BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19813_g4_i1 len=1210 path=[2926:0-1209]

Length=1210
                                                                      Score     E

emb|CDP02973.1|  unnamed protein product                                434   6e-145   
ref|XP_009771793.1|  PREDICTED: probable mitochondrial chaperone ...    426   3e-142   
ref|XP_009618039.1|  PREDICTED: probable mitochondrial chaperone ...    423   7e-141   
ref|XP_007014284.1|  P-loop containing nucleoside triphosphate hy...    423   3e-140   
ref|XP_010048623.1|  PREDICTED: probable mitochondrial chaperone ...    420   2e-139   
ref|XP_010048616.1|  PREDICTED: probable mitochondrial chaperone ...    417   3e-138   
ref|XP_002534483.1|  ATP binding protein, putative                      417   4e-138   Ricinus communis
ref|XP_011043981.1|  PREDICTED: probable mitochondrial chaperone ...    409   3e-135   
ref|XP_011069909.1|  PREDICTED: probable mitochondrial chaperone ...    409   8e-135   
gb|KDP36404.1|  hypothetical protein JCGZ_08673                         407   2e-134   
ref|XP_002325059.2|  hypothetical protein POPTR_0018s10140g             405   7e-134   Populus trichocarpa [western balsam poplar]
ref|XP_004296428.1|  PREDICTED: probable mitochondrial chaperone ...    406   8e-134   
ref|XP_011079303.1|  PREDICTED: probable mitochondrial chaperone ...    405   1e-133   
ref|XP_011009528.1|  PREDICTED: probable mitochondrial chaperone ...    405   2e-133   
ref|XP_002269013.2|  PREDICTED: probable mitochondrial chaperone ...    404   5e-133   Vitis vinifera
emb|CDY38300.1|  BnaA10g11480D                                          403   6e-133   
ref|XP_006401201.1|  hypothetical protein EUTSA_v10013277mg             403   9e-133   
ref|XP_006281485.1|  hypothetical protein CARUB_v10027577mg             401   7e-132   
ref|XP_009120266.1|  PREDICTED: probable mitochondrial chaperone ...    400   1e-131   
ref|XP_010093843.1|  putative mitochondrial chaperone BCS1-B            401   1e-131   
ref|XP_006381812.1|  AAA-type ATPase family protein                     399   2e-131   
ref|XP_003610132.1|  Mitochondrial chaperone BCS1                       400   2e-131   
gb|ACJ85627.1|  unknown                                                 399   2e-131   Medicago truncatula
ref|XP_003541777.1|  PREDICTED: probable mitochondrial chaperone ...    399   3e-131   
ref|XP_010536912.1|  PREDICTED: probable mitochondrial chaperone ...    399   5e-131   
ref|XP_006283565.1|  hypothetical protein CARUB_v10004616mg             398   5e-131   
ref|XP_008223701.1|  PREDICTED: probable mitochondrial chaperone ...    397   2e-130   
emb|CDY68365.1|  BnaCnng58650D                                          396   4e-130   
ref|XP_009132125.1|  PREDICTED: probable mitochondrial chaperone ...    395   6e-130   
ref|XP_007222808.1|  hypothetical protein PRUPE_ppa004191mg             396   6e-130   
ref|XP_004252618.1|  PREDICTED: probable mitochondrial chaperone ...    396   7e-130   
ref|XP_010545417.1|  PREDICTED: probable mitochondrial chaperone ...    395   8e-130   
ref|NP_200556.1|  AAA-type ATPase family protein                        395   2e-129   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD94360.1|  BCS1 like mitochondrial protein                        393   2e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010914133.1|  PREDICTED: probable mitochondrial chaperone ...    394   3e-129   
ref|XP_003549478.1|  PREDICTED: probable mitochondrial chaperone ...    394   3e-129   
ref|XP_008465640.1|  PREDICTED: probable mitochondrial chaperone ...    394   3e-129   
ref|NP_567730.1|  AAA-type ATPase family protein                        393   5e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010048619.1|  PREDICTED: probable mitochondrial chaperone ...    393   6e-129   
ref|XP_006453383.1|  hypothetical protein CICLE_v10008017mg             393   8e-129   
ref|XP_007154771.1|  hypothetical protein PHAVU_003G146400g             392   1e-128   
emb|CAB39604.1|  putative mitochondrial protein                         394   7e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008362379.1|  PREDICTED: probable mitochondrial chaperone ...    390   8e-128   
ref|XP_006413265.1|  hypothetical protein EUTSA_v10024942mg             389   3e-127   
gb|KFK27298.1|  hypothetical protein AALP_AA8G364200                    389   3e-127   
ref|XP_010443434.1|  PREDICTED: probable mitochondrial chaperone ...    389   4e-127   
ref|XP_010438828.1|  PREDICTED: probable mitochondrial chaperone ...    388   4e-127   
ref|XP_010433585.1|  PREDICTED: mitochondrial chaperone BCS1-like       387   4e-127   
ref|XP_010448362.1|  PREDICTED: probable mitochondrial chaperone ...    387   4e-127   
ref|XP_004507847.1|  PREDICTED: probable mitochondrial chaperone ...    388   7e-127   
ref|XP_010048621.1|  PREDICTED: probable mitochondrial chaperone ...    388   8e-127   
ref|XP_010259830.1|  PREDICTED: probable mitochondrial chaperone ...    387   8e-127   
ref|XP_008811298.1|  PREDICTED: probable mitochondrial chaperone ...    388   9e-127   
gb|KCW80939.1|  hypothetical protein EUGRSUZ_C02298                     386   2e-126   
ref|XP_004163719.1|  PREDICTED: LOW QUALITY PROTEIN: probable mit...    387   2e-126   
ref|XP_009139593.1|  PREDICTED: probable mitochondrial chaperone ...    386   2e-126   
ref|XP_004146314.1|  PREDICTED: probable mitochondrial chaperone ...    387   2e-126   
emb|CDX89391.1|  BnaA01g15020D                                          386   3e-126   
ref|XP_010452147.1|  PREDICTED: probable mitochondrial chaperone ...    386   4e-126   
emb|CDX88624.1|  BnaA03g10250D                                          385   9e-126   
gb|EPS73892.1|  hypothetical protein M569_00859                         385   1e-125   
gb|EYU42411.1|  hypothetical protein MIMGU_mgv1a004413mg                384   3e-125   
dbj|BAJ96296.1|  predicted protein                                      384   3e-125   
dbj|BAJ90254.1|  predicted protein                                      383   4e-125   
ref|XP_003578151.1|  PREDICTED: probable mitochondrial chaperone ...    383   6e-125   
emb|CDY71731.1|  BnaAnng38610D                                          382   1e-124   
ref|XP_010483268.1|  PREDICTED: probable mitochondrial chaperone ...    382   1e-124   
ref|XP_009137558.1|  PREDICTED: uncharacterized protein LOC103861592    384   2e-124   
emb|CDX94410.1|  BnaC01g17740D                                          380   5e-124   
emb|CDY11867.1|  BnaC03g12930D                                          379   1e-123   
emb|CDX92734.1|  BnaC07g39920D                                          379   2e-123   
gb|KCW80934.1|  hypothetical protein EUGRSUZ_C02293                     376   1e-122   
ref|XP_010048618.1|  PREDICTED: mitochondrial chaperone BCS1-like       376   3e-122   
ref|XP_009403322.1|  PREDICTED: cell division cycle protein 48-like     375   5e-122   
ref|XP_010048617.1|  PREDICTED: probable mitochondrial chaperone ...    374   1e-121   
dbj|BAD33929.1|  AAA ATPase, central region (50.1 kD)-like protein      372   1e-120   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ09202.1|  hypothetical protein OsI_31476                          372   1e-120   Oryza sativa Indica Group [Indian rice]
gb|KCW80933.1|  hypothetical protein EUGRSUZ_C02292                     372   2e-120   
ref|XP_008652752.1|  PREDICTED: uncharacterized protein LOC103632797    372   2e-120   
ref|XP_006845620.1|  hypothetical protein AMTR_s00019p00215810          370   3e-120   
ref|XP_009391104.1|  PREDICTED: 26S protease regulatory subunit 6...    369   2e-119   
ref|XP_010688491.1|  PREDICTED: uncharacterized protein LOC104902414    368   6e-119   
ref|XP_010433009.1|  PREDICTED: probable mitochondrial chaperone ...    368   6e-119   
ref|XP_004956922.1|  PREDICTED: uncharacterized protein LOC101755746    367   2e-118   
emb|CAB52469.1|  putative protein                                       366   3e-118   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194754.2|  P-loop containing nucleoside triphosphate hydro...    366   3e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010525735.1|  PREDICTED: probable mitochondrial chaperone ...    365   5e-118   
ref|XP_009401058.1|  PREDICTED: 26S protease regulatory subunit 6...    364   9e-118   
ref|XP_002462425.1|  hypothetical protein SORBIDRAFT_02g025400          365   1e-117   Sorghum bicolor [broomcorn]
ref|XP_010438199.1|  PREDICTED: probable mitochondrial chaperone ...    364   1e-117   
emb|CDX68638.1|  BnaC01g08150D                                          362   6e-117   
ref|XP_006412729.1|  hypothetical protein EUTSA_v10024925mg             362   1e-116   
ref|XP_010447746.1|  PREDICTED: probable mitochondrial chaperone ...    361   2e-116   
ref|XP_006285065.1|  hypothetical protein CARUB_v10006378mg             360   4e-116   
ref|XP_009127960.1|  PREDICTED: uncharacterized protein LOC103852809    357   3e-114   
ref|XP_009401574.1|  PREDICTED: mitochondrial chaperone BCS1-like       355   4e-114   
emb|CDY28172.1|  BnaA01g06770D                                          355   5e-114   
gb|KFK29582.1|  hypothetical protein AALP_AA7G153000                    355   6e-114   
ref|XP_010048638.1|  PREDICTED: probable mitochondrial chaperone ...    346   4e-112   
ref|XP_010051018.1|  PREDICTED: probable mitochondrial chaperone ...    348   1e-111   
gb|KCW80938.1|  hypothetical protein EUGRSUZ_C02297                     346   9e-111   
ref|XP_010048620.1|  PREDICTED: probable mitochondrial chaperone ...    346   1e-110   
ref|XP_006360731.1|  PREDICTED: probable mitochondrial chaperone ...    338   7e-108   
ref|XP_004163178.1|  PREDICTED: LOW QUALITY PROTEIN: probable mit...    335   3e-107   
gb|KGN61090.1|  hypothetical protein Csa_2G047830                       331   9e-106   
ref|XP_004149097.1|  PREDICTED: probable mitochondrial chaperone ...    331   1e-105   
gb|KHN22702.1|  Putative mitochondrial chaperone BCS1-B                 327   1e-105   
gb|KCW80930.1|  hypothetical protein EUGRSUZ_C02289                     325   9e-104   
ref|XP_010048637.1|  PREDICTED: probable mitochondrial chaperone ...    321   2e-102   
gb|EMT02652.1|  Putative mitochondrial chaperone BCS1-B                 303   2e-95    
gb|KDP20377.1|  hypothetical protein JCGZ_05260                         298   6e-92    
gb|ADE76156.1|  unknown                                                 295   2e-91    
gb|ABR16643.1|  unknown                                                 292   2e-90    Picea sitchensis
ref|XP_010425638.1|  PREDICTED: probable mitochondrial chaperone ...    292   5e-90    
ref|NP_001066678.1|  Os12g0431100                                       290   1e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002512196.1|  ATP binding protein, putative                      291   3e-89    Ricinus communis
ref|XP_009122028.1|  PREDICTED: probable mitochondrial chaperone ...    290   3e-89    
ref|XP_007014067.1|  ATP binding protein, putative                      289   1e-88    
ref|XP_002466265.1|  hypothetical protein SORBIDRAFT_01g004740          290   1e-88    Sorghum bicolor [broomcorn]
gb|KCW45486.1|  hypothetical protein EUGRSUZ_L00796                     283   1e-88    
ref|XP_006285394.1|  hypothetical protein CARUB_v10006799mg             288   2e-88    
gb|ABA97668.2|  Cell Division Protein AAA ATPase family, putative...    289   2e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010514564.1|  PREDICTED: probable mitochondrial chaperone ...    287   2e-88    
ref|XP_002267624.1|  PREDICTED: uncharacterized protein LOC100263212    288   2e-88    Vitis vinifera
ref|XP_008808726.1|  PREDICTED: probable mitochondrial chaperone ...    288   2e-88    
ref|XP_010040094.1|  PREDICTED: probable mitochondrial chaperone ...    284   3e-88    
ref|XP_006651919.1|  PREDICTED: ATP-dependent zinc metalloproteas...    284   4e-88    
gb|KCW45481.1|  hypothetical protein EUGRSUZ_L007902                    281   4e-88    
gb|ABK27085.1|  unknown                                                 282   7e-88    Picea sitchensis
ref|XP_002276524.2|  PREDICTED: probable mitochondrial chaperone ...    285   8e-88    Vitis vinifera
gb|KCW52812.1|  hypothetical protein EUGRSUZ_J021472                    282   1e-87    
gb|KCW52814.1|  hypothetical protein EUGRSUZ_J021482                    281   1e-87    
ref|XP_008777474.1|  PREDICTED: probable mitochondrial chaperone ...    286   1e-87    
gb|KFK33171.1|  hypothetical protein AALP_AA6G339600                    286   1e-87    
ref|XP_009125282.1|  PREDICTED: probable mitochondrial chaperone ...    285   2e-87    
ref|XP_006292778.1|  hypothetical protein CARUB_v10019028mg             284   3e-87    
ref|NP_198816.1|  AAA-type ATPase family protein                        284   4e-87    Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10224.1|  unnamed protein product                                284   4e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010098650.1|  putative mitochondrial chaperone bcs1              286   5e-87    
gb|KEH38185.1|  chaperone BCS1-A-like protein, putative                 285   8e-87    
ref|XP_004488574.1|  PREDICTED: uncharacterized protein LOC101489676    285   8e-87    
ref|XP_008777056.1|  PREDICTED: mitochondrial chaperone BCS1-like       284   8e-87    
ref|XP_003577966.1|  PREDICTED: peroxisomal biogenesis factor 6-like    285   9e-87    
ref|XP_006405564.1|  hypothetical protein EUTSA_v10028293mg             283   9e-87    
ref|NP_001169714.1|  hypothetical protein precursor                     285   1e-86    Zea mays [maize]
gb|EMS56860.1|  putative mitochondrial chaperone BCS1-B                 280   1e-86    
ref|XP_002443666.1|  hypothetical protein SORBIDRAFT_08g023140          284   1e-86    Sorghum bicolor [broomcorn]
ref|XP_010040092.1|  PREDICTED: probable mitochondrial chaperone ...    284   2e-86    
ref|XP_009139945.1|  PREDICTED: probable mitochondrial chaperone ...    282   2e-86    
ref|XP_011093400.1|  PREDICTED: mitochondrial chaperone BCS1-like       283   2e-86    
ref|XP_010034623.1|  PREDICTED: probable mitochondrial chaperone ...    282   2e-86    
gb|KCW45485.1|  hypothetical protein EUGRSUZ_L00795                     283   2e-86    
ref|XP_010257525.1|  PREDICTED: uncharacterized protein LOC104597594    283   3e-86    
emb|CAN62143.1|  hypothetical protein VITISV_023956                     283   3e-86    Vitis vinifera
ref|XP_004151742.1|  PREDICTED: probable mitochondrial chaperone ...    282   4e-86    
ref|XP_010255848.1|  PREDICTED: mitochondrial respiratory chain c...    283   4e-86    
ref|XP_010502856.1|  PREDICTED: probable mitochondrial chaperone ...    281   5e-86    
ref|XP_009614445.1|  PREDICTED: probable mitochondrial chaperone ...    282   5e-86    
gb|KFK33165.1|  hypothetical protein AALP_AA6G338900                    281   5e-86    
ref|XP_010265413.1|  PREDICTED: probable mitochondrial chaperone ...    283   5e-86    
gb|AGT16562.1|  hypothetical protein SHCRBa_008_G08_R_120               281   6e-86    
ref|XP_007032414.1|  P-loop containing nucleoside triphosphate hy...    280   6e-86    
ref|XP_009369380.1|  PREDICTED: probable mitochondrial chaperone ...    282   7e-86    
gb|ACG28844.1|  ATPase 3                                                281   7e-86    Zea mays [maize]
ref|XP_008393095.1|  PREDICTED: probable mitochondrial chaperone ...    281   7e-86    
gb|ACF83668.1|  unknown                                                 281   8e-86    Zea mays [maize]
ref|XP_011009649.1|  PREDICTED: uncharacterized protein LOC105114707    282   8e-86    
ref|XP_010243399.1|  PREDICTED: ATPase family gene 2 protein-like       282   9e-86    
ref|XP_009365053.1|  PREDICTED: uncharacterized protein LOC103954926    283   9e-86    
ref|XP_007032410.1|  P-loop containing nucleoside triphosphate hy...    282   9e-86    
ref|XP_008351823.1|  PREDICTED: probable mitochondrial chaperone ...    281   1e-85    
emb|CAH10048.1|  Cell Division Protein AAA ATPase family                281   1e-85    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010441108.1|  PREDICTED: probable mitochondrial chaperone ...    280   1e-85    
ref|XP_006658361.1|  PREDICTED: probable mitochondrial chaperone ...    280   1e-85    
ref|XP_003531459.1|  PREDICTED: uncharacterized protein LOC100783574    281   1e-85    
ref|XP_003578011.1|  PREDICTED: uncharacterized protein LOC100830055    281   1e-85    
ref|XP_004233689.1|  PREDICTED: mitochondrial chaperone BCS1-like       280   1e-85    
ref|XP_002443667.1|  hypothetical protein SORBIDRAFT_08g023150          281   1e-85    Sorghum bicolor [broomcorn]
gb|EMS53863.1|  putative mitochondrial chaperone BCS1-B                 281   1e-85    
dbj|BAB02175.1|  mitochondrial protein-like                             280   1e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002441611.1|  hypothetical protein SORBIDRAFT_09g030310          280   2e-85    Sorghum bicolor [broomcorn]
ref|NP_189501.2|  AAA-type ATPase family protein                        280   2e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008231398.1|  PREDICTED: uncharacterized protein LOC103330578    282   2e-85    
ref|XP_006338493.1|  PREDICTED: probable mitochondrial chaperone ...    281   2e-85    
ref|XP_006482802.1|  PREDICTED: uncharacterized protein LOC102622284    281   2e-85    
ref|XP_006439008.1|  hypothetical protein CICLE_v10031208mg             281   2e-85    
gb|KDO46037.1|  hypothetical protein CISIN_1g009640mg                   281   2e-85    
ref|NP_001051601.1|  Os03g0802500                                       281   2e-85    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ92113.1|  predicted protein                                      281   2e-85    
ref|XP_009791983.1|  PREDICTED: ATPase family gene 2 protein-like       281   2e-85    
ref|XP_009343451.1|  PREDICTED: probable mitochondrial chaperone ...    281   2e-85    
ref|XP_010040090.1|  PREDICTED: probable mitochondrial chaperone ...    280   2e-85    
ref|XP_004961038.1|  PREDICTED: probable mitochondrial chaperone ...    279   2e-85    
ref|XP_010450752.1|  PREDICTED: probable mitochondrial chaperone ...    279   2e-85    
ref|XP_010033227.1|  PREDICTED: mitochondrial respiratory chain c...    280   3e-85    
ref|XP_004229339.1|  PREDICTED: putative cell division cycle ATPase     280   3e-85    
ref|XP_009396944.1|  PREDICTED: probable mitochondrial chaperone ...    279   3e-85    
ref|XP_007149116.1|  hypothetical protein PHAVU_005G042400g             280   3e-85    
ref|XP_006369479.1|  hypothetical protein POPTR_0001s23830g             281   3e-85    
ref|NP_189502.2|  P-loop containing nucleoside triphosphate hydro...    279   4e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008670935.1|  PREDICTED: uncharacterized protein LOC103648227    281   4e-85    
emb|CAH10203.1|  Cell Division Protein AAA ATPase family                280   4e-85    Triticum aestivum [Canadian hard winter wheat]
emb|CDP07666.1|  unnamed protein product                                281   4e-85    
ref|XP_002313465.2|  hypothetical protein POPTR_0009s02930g             280   4e-85    Populus trichocarpa [western balsam poplar]
ref|XP_007218964.1|  hypothetical protein PRUPE_ppa003630mg             281   4e-85    
ref|XP_010236721.1|  PREDICTED: ATP-dependent zinc metalloproteas...    280   4e-85    
ref|XP_006600663.1|  PREDICTED: probable mitochondrial chaperone ...    280   4e-85    
ref|NP_198817.1|  AAA-ATPase 1                                          280   4e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008461752.1|  PREDICTED: mitochondrial chaperone BCS1-like       280   5e-85    
ref|XP_010917250.1|  PREDICTED: uncharacterized protein LOC105041886    280   5e-85    
ref|XP_010029271.1|  PREDICTED: probable mitochondrial chaperone ...    279   6e-85    
dbj|BAK01905.1|  predicted protein                                      280   6e-85    
ref|XP_008354934.1|  PREDICTED: uncharacterized protein LOC103418605    281   6e-85    
ref|XP_006602892.1|  PREDICTED: probable mitochondrial chaperone ...    279   6e-85    
ref|XP_006603849.1|  PREDICTED: probable mitochondrial chaperone ...    277   8e-85    
ref|XP_003525061.1|  PREDICTED: probable mitochondrial chaperone ...    279   8e-85    
ref|XP_009594242.1|  PREDICTED: probable mitochondrial chaperone ...    279   8e-85    
ref|XP_010042533.1|  PREDICTED: ATP-dependent zinc metalloproteas...    279   8e-85    
ref|XP_009617194.1|  PREDICTED: ATPase family gene 2 protein-like       279   9e-85    
ref|XP_010906692.1|  PREDICTED: probable mitochondrial chaperone ...    278   9e-85    
ref|XP_010272180.1|  PREDICTED: peroxisomal biogenesis factor 6         281   1e-84    
ref|NP_001148126.1|  ATPase 3                                           278   1e-84    Zea mays [maize]
gb|AAV49983.1|  ATPase 2                                                279   1e-84    Hordeum vulgare subsp. vulgare [barley]
dbj|BAJ97121.1|  predicted protein                                      280   1e-84    
ref|XP_006439684.1|  hypothetical protein CICLE_v10019846mg             278   1e-84    
ref|XP_004302367.1|  PREDICTED: mitochondrial chaperone BCS1-like       277   1e-84    
ref|XP_010040096.1|  PREDICTED: 26S protease regulatory subunit 4...    281   1e-84    
ref|XP_006664528.1|  PREDICTED: vesicle-fusing ATPase 1-like            280   1e-84    
ref|XP_010435957.1|  PREDICTED: 26S protease regulatory subunit 6...    278   1e-84    
ref|XP_009795973.1|  PREDICTED: probable mitochondrial chaperone ...    278   1e-84    
emb|CDY00125.1|  BnaC09g01760D                                          277   1e-84    
ref|XP_010933985.1|  PREDICTED: mitochondrial chaperone BCS1-like...    278   2e-84    
ref|XP_007139617.1|  hypothetical protein PHAVU_008G044800g             278   2e-84    
ref|XP_009150457.1|  PREDICTED: probable mitochondrial chaperone ...    278   2e-84    
gb|KHN34192.1|  Putative mitochondrial chaperone BCS1-B                 277   2e-84    
gb|EMT21356.1|  Putative mitochondrial chaperone bcs1                   278   2e-84    
gb|ACU20008.1|  unknown                                                 274   2e-84    Glycine max [soybeans]
ref|XP_010670348.1|  PREDICTED: probable mitochondrial chaperone ...    276   2e-84    
ref|XP_006409417.1|  hypothetical protein EUTSA_v10023056mg             276   2e-84    
gb|KCW49361.1|  hypothetical protein EUGRSUZ_K02905                     277   3e-84    
ref|XP_010933978.1|  PREDICTED: probable mitochondrial chaperone ...    278   3e-84    
ref|XP_004981386.1|  PREDICTED: uncharacterized protein LOC101785894    277   3e-84    
ref|XP_010678629.1|  PREDICTED: probable mitochondrial chaperone ...    278   3e-84    
