAGRFTVVIQGKGGHAASPHKTRDPIPVLSMAILALQHIVSRETDPLEPRV  265

Query  838   VSVSMIQGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFD  659
             +S+  +QGG + NVIP+T T  GT+R  + +S+  LK+RI+E++  QAAVH CT  +DF 
Sbjct  266   ISIGFVQGGEALNVIPETVTFGGTFRFVSAESYAYLKQRIKEVIETQAAVHHCTAMVDFM  325

Query  658   GTENPTFPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAF  479
                   +P    PTIN   +Y+HA++    ++G+  V   P  MG+EDF  Y +KVP AF
Sbjct  326   EESLRPYP----PTINHPTMYDHAKRVGENLLGKQGVRNDPMIMGAEDFSFYAEKVPAAF  381

Query  478   FFIGVKNEKSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
             F IG KNE   +    HSP+F +DE VL VGA++HAA A  YL  HAK
Sbjct  382   FMIGAKNETMTSAKGLHSPHFVIDEGVLSVGASLHAAVAMAYLEDHAK  429



>ref|XP_010093789.1| IAA-amino acid hydrolase ILR1-like 7 [Morus notabilis]
 gb|EXB54622.1| IAA-amino acid hydrolase ILR1-like 7 [Morus notabilis]
Length=435

 Score =   446 bits (1148),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 217/402 (54%), Positives = 285/402 (71%), Gaps = 7/402 (2%)
 Frame = -1

Query  1540  LKDRIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKT  1361
             L   ++  A++ E   W+RRVRR+IH NPELA+EEF TS +VR ELD LGV+Y WPVA+T
Sbjct  39    LTRELLDSASQPEFSAWLRRVRRKIHENPELAFEEFETSQLVRSELDSLGVEYTWPVAET  98

Query  1360  GVVATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKIL  1181
             GVVA++GSG+ P+ ALRADMDA  IQELVEWEHKS+  GKMHACGHDAH  MLLGAAK+L
Sbjct  99    GVVASVGSGAQPWFALRADMDA--IQELVEWEHKSKNHGKMHACGHDAHVTMLLGAAKLL  156

Query  1180  QQLRQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGE  1001
             Q    QLKGTV L+FQPAEE   GA  ++Q   LD V AIFGLHV+ +   G + SRPG 
Sbjct  157   QSRSNQLKGTVKLVFQPAEEGRAGAYHVLQESALDKVKAIFGLHVSPEMATGTIGSRPGP  216

Query  1000  FLAGCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMI  821
             FLA  G F   I+GKGGHAA P  + DPILAAS+ +++LQ IVSRETDP ++ VV+V  I
Sbjct  217   FLAASGRFAVEIEGKGGHAAAPHVTRDPILAASSVILALQHIVSRETDPLEATVVTVGFI  276

Query  820   QGGSSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPT  641
             +GG + NVIP T    GT+R+   +  + L++RI+E++  QA+VHRC+  +DF   +   
Sbjct  277   EGGRAENVIPQTVRFGGTFRSMTSEGLFYLQQRIKEVIEIQASVHRCSATVDFMLDKRRP  336

Query  640   FPPTLAPTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVK  461
             +P     T+ND  +Y+HA++   +++GE NV L    MG+EDF  Y +K+  AFF IGVK
Sbjct  337   YP----ATVNDEEMYKHAKRVGEVLLGEPNVHLLSMSMGAEDFSFYAEKMAAAFFMIGVK  392

Query  460   NEK-SATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             N+   + +   HSPYF +DEDVLP+GAA+HAA A ++L +H+
Sbjct  393   NKSLGSNLKEVHSPYFVVDEDVLPIGAALHAAVAISFLENHS  434



>ref|NP_001148528.1| IAA-amino acid hydrolase ILR1 precursor [Zea mays]
 gb|ACG31850.1| IAA-amino acid hydrolase ILR1 precursor [Zea mays]
 gb|AFW70626.1| IAA-amino acid hydrolase ILR1 [Zea mays]
Length=434

 Score =   446 bits (1148),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 219/388 (56%), Positives = 275/388 (71%), Gaps = 5/388 (1%)
 Frame = -1