ref|XP_006359141.1|  PREDICTED: putative cell division cycle ATPa...    278   3e-84    
ref|XP_004299617.1|  PREDICTED: uncharacterized protein LOC101309...    277   3e-84    
ref|XP_006292928.1|  hypothetical protein CARUB_v10019198mg             278   3e-84    
gb|ACO87685.1|  AAA-ATPase                                              277   3e-84    Brachypodium sylvaticum
ref|XP_006661289.1|  PREDICTED: mitochondrial chaperone BCS1-like       275   3e-84    
ref|XP_010933968.1|  PREDICTED: probable mitochondrial chaperone ...    277   4e-84    
ref|XP_009396943.1|  PREDICTED: probable mitochondrial chaperone ...    276   4e-84    
ref|NP_189499.1|  AAA-type ATPase family protein                        277   4e-84    Arabidopsis thaliana [mouse-ear cress]
gb|EYU20785.1|  hypothetical protein MIMGU_mgv1a005135mg                277   4e-84    
ref|XP_010435966.1|  PREDICTED: probable mitochondrial chaperone ...    276   4e-84    
ref|XP_010033228.1|  PREDICTED: cell division control protein 48 ...    277   4e-84    
gb|KDO72429.1|  hypothetical protein CISIN_1g011573mg                   276   4e-84    
gb|KDO76001.1|  hypothetical protein CISIN_1g041423mg                   277   4e-84    
ref|XP_006431053.1|  hypothetical protein CICLE_v10011614mg             276   5e-84    
ref|XP_008367101.1|  PREDICTED: LOW QUALITY PROTEIN: probable mit...    275   6e-84    
ref|XP_008437744.1|  PREDICTED: probable mitochondrial chaperone ...    277   6e-84    
gb|ACJ22514.1|  cell division AAA ATPase family protein                 277   6e-84    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006476710.1|  PREDICTED: probable mitochondrial chaperone ...    276   6e-84    
emb|CAH10057.1|  Cell Division Protein AAA ATPase family                277   6e-84    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010034624.1|  PREDICTED: probable mitochondrial chaperone ...    272   7e-84    
ref|XP_004310209.1|  PREDICTED: mitochondrial chaperone BCS1-like       276   7e-84    
gb|AAV49988.1|  ATPase 3                                                277   8e-84    Hordeum vulgare subsp. vulgare [barley]
gb|KEH40138.1|  P-loop nucleoside triphosphate hydrolase superfam...    275   8e-84    
ref|XP_006482518.1|  PREDICTED: probable mitochondrial chaperone ...    276   9e-84    
ref|XP_006654862.1|  PREDICTED: uncharacterized protein LOC102720799    275   1e-83    
ref|XP_006338783.1|  PREDICTED: probable mitochondrial chaperone ...    275   2e-83    
ref|XP_008239668.1|  PREDICTED: mitochondrial chaperone BCS1-like       276   2e-83    
ref|XP_010679779.1|  PREDICTED: probable mitochondrial chaperone ...    276   2e-83    
gb|EMS68880.1|  putative mitochondrial chaperone bcs1                   276   2e-83    
gb|EMT15609.1|  Putative mitochondrial chaperone BCS1-B                 276   2e-83    
ref|XP_007151181.1|  hypothetical protein PHAVU_004G024800g             274   3e-83    
ref|XP_004233688.1|  PREDICTED: putative cell division cycle ATPase     275   3e-83    
ref|XP_006338782.1|  PREDICTED: probable mitochondrial chaperone ...    275   3e-83    
ref|XP_003534467.1|  PREDICTED: probable mitochondrial chaperone ...    275   3e-83    
dbj|BAJ85610.1|  predicted protein                                      275   3e-83    
gb|KHN21333.1|  Putative mitochondrial chaperone bcs1                   271   3e-83    
ref|XP_002461625.1|  hypothetical protein SORBIDRAFT_02g005660          276   3e-83    
ref|XP_010679778.1|  PREDICTED: uncharacterized protein LOC104895...    274   3e-83    
ref|XP_010033229.1|  PREDICTED: probable mitochondrial chaperone ...    273   3e-83    
ref|XP_008791926.1|  PREDICTED: probable mitochondrial chaperone ...    278   3e-83    
ref|XP_010091913.1|  putative mitochondrial chaperone BCS1-B            275   3e-83    
ref|XP_010430850.1|  PREDICTED: probable mitochondrial chaperone ...    274   4e-83    
ref|XP_010037622.1|  PREDICTED: uncharacterized protein LOC104426320    276   4e-83    
ref|XP_004956957.1|  PREDICTED: uncharacterized protein LOC101772766    275   4e-83    
ref|XP_010514563.1|  PREDICTED: mitochondrial chaperone BCS1-like       275   4e-83    
ref|XP_004961037.1|  PREDICTED: probable mitochondrial chaperone ...    273   4e-83    
gb|KCW52811.1|  hypothetical protein EUGRSUZ_J02145                     274   4e-83    
gb|EMT08093.1|  Putative mitochondrial chaperone BCS1-B                 279   4e-83    
ref|XP_002461623.1|  hypothetical protein SORBIDRAFT_02g005630          275   5e-83    
ref|NP_001059098.1|  Os07g0192000                                       275   5e-83    
dbj|BAD30886.1|  AAA-type ATPase-like                                   274   5e-83    
ref|XP_010450740.1|  PREDICTED: 26S protease regulatory subunit 6...    275   6e-83    
emb|CDY63221.1|  BnaAnng18740D                                          273   6e-83    
ref|XP_002461624.1|  hypothetical protein SORBIDRAFT_02g005650          274   6e-83    
gb|KCW52817.1|  hypothetical protein EUGRSUZ_J02151                     273   6e-83    
ref|XP_006387481.1|  hypothetical protein POPTR_0985s00200g             273   7e-83    
gb|KFK33168.1|  hypothetical protein AALP_AA6G339300                    278   7e-83    
ref|XP_010441115.1|  PREDICTED: 26S protease regulatory subunit 6...    274   7e-83    
ref|XP_002460292.1|  hypothetical protein SORBIDRAFT_02g026090          274   8e-83    
dbj|BAJ98749.1|  predicted protein                                      275   8e-83    
gb|KDP31184.1|  hypothetical protein JCGZ_11560                         274   8e-83    
ref|XP_002511494.1|  ATP binding protein, putative                      274   9e-83    
ref|XP_002322133.2|  hypothetical protein POPTR_0015s07870g             273   1e-82    
ref|XP_002517441.1|  ATP binding protein, putative                      274   1e-82    
ref|XP_010661021.1|  PREDICTED: ATP-dependent zinc metalloproteas...    272   1e-82    
ref|XP_007209907.1|  hypothetical protein PRUPE_ppa004321mg             274   1e-82    
ref|XP_006383924.1|  hypothetical protein POPTR_0004s01270g             273   1e-82    
ref|XP_010425637.1|  PREDICTED: mitochondrial chaperone BCS1-like       273   1e-82    
gb|EMT21357.1|  Putative mitochondrial chaperone BCS1-B                 274   1e-82    
ref|XP_006658360.1|  PREDICTED: cell division control protein 48-...    275   1e-82    
emb|CAH10201.1|  Cell Division Protein AAA ATPase family                274   1e-82    
ref|XP_010034622.1|  PREDICTED: probable mitochondrial chaperone ...    273   1e-82    
ref|XP_010502855.1|  PREDICTED: putative cell division cycle ATPase     274   1e-82    
ref|NP_001067387.1|  Os12g0639200                                       274   1e-82    
ref|XP_004955728.1|  PREDICTED: ATP-dependent zinc metalloproteas...    274   1e-82    
ref|XP_004302368.1|  PREDICTED: putative cell division cycle ATPa...    274   1e-82    
tpg|DAA47718.1|  TPA: cell Division Protein AAA ATPase family pro...    274   1e-82    
gb|KCW56152.1|  hypothetical protein EUGRSUZ_I01906                     272   2e-82    
emb|CDP18111.1|  unnamed protein product                                273   2e-82    
ref|XP_009785900.1|  PREDICTED: probable mitochondrial chaperone ...    273   2e-82    
emb|CAH10209.1|  Cell Division Protein AAA ATPase family                273   2e-82    
ref|XP_008665611.1|  PREDICTED: uncharacterized protein LOC103644195    273   2e-82    
ref|XP_010906691.1|  PREDICTED: uncharacterized protein LOC105033529    272   2e-82    
ref|XP_010029261.1|  PREDICTED: probable mitochondrial chaperone ...    273   2e-82    
ref|XP_010228252.1|  PREDICTED: probable mitochondrial chaperone ...    273   2e-82    
gb|EEC69749.1|  hypothetical protein OsI_39283                          273   2e-82    
ref|NP_001147533.1|  cell Division Protein AAA ATPase family            273   2e-82    
gb|KEH21596.1|  P-loop nucleoside triphosphate hydrolase superfam...    274   2e-82    
ref|XP_007155362.1|  hypothetical protein PHAVU_003G194800g             273   2e-82    
ref|XP_006849577.1|  hypothetical protein AMTR_s00024p00191310          273   2e-82    
ref|XP_010029262.1|  PREDICTED: probable mitochondrial chaperone ...    273   2e-82    
ref|XP_003546854.2|  PREDICTED: uncharacterized protein LOC100820437    275   2e-82    
ref|XP_004955729.1|  PREDICTED: ATP-dependent zinc metalloproteas...    273   2e-82    
gb|EMT21354.1|  Putative mitochondrial chaperone BCS1-B                 273   2e-82    
ref|XP_006650745.1|  PREDICTED: probable mitochondrial chaperone ...    266   2e-82    
ref|XP_003557438.1|  PREDICTED: peroxisomal biogenesis factor 6-l...    273   3e-82    
ref|XP_003594544.1|  Mitochondrial chaperone BCS1                       271   3e-82    
ref|XP_008437741.1|  PREDICTED: probable mitochondrial chaperone ...    273   3e-82    
gb|KCW56149.1|  hypothetical protein EUGRSUZ_I01903                     271   3e-82    
ref|XP_006644096.1|  PREDICTED: probable mitochondrial chaperone ...    273   3e-82    
ref|XP_004168312.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    271   3e-82    
ref|XP_011041988.1|  PREDICTED: uncharacterized protein LOC105137805    273   3e-82    
emb|CDP01981.1|  unnamed protein product                                271   3e-82    
dbj|BAK02744.1|  predicted protein                                      274   3e-82    
ref|XP_008437740.1|  PREDICTED: mitochondrial respiratory chain c...    273   3e-82    
ref|XP_010030768.1|  PREDICTED: probable mitochondrial chaperone ...    271   4e-82    
ref|XP_008230972.1|  PREDICTED: probable mitochondrial chaperone ...    271   4e-82    
ref|XP_006664789.1|  PREDICTED: probable mitochondrial chaperone ...    267   4e-82    
emb|CDM84911.1|  unnamed protein product                                273   4e-82    
ref|XP_011083210.1|  PREDICTED: probable mitochondrial chaperone ...    273   4e-82    
gb|KHN48646.1|  Putative mitochondrial chaperone BCS1-B                 272   5e-82    
ref|NP_001167860.1|  hypothetical protein                               271   5e-82    
ref|XP_010029269.1|  PREDICTED: probable mitochondrial chaperone ...    271   5e-82    
ref|XP_004508798.1|  PREDICTED: probable mitochondrial chaperone ...    272   5e-82    
ref|XP_007215296.1|  hypothetical protein PRUPE_ppa005005mg             271   5e-82    
ref|XP_009151864.1|  PREDICTED: probable mitochondrial chaperone ...    271   5e-82    
ref|XP_010317288.1|  PREDICTED: probable mitochondrial chaperone ...    269   5e-82    
gb|EAY99234.1|  hypothetical protein OsI_21193                          271   6e-82    
gb|ABA99613.1|  Cell Division Protein AAA ATPase family, putative...    268   6e-82    
ref|XP_002280981.1|  PREDICTED: probable mitochondrial chaperone ...    272   7e-82    
ref|NP_001174549.1|  Os05g0588850                                       270   7e-82    
ref|XP_004157845.1|  PREDICTED: LOW QUALITY PROTEIN: probable mit...    272   7e-82    
gb|AFK28247.1|  hypothetical protein                                    263   7e-82    
ref|XP_003537605.1|  PREDICTED: mitochondrial chaperone BCS1-like...    271   9e-82    
ref|XP_006292204.1|  hypothetical protein CARUB_v10018409mg             270   1e-81    
gb|ACJ22504.1|  cell division AAA ATPase family protein                 271   1e-81    
ref|XP_001763152.1|  predicted protein                                  263   1e-81    
gb|AFK28237.1|  hypothetical protein                                    262   1e-81    
ref|XP_008379811.1|  PREDICTED: probable mitochondrial chaperone ...    270   1e-81    
gb|KCW44542.1|  hypothetical protein EUGRSUZ_L01951                     270   1e-81    
emb|CAJ13559.1|  unnamed protein product                                271   1e-81    
ref|XP_010655379.1|  PREDICTED: 26S protease regulatory subunit 6...    270   1e-81    
ref|XP_010087750.1|  putative mitochondrial chaperone BCS1-B            271   1e-81    
gb|AFK28241.1|  hypothetical protein                                    262   1e-81    
gb|AFK28230.1|  hypothetical protein                                    262   1e-81    
gb|AFK28250.1|  hypothetical protein                                    262   1e-81    
ref|XP_009344864.1|  PREDICTED: probable mitochondrial chaperone ...    270   1e-81    
ref|XP_010426630.1|  PREDICTED: probable mitochondrial chaperone ...    271   2e-81    
gb|AFK28232.1|  hypothetical protein                                    262   2e-81    
ref|XP_006353792.1|  PREDICTED: mitochondrial chaperone BCS1-like       270   2e-81    
ref|XP_010041206.1|  PREDICTED: probable mitochondrial chaperone ...    270   2e-81    
ref|XP_007151180.1|  hypothetical protein PHAVU_004G024700g             272   2e-81    
ref|NP_001067388.1|  Os12g0639400                                       269   2e-81    
ref|XP_010502854.1|  PREDICTED: probable mitochondrial chaperone ...    270   2e-81    
ref|XP_002281222.2|  PREDICTED: probable mitochondrial chaperone ...    271   2e-81    
ref|XP_011087108.1|  PREDICTED: mitochondrial chaperone BCS1-like       270   2e-81    
gb|EMS58223.1|  putative mitochondrial chaperone BCS1-B                 271   2e-81    
ref|XP_006657527.1|  PREDICTED: probable mitochondrial chaperone ...    271   2e-81    
ref|XP_008341524.1|  PREDICTED: probable mitochondrial chaperone ...    268   2e-81    
tpg|DAA59913.1|  TPA: ATPase 2                                          270   2e-81    
ref|NP_001130836.1|  uncharacterized protein LOC100191940               270   2e-81    
emb|CDY04025.1|  BnaC02g37400D                                          270   2e-81    
ref|NP_001059102.2|  Os07g0192800                                       274   2e-81    
gb|KDP41767.1|  hypothetical protein JCGZ_26785                         271   2e-81    
ref|XP_006293261.1|  hypothetical protein CARUB_v10019597mg             268   2e-81    
ref|XP_010679777.1|  PREDICTED: uncharacterized protein LOC104895...    270   3e-81    
ref|XP_009111601.1|  PREDICTED: probable mitochondrial chaperone ...    269   3e-81    
gb|AFK28240.1|  hypothetical protein                                    261   3e-81    
ref|XP_011028680.1|  PREDICTED: probable mitochondrial chaperone ...    270   3e-81    
ref|XP_004299616.1|  PREDICTED: uncharacterized protein LOC101309...    270   3e-81    
ref|XP_010528302.1|  PREDICTED: mitochondrial chaperone BCS1-like       270   3e-81    
ref|XP_004152541.1|  PREDICTED: probable mitochondrial chaperone ...    270   3e-81    
ref|XP_007032405.1|  AAA-ATPase 1                                       270   3e-81    
ref|XP_008669733.1|  PREDICTED: probable mitochondrial chaperone ...    268   3e-81    
ref|XP_004152449.1|  PREDICTED: uncharacterized protein LOC101216763    270   3e-81    
ref|XP_008650821.1|  PREDICTED: uncharacterized protein LOC100191...    270   3e-81    
ref|XP_010515473.1|  PREDICTED: probable mitochondrial chaperone ...    270   4e-81    
ref|XP_006465143.1|  PREDICTED: probable mitochondrial chaperone ...    264   4e-81    
ref|XP_011091602.1|  PREDICTED: probable mitochondrial chaperone ...    270   4e-81    
ref|XP_004963340.1|  PREDICTED: ATP-dependent zinc metalloproteas...    270   4e-81    
ref|XP_006290910.1|  hypothetical protein CARUB_v10017023mg             270   4e-81    
gb|ACL54671.1|  unknown                                                 270   4e-81    
ref|XP_010690844.1|  PREDICTED: probable mitochondrial chaperone ...    269   4e-81    
ref|XP_011078940.1|  PREDICTED: probable mitochondrial chaperone ...    268   4e-81    
gb|AFK28236.1|  hypothetical protein                                    261   4e-81    
ref|XP_010248609.1|  PREDICTED: probable mitochondrial chaperone ...    269   4e-81    
ref|XP_002524248.1|  ATP binding protein, putative                      268   5e-81    
gb|AFK28242.1|  hypothetical protein                                    261   5e-81    
gb|ABO92982.1|  putative AAA ATPase                                     270   5e-81    
gb|ABO93010.1|  putative AAA ATPase                                     271   5e-81    
dbj|BAD38324.1|  putative AAA ATPase, central region (50.1 kD)          268   5e-81    
gb|ABR16249.1|  unknown                                                 270   5e-81    
ref|XP_010425635.1|  PREDICTED: probable mitochondrial chaperone ...    269   5e-81    
ref|XP_011038492.1|  PREDICTED: probable mitochondrial chaperone ...    269   6e-81    
gb|KFK34343.1|  hypothetical protein AALP_AA5G132800                    270   6e-81    
ref|XP_011038592.1|  PREDICTED: probable 26S protease regulatory ...    270   6e-81    
emb|CAN69873.1|  hypothetical protein VITISV_030608                     268   6e-81    
ref|XP_002275965.1|  PREDICTED: peroxisomal biogenesis factor 6-like    270   6e-81    
ref|XP_002275823.3|  PREDICTED: uncharacterized protein LOC100250791    270   6e-81    
ref|XP_011038489.1|  PREDICTED: probable mitochondrial chaperone ...    269   6e-81    
ref|XP_008458698.1|  PREDICTED: mitochondrial chaperone BCS1-like       268   6e-81    
ref|NP_189492.1|  AAA-type ATPase family protein                        270   7e-81    
gb|EEC84666.1|  hypothetical protein OsI_31566                          269   7e-81    
gb|AIZ68136.1|  ATP binding protein                                     268   7e-81    
ref|XP_004152542.1|  PREDICTED: probable mitochondrial chaperone ...    269   7e-81    
ref|XP_008389964.1|  PREDICTED: probable mitochondrial chaperone ...    268   8e-81    
ref|XP_006403972.1|  hypothetical protein EUTSA_v10010287mg             269   8e-81    
ref|XP_006283555.1|  hypothetical protein CARUB_v10004609mg             269   9e-81    
ref|XP_010425631.1|  PREDICTED: probable mitochondrial chaperone ...    269   9e-81    
ref|XP_004489365.1|  PREDICTED: probable mitochondrial chaperone ...    266   9e-81    
emb|CAH10071.1|  Cell Division Protein AAA ATPase family                269   9e-81    
gb|ACJ22503.1|  cell division AAA ATPase family protein                 269   9e-81    
ref|XP_002514945.1|  ATP binding protein, putative                      268   1e-80    
gb|EMT23138.1|  Putative mitochondrial chaperone BCS1-B                 268   1e-80    
ref|XP_002319660.2|  hypothetical protein POPTR_0013s04520g             268   1e-80    
ref|XP_003543646.1|  PREDICTED: probable mitochondrial chaperone ...    268   1e-80    
gb|AFK28225.1|  hypothetical protein                                    259   1e-80    
ref|XP_009777495.1|  PREDICTED: mitochondrial chaperone BCS1-like       268   1e-80    
ref|NP_001145385.1|  hypothetical protein precursor                     268   1e-80    
ref|XP_004293765.1|  PREDICTED: mitochondrial chaperone BCS1-like       266   1e-80    
gb|AFK28244.1|  hypothetical protein                                    259   1e-80    
ref|XP_003579077.1|  PREDICTED: mitochondrial chaperone BCS1-like       268   1e-80    
gb|AFK28243.1|  hypothetical protein                                    259   1e-80    
ref|XP_009335806.1|  PREDICTED: probable mitochondrial chaperone ...    268   1e-80    
ref|XP_006664790.1|  PREDICTED: probable mitochondrial chaperone ...    264   2e-80    
gb|AFK28245.1|  hypothetical protein                                    259   2e-80    
emb|CDX90674.1|  BnaA03g41070D                                          267   2e-80    
gb|AFK28223.1|  hypothetical protein                                    259   2e-80    
emb|CDP20643.1|  unnamed protein product                                268   2e-80    
gb|EEC79781.1|  hypothetical protein OsI_21194                          261   2e-80    
ref|XP_008341515.1|  PREDICTED: probable mitochondrial chaperone ...    268   2e-80    
ref|XP_009631121.1|  PREDICTED: mitochondrial chaperone BCS1-like       267   2e-80    
gb|AFK28227.1|  hypothetical protein                                    259   2e-80    
ref|XP_004489363.1|  PREDICTED: probable mitochondrial chaperone ...    266   2e-80    
gb|EEE66727.1|  hypothetical protein OsJ_23415                          267   2e-80    
gb|KDP45448.1|  hypothetical protein JCGZ_09697                         265   2e-80    
gb|AFK28229.1|  hypothetical protein                                    259   2e-80    
ref|XP_004148704.1|  PREDICTED: mitochondrial chaperone BCS1-like       266   2e-80    
ref|XP_009785318.1|  PREDICTED: probable mitochondrial chaperone ...    268   2e-80    
emb|CBI27574.3|  unnamed protein product                                270   2e-80    
ref|XP_006366115.1|  PREDICTED: probable mitochondrial chaperone ...    268   2e-80    
ref|XP_010528303.1|  PREDICTED: probable mitochondrial chaperone ...    267   2e-80    
ref|XP_008353490.1|  PREDICTED: LOW QUALITY PROTEIN: probable mit...    268   2e-80    
ref|XP_010029752.1|  PREDICTED: probable mitochondrial chaperone ...    267   3e-80    
ref|XP_009136576.1|  PREDICTED: probable mitochondrial chaperone ...    267   3e-80    
ref|XP_004955726.1|  PREDICTED: probable 26S protease regulatory ...    268   3e-80    
ref|XP_004171624.1|  PREDICTED: probable mitochondrial chaperone ...    267   3e-80    
ref|XP_004983965.1|  PREDICTED: uncharacterized protein LOC101770...    267   3e-80    
gb|AFK28249.1|  hypothetical protein                                    258   3e-80    
ref|XP_011048067.1|  PREDICTED: probable mitochondrial chaperone ...    266   3e-80    
gb|KFK33745.1|  hypothetical protein AALP_AA5G054400                    267   4e-80    
gb|KDO47911.1|  hypothetical protein CISIN_1g011286mg                   266   4e-80    
ref|XP_010557749.1|  PREDICTED: probable mitochondrial chaperone ...    266   4e-80    
ref|XP_011088431.1|  PREDICTED: probable mitochondrial chaperone ...    266   4e-80    
ref|XP_010514555.1|  PREDICTED: putative cell division cycle ATPase     268   4e-80    
ref|XP_004955725.1|  PREDICTED: probable 26S protease regulatory ...    268   4e-80    
ref|XP_004512073.1|  PREDICTED: 26S protease regulatory subunit 8...    267   4e-80    
gb|AFK28216.1|  hypothetical protein                                    258   4e-80    
ref|XP_002267418.2|  PREDICTED: probable mitochondrial chaperone ...    266   4e-80    
gb|KDO46837.1|  hypothetical protein CISIN_1g013128mg                   265   5e-80    
ref|XP_006292221.1|  hypothetical protein CARUB_v10018427mg             265   5e-80    
gb|EMT29797.1|  Putative mitochondrial chaperone bcs1                   264   5e-80    
ref|XP_003622403.1|  AAA-ATPase 1-like protein                          267   5e-80    
emb|CAN77016.1|  hypothetical protein VITISV_010516                     265   5e-80    
gb|AFK28217.1|  hypothetical protein                                    258   5e-80    
ref|XP_006290856.1|  hypothetical protein CARUB_v10016966mg             268   6e-80    
ref|XP_008353416.1|  PREDICTED: probable mitochondrial chaperone ...    266   6e-80    



>emb|CDP02973.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   434 bits (1116),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 225/312 (72%), Positives = 251/312 (80%), Gaps = 22/312 (7%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP+ K EI ADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPINKAEIMADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFLGYDIYD+ELTEVHTNSELRKLLMKTSSKSIIVIEDIDCS+NLTNR++
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  308

Query  362  MNGGGSTREYSS--------AATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTN  517
              G  ++    S          + GGEDGGN ITLSGLLNFTDGLWSCCGSERIFVFTTN
Sbjct  309  SGGAANSGGARSNNFDVSPPGTSNGGEDGGNSITLSGLLNFTDGLWSCCGSERIFVFTTN  368

Query  518  HVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVI  697
            H+EKLDPALLRSGRMDMH+ MSYC+FPALKILLKNY          + E +   +  +V+
Sbjct  369  HIEKLDPALLRSGRMDMHVFMSYCSFPALKILLKNY----LGYNDGDLERDLEEEFKQVM  424

Query  698  DAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeed  877
            D AEMTPAD+SEVLI+NRR+KERA+WEL+E  +MRAE+ +           G +    ED
Sbjct  425  DKAEMTPADISEVLIKNRRDKERAVWELLEALKMRAEKKS----------RGLNGTVVED  474

Query  878  eeqeKRALESPK  913
            EEQEKRAL+SPK
Sbjct  475  EEQEKRALDSPK  486



>ref|XP_009771793.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Nicotiana 
sylvestris]
Length=488

 Score =   426 bits (1096),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 223/304 (73%), Positives = 245/304 (81%), Gaps = 16/304 (5%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP KK EI ADL DFANGE+FYQ TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPHKKAEIMADLLDFANGESFYQTTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFLGYDIYD+ELTEVHTNSELRKLLMKTSSKSIIVIEDIDCS+NLTNR+ 
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKN  308

Query  362  MNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPA  541
             +    +   + A     EDGGN ITLSGLLNFTDGLWSCCG+ERIFVFTTNH+EKLDPA
Sbjct  309  NSTHSFSPPGAGAGAGSNEDGGNTITLSGLLNFTDGLWSCCGTERIFVFTTNHIEKLDPA  368

Query  542  LLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPA  721
            LLRSGRMDMHIHMSYC+F ALKILLKNY       + ++ E + L QL +VI+ AEMTPA
Sbjct  369  LLRSGRMDMHIHMSYCSFAALKILLKNY----LGYDDDDVEKQLLEQLEQVIEKAEMTPA  424

Query  722  DVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeedeeqeKRAL  901
            D+SEVLI+NRRNK +A+WEL+E  R RAERN                   +DEEQEKRAL
Sbjct  425  DISEVLIKNRRNKNKAVWELLEALRTRAERN------------DAVKSSADDEEQEKRAL  472

Query  902  ESPK  913
            ESPK
Sbjct  473  ESPK  476



>ref|XP_009618039.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Nicotiana 
tomentosiformis]
Length=493

 Score =   423 bits (1087),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 225/309 (73%), Positives = 249/309 (81%), Gaps = 20/309 (6%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP KK EI ADL DFANGE+FYQ TGRAWKRGYLLYGPPGT
Sbjct  190  HPWESVPFKHPSTFETLAMDPQKKAEIMADLLDFANGESFYQTTGRAWKRGYLLYGPPGT  249

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRE-  358
            GKSSMIAAMANFLGYDIYD+ELTEVHTNSELRKLLMKTSSKSIIVIEDIDCS+NLTNR+ 
Sbjct  250  GKSSMIAAMANFLGYDIYDLELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKN  309

Query  359  -RMNGGGSTREYS--SAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
               N   ST  +S   A +   EDGGN ITLSGLLNFTDGLWSCCG+ERIFVFT+NH+EK
Sbjct  310  NNNNNNSSTHSFSPPGAGSCSTEDGGNTITLSGLLNFTDGLWSCCGTERIFVFTSNHIEK  369

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPALLRSGRMDMHIHMSYC+F ALKILLKNY       + ++ E + L QL +VI+ AE
Sbjct  370  LDPALLRSGRMDMHIHMSYCSFAALKILLKNY----LGYDDDDVERQFLEQLEQVIEKAE  425

Query  710  MTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeedeeqe  889
            MTPAD+SEVLI+NRRNK +A+WEL+E  R RAERN                   +DEEQE
Sbjct  426  MTPADISEVLIKNRRNKNKAVWELLEALRTRAERN------------DAVKSSSDDEEQE  473

Query  890  KRALESPKR  916
            KRALESPK+
Sbjct  474  KRALESPKQ  482



>ref|XP_007014284.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY31903.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=538

 Score =   423 bits (1087),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 223/310 (72%), Positives = 257/310 (83%), Gaps = 15/310 (5%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDPVKK+EI  DLKDFANG++FYQ+TGRAWKRGYLLYGPPGT
Sbjct  217  HPWESVPFKHPSTFDTLAMDPVKKQEIMDDLKDFANGQSFYQKTGRAWKRGYLLYGPPGT  276

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+L YDIYD+ELTEVH NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR++
Sbjct  277  GKSSMIAAMANYLSYDIYDLELTEVHNNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  336

Query  362  MNGGGSTREY------SSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHV  523
            +    STR Y        + +  GEDGGN ITLSGLLNFTDGLWSCCGSERIFVFTTNH+
Sbjct  337  ITNNPSTRNYYDPEIRCGSGSICGEDGGNSITLSGLLNFTDGLWSCCGSERIFVFTTNHI  396

Query  524  EKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDA  703
            EKLDPALLRSGRMDMHI+MSYC++PALKILLKNY       E+ + + + L++L EV+D 
Sbjct  397  EKLDPALLRSGRMDMHIYMSYCSYPALKILLKNY----LGYEESDLDYDVLKELEEVVDK  452

Query  704  AEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeedee  883
            AEMTPAD+SEVLI+ RR+K++A+ EL EI + RAERN      +  S   ++  + EDEE
Sbjct  453  AEMTPADISEVLIKIRRHKQKAVSELSEILKTRAERN-----LKSGSLREKNSDDMEDEE  507

Query  884  qeKRALESPK  913
            QEKRALESPK
Sbjct  508  QEKRALESPK  517



>ref|XP_010048623.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
 gb|KCW80940.1| hypothetical protein EUGRSUZ_C02301 [Eucalyptus grandis]
Length=518

 Score =   420 bits (1080),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 225/310 (73%), Positives = 251/310 (81%), Gaps = 10/310 (3%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP +K  I+ DL+DFA G+AFYQRTGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPERKSNIEEDLRDFAAGQAFYQRTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFLGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCSVNL+NR +
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSVNLSNRAK  308

Query  362  MNGGGSTREYSSA----ATQGGEDGGNR--ITLSGLLNFTDGLWSCCGSERIFVFTTNHV  523
                G+ R Y  +    A +GGEDG N   ITLSGLLNFTDGLWSCCGSERIFVFTTNH+
Sbjct  309  ATHAGAPRSYYDSGAPDAARGGEDGNNNNTITLSGLLNFTDGLWSCCGSERIFVFTTNHI  368

Query  524  EKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDA  703
            EKLDPALLRSGRMDMHI+MSYC++PALKILL+NY      +E EE    A  +L E  + 
Sbjct  369  EKLDPALLRSGRMDMHIYMSYCSYPALKILLRNY----LGSEAEELGEAAASELREAAEK  424

Query  704  AEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeedee  883
            A+MTPAD+SEVLI+NRRNKERA+ EL+E+ R RAERN    G          V E E+EE
Sbjct  425  AKMTPADISEVLIKNRRNKERAVGELLEVLRARAERNEKCGGLREECELNGVVEEMEEEE  484

Query  884  qeKRALESPK  913
            QEKRALESPK
Sbjct  485  QEKRALESPK  494



>ref|XP_010048616.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
 gb|KCW80929.1| hypothetical protein EUGRSUZ_C02288 [Eucalyptus grandis]
Length=517

 Score =   417 bits (1072),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 222/309 (72%), Positives = 250/309 (81%), Gaps = 9/309 (3%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP +K EIK DL+DFA G+AFYQRTGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPERKREIKEDLRDFAAGQAFYQRTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFLGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCSVNL+NR +
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSVNLSNRAK  308

Query  362  MNGGGSTREYSSA----ATQGGEDGGNR-ITLSGLLNFTDGLWSCCGSERIFVFTTNHVE  526
                G+ R Y  +    A +G EDG N  ITLSGLLNFTDGLWSCCGSERIFVFTTNH+E
Sbjct  309  ATHAGAPRNYYDSGAPDAARGSEDGNNNTITLSGLLNFTDGLWSCCGSERIFVFTTNHIE  368

Query  527  KLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAA  706
            KLDPALLRSGRMDM I+MSYC++PALKILL+NY      +E E+      R+L E  + A
Sbjct  369  KLDPALLRSGRMDMRIYMSYCSYPALKILLRNY----LGSEAEDLGEAEARELREAAEKA  424

Query  707  EMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeedeeq  886
            +MTPAD+SEVLI+NRRNKERA+ EL+E+ + RAERN    G          V E E+EEQ
Sbjct  425  KMTPADISEVLIKNRRNKERAVGELLEVLKTRAERNEKYGGLREECELNGVVEEMEEEEQ  484

Query  887  eKRALESPK  913
            EKRALESPK
Sbjct  485  EKRALESPK  493



>ref|XP_002534483.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF27900.1| ATP binding protein, putative [Ricinus communis]
Length=518

 Score =   417 bits (1071),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 210/280 (75%), Positives = 234/280 (84%), Gaps = 10/280 (4%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDPVKK+EI  DLKDFANG++FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPVKKQEILQDLKDFANGQSFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVHTNSELRKLLMKT+SKSIIVIEDIDCS+NL+NR++
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHTNSELRKLLMKTTSKSIIVIEDIDCSINLSNRKK  308

Query  362  MNGGGSTREY------SSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHV  523
             N     R Y      S +    GEDGGN ITLSGLLNFTDGLWSCCGSERIFVFTTNH+
Sbjct  309  SNTNSMARSYYDQEMRSGSGGASGEDGGNSITLSGLLNFTDGLWSCCGSERIFVFTTNHI  368

Query  524  EKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDA  703
            EKLDPALLRSGRMDMHI MSYC+FPALKILLKNY       ++ + E   L +L +VI+ 
Sbjct  369  EKLDPALLRSGRMDMHIFMSYCSFPALKILLKNY-LGYDHEKEGDLEDGILEELEQVINE  427

Query  704  AEMTPADVSEVLIRNRRN---KERALWELVEISRMRAERN  814
            AEMTPADVSEVLI++RRN   K RAL EL+   + RAERN
Sbjct  428  AEMTPADVSEVLIKHRRNKXXKNRALRELLGALKERAERN  467



>ref|XP_011043981.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Populus euphratica]
Length=513

 Score =   409 bits (1052),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 216/312 (69%), Positives = 252/312 (81%), Gaps = 16/312 (5%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP KK EI  DLKDFANG++FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPAKKGEIMEDLKDFANGQSFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVH NSELRKLLMKTSSKSIIVIEDIDCS+NL+NR++
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHNNSELRKLLMKTSSKSIIVIEDIDCSINLSNRKK  308

Query  362  MNGGGST--REY------SSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTN  517
                 S+  R Y      S      G++GGN ITLSGLLNFTDGLWSCCGSERIFVFTTN
Sbjct  309  GTANNSSIGRSYCDPEMRSGPGAGTGDEGGNSITLSGLLNFTDGLWSCCGSERIFVFTTN  368

Query  518  HVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVI  697
            HV+KLDPALLRSGRMDMH+ MSYC+FPALKILLKNY       ++ + +   L++L EVI
Sbjct  369  HVDKLDPALLRSGRMDMHVFMSYCSFPALKILLKNY----LGRDESDLDEGVLKELGEVI  424

Query  698  DAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeed  877
            D AEMTPAD+SE+LI+NRRNK++A+ EL+E  + RAER +            +++ + E+
Sbjct  425  DKAEMTPADISELLIKNRRNKDKAVIELLEALKERAERKS----KSGECVREKNLNDVEE  480

Query  878  eeqeKRALESPK  913
            EEQEKRALESPK
Sbjct  481  EEQEKRALESPK  492



>ref|XP_011069909.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Sesamum indicum]
Length=525

 Score =   409 bits (1050),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 208/283 (73%), Positives = 233/283 (82%), Gaps = 16/283 (6%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP KK EI ADL DFANGE+FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPAKKAEIMADLLDFANGESFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEV+TNSELRKLLMKTSSKSIIVIEDIDCS+NLTNR +
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVNTNSELRKLLMKTSSKSIIVIEDIDCSINLTNRNK  308

Query  362  ---------MNGGGSTREYSSAA---TQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFV  505
                      N G     Y  AA     GGEDG N ITLSGLLNFTDGLWSCCGSERIFV
Sbjct  309  NAGGGGGSSGNSGSRKNSYDVAAPPGANGGEDGVNTITLSGLLNFTDGLWSCCGSERIFV  368

Query  506  FTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrql  685
            FTTNH+EKLDPALLRSGRMDMHIHMSYC FP+LKILLKNY       E+ + + E + +L
Sbjct  369  FTTNHIEKLDPALLRSGRMDMHIHMSYCTFPSLKILLKNY----LGYEESDLKQEVVDEL  424

Query  686  aeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
              VI+ AEMTPAD+SEVLI+NRR+K +A+ EL+E  +++AE+N
Sbjct  425  KGVIEEAEMTPADISEVLIKNRRDKSKAVDELLEALKIKAEKN  467



>gb|KDP36404.1| hypothetical protein JCGZ_08673 [Jatropha curcas]
Length=521

 Score =   407 bits (1046),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 224/319 (70%), Positives = 254/319 (80%), Gaps = 22/319 (7%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLA+DP+KKEEI  DLKDFANG+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLALDPLKKEEIMEDLKDFANGQGFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFLGYDIYD+ELTEVHTNSELRKLLMKT SKSIIVIEDIDCS+NL+NR++
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHTNSELRKLLMKTISKSIIVIEDIDCSINLSNRKK  308

Query  362  M---NGGGSTREYSSAATQG------------GEDGGNRITLSGLLNFTDGLWSCCGSER  496
            +   NGG   R Y  +  +             GEDGGN ITLSGLLNFTDGLWSCCGSER
Sbjct  309  INNNNGGSMGRSYYESELRSGGGGAGGGGAGGGEDGGNSITLSGLLNFTDGLWSCCGSER  368

Query  497  IFVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegeal  676
            IFVFTTNH+EKLDPALLRSGRMDMHI+MSYC+FPALKILLKNY       E+ + E   L
Sbjct  369  IFVFTTNHIEKLDPALLRSGRMDMHIYMSYCSFPALKILLKNY----LGVEESDLEDGVL  424

Query  677  rqlaeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsggge  856
            ++L +VID AEMTPADVSEVLI+NRR+K RA+ ELV I + +AER               
Sbjct  425  KELEQVIDGAEMTPADVSEVLIKNRRDKNRAVRELVGILKEKAERKV---KNGNGIRENN  481

Query  857  dvfeeedeeqeKRALESPK  913
            ++ + E+EEQEKRALESPK
Sbjct  482  NLNDFEEEEQEKRALESPK  500



>ref|XP_002325059.2| hypothetical protein POPTR_0018s10140g [Populus trichocarpa]
 gb|EEF03624.2| hypothetical protein POPTR_0018s10140g [Populus trichocarpa]
Length=498

 Score =   405 bits (1041),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 214/305 (70%), Positives = 250/305 (82%), Gaps = 17/305 (6%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP KK EI  DLKDFANG++FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPAKKGEIMEDLKDFANGQSFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVH NSELRKLLMKTSSKSIIVIEDIDCS+NL+NR+ 
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHNNSELRKLLMKTSSKSIIVIEDIDCSINLSNRK-  307

Query  362  MNGGGSTREYSSAATQG-GEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
                   +E  S    G G++GGN ITLSGLLNFTDGLWSCCGSERIFVFTTNHV+KLDP
Sbjct  308  -------KEMRSGPGVGTGDEGGNSITLSGLLNFTDGLWSCCGSERIFVFTTNHVDKLDP  360

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTP  718
            ALLRSGRMDMH+ M+YC+FPALKILLKNY       E+ + +   L++L EVID AEMTP
Sbjct  361  ALLRSGRMDMHVFMNYCSFPALKILLKNY----LGREESDLDEGVLKELEEVIDKAEMTP  416

Query  719  ADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeedeeqeKRA  898
            AD+SE+LI+NRRNK++A+ EL+E  + RAER +            +++ + E+EEQEKRA
Sbjct  417  ADISELLIKNRRNKDKAVIELLEALKERAERKS----KSGECVREKNLNDVEEEEQEKRA  472

Query  899  LESPK  913
            L+SPK
Sbjct  473  LDSPK  477



>ref|XP_004296428.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Fragaria 
vesca subsp. vesca]
Length=518

 Score =   406 bits (1043),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 218/316 (69%), Positives = 253/316 (80%), Gaps = 22/316 (7%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP  K+EI  DL+DFANG++FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPKVKKEIMEDLQDFANGQSFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFLGYDIYD+ELTEVHTNSELRKLLMKTSSKS+IVIEDIDCS+NLTNR++
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHTNSELRKLLMKTSSKSVIVIEDIDCSINLTNRKK  308

Query  362  -----MNGGGSTREYSSA----ATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTT  514
                  +GG + R Y ++       G E GGN ITLSGLLNFTDGLWSCCGSERIFVFTT
Sbjct  309  NGGGDASGGAAMRTYYNSPEMRGVSGEEGGGNSITLSGLLNFTDGLWSCCGSERIFVFTT  368

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NH+EKLDPALLRSGRMDMHI MS+C+FPALKILLKNY       E+ + + E  ++  EV
Sbjct  369  NHIEKLDPALLRSGRMDMHIFMSHCSFPALKILLKNY----LGFEEGDLDEEIAKEFEEV  424

Query  695  IDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeee  874
            +D A MTPADVSE LI+NRR+K++A+ EL+E+ +++AE+N                 EEE
Sbjct  425  LDKAGMTPADVSEALIKNRRDKDKAVRELLEVLKVKAEKN---------KKSNAGSAEEE  475

Query  875  deeqeKRALESPKRNG  922
            +EEQEKRALESPK  G
Sbjct  476  EEEQEKRALESPKVEG  491



>ref|XP_011079303.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Sesamum indicum]
Length=526

 Score =   405 bits (1042),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 207/283 (73%), Positives = 235/283 (83%), Gaps = 18/283 (6%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
             PWESVPFKHPSTFDTLAMDP+KK EI ADLKDFA+GE+FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  QPWESVPFKHPSTFDTLAMDPLKKAEIVADLKDFASGESFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRE-  358
            GKSSMIAAMAN+LGYDIYD+ELTEV+TNSELRKLLMKT+SKSIIVIEDIDCS+NLTNR  
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVNTNSELRKLLMKTTSKSIIVIEDIDCSINLTNRNM  308