Query  1498  VEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGSGSPPFV  1319
             V W+R VRR IH+ PELA++E  TS +VR ELD +GV YRWPVA+TGVVATI   + P V
Sbjct  51    VTWLRGVRRRIHQRPELAFQEHRTSELVRAELDAIGVPYRWPVAQTGVVATIAGSAGPTV  110

Query  1318  ALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLKGTVLLI  1139
             ALRADMDALP+QE+V+W +KSQ  GKMHACGHDAHT MLLGAAK+LQ  +  LKG V L+
Sbjct  111   ALRADMDALPVQEMVDWAYKSQESGKMHACGHDAHTTMLLGAAKLLQARKGDLKGAVKLV  170

Query  1138  FQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCGMFKATIKG  959
             FQP+EE   GA  ++Q G LD V AIFGLHV    PVGVVASRPG F A  G F ATI+G
Sbjct  171   FQPSEEGYGGAYYVLQEGALDGVSAIFGLHVDPALPVGVVASRPGPFTATAGRFSATIRG  230

Query  958   KGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSFNVIPDTAT  779
             KGGHAA+P ESVDP++ A+T+++SLQ IV+RE DP    VVS++ ++GG +FNVIP++ T
Sbjct  231   KGGHAAVPHESVDPVVVAATAILSLQQIVAREVDPLHGAVVSITFVKGGEAFNVIPESVT  290

Query  778   ITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLAPTINDVRI  599
               GT R+   +    L KR++EIV   ++VH CT  +DF   E   +P       ND R+
Sbjct  291   FGGTMRSMTDEGLSYLMKRVKEIVEGHSSVHHCTASLDFMEEEMRPYP----AVANDERM  346

Query  598   YEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEKS-ATVFPPHSP  422
             Y HAR     ++GE++V++AP  MG+EDFG Y  ++ GAFF IGV NE +  TV  PHSP
Sbjct  347   YAHARAVGESLLGENHVKVAPQVMGAEDFGFYARRMAGAFFTIGVGNESTMVTVQQPHSP  406

Query  421   YFTLDEDVLPVGAAVHAAFAYTYLLSHA  338
             YF +DED LPVGAA HAA A  +L  H+
Sbjct  407   YFVIDEDALPVGAAFHAAVAIDFLKKHS  434



>gb|KHG25042.1| IAA-amino acid hydrolase ILR1-like 4 [Gossypium arboreum]
Length=437

 Score =   446 bits (1147),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 224/413 (54%), Positives = 286/413 (69%), Gaps = 25/413 (6%)
 Frame = -1

Query  1531  RIMGLANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVV  1352
               +  + + E ++WM  +RR+IH N EL YEEF TS ++R ELD +G+ Y+ P+A TGVV
Sbjct  38    NFLEFSKKPEIMDWMVNIRRKIHENRELGYEEFETSKLIRAELDLMGIPYKCPIAVTGVV  97

Query  1351  ATIGSGSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQL  1172
               IG+G PPFVALRADMDAL +      EHKS+V GKMHACGHDAH AMLLGAAK+LQ  
Sbjct  98    GYIGTGKPPFVALRADMDALAM------EHKSKVPGKMHACGHDAHVAMLLGAAKMLQHN  151

Query  1171  RQQLKGTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLA  992
             +  L+GTV+LIFQPAEE G GAK M+  G LD VDAIF LHV  + P+G+VASRPG   A
Sbjct  152   QNDLQGTVVLIFQPAEEGGGGAKIMLDEGALDKVDAIFALHVTARVPIGMVASRPGPISA  211

Query  991   GCGMFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGG  812
               G F+A I GKGGHAAIPQ +VDPILAAS  ++SLQ +VSRE DP DSQVVS++  QGG
Sbjct  212   AMGFFEAVINGKGGHAAIPQHTVDPILAASNVIVSLQHLVSREADPLDSQVVSIAKFQGG  271

Query  811   SSFNVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPP  632
              +FNVIPD+ TI GT+RAF+K+SF  L++RIEE++  QA+V RC   + FD  E   +P 
Sbjct  272   GAFNVIPDSVTIGGTFRAFSKESFLQLRQRIEEVISKQASVQRCNATVIFD--ERSMYP-  328