Query  359  --------RMNGGGSTREY----SSAATQGGED-GGNRITLSGLLNFTDGLWSCCGSERI  499
                    R +       Y    S+    GGED GGN ITLSGLLNFTDGLWSCCGSERI
Sbjct  309  TGCGGGGGRNSCSRKNNIYDVAPSTPVANGGEDGGGNTITLSGLLNFTDGLWSCCGSERI  368

Query  500  FVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealr  679
            FVFTTNH++KLDPALLRSGRMDMHIHMSYC+FPALKILLKNY       E+ + + E L 
Sbjct  369  FVFTTNHIQKLDPALLRSGRMDMHIHMSYCSFPALKILLKNY----LGYEERDLDKELLE  424

Query  680  qlaeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAE  808
            +L EV+DAAEMTPAD+SE+LI+NRRNK++A  EL+ + ++RAE
Sbjct  425  ELEEVVDAAEMTPADISELLIKNRRNKKKAAVELLAVLKLRAE  467



>ref|XP_011009528.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Populus euphratica]
Length=516

 Score =   405 bits (1040),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 217/313 (69%), Positives = 252/313 (81%), Gaps = 15/313 (5%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDPVKK EI  DLKDFANG++FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPVKKAEIIEDLKDFANGQSFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVH NSELRKLLMKTSSKSIIVIEDIDCS++L+NR++
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHHNSELRKLLMKTSSKSIIVIEDIDCSIDLSNRKK  308

Query  362  MNGGGST---REY------SSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTT  514
                 S+   R Y      S +    GE+GGN ITLSGLLNFTDGLWSCCGSERIFVFTT
Sbjct  309  GGPNNSSSIGRSYCDPEMRSGSGVSTGEEGGNSITLSGLLNFTDGLWSCCGSERIFVFTT  368

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NH++KLDPALLRSGRMDMH+ MSYC+FPAL+ILLKNY        + + +   L++L EV
Sbjct  369  NHIDKLDPALLRSGRMDMHVFMSYCSFPALRILLKNY----LGNAESDLDEGVLKELEEV  424

Query  695  IDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeee  874
            ID AEMTPAD+SE+LI+NRRNK+RA+ EL+E  + +AE     K G+       +   EE
Sbjct  425  IDKAEMTPADISELLIKNRRNKDRAVIELLEALKNKAE--MKLKSGDCVREKDLNDVGEE  482

Query  875  deeqeKRALESPK  913
            +EEQEKRALESPK
Sbjct  483  EEEQEKRALESPK  495



>ref|XP_002269013.2| PREDICTED: probable mitochondrial chaperone BCS1-B [Vitis vinifera]
 emb|CBI17831.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   404 bits (1037),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 214/312 (69%), Positives = 244/312 (78%), Gaps = 14/312 (4%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP  K+EI  DL+DF+NG+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  188  HPWESVPFKHPSTFDTLAMDPTTKKEIMDDLRDFSNGQTFYQKTGRAWKRGYLLYGPPGT  247

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFLGYD+YD+ELTEVHTNSELRKLLMKTSSKSIIVIEDIDCS+NL NR++
Sbjct  248  GKSSMIAAMANFLGYDVYDLELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSINLGNRKK  307

Query  362  MNGGGST-------REYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNH  520
             N GG                   GEDG N ITLSGLLNFTDGLWSCCGSERIFVFTTNH
Sbjct  308  SNSGGRQGYDGTPHEMRGGGGAGAGEDGVNSITLSGLLNFTDGLWSCCGSERIFVFTTNH  367

Query  521  VEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVID  700
            +EKLDPALLRSGRMDMHI MSYC FPALKILL+NY        + +   + + ++  VID
Sbjct  368  IEKLDPALLRSGRMDMHIFMSYCTFPALKILLQNY----LGFSEPDMGLQIMEEIEAVID  423

Query  701  AAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeede  880
             A+MTPAD+SEVLI+NRR+K++AL EL+E  R  AER    K     S   ++  E E+E
Sbjct  424  KAQMTPADISEVLIKNRRHKDKALSELLEALRNMAERR---KKENWRSAREKNSTEVEEE  480

Query  881  eqeKRALESPKR  916
            EQEKRALE+PK+
Sbjct  481  EQEKRALENPKQ  492



>emb|CDY38300.1| BnaA10g11480D [Brassica napus]
Length=513

 Score =   403 bits (1036),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 206/281 (73%), Positives = 234/281 (83%), Gaps = 14/281 (5%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDPVKK++I  DLKDFA G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPVKKQQIMDDLKDFAEGQMFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN LGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR++
Sbjct  249  GKSSMIAAMANHLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  308

Query  362  MNGGGST---REYSSAATQ-----GGEDG-GNRITLSGLLNFTDGLWSCCGSERIFVFTT  514
             N   +T   R Y    T+     G E G GN ITLSGLLNFTDGLWSCCGSERIFVFTT
Sbjct  309  -NSNATTQTQRSYYDMETRPGTGSGEESGNGNTITLSGLLNFTDGLWSCCGSERIFVFTT  367

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NH+EKLDPALLRSGRMDMHIHMSYC+FP+LKILLKNY       E+E+ E + L+++  V
Sbjct  368  NHIEKLDPALLRSGRMDMHIHMSYCDFPSLKILLKNY----LGYEEEDVEEDVLKEMERV  423

Query  695  IDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNT  817
            +D AEMTPADVSE LI+NRR+KE+A+ EL+E  + R E N 
Sbjct  424  VDKAEMTPADVSEALIKNRRDKEKAVRELLEDLKSRGEGNV  464



>ref|XP_006401201.1| hypothetical protein EUTSA_v10013277mg [Eutrema salsugineum]
 gb|ESQ42654.1| hypothetical protein EUTSA_v10013277mg [Eutrema salsugineum]
Length=515

 Score =   403 bits (1035),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 201/282 (71%), Positives = 231/282 (82%), Gaps = 14/282 (5%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP+KK++I  DLKDFA G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPIKKQQIMDDLKDFAEGQLFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR++
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  308

Query  362  MNGGGSTR---------EYSSAATQGGEDG-GNRITLSGLLNFTDGLWSCCGSERIFVFT  511
              G  S           E  + +  G E G GN ITLSGLLNFTDGLWSCCGSERIFVFT
Sbjct  309  SGGASSNEAAKRSCYDPETRNGSGSGEESGNGNTITLSGLLNFTDGLWSCCGSERIFVFT  368

Query  512  TNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlae  691
            TNH+EKLDPALLRSGRMDMHI+MSYCNFP+LKILLKNY        +E+   + LR++  
Sbjct  369  TNHIEKLDPALLRSGRMDMHIYMSYCNFPSLKILLKNY----LGYGEEDINDDVLREMER  424

Query  692  VIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNT  817
            V++ AEMTPADVSE LI+NRR+KE+A+ EL+E  + R E N 
Sbjct  425  VVEKAEMTPADVSEALIKNRRDKEKAIVELLEDLKSRGEINV  466



>ref|XP_006281485.1| hypothetical protein CARUB_v10027577mg [Capsella rubella]
 gb|EOA14383.1| hypothetical protein CARUB_v10027577mg [Capsella rubella]
Length=521

 Score =   401 bits (1030),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 201/284 (71%), Positives = 234/284 (82%), Gaps = 16/284 (6%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP+KK++I  DLKDFA G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPIKKQQIMDDLKDFAEGQVFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR++
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  308

Query  362  MNGGGST-REYSSAATQGGEDGGNR-----------ITLSGLLNFTDGLWSCCGSERIFV  505
             +   ST R Y  A T+ G   G+            ITLSGLLNFTDGLWSCCGSERIFV
Sbjct  309  NSSNASTQRSYYDAETRNGSGSGSGGSGEEGGNGNTITLSGLLNFTDGLWSCCGSERIFV  368

Query  506  FTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrql  685
            FTTNH+EKLDPALLRSGRMDMH++MS+CNFP+LKILLKNY       E E+ + + L+++
Sbjct  369  FTTNHIEKLDPALLRSGRMDMHVYMSFCNFPSLKILLKNY----LGYEVEDIDEDVLKEM  424

Query  686  aeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNT  817
              V+D AEMTPADVSE LI+NRR+KE+A+ EL+E  + R ERN 
Sbjct  425  ERVVDKAEMTPADVSEALIKNRRDKEKAIRELLEDLKSRGERNV  468



>ref|XP_009120266.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Brassica 
rapa]
Length=513

 Score =   400 bits (1028),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 205/281 (73%), Positives = 233/281 (83%), Gaps = 14/281 (5%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDPVKK++I  DLKDFA G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPVKKQQIMDDLKDFAEGQMFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN LGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR++
Sbjct  249  GKSSMIAAMANHLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  308

Query  362  MNGGGST---REYSSAATQ-----GGEDG-GNRITLSGLLNFTDGLWSCCGSERIFVFTT  514
             N   +T   R Y    T+     G E G GN ITLSGLLNFTDGLWSCCGSERIFVFTT
Sbjct  309  -NSNATTQTQRSYYDMETRPGTGSGEESGNGNTITLSGLLNFTDGLWSCCGSERIFVFTT  367

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NH+EKLDPALLRSGRMDMHIHMSYC+FP+LKILLKNY       E+E+ E + L+++  V
Sbjct  368  NHIEKLDPALLRSGRMDMHIHMSYCDFPSLKILLKNY----LGYEEEDVEEDVLKEMERV  423

Query  695  IDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNT  817
            +D AEMTPADVSE LI+NR +KE+A+ EL+E  + R E N 
Sbjct  424  VDRAEMTPADVSEALIKNRMDKEKAVRELLEDLKSRGEGNV  464



>ref|XP_010093843.1| putative mitochondrial chaperone BCS1-B [Morus notabilis]
 gb|EXB54731.1| putative mitochondrial chaperone BCS1-B [Morus notabilis]
Length=544

 Score =   401 bits (1030),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 201/283 (71%), Positives = 233/283 (82%), Gaps = 18/283 (6%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP+KK ++  DL DFANGE FYQ+TGRAWKRGYLLYGPPGT
Sbjct  193  HPWESVPFKHPSTFETLAMDPIKKTKLMEDLNDFANGEKFYQKTGRAWKRGYLLYGPPGT  252

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVHTNSELRKLLMKTSSKSIIVIEDIDCS+NLTNR++
Sbjct  253  GKSSMIAAMANYLGYDIYDLELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  312

Query  362  MNGGGSTREYSSA--------------ATQGGEDGGNRITLSGLLNFTDGLWSCCGSERI  499
             +G   +R  +S+                  G  GGN ITLSGLLNFTDGLWSCCGSERI
Sbjct  313  NHGPMHSRNVNSSNCYDAAAAAAEQMRGEGDGNVGGNSITLSGLLNFTDGLWSCCGSERI  372

Query  500  FVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealr  679
            FVFTTNH+EKLDPALLRSGRMD+HI MSYC+FPALKILL+NY       + ++ +G+ LR
Sbjct  373  FVFTTNHIEKLDPALLRSGRMDLHIFMSYCSFPALKILLRNY----LGCKADDLDGDVLR  428

Query  680  qlaeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAE  808
             L  V+D AEMTPADVSEVLI+NRR+++RA+ EL+E  ++RAE
Sbjct  429  DLESVVDEAEMTPADVSEVLIKNRRDRDRAVRELLETLKVRAE  471



>ref|XP_006381812.1| AAA-type ATPase family protein [Populus trichocarpa]
 gb|ERP59609.1| AAA-type ATPase family protein [Populus trichocarpa]
Length=501

 Score =   399 bits (1026),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 214/304 (70%), Positives = 245/304 (81%), Gaps = 12/304 (4%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDPVKK EI  DLKDFANG++FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPVKKAEIIEDLKDFANGQSFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVH NSELRKLLMKTSSKSIIVIEDIDCS++L+NR++
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHHNSELRKLLMKTSSKSIIVIEDIDCSIDLSNRKK  308

Query  362  MNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPA  541
                GS    SS     G    N ITLSGLLNFTDGLWSCCGSERIFVFTTNH++KLDPA
Sbjct  309  ----GSPNNSSSI----GRSYWNSITLSGLLNFTDGLWSCCGSERIFVFTTNHIDKLDPA  360

Query  542  LLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPA  721
            LLRSGRMDMH+ MSYC+FPAL+ILLKNY        + + +   L++L EVID AEMTPA
Sbjct  361  LLRSGRMDMHVFMSYCSFPALRILLKNY----LGNAESDLDEGVLKELEEVIDKAEMTPA  416

Query  722  DVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeedeeqeKRAL  901
            D+SE+LI+NRRNK+RA+ EL+E  + +AE         R     +   EEE+EEQEKRAL
Sbjct  417  DISELLIKNRRNKDRAVIELLEALKNKAEMKLKSGECVREKNLNDVGEEEEEEEQEKRAL  476

Query  902  ESPK  913
            ESPK
Sbjct  477  ESPK  480



>ref|XP_003610132.1| Mitochondrial chaperone BCS1 [Medicago truncatula]
 gb|AES92329.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=521

 Score =   400 bits (1027),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 201/280 (72%), Positives = 230/280 (82%), Gaps = 12/280 (4%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP+KK+EI  DL+DFANG+ FY +TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPMKKKEIMEDLQDFANGQGFYHKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRE-  358
            GKSSMIAAMANFLGYDIYD+ELTEVH NSELRKLLMKTSSKSIIVIEDIDCS+NL+NR+ 
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHNNSELRKLLMKTSSKSIIVIEDIDCSINLSNRKN  308

Query  359  -RMNGGGSTREYSSAATQG-------GEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTT  514
             + + G  +    +    G       GE+ GN ITLSGLLNFTDGLWSCCGSERIFVFTT
Sbjct  309  NKKSVGSVSVNSRNFYENGVGEMRGVGEENGNSITLSGLLNFTDGLWSCCGSERIFVFTT  368

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NH+EKLDPALLRSGRMDMHI MSYC+  ALKILLKNY       E  + +   L++L EV
Sbjct  369  NHIEKLDPALLRSGRMDMHIFMSYCSIQALKILLKNY---LGCEEGVDLDDSVLKELEEV  425

Query  695  IDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            ++ A MTPAD+SEVLI+NRR KE+A+ EL+EI ++RAERN
Sbjct  426  VEMARMTPADISEVLIKNRRKKEKAVDELLEILKVRAERN  465



>gb|ACJ85627.1| unknown [Medicago truncatula]
 gb|AFK42598.1| unknown [Medicago truncatula]
Length=521

 Score =   399 bits (1026),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 201/280 (72%), Positives = 230/280 (82%), Gaps = 12/280 (4%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP+KK+EI  DL+DFANG+ FY +TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPMKKKEIVEDLQDFANGQGFYHKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRE-  358
            GKSSMIAAMANFLGYDIYD+ELTEVH NSELRKLLMKTSSKSIIVIEDIDCS+NL+NR+ 
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHNNSELRKLLMKTSSKSIIVIEDIDCSINLSNRKN  308

Query  359  -RMNGGGSTREYSSAATQG-------GEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTT  514
             + + G  +    +    G       GE+ GN ITLSGLLNFTDGLWSCCGSERIFVFTT
Sbjct  309  NKKSVGSVSVNSRNFYENGVGEMRGVGEENGNSITLSGLLNFTDGLWSCCGSERIFVFTT  368

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NH+EKLDPALLRSGRMDMHI MSYC+  ALKILLKNY       E  + +   L++L EV
Sbjct  369  NHIEKLDPALLRSGRMDMHIFMSYCSIQALKILLKNY---LGCEEGVDLDDSVLKELEEV  425

Query  695  IDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            ++ A MTPAD+SEVLI+NRR KE+A+ EL+EI ++RAERN
Sbjct  426  VEMARMTPADISEVLIKNRRKKEKAVDELLEILKVRAERN  465



>ref|XP_003541777.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Glycine 
max]
Length=513

 Score =   399 bits (1025),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 210/278 (76%), Positives = 229/278 (82%), Gaps = 11/278 (4%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP KK+EI  DL DFANG++FY +TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPHKKKEIMEDLLDFANGQSFYHKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFLGYDIYD+ELTEVH NSELRKLLMKTSSKSIIVIEDIDCS+NLT R+ 
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHNNSELRKLLMKTSSKSIIVIEDIDCSINLTGRKN  308

Query  362  MNGGGS---TREYSS----AATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNH  520
             NG  S   +R Y      A    GE+GGN ITLSGLLNFTDGLWSCCGSERIFVFTTNH
Sbjct  309  NNGSVSVSASRSYYDSEIRAGGGCGEEGGNNITLSGLLNFTDGLWSCCGSERIFVFTTNH  368

Query  521  VEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVID  700
            +EKLDPALLRSGRMDMHI MSYC+FPALKILLKNY       E  E E   L+QL EV+D
Sbjct  369  IEKLDPALLRSGRMDMHIFMSYCSFPALKILLKNY----LGCEACELEESILKQLEEVVD  424

Query  701  AAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
             A MTPAD+SEVLI+NRR KE+A+ EL E  ++RAE N
Sbjct  425  VARMTPADISEVLIKNRRKKEKAVEELFETLKLRAEMN  462



>ref|XP_010536912.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Tarenaya 
hassleriana]
Length=511

 Score =   399 bits (1024),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 199/278 (72%), Positives = 232/278 (83%), Gaps = 10/278 (4%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            +PWESVPFKHPSTFDTLAMDPVKK++I  DL+DFA G++FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  YPWESVPFKHPSTFDTLAMDPVKKQQIMEDLRDFAEGQSFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN LGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR++
Sbjct  249  GKSSMIAAMANHLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  308

Query  362  MNGGGSTREY----SSAATQGGEDGGNR--ITLSGLLNFTDGLWSCCGSERIFVFTTNHV  523
             +   + R Y    +   +  G+D GN   ITLSGLLNFTDGLWSCCGSERIFVFTTNH+
Sbjct  309  NSTNQTPRSYYDPEARNGSGSGDDSGNNNTITLSGLLNFTDGLWSCCGSERIFVFTTNHI  368

Query  524  EKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDA  703
            EKLDPALLRSGRMDMHI+MSYC  P+LKILL NY       E+ +   + LR+L +V++ 
Sbjct  369  EKLDPALLRSGRMDMHIYMSYCTLPSLKILLLNY----LGYEEGDINVDVLRELEKVVEK  424

Query  704  AEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNT  817
            AEMTPADVSE LI+NRR++E+AL EL++  R RAERN 
Sbjct  425  AEMTPADVSEALIKNRRDREKALRELLDELRSRAERNV  462



>ref|XP_006283565.1| hypothetical protein CARUB_v10004616mg [Capsella rubella]
 gb|EOA16463.1| hypothetical protein CARUB_v10004616mg [Capsella rubella]
Length=507

 Score =   398 bits (1023),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 200/273 (73%), Positives = 226/273 (83%), Gaps = 7/273 (3%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTFDTLAMDPVKK+EI  DL DFA  ++FYQ+TGRAWKRGYLLYGPPGTG
Sbjct  190  PWESVPFKHPSTFDTLAMDPVKKQEIMEDLTDFAKCQSFYQKTGRAWKRGYLLYGPPGTG  249

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN+L YDIYD+ELTEV +NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR + 
Sbjct  250  KSSMIAAMANYLRYDIYDLELTEVKSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRNKK  309

Query  365  NGGGSTREYSSAATQG-GEDGGN--RITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
               GS  E  +    G  ED GN   ITLSGLLNFTDGLWSCCGSERIFVFTTNHV+KLD
Sbjct  310  QSNGSYNETEALTGSGLNEDSGNGDTITLSGLLNFTDGLWSCCGSERIFVFTTNHVDKLD  369

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PALLRSGRMDMH+HMSYC FP++KILL+NY       E+ +     L++L EV+D AE+T
Sbjct  370  PALLRSGRMDMHVHMSYCTFPSVKILLRNY----LGYEEGDLSDGVLKELEEVVDKAEIT  425

Query  716  PADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            PADVSE LI+NRR+K+RA+ EL+E  R RAERN
Sbjct  426  PADVSEALIKNRRDKKRAVKELLEDLRSRAERN  458



>ref|XP_008223701.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Prunus mume]
Length=531

 Score =   397 bits (1021),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 225/325 (69%), Positives = 254/325 (78%), Gaps = 24/325 (7%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP  K+EI  DL+DFANG+AFYQ TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPKVKKEIMDDLRDFANGQAFYQNTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFLGYDIYD+ELTEVHTNSELRKLLMKTSSKSIIVIEDIDCS+NLTNR++
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  308

Query  362  MN----GGGSTREY-------------SSAATQGGEDGGNRITLSGLLNFTDGLWSCCGS  490
             N    GG S R Y             S    +GG  GGN ITLSGLLNFTDGLWSCCGS
Sbjct  309  NNGGGGGGASARTYYDSMEMRGGGGGVSVPGEEGG--GGNSITLSGLLNFTDGLWSCCGS  366

Query  491  ERIFVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeege  670
            ERIFVFTTNH+EKLDPALLRSGRMDMHI MS+C++PALKILLKNY       E+ + + E
Sbjct  367  ERIFVFTTNHIEKLDPALLRSGRMDMHIFMSHCSYPALKILLKNY----LGYEEGDLDEE  422

Query  671  alrqlaeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTg-kkggernsg  847
              ++   V++ A MTPADVSEVLI+NRR+K  A+ EL+E  + RAE+N       E+ +G
Sbjct  423  IGKEFEGVLEKAGMTPADVSEVLIKNRRDKGNAVRELLEALKARAEKNNAGGGSREKVNG  482

Query  848  ggedvfeeedeeqeKRALESPKRNG  922
            G +   EEE+EEQEKRALESPK  G
Sbjct  483  GHDLEEEEEEEEQEKRALESPKEEG  507



>emb|CDY68365.1| BnaCnng58650D [Brassica napus]
Length=512

 Score =   396 bits (1017),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 197/279 (71%), Positives = 230/279 (82%), Gaps = 11/279 (4%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDPVKK++I  DLKDFA G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPVKKQQIMDDLKDFAEGQMFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN LGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR++
Sbjct  249  GKSSMIAAMANHLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  308

Query  362  MNGGGSTREYSSAATQGGEDGGNR-------ITLSGLLNFTDGLWSCCGSERIFVFTTNH  520
             +   + R Y    T+ G   G         ITLSGLLNFTDGLWSCCGSERIFVFTTNH
Sbjct  309  NSNATTQRSYYDMETRPGTGSGEESGNGGNTITLSGLLNFTDGLWSCCGSERIFVFTTNH  368

Query  521  VEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVID  700
            ++KLDPALLRSGRMDMHIHMSYC+FP+LKILLKNY       E+E+ + + L+++  V++
Sbjct  369  IDKLDPALLRSGRMDMHIHMSYCDFPSLKILLKNY----LGYEEEDVDDDVLKEMERVVE  424

Query  701  AAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNT  817
             AEMTPADVSE LI+NRR+K+RA+ EL+E  + R + N 
Sbjct  425  KAEMTPADVSEALIKNRRDKDRAVRELLEDLKSRGDGNV  463



>ref|XP_009132125.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Brassica 
rapa]
Length=512

 Score =   395 bits (1016),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 199/281 (71%), Positives = 229/281 (81%), Gaps = 15/281 (5%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP KK+EI  DLKDF  G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPTKKQEIMDDLKDFVLGQMFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR +
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRNK  308

Query  362  MNG---------GGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTT  514
             +G         G  TR  S +  + G   GN ITLSGLLNFTDGLWSCCGSERIFVFTT
Sbjct  309  SSGLKAGSEHRIGSETRIGSGSGEESG--NGNTITLSGLLNFTDGLWSCCGSERIFVFTT  366

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NH+EKLDPALLRSGRMDMH+ MSYC+FP+LKILL+NY       E+E+   + L+++  V
Sbjct  367  NHIEKLDPALLRSGRMDMHVCMSYCDFPSLKILLRNY----LGYEEEDVGDDVLKEMERV  422

Query  695  IDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNT  817
            ++ AEMTPADVSE LIRNRR+KE+A+ EL+   + R ERN 
Sbjct  423  VEKAEMTPADVSEALIRNRRDKEKAVRELLVELKSRWERNV  463



>ref|XP_007222808.1| hypothetical protein PRUPE_ppa004191mg [Prunus persica]
 gb|EMJ24007.1| hypothetical protein PRUPE_ppa004191mg [Prunus persica]
Length=524

 Score =   396 bits (1017),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 225/324 (69%), Positives = 252/324 (78%), Gaps = 23/324 (7%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP  K+EI  DLKDFANG+AFYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPKVKKEIMNDLKDFANGQAFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNR--  355
            GKSSMIAAMANFLGYDIYD+ELTEVHTNSELRKLLMKTSSKSIIVIEDIDCS+NLTNR  
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  308

Query  356  -ERMNGGGSTREY-------------SSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSE  493
                 GG S R Y             S    +GG  GGN ITLSGLLNFTDGLWSCCGSE
Sbjct  309  NNGGGGGASARTYYDSMEMRGGGGGVSVPGEEGG--GGNSITLSGLLNFTDGLWSCCGSE  366

Query  494  RIFVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegea  673
            RIFVFTTNH+EKLDPALLRSGRMDMHI MS+C++PALKILLKNY       E+ + + E 
Sbjct  367  RIFVFTTNHIEKLDPALLRSGRMDMHIFMSHCSYPALKILLKNY----LGYEEGDLDEEI  422

Query  674  lrqlaeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTg-kkggernsgg  850
             ++   V++ A MTPADVSEVLI+NRR+K  A+ EL+E  + RAE+N       E+ +GG
Sbjct  423  GKEFEGVLEKAGMTPADVSEVLIKNRRDKGNAVRELLEALKARAEKNNAGGGSREKVNGG  482

Query  851  gedvfeeedeeqeKRALESPKRNG  922
             +   EEE+EEQEKRALESPK  G
Sbjct  483  HDLEEEEEEEEQEKRALESPKEEG  506



>ref|XP_004252618.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Solanum lycopersicum]
Length=518

 Score =   396 bits (1017),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 204/277 (74%), Positives = 229/277 (83%), Gaps = 12/277 (4%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDPVKK EI ADL DFANGE+FYQRTGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPVKKAEIMADLLDFANGESFYQRTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFLGYDIYD+ELTEVHTNSELRKLLMKTSSKSIIVIEDIDCS+NLTNR+ 
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKN  308

Query  362  MNGGGSTR--------EYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTN  517
             +   ++                   + GGN ITLSGLLNFTDGLWSCCGSERIFVFTTN
Sbjct  309  NSSSSNSSSNYNVSPPGSGGGGGSSEDGGGNTITLSGLLNFTDGLWSCCGSERIFVFTTN  368

Query  518  HVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVI  697
            H+EKLDPALLRSGRMDMHIHMSY +F ALKILLKN+        +++ E E L QL +V+
Sbjct  369  HIEKLDPALLRSGRMDMHIHMSYSSFAALKILLKNF----LGYNEDDVEKELLEQLEQVM  424

Query  698  DAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAE  808
            + AEMTPAD+SEVLI+NRRNK++A+WEL+E  + RAE
Sbjct  425  ERAEMTPADISEVLIKNRRNKDKAVWELLEALKARAE  461



>ref|XP_010545417.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Tarenaya 
hassleriana]
Length=520

 Score =   395 bits (1016),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 198/277 (71%), Positives = 229/277 (83%), Gaps = 10/277 (4%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP+KK++I  DL+DFA G++FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPMKKQQIMEDLRDFAEGQSFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR++
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRQK  308

Query  362  MNGGGSTREYSSAATQ----GGEDGGNR--ITLSGLLNFTDGLWSCCGSERIFVFTTNHV  523
             N     R      T+     GED GN   ITLSGLLNFTDGLWSCCGSERIFVFTTNH+
Sbjct  309  SNTNQIPRSAYDPVTRSGLGSGEDSGNSNTITLSGLLNFTDGLWSCCGSERIFVFTTNHI  368

Query  524  EKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDA  703
            EKLD ALLRSGRMDMHIHMSYC  P+LKILLKNY       E+E+ +G+  +++   ++ 
Sbjct  369  EKLDAALLRSGRMDMHIHMSYCTMPSLKILLKNY----LGYEEEDLDGDVSKEMEAAVEK  424

Query  704  AEMTPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            A+MTPADVSE LI+NRR+ +RA+ EL+   R RAERN
Sbjct  425  AKMTPADVSESLIKNRRSGDRAVRELLGELRSRAERN  461



>ref|NP_200556.1| AAA-type ATPase family protein [Arabidopsis thaliana]
 dbj|BAB08783.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96906.1| AAA-type ATPase family protein [Arabidopsis thaliana]
Length=520

 Score =   395 bits (1014),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 200/284 (70%), Positives = 231/284 (81%), Gaps = 16/284 (6%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP KK++I  DLKDFA G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPRKKQQIMDDLKDFAEGQVFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR++
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  308

Query  362  MNGG-GSTREYSSAATQGGEDGGNR-----------ITLSGLLNFTDGLWSCCGSERIFV  505
             +    S R Y  A T+ G   G+            ITLSGLLNFTDGLWSCCGSERIFV
Sbjct  309  NSSNVSSQRSYYDAETRNGSGSGSGGSGEEGGNGNTITLSGLLNFTDGLWSCCGSERIFV  368

Query  506  FTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrql  685
            FTTNH+EKLDPALLRSGRMDMHI+MS+CNFP+LKILLKNY         E+  G+ L+++
Sbjct  369  FTTNHIEKLDPALLRSGRMDMHIYMSFCNFPSLKILLKNY----LGYGVEDINGDVLKEM  424

Query  686  aeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNT  817
              V++ AEMTPADVSE LI+NRR+KE+A+ EL+E  + R ERN 
Sbjct  425  EMVVEKAEMTPADVSEALIKNRRDKEKAIRELLEDLKSRGERNV  468



>dbj|BAD94360.1| BCS1 like mitochondrial protein [Arabidopsis thaliana]
Length=485

 Score =   393 bits (1010),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 200/273 (73%), Positives = 225/273 (82%), Gaps = 7/273 (3%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTFDTLAMDPVKK++I  DLKDFA  ++FY+RTGRAWKRGYLLYGPPGTG
Sbjct  169  PWESVPFKHPSTFDTLAMDPVKKQQIMEDLKDFAECQSFYERTGRAWKRGYLLYGPPGTG  228

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN+L YDIYD+ELTEV +NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR + 
Sbjct  229  KSSMIAAMANYLRYDIYDLELTEVKSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRNKK  288

Query  365  NGGGSTREYSSAATQG-GED--GGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
               GS  E       G G+D   GN ITLSGLLNFTDGLWSCCGSERIFVFTTNH+EKLD
Sbjct  289  QSTGSYNEPEMLTGSGLGDDLGDGNTITLSGLLNFTDGLWSCCGSERIFVFTTNHIEKLD  348

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PALLRSGRMDMHIHMSYC F ++KILL+NY       E+ +     L++LAEV+D AE+T
Sbjct  349  PALLRSGRMDMHIHMSYCTFSSVKILLRNY----LGFEEGDLNDVVLKELAEVVDRAEIT  404

Query  716  PADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            PADVSE LI+NRR+KERA+ EL+   R R ERN
Sbjct  405  PADVSEALIKNRRDKERAVRELLVDLRSRVERN  437



>ref|XP_010914133.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Elaeis guineensis]
 ref|XP_010914134.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Elaeis guineensis]
 ref|XP_010914135.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Elaeis guineensis]
 ref|XP_010914136.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Elaeis guineensis]
 ref|XP_010914137.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Elaeis guineensis]
Length=514

 Score =   394 bits (1012),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 216/309 (70%), Positives = 243/309 (79%), Gaps = 2/309 (1%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP KKEEI ADL+DFA G  FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPFKKEEIMADLRDFAEGNTFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVHTNSELRKLLMKT+SKSIIVIEDIDCS+NL NR  
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHTNSELRKLLMKTTSKSIIVIEDIDCSINLANRSS  308

Query  362  MNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPA  541
                        A     +   N ITLSGLLNFTDGLWSCCGSERIFVFTTN +EKLDPA
Sbjct  309  KKPPSEPPSDFRAGAGPDDSTANSITLSGLLNFTDGLWSCCGSERIFVFTTNRIEKLDPA  368

Query  542  LLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPA  721
            LLRSGRMDMHI MSYC+FPALKIL+KNYLG +      EEE  +L+QL EVID A++TPA
Sbjct  369  LLRSGRMDMHIFMSYCSFPALKILMKNYLGFDDGELDGEEEDGSLKQLEEVIDEADITPA  428

Query  722  DVSEVLIRNRRNKER-ALWELVEISRMRAERNTg-kkggernsgggedvfeeedeeqeKR  895
            DVSEVLI+NRR ++R A+ EL+E+ + R E+    ++          +  EEE+EEQEKR
Sbjct  429  DVSEVLIKNRRREKREAMKELLEVLKSRVEKKKAGRRSAAARKKTLNEELEEEEEEQEKR  488

Query  896  ALESPKRNG  922
            ALESPK  G
Sbjct  489  ALESPKDGG  497



>ref|XP_003549478.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Glycine 
max]
 gb|KHN17592.1| Putative mitochondrial chaperone BCS1-B [Glycine soja]
Length=512

 Score =   394 bits (1011),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 204/279 (73%), Positives = 228/279 (82%), Gaps = 12/279 (4%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP KK++I  DL+DFANG++FY +TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPHKKKQIMEDLQDFANGQSFYHKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFLGYDIYD+ELTEVH NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR+ 
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHNNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKN  308

Query  362  MNG--------GGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTN  517
             N         G    E         E+GGN ITLSGLLNFTDGLWSCCGSERIFVFTTN
Sbjct  309  NNSSSSVSASTGYYDSEIRGGGGGCAEEGGNNITLSGLLNFTDGLWSCCGSERIFVFTTN  368

Query  518  HVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVI  697
            H+EKLDPALLRSGRMDMHI MSYC+FPALKILLKNY       E+ E E   L++L EV+
Sbjct  369  HIEKLDPALLRSGRMDMHIFMSYCSFPALKILLKNY----LGCEECELEEPILKRLEEVV  424

Query  698  DAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            D A MTPAD+SEVLI+NRR +E+A+ EL+E  ++RAE N
Sbjct  425  DVARMTPADISEVLIKNRRKREKAVEELLETLKLRAEMN  463



>ref|XP_008465640.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Cucumis melo]
Length=530

 Score =   394 bits (1013),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 201/285 (71%), Positives = 231/285 (81%), Gaps = 18/285 (6%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP+KK++I  DL+DFANG+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPLKKQQIMEDLRDFANGQRFYQQTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFLGYDIYD+ELTEVH NSELRKLLMKT+SKSIIVIEDIDCS+NLT+R++
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHNNSELRKLLMKTTSKSIIVIEDIDCSINLTDRKK  308

Query  362  MNGGGSTREY--------------SSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERI  499
             N    TR Y                 +  G + GGN ITLSGLLNFTDGLWSCCGSERI
Sbjct  309  KNPVSGTRSYYDLPDFRCGGGNGGGYGSISGDDGGGNSITLSGLLNFTDGLWSCCGSERI  368

Query  500  FVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealr  679
            FVFTTNH+EKLD ALLRSGRMDMHI MSYC+FPALKILLKNY       E++E +   L 
Sbjct  369  FVFTTNHIEKLDSALLRSGRMDMHIFMSYCSFPALKILLKNY----LNYEEDELDSIVLN  424

Query  680  qlaeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            ++ +VID A+MTPADVSE+LI+NRR K RA+ EL+E  + +AE+N
Sbjct  425  EIKDVIDKAKMTPADVSELLIKNRRCKNRAMAELLETFKSKAEKN  469



>ref|NP_567730.1| AAA-type ATPase family protein [Arabidopsis thaliana]
 gb|AAL91623.1| AT4g25830/F14M19_110 [Arabidopsis thaliana]
 gb|AEE85120.1| AAA-type ATPase family protein [Arabidopsis thaliana]
Length=506

 Score =   393 bits (1009),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 200/273 (73%), Positives = 225/273 (82%), Gaps = 7/273 (3%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTFDTLAMDPVKK++I  DLKDFA  ++FY+RTGRAWKRGYLLYGPPGTG
Sbjct  190  PWESVPFKHPSTFDTLAMDPVKKQQIMEDLKDFAECQSFYERTGRAWKRGYLLYGPPGTG  249

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN+L YDIYD+ELTEV +NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR + 
Sbjct  250  KSSMIAAMANYLRYDIYDLELTEVKSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRNKK  309

Query  365  NGGGSTREYSSAATQG-GED--GGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
               GS  E       G G+D   GN ITLSGLLNFTDGLWSCCGSERIFVFTTNH+EKLD
Sbjct  310  QSTGSYNEPEMLTGSGLGDDLGDGNTITLSGLLNFTDGLWSCCGSERIFVFTTNHIEKLD  369

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PALLRSGRMDMHIHMSYC F ++KILL+NY       E+ +     L++LAEV+D AE+T
Sbjct  370  PALLRSGRMDMHIHMSYCTFSSVKILLRNY----LGFEEGDLNDVVLKELAEVVDRAEIT  425

Query  716  PADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            PADVSE LI+NRR+KERA+ EL+   R R ERN
Sbjct  426  PADVSEALIKNRRDKERAVRELLVDLRSRVERN  458



>ref|XP_010048619.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
 gb|KCW80935.1| hypothetical protein EUGRSUZ_C02294 [Eucalyptus grandis]
Length=508

 Score =   393 bits (1009),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 196/276 (71%), Positives = 228/276 (83%), Gaps = 9/276 (3%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
             PWE+VPFKHPSTFDTLAMDP KK +I  DL+DFA G+AFYQRTGRAWKRGYLLYGPPGT
Sbjct  192  RPWEAVPFKHPSTFDTLAMDPEKKRDIMEDLRDFAAGQAFYQRTGRAWKRGYLLYGPPGT  251

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFLGYDIYD+ELTEV +NSELRKLLMKTSSKSIIVIEDIDCSVNL+NR +
Sbjct  252  GKSSMIAAMANFLGYDIYDLELTEVPSNSELRKLLMKTSSKSIIVIEDIDCSVNLSNRSK  311

Query  362  MNGGGSTREYSSA----ATQGGED-GGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVE  526
                 + + YS      A  GG+D   N +TLSGLLNFTDGLWSCCGSERIFVFTTNH+E
Sbjct  312  APKAPAPQSYSDPDAPDAASGGKDWNNNTMTLSGLLNFTDGLWSCCGSERIFVFTTNHIE  371

Query  527  KLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAA  706
            KLDPALLRSGRMDMHI MS+C++PAL+ILL NY      ++ E+    A  +L E ++ A
Sbjct  372  KLDPALLRSGRMDMHICMSHCSYPALEILLDNY----LGSKGEDLGEVAASELQEAVEKA  427

Query  707  EMTPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            +MTPAD+SEVLI+NRRNKE+A+ EL+E+ + RA+RN
Sbjct  428  KMTPADISEVLIKNRRNKEKAVSELLEVLKARADRN  463



>ref|XP_006453383.1| hypothetical protein CICLE_v10008017mg [Citrus clementina]
 ref|XP_006474174.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Citrus 
sinensis]
 gb|ESR66623.1| hypothetical protein CICLE_v10008017mg [Citrus clementina]
 gb|KDO46510.1| hypothetical protein CISIN_1g010133mg [Citrus sinensis]
Length=517

 Score =   393 bits (1009),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 213/315 (68%), Positives = 250/315 (79%), Gaps = 22/315 (7%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESV FKHPSTFDTLA+DP KK EI  DLKDFANG +FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVSFKHPSTFDTLAIDPEKKIEIMEDLKDFANGMSFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNR-E  358
            GKSSMIAAMAN+LGYDIYD+ELTEVH NSELRKLLMKTSSKSIIVIEDIDCS++L+NR +
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHNNSELRKLLMKTSSKSIIVIEDIDCSISLSNRNK  308

Query  359  RMNGGGSTREYSS-----------AATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFV  505
            R NG GS     +           + + GGEDG N ITLSGLLNFTDGLWSCCGSE+IFV
Sbjct  309  RSNGSGSRGNCGNGNYYEPEMRCGSGSVGGEDGNNSITLSGLLNFTDGLWSCCGSEKIFV  368

Query  506  FTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrql  685
            FTTNH+EKLDPALLRSGRMDMHI MSYC++PAL ILLKNY       E+ + E E L++L
Sbjct  369  FTTNHIEKLDPALLRSGRMDMHIFMSYCSYPALLILLKNY----LGYEESDLEDETLKEL  424

Query  686  aeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvf  865
             +V+  AEMTPAD+SEVLI+N+R+K +A+ EL+E  +++AE+N       ++ G      
Sbjct  425  EDVVGKAEMTPADISEVLIKNKRDKCKAVRELLETLKVKAEKNV------KHGGIIVKNS  478

Query  866  eeedeeqeKRALESP  910
            + E+EEQEKRALESP
Sbjct  479  DYEEEEQEKRALESP  493



>ref|XP_007154771.1| hypothetical protein PHAVU_003G146400g [Phaseolus vulgaris]
 gb|ESW26765.1| hypothetical protein PHAVU_003G146400g [Phaseolus vulgaris]
Length=514

 Score =   392 bits (1008),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 205/282 (73%), Positives = 229/282 (81%), Gaps = 18/282 (6%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP KK+EI  DL+DFANG++FY +TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPQKKKEIMEDLQDFANGQSFYHKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVH NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR  
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHNNSELRKLLMKTSSKSIIVIEDIDCSINLTNR--  306

Query  362  MNGGGSTREYSSAATQGGE-----------DGGNRITLSGLLNFTDGLWSCCGSERIFVF  508
             N  G+T   +S +    E           +GGN ITLSGLLNFTDGLWSCCGSERIFVF
Sbjct  307  -NNIGNTSVSASRSYYDSELRGGGGGGGGEEGGNTITLSGLLNFTDGLWSCCGSERIFVF  365

Query  509  TTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqla  688
            TTNH+EKLDPALLRSGRMDMHI MSYC+FPALKILLKNY       E+ E E   L+QL 
Sbjct  366  TTNHIEKLDPALLRSGRMDMHIFMSYCSFPALKILLKNY----LGCEECELEESILKQLE  421

Query  689  eVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            EV+  A MTPAD+SEVLI+NRR KE A+ EL+E  ++RA+ N
Sbjct  422  EVVKVARMTPADISEVLIKNRRKKENAVEELLETLKVRADMN  463



>emb|CAB39604.1| putative mitochondrial protein [Arabidopsis thaliana]
 emb|CAB79438.1| putative mitochondrial protein [Arabidopsis thaliana]
Length=618

 Score =   394 bits (1012),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 200/273 (73%), Positives = 225/273 (82%), Gaps = 7/273 (3%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTFDTLAMDPVKK++I  DLKDFA  ++FY+RTGRAWKRGYLLYGPPGTG
Sbjct  302  PWESVPFKHPSTFDTLAMDPVKKQQIMEDLKDFAECQSFYERTGRAWKRGYLLYGPPGTG  361

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN+L YDIYD+ELTEV +NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR + 
Sbjct  362  KSSMIAAMANYLRYDIYDLELTEVKSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRNKK  421

Query  365  NGGGSTREYSSAATQG-GED--GGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
               GS  E       G G+D   GN ITLSGLLNFTDGLWSCCGSERIFVFTTNH+EKLD
Sbjct  422  QSTGSYNEPEMLTGSGLGDDLGDGNTITLSGLLNFTDGLWSCCGSERIFVFTTNHIEKLD  481

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PALLRSGRMDMHIHMSYC F ++KILL+NY       E+ +     L++LAEV+D AE+T
Sbjct  482  PALLRSGRMDMHIHMSYCTFSSVKILLRNY----LGFEEGDLNDVVLKELAEVVDRAEIT  537

Query  716  PADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            PADVSE LI+NRR+KERA+ EL+   R R ERN
Sbjct  538  PADVSEALIKNRRDKERAVRELLVDLRSRVERN  570



>ref|XP_008362379.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Malus domestica]
Length=526

 Score =   390 bits (1003),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 218/316 (69%), Positives = 247/316 (78%), Gaps = 14/316 (4%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP  K EI  DL DFANG+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPKTKREIMDDLMDFANGQNFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVHTNSELRKLLMKTSSKSIIVIEDIDCS+NLTNR+ 
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKN  308

Query  362  MNGGGST-REYSSAA--------TQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTT  514
            + GGG+  R Y  +         +     GGN ITLSGLLNFTDGLWSCCGSERIFVFTT
Sbjct  309  ICGGGNAGRNYYESGEIRGGVGGSGEEGGGGNSITLSGLLNFTDGLWSCCGSERIFVFTT  368

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NH+EKLDPALLRSGRMDMHI MS+C+FPALKILL+NY       ++ + + E  R+  EV
Sbjct  369  NHIEKLDPALLRSGRMDMHIFMSHCSFPALKILLRNY----LGYDEGDLDEEITREFEEV  424