Query  631   TLAPTINDVRIYEHARKSSSLIVGEDN-VELAPGQMGSEDFGMYLDKVPGAFFFIGVKNE  455
                   N+  ++EH RK +  I+G +N +E+ P QMG EDF  + + +PG FFF+G+K E
Sbjct  329   ---VNSNNKELHEHFRKVAGEILGFENIIEMQP-QMGGEDFAFFSESIPGLFFFLGMK-E  383

Query  454   KSATVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAKPPHSSS*NPNRFT  296
                 V   HSPYF ++EDV P GAA+HA+ A TYLL           NP ++T
Sbjct  384   TEGAVHSGHSPYFRVNEDVFPYGAALHASLAITYLLQ----------NPTKYT  426



>ref|XP_009798013.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 isoform X1 [Nicotiana 
sylvestris]
Length=435

 Score =   446 bits (1146),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 217/397 (55%), Positives = 281/397 (71%), Gaps = 7/397 (2%)
 Frame = -1

Query  1516  ANETETVEWMRRVRREIHRNPELAYEEFATSAVVRRELDRLGVKYRWPVAKTGVVATIGS  1337
             A + E  +W++RVRR IH  PELA++E  T+ ++R ELD LG+KY  PVAKTG+V TIGS
Sbjct  40    ARQPEFYDWLKRVRRRIHEYPELAFQEHRTNQLIRDELDALGIKYLSPVAKTGLVGTIGS  99

Query  1336  GSPPFVALRADMDALPIQELVEWEHKSQVDGKMHACGHDAHTAMLLGAAKILQQLRQQLK  1157
             G  P+  LRADMDALPIQELV+WE+KS++DGKMHACGHDAH  MLLGAA++LQ  R +LK
Sbjct  100   GGQPWFGLRADMDALPIQELVDWEYKSKIDGKMHACGHDAHVTMLLGAARLLQNRRDKLK  159

Query  1156  --GTVLLIFQPAEERGRGAKDMIQNGVLDNVDAIFGLHVAHKYPVGVVASRPGEFLAGCG  983
               GTV L+FQP EE   GA  M++ G LD V AIFG+HV    P G + SRPG  +AG G
Sbjct  160   LKGTVKLVFQPGEEGYAGASYMLEEGALDEVQAIFGMHVWPYMPTGTIGSRPGPIMAGAG  219

Query  982   MFKATIKGKGGHAAIPQESVDPILAASTSVISLQSIVSRETDPFDSQVVSVSMIQGGSSF  803
              F AT++GKGGHAA+P  + DPILA S +V++LQ +VSRETDP DS+VVSV+ + GG + 
Sbjct  220   RFTATMQGKGGHAAMPHTTRDPILAVSMAVLALQQLVSRETDPLDSRVVSVAFVDGGQAG  279

Query  802   NVIPDTATITGTYRAFNKDSFYSLKKRIEEIVRAQAAVHRCTVEIDFDGTENPTFPPTLA  623
             NVIP +    GT+R    + +  LK+RI+E++  QA VHRC+  IDF       +P    
Sbjct  280   NVIPASVQFGGTFRFLTFEDYSYLKQRIKEVIETQAGVHRCSATIDFSEELMRPYP----  335

Query  622   PTINDVRIYEHARKSSSLIVGEDNVELAPGQMGSEDFGMYLDKVPGAFFFIGVKNEK-SA  446
             PTIND  IYEHA+K   +++GE NV  AP  MG+EDF  Y  K   AFF+IG +N+  ++
Sbjct  336   PTINDPMIYEHAKKVGEVLLGEQNVHYAPITMGAEDFSFYSQKKSAAFFYIGAQNKTVTS  395

Query  445   TVFPPHSPYFTLDEDVLPVGAAVHAAFAYTYLLSHAK  335
             TV   HSPYFT+DEDVLP+GAA+HAA A ++  +H +
Sbjct  396   TVRGLHSPYFTIDEDVLPIGAALHAAVAISHFDTHVQ  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5262573346098