Query  695  IDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeee  874
            ++ A MTPADVSEVLI+NRR+K  A+ EL+E  + RAER   KK         E+   EE
Sbjct  425  LEKAAMTPADVSEVLIKNRRDKGNAVMELLEALKARAERR-KKKESNGGGELEEEEDVEE  483

Query  875  deeqeKRALESPKRNG  922
            +EEQEKRALESPK  G
Sbjct  484  EEEQEKRALESPKDEG  499



>ref|XP_006413265.1| hypothetical protein EUTSA_v10024942mg [Eutrema salsugineum]
 gb|ESQ54718.1| hypothetical protein EUTSA_v10024942mg [Eutrema salsugineum]
Length=515

 Score =   389 bits (999),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 194/275 (71%), Positives = 226/275 (82%), Gaps = 9/275 (3%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTFDTLAMDPVKK++I  DLKDFA  ++FYQ+TGRAWKRGYLLYGPPGTG
Sbjct  191  PWESVPFKHPSTFDTLAMDPVKKKQIMEDLKDFAKCQSFYQKTGRAWKRGYLLYGPPGTG  250

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN+LGYDIYD+ELTEV +NSELRKLLMKTSSKSIIVIEDIDCS++LTNR + 
Sbjct  251  KSSMIAAMANYLGYDIYDLELTEVKSNSELRKLLMKTSSKSIIVIEDIDCSISLTNRSKK  310

Query  365  NGGGSTR---EYSSAATQGGEDGGN--RITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                 +    E +   +  G+D GN   ITLSGLLNFTDGLWSCCGSERIFVFTTNH+EK
Sbjct  311  QSTAGSYYDPEMTLTGSGLGDDSGNGSTITLSGLLNFTDGLWSCCGSERIFVFTTNHIEK  370

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPALLRSGRMDMHI+MSYC FP+LKILL+NY       E+ +      +++ EV+  AE
Sbjct  371  LDPALLRSGRMDMHIYMSYCTFPSLKILLRNY----LGYEERDLNDGVFKEMEEVVVKAE  426

Query  710  MTPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            +TPADVSE LI+NRR++E+AL EL+E  R RA+RN
Sbjct  427  ITPADVSEALIKNRRDREKALRELLEELRSRAKRN  461



>gb|KFK27298.1| hypothetical protein AALP_AA8G364200 [Arabis alpina]
Length=525

 Score =   389 bits (999),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 195/283 (69%), Positives = 230/283 (81%), Gaps = 15/283 (5%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP+KK++I  DL DFA G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPIKKQQIMDDLLDFAEGQLFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR++
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  308

Query  362  MNGGGSTRE-YSSAATQGGEDGGNR----------ITLSGLLNFTDGLWSCCGSERIFVF  508
             +    T++ Y    T+ G   G+           ITLSGLLNFTDGLWSCCGSERIFVF
Sbjct  309  NSTNAVTQKSYYDPETRTGSGSGSGSGEESGNGNTITLSGLLNFTDGLWSCCGSERIFVF  368

Query  509  TTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqla  688
            TTNH+EKLDPALLRSGRMDMHI+MSYCNFP+LKIL+KNY       ++E+   +  +++ 
Sbjct  369  TTNHIEKLDPALLRSGRMDMHIYMSYCNFPSLKILIKNY----LGYKEEDVNDDVWKEME  424

Query  689  eVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNT  817
             V+D AEMTPADVSE LI+NRR+KE+A+ EL++  +   ERN 
Sbjct  425  RVVDKAEMTPADVSEALIKNRRDKEKAIRELLDDLKSIGERNV  467



>ref|XP_010443434.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=519

 Score =   389 bits (998),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/285 (70%), Positives = 232/285 (81%), Gaps = 17/285 (6%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP+KK++I  DLKDFANG+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPLKKQQIMDDLKDFANGQVFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR++
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  308

Query  362  --MNGGGSTREYSSAATQGGEDGGNR-----------ITLSGLLNFTDGLWSCCGSERIF  502
               N    +R Y  A T+ G   G             ITLSGLLNFTDGLWSCCGSERIF
Sbjct  309  NSSNVSSLSRSYYEAETRNGSGSGGSGEEGGNGNNNTITLSGLLNFTDGLWSCCGSERIF  368

Query  503  VFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrq  682
            VFTTNH+EKLDPALLRSGRMDM I+MS+CNFP+LKILLKNY       E+E+   + L++
Sbjct  369  VFTTNHIEKLDPALLRSGRMDMRIYMSFCNFPSLKILLKNY----LGYEEEDVGEDLLKE  424

Query  683  laeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNT  817
            +  V+D AEMTPADVSE LI+NRR+KE+A+ +L+E  + R ERN 
Sbjct  425  MERVVDKAEMTPADVSEALIKNRRDKEKAIRDLLEDLKSRGERNV  469



>ref|XP_010438828.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=492

 Score =   388 bits (996),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 194/272 (71%), Positives = 225/272 (83%), Gaps = 13/272 (5%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTFDTLAMDPVKK++I  DL DFA  ++FYQ+TGRAWKRGYLLYGPPGTG
Sbjct  190  PWESVPFKHPSTFDTLAMDPVKKQQIMDDLTDFAQCQSFYQKTGRAWKRGYLLYGPPGTG  249

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN L YDIYD+ELTEV +NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR + 
Sbjct  250  KSSMIAAMANHLRYDIYDLELTEVKSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRNK-  308

Query  365  NGGGSTREYSSAATQGGEDGGN--RITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
                  ++ +   T   ED GN   ITLSGLLNFTDGLWSCCGSERIFVFTTNH++KLDP
Sbjct  309  ------KQSNETETGFVEDSGNGSTITLSGLLNFTDGLWSCCGSERIFVFTTNHIDKLDP  362

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTP  718
            ALLRSGRMDMH+HMSYC FP++KILL+NY       E+ +   + L+++ EV+D AE+TP
Sbjct  363  ALLRSGRMDMHVHMSYCTFPSIKILLRNY----LGYEEGDLNDDVLKEMEEVVDKAEITP  418

Query  719  ADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            ADVSE LI+NRR+KERA+ EL+E  R RA+RN
Sbjct  419  ADVSEALIKNRRDKERAVRELLEDLRSRAKRN  450



>ref|XP_010433585.1| PREDICTED: mitochondrial chaperone BCS1-like [Camelina sativa]
Length=491

 Score =   387 bits (995),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 192/270 (71%), Positives = 224/270 (83%), Gaps = 9/270 (3%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTFDTLAMDPVKK++I  DL DFA  ++FYQ+TGRAWKRGYLLYGPPGTG
Sbjct  190  PWESVPFKHPSTFDTLAMDPVKKQQIMDDLTDFAQCQSFYQKTGRAWKRGYLLYGPPGTG  249

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN L YDIYD+ELTEV +NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR + 
Sbjct  250  KSSMIAAMANHLRYDIYDLELTEVKSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRNK-  308

Query  365  NGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
                 + E  +   +G  DG   ITLSGLLNFTDGLWSCCGSERIFVFTTNH++KLDPAL
Sbjct  309  ---KQSNETETGFVEGSGDGST-ITLSGLLNFTDGLWSCCGSERIFVFTTNHIDKLDPAL  364

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPAD  724
            LRSGRMDMH+HMSYC FP++KILL+NY       E+ +   + L+++ EV+D AE+TPAD
Sbjct  365  LRSGRMDMHVHMSYCTFPSIKILLRNY----LGYEEGDLNDDVLKEMEEVVDKAEITPAD  420

Query  725  VSEVLIRNRRNKERALWELVEISRMRAERN  814
            VSE LI+NRR+K+RA+ EL+E  R RA+RN
Sbjct  421  VSEALIKNRRDKDRAVRELLEDLRSRAKRN  450



>ref|XP_010448362.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=492

 Score =   387 bits (995),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 193/270 (71%), Positives = 224/270 (83%), Gaps = 9/270 (3%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTFDTLAMDPVKK++I  DL DFA  ++FYQ+TGRAWKRGYLLYGPPGTG
Sbjct  190  PWESVPFKHPSTFDTLAMDPVKKQQIMDDLTDFAQCQSFYQKTGRAWKRGYLLYGPPGTG  249

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN L YDIYD+ELTEV +NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR + 
Sbjct  250  KSSMIAAMANHLRYDIYDLELTEVKSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRNK-  308

Query  365  NGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
                 + E  +   +   D GN ITLSGLLNFTDGLWSCCGSERIFVFTTNH++KLDPAL
Sbjct  309  ---KQSNETETGFVEDSGD-GNTITLSGLLNFTDGLWSCCGSERIFVFTTNHIDKLDPAL  364

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPAD  724
            LRSGRMDMH+HMSYC FP++KILL+NY       E+ +   + L+++ EV+D AE+TPAD
Sbjct  365  LRSGRMDMHVHMSYCTFPSIKILLRNY----LGYEEGDLNDDVLKEMEEVVDKAEITPAD  420

Query  725  VSEVLIRNRRNKERALWELVEISRMRAERN  814
            VSE LI+NRR+KERA+ EL+E  R RA+RN
Sbjct  421  VSEALIKNRRDKERAVRELLEDLRSRAKRN  450



>ref|XP_004507847.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Cicer 
arietinum]
Length=518

 Score =   388 bits (997),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 203/284 (71%), Positives = 231/284 (81%), Gaps = 15/284 (5%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP+KK+EI  DL DFANG++FY +TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPLKKKEIMEDLIDFANGQSFYHKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNR--  355
            GKSSMIAAMAN+LGYDIYD+ELTEVH NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR  
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHNNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  308

Query  356  ERMNGGGSTREYSSAATQ----------GGEDGGNRITLSGLLNFTDGLWSCCGSERIFV  505
            ++ N  GS   Y S   +          GGE+GGN ITLSGLLNFTDGLWSCCGSERIFV
Sbjct  309  DKNNVSGSRSFYDSVEMRGVGGGVGVGGGGEEGGNSITLSGLLNFTDGLWSCCGSERIFV  368

Query  506  FTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrql  685
            FTTNH+EKLDPALLRSGRMDMHI MSYC+  ALKILLK Y       E  + +   L++L
Sbjct  369  FTTNHIEKLDPALLRSGRMDMHIFMSYCSVSALKILLKKY---LGVEEGVDLDEIVLKEL  425

Query  686  aeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNT  817
             EV++ A+MTPAD+SEVLI+NRR KE+A+ EL+EI + +AE N 
Sbjct  426  EEVVEIAKMTPADISEVLIKNRRKKEKAVGELLEILKSKAEENV  469



>ref|XP_010048621.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
Length=518

 Score =   388 bits (996),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 207/308 (67%), Positives = 241/308 (78%), Gaps = 13/308 (4%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWE+VPFKHPSTFDTLAMDP KK +I  DL+DFA G+AFYQRTGRAWKRGYLLYGPPGTG
Sbjct  197  PWEAVPFKHPSTFDTLAMDPEKKRDIMEDLRDFAAGQAFYQRTGRAWKRGYLLYGPPGTG  256

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMANFLGYDIYD+ELTEV +N+ELRKLLMKTSSKSIIVIEDIDCSVNL+NR + 
Sbjct  257  KSSMIAAMANFLGYDIYDLELTEVPSNTELRKLLMKTSSKSIIVIEDIDCSVNLSNRSKA  316

Query  365  NGGGSTREYS----SAATQGGED-GGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                  + YS    S A  GG+D   N +TLSGLLNFTDGLWSCCGSERIFVFTTNH++K
Sbjct  317  PKAPPPQSYSAPDASNAASGGKDWNNNTMTLSGLLNFTDGLWSCCGSERIFVFTTNHIDK  376

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPALLRSGRMDMHI MSYC++PAL+ILL NY      +E E+    A  +L E ++ A+
Sbjct  377  LDPALLRSGRMDMHICMSYCSYPALEILLHNY----LGSEGEDLSEAAASELREAVEKAK  432

Query  710  MTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeedeeqe  889
            MTPAD+SEVLI+ RRN+E+ + EL+E+ + RAE N              +   +E+EEQE
Sbjct  433  MTPADISEVLIKKRRNREKVVSELLEVMKARAEGN----EEYGGLREKFESNGDEEEEQE  488

Query  890  KRALESPK  913
            KRALESPK
Sbjct  489  KRALESPK  496



>ref|XP_010259830.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Nelumbo nucifera]
Length=505

 Score =   387 bits (995),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 202/272 (74%), Positives = 228/272 (84%), Gaps = 7/272 (3%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP KK EI ADL+DFA+G++FYQ TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPAKKAEIMADLRDFADGQSFYQTTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEV+TNSELRKLLMKT+SKSIIVIEDIDCS+NLTNR++
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVNTNSELRKLLMKTTSKSIIVIEDIDCSINLTNRKK  308

Query  362  MNGGG---STREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
              G        +    A  GGEDGGN ITLSGLLNFTDGLWSCCGSERIFVFTTNH+EKL
Sbjct  309  PAGRNYHDPIPDMRGGAGSGGEDGGNSITLSGLLNFTDGLWSCCGSERIFVFTTNHIEKL  368

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPALLR GRMDMHI MSYC+FPALKILLKNY        + + + E L++L  VID AEM
Sbjct  369  DPALLRCGRMDMHIFMSYCSFPALKILLKNY----LGLNEGDLKDEVLKELEAVIDMAEM  424

Query  713  TPADVSEVLIRNRRNKERALWELVEISRMRAE  808
            TPAD+SEVLI+NRR+K +A+ EL+   + RAE
Sbjct  425  TPADISEVLIKNRRDKAKAMAELLAALKNRAE  456



>ref|XP_008811298.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
 ref|XP_008811299.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
 ref|XP_008811300.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
 ref|XP_008811301.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
 ref|XP_008811303.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
 ref|XP_008811304.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
 ref|XP_008811305.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
 ref|XP_008811306.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
Length=523

 Score =   388 bits (996),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 204/272 (75%), Positives = 224/272 (82%), Gaps = 6/272 (2%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP KKEEI ADL+DFA G AFYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPSKKEEIMADLRDFAEGNAFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFLGYDIYD+ELTEVHTNSELRKLLMKT+SKSIIVIEDIDCS+NLTNR  
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHTNSELRKLLMKTTSKSIIVIEDIDCSINLTNRSS  308

Query  362  M---NGGGSTREYSSAATQGGEDG-GNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                N   S       A  G +D   N ITLSGLLNFTDGLWSCCGSERIFVFTTN +EK
Sbjct  309  KKPPNEPPSEFRAGPGARTGPDDATANSITLSGLLNFTDGLWSCCGSERIFVFTTNRIEK  368

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPALLRSGRMDMHI MSYC+FPALKIL+KNY       E + EE   L+QL EVID AE
Sbjct  369  LDPALLRSGRMDMHIFMSYCSFPALKILMKNY-LGFDDGELDGEEDGLLKQLEEVIDEAE  427

Query  710  MTPADVSEVLIRNRRNKER-ALWELVEISRMR  802
            +TPADVSE+LI+NRR ++R A+ EL+E+ + R
Sbjct  428  ITPADVSELLIKNRRREKREAIKELLEVLKSR  459



>gb|KCW80939.1| hypothetical protein EUGRSUZ_C02298 [Eucalyptus grandis]
Length=501

 Score =   386 bits (992),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 207/310 (67%), Positives = 242/310 (78%), Gaps = 13/310 (4%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWE+VPFKHPSTFDTLAMDP KK +I  DL+DFA G+AFYQRTGRAWKRGYLLYGPPGTG
Sbjct  197  PWEAVPFKHPSTFDTLAMDPEKKRDIMEDLRDFAAGQAFYQRTGRAWKRGYLLYGPPGTG  256

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMANFLGYDIYD+ELTEV +N+ELRKLLMKTSSKSIIVIEDIDCSVNL+NR + 
Sbjct  257  KSSMIAAMANFLGYDIYDLELTEVPSNTELRKLLMKTSSKSIIVIEDIDCSVNLSNRSKA  316

Query  365  NGGGSTREYS----SAATQGGED-GGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                  + YS    S A  GG+D   N +TLSGLLNFTDGLWSCCGSERIFVFTTNH++K
Sbjct  317  PKAPPPQSYSAPDASNAASGGKDWNNNTMTLSGLLNFTDGLWSCCGSERIFVFTTNHIDK  376

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPALLRSGRMDMHI MSYC++PAL+ILL NY      +E E+    A  +L E ++ A+
Sbjct  377  LDPALLRSGRMDMHICMSYCSYPALEILLHNY----LGSEGEDLSEAAASELREAVEKAK  432

Query  710  MTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeedeeqe  889
            MTPAD+SEVLI+ RRN+E+ + EL+E+ + RAE     K          +    E+EEQE
Sbjct  433  MTPADISEVLIKKRRNREKVVSELLEVIKARAE----GKEEYGGLREKCESNGVEEEEQE  488

Query  890  KRALESPKRN  919
            KRALESP+R+
Sbjct  489  KRALESPQRS  498



>ref|XP_004163719.1| PREDICTED: LOW QUALITY PROTEIN: probable mitochondrial chaperone 
BCS1-B-like [Cucumis sativus]
Length=529

 Score =   387 bits (995),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 197/285 (69%), Positives = 229/285 (80%), Gaps = 18/285 (6%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP+KK++I  DL+DFANG+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPLKKQQIMEDLRDFANGQRFYQQTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFLGYDIYD+ELTEVH NSELRKLLMKT+SKSIIVIEDIDCS+NLT+R++
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHNNSELRKLLMKTTSKSIIVIEDIDCSINLTDRKK  308

Query  362  MNGGGSTREY--------------SSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERI  499
             +     R Y                 +  G + GGN ITLSGLLNFTDGLWSCCGSERI
Sbjct  309  KSPVSGMRSYYDLPDFRCGGGNGGGYGSISGDDGGGNSITLSGLLNFTDGLWSCCGSERI  368

Query  500  FVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealr  679
            FVFTTNH+EKLD ALLRSGRMDMHI MSYC+F ALKILLKNY       E+++ +   L 
Sbjct  369  FVFTTNHIEKLDSALLRSGRMDMHIFMSYCSFSALKILLKNY----LNYEEDDLDSIVLN  424

Query  680  qlaeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            ++ +VID A+MTPADVSE+LI+NRR K RA+ EL+E  + +AE+N
Sbjct  425  EIKDVIDKAKMTPADVSELLIKNRRCKNRAVTELLETLKSKAEKN  469



>ref|XP_009139593.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Brassica 
rapa]
Length=513

 Score =   386 bits (992),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 199/274 (73%), Positives = 223/274 (81%), Gaps = 13/274 (5%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTF+TLAMDPVKK EI  DLKDF    +FYQRTGRAWKRGYLL+GPPGTG
Sbjct  194  PWESVPFKHPSTFETLAMDPVKKREIMEDLKDFTECRSFYQRTGRAWKRGYLLHGPPGTG  253

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN+LGYDIYD+ELTEV +NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR   
Sbjct  254  KSSMIAAMANYLGYDIYDLELTEVKSNSELRKLLMKTSSKSIIVIEDIDCSINLTNR---  310

Query  365  NGGGSTREYSSAATQGG---EDG-GNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
              G    E   A T  G   E G GN ITLSGLLNFTDGLWSCCGSERIFVFTTNH+EKL
Sbjct  311  --GKKFNEPEMALTGSGLGDESGNGNTITLSGLLNFTDGLWSCCGSERIFVFTTNHIEKL  368

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPALLRSGRMDMH++MSYC FP+LKILL+NY       E+ +     L++L  V++ AE+
Sbjct  369  DPALLRSGRMDMHVYMSYCTFPSLKILLRNY----LGYEEGDLSDVVLKELEGVVEKAEI  424

Query  713  TPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            TPADVSEVLI+NRR+KERA+ EL+E  + RA RN
Sbjct  425  TPADVSEVLIKNRRDKERAVGELLEDLKRRAGRN  458



>ref|XP_004146314.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Cucumis 
sativus]
 gb|KGN65452.1| hypothetical protein Csa_1G423100 [Cucumis sativus]
Length=530

 Score =   387 bits (994),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 197/285 (69%), Positives = 229/285 (80%), Gaps = 18/285 (6%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP+KK++I  DL+DFANG+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPLKKQQIMEDLRDFANGQRFYQQTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFLGYDIYD+ELTEVH NSELRKLLMKT+SKSIIVIEDIDCS+NLT+R++
Sbjct  249  GKSSMIAAMANFLGYDIYDLELTEVHNNSELRKLLMKTTSKSIIVIEDIDCSINLTDRKK  308

Query  362  MNGGGSTREY--------------SSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERI  499
             +     R Y                 +  G + GGN ITLSGLLNFTDGLWSCCGSERI
Sbjct  309  KSPVSGMRSYYDLPDFRCGGGNGGGYGSISGDDGGGNSITLSGLLNFTDGLWSCCGSERI  368

Query  500  FVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealr  679
            FVFTTNH+EKLD ALLRSGRMDMHI MSYC+F ALKILLKNY       E+++ +   L 
Sbjct  369  FVFTTNHIEKLDSALLRSGRMDMHIFMSYCSFSALKILLKNY----LNYEEDDLDSIVLN  424

Query  680  qlaeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            ++ +VID A+MTPADVSE+LI+NRR K RA+ EL+E  + +AE+N
Sbjct  425  EIKDVIDKAKMTPADVSELLIKNRRCKNRAVTELLETLKSKAEKN  469



>emb|CDX89391.1| BnaA01g15020D [Brassica napus]
Length=509

 Score =   386 bits (992),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 198/274 (72%), Positives = 222/274 (81%), Gaps = 13/274 (5%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTF+TLAMDPVKK EI  DLKDF    +FYQRTGRAWKRGYLL+GPPGTG
Sbjct  196  PWESVPFKHPSTFETLAMDPVKKREIMEDLKDFTECRSFYQRTGRAWKRGYLLHGPPGTG  255

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN+LGYDIYD+ELTEV +NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR   
Sbjct  256  KSSMIAAMANYLGYDIYDLELTEVKSNSELRKLLMKTSSKSIIVIEDIDCSINLTNR---  312

Query  365  NGGGSTREYSSAATQGG----EDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
              G    E   A T  G       G+ ITLSGLLNFTDGLWSCCGSERIFVFTTNH+EKL
Sbjct  313  --GKKFNEPEMALTGSGLGDESVNGDTITLSGLLNFTDGLWSCCGSERIFVFTTNHIEKL  370

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPALLRSGRMDMH++MSYC FP+LKILL+NY       E+ +     LR+L  V++ AE+
Sbjct  371  DPALLRSGRMDMHVYMSYCTFPSLKILLRNY----LGYEEGDLSDVVLRELEGVVEKAEI  426

Query  713  TPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            TPADVSEVLI+NRR+KERA+ EL+E  + RAERN
Sbjct  427  TPADVSEVLIKNRRDKERAVRELLEDLKRRAERN  460



>ref|XP_010452147.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=526

 Score =   386 bits (992),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 198/288 (69%), Positives = 227/288 (79%), Gaps = 20/288 (7%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP+KK++I  DLKDFA G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPLKKQQIMDDLKDFAKGQVFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNR--  355
            GKSSMIAAMAN+LGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR  
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  308

Query  356  -ERMNGGGSTREYSSAATQGGEDGGNR-------------ITLSGLLNFTDGLWSCCGSE  493
                      + Y    T+ G   G               ITLSGLLNFTDGLWSCCGSE
Sbjct  309  NSSNVSSSLKKSYYEPETRNGSGSGGSGGSGEEGGNGNNTITLSGLLNFTDGLWSCCGSE  368

Query  494  RIFVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegea  673
            RIFVFTTNH+EKLDPALLRSGRMDMHI+MS+CNFP+LKILLKNY       E+E+   + 
Sbjct  369  RIFVFTTNHIEKLDPALLRSGRMDMHIYMSFCNFPSLKILLKNY----LGYEEEDVNEDV  424

Query  674  lrqlaeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNT  817
            L+++  V+D AEMTPADVSE LI+NRR+KE+A+ EL+E  + R ERN 
Sbjct  425  LKEMERVVDKAEMTPADVSEALIKNRRDKEKAIRELLEDLKSRGERNV  472



>emb|CDX88624.1| BnaA03g10250D [Brassica napus]
Length=513

 Score =   385 bits (989),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 200/282 (71%), Positives = 231/282 (82%), Gaps = 16/282 (6%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP KK+EI  DLKDF  G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPTKKQEIMDDLKDFVLGQMFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR +
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRNK  308

Query  362  MNG----------GGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFT  511
             +G          G  TR  S +  + G   GN ITLSGLLNFTDGLWSCCGSERIFVFT
Sbjct  309  SSGLKADLQNLRIGSETRSGSGSGEESGN--GNTITLSGLLNFTDGLWSCCGSERIFVFT  366

Query  512  TNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlae  691
            TNH+EKLDPALLRSGRMDMH+ MSYC+FP+LKILL+NY       E+E+ +G+ L+++  
Sbjct  367  TNHIEKLDPALLRSGRMDMHVCMSYCDFPSLKILLRNY----LGYEEEDVDGDVLKEMER  422

Query  692  VIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNT  817
            V++ AEMTPADVSE LIRNRR+KE+A+ EL+   + R ERN 
Sbjct  423  VVEKAEMTPADVSEALIRNRRDKEKAVRELLVELKSRWERNV  464



>gb|EPS73892.1| hypothetical protein M569_00859, partial [Genlisea aurea]
Length=509

 Score =   385 bits (988),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/275 (69%), Positives = 226/275 (82%), Gaps = 8/275 (3%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP KK E+ ADL+DFANGE+FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPEKKSELMADLRDFANGESFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN++GYDIYD+ELTEV TNSELRKLLMKTSSKSIIVIEDIDCS+NL++R +
Sbjct  249  GKSSMIAAMANYIGYDIYDLELTEVCTNSELRKLLMKTSSKSIIVIEDIDCSINLSDRNK  308

Query  362  MNGG-GS---TREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
            ++G  GS    R  +      G+D GN +TLSGLLNFTDGLWSCCGSERIFVFTTNH+EK
Sbjct  309  ISGSCGSIPGARRNAYDIPGAGDDAGNTVTLSGLLNFTDGLWSCCGSERIFVFTTNHIEK  368

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPALLRSGRMD+HIHM++C+F +L+ILLKNY          +     L +   +I  AE
Sbjct  369  LDPALLRSGRMDVHIHMTFCSFQSLEILLKNY----LGFHDGDLPEGVLSEFEALIGDAE  424

Query  710  MTPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            +TPA+VSEVLI+NRR+ ++A+ EL+E  R  AE+N
Sbjct  425  ITPAEVSEVLIKNRRDGKKAVDELMEKLRRMAEKN  459



>gb|EYU42411.1| hypothetical protein MIMGU_mgv1a004413mg [Erythranthe guttata]
Length=528

 Score =   384 bits (987),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 221/319 (69%), Positives = 247/319 (77%), Gaps = 18/319 (6%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP KK EI ADL DFANGE+FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFDTLAMDPSKKAEIMADLLDFANGESFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEV+TNSELRKLLMKTSSKSIIVIEDIDCS+NLTNR +
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVNTNSELRKLLMKTSSKSIIVIEDIDCSINLTNRNK  308

Query  362  MNGGGSTREYSSAATQGGE------------DGGNRITLSGLLNFTDGLWSCCGSERIFV  505
              GGG        +   G             +GGN ITLSGLLNFTDGLWSCCGSERIFV
Sbjct  309  SGGGGGGAAARKNSYDIGSPPGGGGAAGGGEEGGNTITLSGLLNFTDGLWSCCGSERIFV  368

Query  506  FTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrql  685
            FTTNH+EKLDPALLRSGRMDMHI+MSYC+F +LKILLKNYLG E +  +E    E    +
Sbjct  369  FTTNHIEKLDPALLRSGRMDMHINMSYCSFQSLKILLKNYLGFEESGLREGVLAELEAVV  428

Query  686  aeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvf  865
            A    AAEMTPAD+SEVLI+NRR+K +A+ ELVE  ++RAE+N  +           +  
Sbjct  429  A----AAEMTPADISEVLIKNRRDKNKAVEELVEALKIRAEKN--RLKKTNVVVVIGNDV  482

Query  866  eeedeeqeKRALESPKRNG  922
              EDEEQEKRALE PK NG
Sbjct  483  VVEDEEQEKRALEYPKENG  501



>dbj|BAJ96296.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=516

 Score =   384 bits (985),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 193/272 (71%), Positives = 219/272 (81%), Gaps = 9/272 (3%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PW+ VPFKHPSTFDTLAMDP +K  I ADL+DFA+G +FY+RTGRAWKRGYLLYGPPGTG
Sbjct  191  PWDPVPFKHPSTFDTLAMDPDRKASIMADLRDFADGSSFYERTGRAWKRGYLLYGPPGTG  250

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMANFLGYD+YD+ELTEV +N+ELRKLLMKT+SKSIIVIEDIDCSV+LTNR  +
Sbjct  251  KSSMIAAMANFLGYDVYDLELTEVSSNAELRKLLMKTTSKSIIVIEDIDCSVDLTNRAAL  310

Query  365  NGGGSTREYSSAAT--QGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
                  R     A     G   G  ITLSGLLNFTDGLWSCCGSERIFVFTTNH+EKLDP
Sbjct  311  APAPRPRPTLDGAVDQDAGAASGRSITLSGLLNFTDGLWSCCGSERIFVFTTNHIEKLDP  370

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTP  718
            ALLRSGRMDMH+ MSYC FPALKILLKNYL L+  + +     E        I+AAE+TP
Sbjct  371  ALLRSGRMDMHVFMSYCTFPALKILLKNYLCLQDDSAEVMRGLEEW------IEAAEITP  424

Query  719  ADVSEVLIRNRRN-KERALWELVEISRMRAER  811
            ADVSEVLI+NRRN KERA+ EL+E+ + RAE+
Sbjct  425  ADVSEVLIKNRRNGKERAMEELLEVLKTRAEK  456



>dbj|BAJ90254.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97372.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=516

 Score =   383 bits (984),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 193/272 (71%), Positives = 219/272 (81%), Gaps = 9/272 (3%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PW+ VPFKHPSTFDTLAMDP +K  I ADL+DFA+G +FY+RTGRAWKRGYLLYGPPGTG
Sbjct  191  PWDPVPFKHPSTFDTLAMDPDRKASIMADLRDFADGSSFYERTGRAWKRGYLLYGPPGTG  250

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMANFLGYD+YD+ELTEV +N+ELRKLLMKT+SKSIIVIEDIDCSV+LTNR  +
Sbjct  251  KSSMIAAMANFLGYDVYDLELTEVSSNAELRKLLMKTTSKSIIVIEDIDCSVDLTNRAAL  310

Query  365  NGGGSTREYSSAAT--QGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
                  R     A     G   G  ITLSGLLNFTDGLWSCCGSERIFVFTTNH+EKLDP
Sbjct  311  APAPRPRPTLDGAVDQDAGAASGRSITLSGLLNFTDGLWSCCGSERIFVFTTNHIEKLDP  370

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTP  718
            ALLRSGRMDMH+ MSYC FPALKILLKNYL L+  + +     E        I+AAE+TP
Sbjct  371  ALLRSGRMDMHVFMSYCTFPALKILLKNYLCLQDDSAEVMRGLEEW------IEAAEITP  424

Query  719  ADVSEVLIRNRRN-KERALWELVEISRMRAER  811
            ADVSEVLI+NRRN KERA+ EL+E+ + RAE+
Sbjct  425  ADVSEVLIKNRRNGKERAMEELLEVLKTRAEK  456



>ref|XP_003578151.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Brachypodium 
distachyon]
Length=519

 Score =   383 bits (983),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 207/315 (66%), Positives = 245/315 (78%), Gaps = 24/315 (8%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PW+ VPFKHPSTFDTLAMDP +K +I ADL+DF+NG AFY+RTGRAWKRGYLLYGPPGTG
Sbjct  191  PWDPVPFKHPSTFDTLAMDPDRKADIMADLRDFSNGSAFYERTGRAWKRGYLLYGPPGTG  250

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMANFLGYD+YD+ELTEV +N+ELRKLLMKT+SKSIIVIEDIDCSV+LTNR  M
Sbjct  251  KSSMIAAMANFLGYDVYDLELTEVSSNAELRKLLMKTTSKSIIVIEDIDCSVDLTNRAAM  310

Query  365  -----------NGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFT  511
                         G +  + + AAT      G  ITLSGLLNFTDGLWSCCGSERIFVFT
Sbjct  311  AQPAPKPRPSITDGTADHDTTGAAT------GRSITLSGLLNFTDGLWSCCGSERIFVFT  364

Query  512  TNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlae  691
            TNHVEKLDPALLRSGRMDMH+ MSYC+FPALKILLKNYL  +  ++   +   A+ +   
Sbjct  365  TNHVEKLDPALLRSGRMDMHVFMSYCSFPALKILLKNYLCFQGDSDDCADVVRAMEEW--  422

Query  692  VIDAAEMTPADVSEVLIRNRRN-KERALWELVEISRMRAERNTgkkggernsgggedvfe  868
             I+AAE+TPADVSEVLI+NRRN K++ L EL+E+ + RAE+    +     +   +D  +
Sbjct  423  -IEAAEITPADVSEVLIKNRRNGKKKTLVELLEVLKARAEKR---QRDSGTAAARKDAGD  478

Query  869  eedeeqeKRALESPK  913
             E+EE+EKRALESPK
Sbjct  479  NEEEEEEKRALESPK  493



>emb|CDY71731.1| BnaAnng38610D [Brassica napus]
Length=498

 Score =   382 bits (980),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 191/272 (70%), Positives = 220/272 (81%), Gaps = 6/272 (2%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTF+TLAMDP KK EI  DLKDFA  E FY++TGRAWKRGYLLYGPPGTG
Sbjct  190  PWESVPFKHPSTFETLAMDPAKKREIIEDLKDFAECEYFYRKTGRAWKRGYLLYGPPGTG  249

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN+LGYDIYD+EL EV +NSELRKLLMKTSSKSIIVIEDIDCS++L NR + 
Sbjct  250  KSSMIAAMANYLGYDIYDLELAEVRSNSELRKLLMKTSSKSIIVIEDIDCSIDLKNRSKK  309

Query  365  NGGGSTRE--YSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
                   E   + +   G E  GN ITLSGLLNFTDGLWSCCGSERIFVFTTNH+EKLDP
Sbjct  310  KQSYYEPEMMLTGSGLGGDEGNGNTITLSGLLNFTDGLWSCCGSERIFVFTTNHIEKLDP  369

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTP  718
            ALLRSGRMDMH++MSYC F ++KILLKNY       E+ +   + L++L  V+D AE+TP
Sbjct  370  ALLRSGRMDMHVYMSYCTFASVKILLKNY----LGYEEGDLSDDVLKELERVVDKAEITP  425

Query  719  ADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            ADVSE LI+N+R+KERA+ EL+E  + RAERN
Sbjct  426  ADVSECLIKNKRDKERAVSELLEDMKRRAERN  457



>ref|XP_010483268.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X1 
[Camelina sativa]
 ref|XP_010483269.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X2 
[Camelina sativa]
Length=524

 Score =   382 bits (982),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 198/286 (69%), Positives = 229/286 (80%), Gaps = 18/286 (6%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP+KK++I  DLKDFA G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPLKKQQIMDDLKDFAKGQVFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR++
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKK  308

Query  362  ---MNGGGSTREYSSAATQGGEDGGNR-----------ITLSGLLNFTDGLWSCCGSERI  499
                N    +R Y    T+ G   G             ITLSGLLNFTDGLWSCCGSERI
Sbjct  309  SSSSNVSSLSRSYYEPDTRNGSGSGGSGEEGGNGNNNTITLSGLLNFTDGLWSCCGSERI  368

Query  500  FVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealr  679
            FVFTTNH+EKLDPALLRSGRMDM I+MS+CNFP+LKILLKNY       E+E+   + L+
Sbjct  369  FVFTTNHIEKLDPALLRSGRMDMRIYMSFCNFPSLKILLKNY----LGYEEEDVGEDVLK  424

Query  680  qlaeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNT  817
            ++  V+D AEMTPADVSE LI+NRR+KE+A+ EL+   + R ERN 
Sbjct  425  EMERVVDKAEMTPADVSEALIKNRRDKEKAIRELLVDLKSRGERNV  470



>ref|XP_009137558.1| PREDICTED: uncharacterized protein LOC103861592 [Brassica rapa]
Length=596

 Score =   384 bits (987),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 191/272 (70%), Positives = 221/272 (81%), Gaps = 6/272 (2%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTF+TLAMDP KK EI  DLKDFA  E+FY++TGRAWKRGYLLYGPPGTG
Sbjct  282  PWESVPFKHPSTFETLAMDPAKKREIMEDLKDFAECESFYRKTGRAWKRGYLLYGPPGTG  341

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN+LGYDIYD+EL EV +NSELRKLLMKTSSKSIIVIEDIDCS++L NR + 
Sbjct  342  KSSMIAAMANYLGYDIYDLELAEVRSNSELRKLLMKTSSKSIIVIEDIDCSIDLKNRSKK  401

Query  365  NGGGSTRE--YSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
                   E   + +   G E  GN ITLSGLLNFTDGLWSCCGSERIFVFTTNH+EKLDP
Sbjct  402  KQSYYEPEMMLTGSGLGGDEGNGNTITLSGLLNFTDGLWSCCGSERIFVFTTNHIEKLDP  461

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTP  718
            ALLRSGRMDMH++MSYC F ++KILLKNY       E+ +   + L++L  V+D AE+TP
Sbjct  462  ALLRSGRMDMHVYMSYCTFASVKILLKNY----LGYEEGDLSDDVLKELERVVDKAEITP  517

Query  719  ADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            ADVSE LI+N+R+KERA+ EL+E  + RAERN
Sbjct  518  ADVSECLIKNKRDKERAVSELLEDMKRRAERN  549



>emb|CDX94410.1| BnaC01g17740D [Brassica napus]
Length=516

 Score =   380 bits (977),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 198/281 (70%), Positives = 226/281 (80%), Gaps = 15/281 (5%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTF+TLAMDPVKK EI  DLKDFA  ++FY+RTGRAWKRGYLLYGPPGTG
Sbjct  192  PWESVPFKHPSTFETLAMDPVKKREIMEDLKDFAECQSFYRRTGRAWKRGYLLYGPPGTG  251

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER-  361
            KSSMIAAMAN+LGYDIYD+ELTEV +NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR   
Sbjct  252  KSSMIAAMANYLGYDIYDLELTEVKSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRGNK  311

Query  362  -------MNGGGSTRE---YSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFT  511
                   + G G   E    +      G   GN ITLSGLLNFTDGLWSCCGSERIFVFT
Sbjct  312  FNEPEMTLTGSGLGDESVNGNGNGNGNGNGNGNTITLSGLLNFTDGLWSCCGSERIFVFT  371

Query  512  TNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlae  691
            TNH+EKLDPALLRSGRMDMH++MSYC FP+LKILL+NY       E+ +   + L++L  
Sbjct  372  TNHIEKLDPALLRSGRMDMHVYMSYCTFPSLKILLRNY----LGYEEGDLSDDVLKELEG  427

Query  692  VIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            V++ AE+TPADVSEVLI+NRR+KERA+ EL+E  + RAERN
Sbjct  428  VVEKAEITPADVSEVLIKNRRDKERAVRELLEDLKRRAERN  468



>emb|CDY11867.1| BnaC03g12930D [Brassica napus]
Length=513

 Score =   379 bits (974),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/282 (70%), Positives = 229/282 (81%), Gaps = 16/282 (6%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP KK+EI  DLKDF  G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  189  HPWESVPFKHPSTFETLAMDPKKKQEIMDDLKDFVLGQMFYQKTGRAWKRGYLLYGPPGT  248

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN+LGYDIYD+ELTEVH+NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR +
Sbjct  249  GKSSMIAAMANYLGYDIYDLELTEVHSNSELRKLLMKTSSKSIIVIEDIDCSINLTNRNK  308

Query  362  MNG----------GGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFT  511
             +G          G  TR  S +  + G   GN ITLSGLLNFTDGLWSCCGSERIF+FT
Sbjct  309  SSGLKADLQNLRIGSETRSGSGSGEESGN--GNTITLSGLLNFTDGLWSCCGSERIFIFT  366

Query  512  TNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlae  691
            TNH+EKLDPALLRSGRMDMH+ MSYC+F +LKILL+NY       E+E+ + + L+++  
Sbjct  367  TNHIEKLDPALLRSGRMDMHVCMSYCDFSSLKILLRNY----LGYEEEDVDDDVLKEMER  422

Query  692  VIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNT  817
            V++ AEMTPADVSE LI+NRR+KE+A+ EL+   + R ERN 
Sbjct  423  VVEKAEMTPADVSEALIKNRRDKEKAVRELLVELKSRWERNV  464



>emb|CDX92734.1| BnaC07g39920D [Brassica napus]
Length=508

 Score =   379 bits (973),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 193/274 (70%), Positives = 219/274 (80%), Gaps = 9/274 (3%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTF+TLAMDP KK  I  DLKDFA  E+FY++TGRAWKRGYLLYGPPGTG
Sbjct  193  PWESVPFKHPSTFETLAMDPAKKRRIMEDLKDFAECESFYRKTGRAWKRGYLLYGPPGTG  252

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN+LGYDIYD+EL EV +NSELRKLLMKTSSKSIIVIEDIDCS+ L NR R 
Sbjct  253  KSSMIAAMANYLGYDIYDLELAEVRSNSELRKLLMKTSSKSIIVIEDIDCSIELKNR-RS  311

Query  365  NGGGSTRE----YSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
                S  E     + +   G E  GN ITLSGLLNFTDGLWSCCGSERIFVFTTNH+EKL
Sbjct  312  KKKQSYYEPEMMLTGSGLGGDEGNGNTITLSGLLNFTDGLWSCCGSERIFVFTTNHIEKL  371

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPALLRSGRMDMHI+MSYC F ++KILLKNY       E+ +   + L++L  V+D AE+
Sbjct  372  DPALLRSGRMDMHIYMSYCTFASVKILLKNY----LGYEEGDLSDDVLKELERVVDKAEI  427

Query  713  TPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            TPADVSE LI+NRR+KERA+ EL+E  + R ERN
Sbjct  428  TPADVSEALIKNRRDKERAVRELLEDMKRRVERN  461



>gb|KCW80934.1| hypothetical protein EUGRSUZ_C02293, partial [Eucalyptus grandis]
Length=482

 Score =   376 bits (965),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 191/274 (70%), Positives = 222/274 (81%), Gaps = 9/274 (3%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  VPFKHP TFDTLAM+P +K  I  DL+DFA G+AFYQRTGRAWKRGYLLYGPPGTGK
Sbjct  180  WTPVPFKHPGTFDTLAMEPERKRGIMEDLRDFAAGQAFYQRTGRAWKRGYLLYGPPGTGK  239

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SSMIAAMANFLGYDIYD+ELTEV +NSELRKLLMKTSSKSIIVIEDIDCS NL+NR   +
Sbjct  240  SSMIAAMANFLGYDIYDLELTEVLSNSELRKLLMKTSSKSIIVIEDIDCSANLSNRSEAS  299

Query  368  GGGSTREYSSAAT----QGGEDGGN-RITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
                 R  S  +T      G+ G N +ITLSGLLNFTDGLWSCCGSERIFVFTTNH+EKL
Sbjct  300  QASVPRSSSDPSTPDAASSGKGGNNKKITLSGLLNFTDGLWSCCGSERIFVFTTNHIEKL  359

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPALLRSGRMD+HI+M+YC++PALKILL+NY      +E ++    A R+L E ++ A+M
Sbjct  360  DPALLRSGRMDVHIYMNYCSYPALKILLQNY----LGSEAKDLGQAAARELQEAVEKAKM  415

Query  713  TPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            TPAD+SEVLI+NRRNKE+A+ EL+E  +  AERN
Sbjct  416  TPADISEVLIKNRRNKEKAVNELLEALKAGAERN  449



>ref|XP_010048618.1| PREDICTED: mitochondrial chaperone BCS1-like [Eucalyptus grandis]
Length=520

 Score =   376 bits (966),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 191/274 (70%), Positives = 222/274 (81%), Gaps = 9/274 (3%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  VPFKHP TFDTLAM+P +K  I  DL+DFA G+AFYQRTGRAWKRGYLLYGPPGTGK
Sbjct  196  WTPVPFKHPGTFDTLAMEPERKRGIMEDLRDFAAGQAFYQRTGRAWKRGYLLYGPPGTGK  255

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SSMIAAMANFLGYDIYD+ELTEV +NSELRKLLMKTSSKSIIVIEDIDCS NL+NR   +
Sbjct  256  SSMIAAMANFLGYDIYDLELTEVLSNSELRKLLMKTSSKSIIVIEDIDCSANLSNRSEAS  315

Query  368  GGGSTREYSSAAT----QGGEDGGN-RITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
                 R  S  +T      G+ G N +ITLSGLLNFTDGLWSCCGSERIFVFTTNH+EKL
Sbjct  316  QASVPRSSSDPSTPDAASSGKGGNNKKITLSGLLNFTDGLWSCCGSERIFVFTTNHIEKL  375

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPALLRSGRMD+HI+M+YC++PALKILL+NY      +E ++    A R+L E ++ A+M
Sbjct  376  DPALLRSGRMDVHIYMNYCSYPALKILLQNY----LGSEAKDLGQAAARELQEAVEKAKM  431

Query  713  TPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            TPAD+SEVLI+NRRNKE+A+ EL+E  +  AERN
Sbjct  432  TPADISEVLIKNRRNKEKAVNELLEALKAGAERN  465



>ref|XP_009403322.1| PREDICTED: cell division cycle protein 48-like [Musa acuminata 
subsp. malaccensis]
Length=518

 Score =   375 bits (964),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 211/313 (67%), Positives = 243/313 (78%), Gaps = 7/313 (2%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTFDTLAMD  +KE I ADLKDFA G+AFY++TGRAWKRGYLLYGPPGTG
Sbjct  190  PWESVPFKHPSTFDTLAMDSSRKELIMADLKDFAEGKAFYEKTGRAWKRGYLLYGPPGTG  249

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNR--E  358
            KSSMIAAMAN+LGYD+YD+ELTEVHTNSELRKLLMKT+ KSIIVIEDIDCS+NLTNR  +
Sbjct  250  KSSMIAAMANYLGYDVYDLELTEVHTNSELRKLLMKTTPKSIIVIEDIDCSINLTNRSSK  309

Query  359  RMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
            ++      R       +        +TLSGLLNFTDGLWSCCGSERIFVFTTNHVE+LD 
Sbjct  310  KLASPYDLRPTGGCGAEDVHAAAKTMTLSGLLNFTDGLWSCCGSERIFVFTTNHVEELDS  369

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaae--qeeeegealrqlaeVIDAAEM  712
            ALLRSGRMDMHI MSYC+FPALKIL+KNYLGLE        +E    LR+L EVID AE+
Sbjct  370  ALLRSGRMDMHILMSYCSFPALKILMKNYLGLEDGELGGDTQENCGLLRELEEVIDDAEI  429

Query  713  TPADVSEVLIRNRRNKER-ALWELVEISRMRAERNTgkk--ggernsgggedvfeeedee  883
            TPADVSE+LI+NRR ++R A+ EL+E  + RAE+   ++            D   EE+EE
Sbjct  430  TPADVSEILIKNRRREKREAMAELLEALKARAEKRKKERGGSSATARKKSLDDEMEEEEE  489

Query  884  qeKRALESPKRNG  922
            QEKRALESPK +G
Sbjct  490  QEKRALESPKESG  502



>ref|XP_010048617.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
 gb|KCW80931.1| hypothetical protein EUGRSUZ_C02290 [Eucalyptus grandis]
Length=503

 Score =   374 bits (960),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 208/307 (68%), Positives = 238/307 (78%), Gaps = 10/307 (3%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V FKHPSTFDTLAMDP +K +I  DL+DF  G+AFYQRTGRAWKRGYLLYGPPGTGK
Sbjct  180  WNPVLFKHPSTFDTLAMDPERKRDIMEDLRDFVAGKAFYQRTGRAWKRGYLLYGPPGTGK  239

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SSMIAAMANFL YDIYD+ELT+V +NSELR LLM+TSSKSIIVIEDIDCS NL NR +  
Sbjct  240  SSMIAAMANFLSYDIYDLELTKVLSNSELRDLLMRTSSKSIIVIEDIDCSANLCNRSKAP  299

Query  368  GGGSTREYSSA----ATQGGEDGGNR-ITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
               + R  S      A  G EDG N  ITLSGLLNFTDGLWSCCGSERIFVFTTNH++KL
Sbjct  300  QDLARRSCSDPGAPNAALGSEDGNNNPITLSGLLNFTDGLWSCCGSERIFVFTTNHIDKL  359

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPALLRSGRMDMHI+MSYC++PALKILL NY     +  ++  E  A  +L EV+  A+M
Sbjct  360  DPALLRSGRMDMHIYMSYCSYPALKILLHNY---LGSEAEDLGEAAAASELREVVKKAKM  416

Query  713  TPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeedeeqeK  892
            TPAD+SEVLI+NRRNKE+A+ EL+E  + RAERN  +K G        +  EEE+EEQEK
Sbjct  417  TPADISEVLIKNRRNKEKAVSELLEALKARAERN--EKYGGLRGERELNGEEEEEEEQEK  474

Query  893  RALESPK  913
            RALESPK
Sbjct  475  RALESPK  481



>dbj|BAD33929.1| AAA ATPase, central region (50.1 kD)-like protein [Oryza sativa 
Japonica Group]
 gb|EAZ44829.1| hypothetical protein OsJ_29465 [Oryza sativa Japonica Group]
Length=523

 Score =   372 bits (956),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 206/318 (65%), Positives = 238/318 (75%), Gaps = 14/318 (4%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PW+ VPFKHPSTFDTLAMDP +K  I ADL+DFA+G AFY+RTGRAWKRGYLLYGPPGTG
Sbjct  191  PWDPVPFKHPSTFDTLAMDPERKAAIMADLRDFADGSAFYERTGRAWKRGYLLYGPPGTG  250

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN LGYD+YD+ELTEV +N+ELRKLLMKT+SKSIIVIEDIDCSV+LTNR   
Sbjct  251  KSSMIAAMANHLGYDVYDLELTEVGSNAELRKLLMKTTSKSIIVIEDIDCSVDLTNRATA  310

Query  365  NGGGSTREYSSAATQGGED----------GGNRITLSGLLNFTDGLWSCCGSERIFVFTT  514
                   +  ++   G  D              ITLSGLLNFTDGLWSCCGSERIFVFTT
Sbjct  311  AAAAQPPKPRASIDGGAIDQDAAAAPAGAAARSITLSGLLNFTDGLWSCCGSERIFVFTT  370

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NH+EKLDPALLRSGRMDMHI MSYC FPALKILL+NYL  +++A        A     E 
Sbjct  371  NHIEKLDPALLRSGRMDMHIFMSYCTFPALKILLRNYLDDDSSASSSSAAAAATMAGLET  430

Query  695  -IDAAEMTPADVSEVLIRNRRN-KERALWELVEISRMRAERNTgkkggernsgggedvfe  868
             IDAAE+TPADVSEVLI+NRRN +E+A+ +L+E+ + RAE+          +  G    E
Sbjct  431  WIDAAEITPADVSEVLIKNRRNGREQAMEQLLEVLKARAEKRP--PSAAAGNATGGGDNE  488

Query  869  eedeeqeKRALESPKRNG  922
            EE+EE+EKRALESPK  G
Sbjct  489  EEEEEEEKRALESPKEGG  506



>gb|EAZ09202.1| hypothetical protein OsI_31476 [Oryza sativa Indica Group]
Length=524

 Score =   372 bits (956),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 209/318 (66%), Positives = 241/318 (76%), Gaps = 13/318 (4%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PW+ VPFKHPSTFDTLAMDP +K  I ADL+DFA+G AFY+RTGRAWKRGYLLYGPPGTG
Sbjct  191  PWDPVPFKHPSTFDTLAMDPERKAAIMADLRDFADGSAFYERTGRAWKRGYLLYGPPGTG  250

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN LGYD+YD+ELTEV +N+ELRKLLMKT+SKSIIVIEDIDCSV+LTNR   
Sbjct  251  KSSMIAAMANHLGYDVYDLELTEVGSNAELRKLLMKTTSKSIIVIEDIDCSVDLTNRATA  310

Query  365  NGGGSTREYSSAATQGGED----------GGNRITLSGLLNFTDGLWSCCGSERIFVFTT  514
                   +  ++   G  D              ITLSGLLNFTDGLWSCCGSERIFVFTT
Sbjct  311  AAAAQPPKPRASIDGGAIDQDAAAAPAGAAARSITLSGLLNFTDGLWSCCGSERIFVFTT  370

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NH+EKLDPALLRSGRMDMHI MSYC FPALKILL+NYL  +++A        A     E 
Sbjct  371  NHIEKLDPALLRSGRMDMHIFMSYCTFPALKILLRNYLDDDSSASSSSAAAAATMAGLET  430

Query  695  -IDAAEMTPADVSEVLIRNRRN-KERALWELVEISRMRAERNTgkkggernsgggedvfe  868
             IDAAE+TPADVSEVLI+NRRN +E+A+ +L+E+ + RAE+         N+ GG D  E
Sbjct  431  WIDAAEITPADVSEVLIKNRRNGREQAMEQLLEVLKARAEKRP-PSAAAGNATGGGDNEE  489

Query  869  eedeeqeKRALESPKRNG  922
            EE+EE+EKRALESPK  G
Sbjct  490  EEEEEEEKRALESPKEGG  507



>gb|KCW80933.1| hypothetical protein EUGRSUZ_C02292 [Eucalyptus grandis]
Length=517

 Score =   372 bits (954),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/274 (69%), Positives = 219/274 (80%), Gaps = 9/274 (3%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W+ VPFKHPSTFDTLAMDP +K EI  DL+DF  G+AFYQRTGRAWKRGYLLYGPPGTGK
Sbjct  181  WKPVPFKHPSTFDTLAMDPERKREIMDDLRDFVAGKAFYQRTGRAWKRGYLLYGPPGTGK  240

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SSMIAAMANFL YDIYD+ELT+V +NSELR+LLMKTSSKSIIVIEDIDCS +L NR +  
Sbjct  241  SSMIAAMANFLSYDIYDLELTKVCSNSELRELLMKTSSKSIIVIEDIDCSADLPNRSKAP  300

Query  368  GGGSTREYSSAATQGGEDGG-----NRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
               + R  S+        GG     N ITLSGLLNFTDGLWSC GSERIFVFTTNH++K+
Sbjct  301  QHPARRSCSNPGAPDAPSGGKHRNNNTITLSGLLNFTDGLWSCSGSERIFVFTTNHIDKI  360

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPALLRSGRMDMHI++SYC++PALKILL+NY      +E E+    A  +L EV+  A+M
Sbjct  361  DPALLRSGRMDMHIYLSYCSYPALKILLQNY----LGSEAEDLGRAAASELREVVKKAKM  416

Query  713  TPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            TPAD+SEVLI+NRRNKE+AL EL+E  + RAERN
Sbjct  417  TPADISEVLIKNRRNKEKALSELLEALKARAERN  450



>ref|XP_008652752.1| PREDICTED: uncharacterized protein LOC103632797 [Zea mays]
 tpg|DAA61594.1| TPA: hypothetical protein ZEAMMB73_200534 [Zea mays]
Length=530

 Score =   372 bits (954),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/273 (70%), Positives = 219/273 (80%), Gaps = 4/273 (1%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PW+ VPFKHPSTFDTLAMDP +K  I ADL+DFA G AFY+RTGRAWKRGYLLYGPPGTG
Sbjct  191  PWDPVPFKHPSTFDTLAMDPARKAAIMADLRDFAEGSAFYERTGRAWKRGYLLYGPPGTG  250

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMANFLGYD+YD+ELTEV +N+ELRKLLMKT+SKSIIVIEDIDCSV+LTNR   
Sbjct  251  KSSMIAAMANFLGYDVYDLELTEVSSNAELRKLLMKTTSKSIIVIEDIDCSVDLTNRAGA  310

Query  365  NGGGSTREYSSAATQ--GGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
                  R     A +  GG   G  ITLSGLLNFTDGLWSCCG+ERIFVFTTNH+EKLDP
Sbjct  311  PPRPKPRASIDGAIEQDGGAGAGRSITLSGLLNFTDGLWSCCGAERIFVFTTNHIEKLDP  370

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeeg-ealrqlaeVIDAAEMT  715
            ALLRSGRMDMH+ MSYC+F ALKILL+NYLG +   E +       LR L E +DAAE+T
Sbjct  371  ALLRSGRMDMHVFMSYCSFQALKILLRNYLGFQGDEELDRLSDPAVLRGLEEWVDAAEIT  430

Query  716  PADVSEVLIRNRRN-KERALWELVEISRMRAER  811
            PADVSEVLI+NRR+ K  A+ EL++  + RAE+
Sbjct  431  PADVSEVLIKNRRSGKAEAMRELLDALKARAEK  463



>ref|XP_006845620.1| hypothetical protein AMTR_s00019p00215810 [Amborella trichopoda]
 gb|ERN07295.1| hypothetical protein AMTR_s00019p00215810 [Amborella trichopoda]
Length=496

 Score =   370 bits (950),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 197/307 (64%), Positives = 230/307 (75%), Gaps = 17/307 (6%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTFDTLAM+P KK EIK DL DFA GE FY++TGRAWKRGYLLYGPPGTG
Sbjct  190  PWESVPFKHPSTFDTLAMNPAKKAEIKGDLDDFAKGEDFYKKTGRAWKRGYLLYGPPGTG  249

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN LGYDIYD+ELTEVH+NSELRKLL+KT+SKSIIVIEDIDCS++L+NR + 
Sbjct  250  KSSMIAAMANHLGYDIYDLELTEVHSNSELRKLLIKTTSKSIIVIEDIDCSIDLSNRAKK  309

Query  365  NGGGSTREYSSAATQGGEDGGNR-ITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPA  541
                +  + S+      E+   + +TLSGLLNFTDGLWSCCGSERIFVFTTNH+EKLDPA
Sbjct  310  PKPTTPSDPSNPTPNLQEENNTKTVTLSGLLNFTDGLWSCCGSERIFVFTTNHIEKLDPA  369

Query  542  LLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPA  721
            LLRSGRMDMHI MSYC + ALKIL+ NY          E E E L+ +  ++D AEMTPA
Sbjct  370  LLRSGRMDMHIFMSYCCYEALKILVTNY-------LGIEGEDEGLKAVEALVDEAEMTPA  422

Query  722  DVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeedeeqeKRAL  901
            D+SE+LI+ RR+ ++AL +L      RAE+                  EE  EEQEKRAL
Sbjct  423  DISEILIKRRRDPKKALEDLKAAMEKRAEQK---------ERVRNPTSEEVAEEQEKRAL  473

Query  902  ESPKRNG  922
            E+PK NG
Sbjct  474  ETPKENG  480



>ref|XP_009391104.1| PREDICTED: 26S protease regulatory subunit 6A homolog B-like 
[Musa acuminata subsp. malaccensis]
Length=502

 Score =   369 bits (946),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/271 (69%), Positives = 221/271 (82%), Gaps = 3/271 (1%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP+KKE IKADLKDFA  E FYQRTGRAWKRGYLLYGPPGT
Sbjct  188  HPWESVPFKHPSTFETLAMDPIKKEAIKADLKDFAEREVFYQRTGRAWKRGYLLYGPPGT  247

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAA+AN+L YD++D+ELTEVHTNS+LRKLLMKT+SKSIIVIEDIDCS+NLTNR  
Sbjct  248  GKSSMIAAIANYLNYDVFDLELTEVHTNSDLRKLLMKTTSKSIIVIEDIDCSINLTNRSS  307

Query  362  MNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPA  541
                 +   Y S       +    ITLSGLLNFTDGLWSCCG+ERIFVFTTNH+EKLDPA
Sbjct  308  -GWKKAMPLYDSTFGSDDANAAKTITLSGLLNFTDGLWSCCGNERIFVFTTNHIEKLDPA  366

Query  542  LLRSGRMDMHIHMSYCNFPALKILLKNYlg-leaaaeqeeeegealrqlaeVIDAAEMTP  718
            LLRSGRMDMHI MSYC++ ALK L++NYL   +   E E +  E L++L EVI+  ++TP
Sbjct  367  LLRSGRMDMHICMSYCSYEALKTLMQNYLSPEDVELEHEGKNAELLKELEEVINGVDITP  426

Query  719  ADVSEVLIRNRRNKE-RALWELVEISRMRAE  808
            ADVSE+LI+NRR K+  A+ EL+E+ + RA+
Sbjct  427  ADVSEILIKNRRRKKLEAMAELLEVLKNRAK  457



>ref|XP_010688491.1| PREDICTED: uncharacterized protein LOC104902414 [Beta vulgaris 
subsp. vulgaris]
Length=520

 Score =   368 bits (944),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 183/271 (68%), Positives = 215/271 (79%), Gaps = 4/271 (1%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWE+VPFKHPSTFDTLA+DP +K +I ADL++FA GE+FY+ TGRAWKRGYLLYGPPGT
Sbjct  191  HPWEAVPFKHPSTFDTLAIDPKRKADIMADLREFAAGESFYRATGRAWKRGYLLYGPPGT  250

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMAN L YDIYD+E+TEV +NSELRKLLMKT+SKSIIVIEDIDCSV+L++R+ 
Sbjct  251  GKSSMIAAMANHLNYDIYDLEVTEVGSNSELRKLLMKTTSKSIIVIEDIDCSVDLSDRKI  310

Query  362  MNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPA  541
                   R +       G  G   +TLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPA
Sbjct  311  NTPNHHHRGFHHPGPDDGLSGPGSVTLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPA  370

Query  542  LLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPA  721
            LLR GRMDMHIH+SYC+F ALKILLKNY       E  E + + + +   V++ AEMTPA
Sbjct  371  LLRCGRMDMHIHLSYCSFEALKILLKNY----VGLEDGELDSQTMAEFEAVVEKAEMTPA  426

Query  722  DVSEVLIRNRRNKERALWELVEISRMRAERN  814
            DVSEVLIR+RR ++R + EL+E  + RA  N
Sbjct  427  DVSEVLIRHRRERKRVVKELLEEFKRRANGN  457



>ref|XP_010433009.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=522

 Score =   368 bits (944),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 199/310 (64%), Positives = 236/310 (76%), Gaps = 8/310 (3%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPW+SV FKHPSTFDTLAMDP KK+ I  DL++FA+G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  199  HPWDSVRFKHPSTFDTLAMDPEKKKRIMEDLREFASGQGFYQKTGRAWKRGYLLYGPPGT  258

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSS+IAAMAN+LGYDIYD+ELTEV  NSELRKLLMKTSSKSIIVIEDIDCS+NLT R +
Sbjct  259  GKSSLIAAMANYLGYDIYDLELTEVQNNSELRKLLMKTSSKSIIVIEDIDCSINLTKRGK  318

Query  362  MNGGGSTREYSSAATQGG--EDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
                  + EY      G   ++ G+ +TLSGLLNFTDGLWSCCGSE+IFVFTTNH++KLD
Sbjct  319  NKKKNGSYEYDPGLINGSGLDEPGSSVTLSGLLNFTDGLWSCCGSEKIFVFTTNHIDKLD  378

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
             ALLRSGRMDMHIHM +C FPALKILLKNY       E++E +G  L ++   ++ AE+T
Sbjct  379  SALLRSGRMDMHIHMGFCKFPALKILLKNY----LRLEEDEIDGVVLEEMEGCVEEAEIT  434

Query  716  PADVSEVLIRNRRNKERALWELVEI--SRMRAERNTgkkggernsgggedvfeeedeeqe  889
            PADVSEVLI NR + E+A+ ELV +   R+   R            G E+  EE +EEQE
Sbjct  435  PADVSEVLISNRSDAEKAVRELVCVLKERVVKRRKNVGLKKVTKEEGEEEEEEEAEEEQE  494

Query  890  KRALESPKRN  919
            KRAL+SP RN
Sbjct  495  KRALDSPNRN  504



>ref|XP_004956922.1| PREDICTED: uncharacterized protein LOC101755746 [Setaria italica]
Length=529

 Score =   367 bits (941),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/272 (69%), Positives = 217/272 (80%), Gaps = 10/272 (4%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PW+ VPFKHPSTFDTLAMDP +K  I ADL+DFA+G AFY+RTGRAWKRGYLLYGPPGTG
Sbjct  191  PWDPVPFKHPSTFDTLAMDPARKAAIMADLRDFADGSAFYERTGRAWKRGYLLYGPPGTG  250

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN+LGYD+YD+ELTEV +N+ELRKLLMKT+SKSIIVIEDIDCSV+LTNR + 
Sbjct  251  KSSMIAAMANYLGYDVYDLELTEVGSNAELRKLLMKTTSKSIIVIEDIDCSVDLTNRAKP  310

Query  365  NGGGSTREYSSAAT---QGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
                     S   T    GG   G  ITLSGLLNFTDGLWSCCG+ERIFVFTTNHVEKLD
Sbjct  311  PAAAPKPRPSIDGTIDQDGGAGAGRSITLSGLLNFTDGLWSCCGAERIFVFTTNHVEKLD  370

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV------I  697
            PALLRSGRMDMHI MSYC+FPAL+ILL+NYLG E+  + +    E     A +      +
Sbjct  371  PALLRSGRMDMHIFMSYCSFPALRILLRNYLGFESDEDLDRLGDEDAGAAAALRGLEEWV  430

Query  698  DAAEMTPADVSEVLIRNRRN-KERALWELVEI  790
            DAAE+TPADVSEVLI+NRR+ K  A+ EL+++
Sbjct  431  DAAEITPADVSEVLIKNRRSGKAEAMRELLDV  462



>emb|CAB52469.1| putative protein [Arabidopsis thaliana]
 emb|CAB81018.1| putative protein [Arabidopsis thaliana]
Length=512

 Score =   366 bits (939),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 198/307 (64%), Positives = 234/307 (76%), Gaps = 6/307 (2%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPW+SV FKHPSTFDTLAMDP KK+ I  DL++FANG+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  190  HPWDSVRFKHPSTFDTLAMDPEKKKRIMEDLREFANGQGFYQKTGRAWKRGYLLYGPPGT  249

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSS+IAAMAN+LGYDIYD+ELTEV  NSELRKLLMKTSSKSIIVIEDIDCS++LT R +
Sbjct  250  GKSSLIAAMANYLGYDIYDLELTEVQNNSELRKLLMKTSSKSIIVIEDIDCSISLTKRGK  309

Query  362  MNGGGSTREYSSAATQGG--EDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
                  + EY    T G   E+ G+ +TLSGLLNFTDGLWSCCGSE+IFVFTTNH+EKLD
Sbjct  310  NKKKNGSYEYDPGLTNGSGLEEPGSSVTLSGLLNFTDGLWSCCGSEKIFVFTTNHIEKLD  369

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
             AL+RSGRMDMH+HM +C FPALKILLKNYL LE          E    +      AE+T
Sbjct  370  SALMRSGRMDMHVHMGFCKFPALKILLKNYLRLEEEDMDSVVLKEMEECVE----EAEIT  425

Query  716  PADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeedeeqeKR  895
            PADVSEVLIRNR + E+A+ E+V + + R  +     G ++    G++  EE +EEQEKR
Sbjct  426  PADVSEVLIRNRSDAEKAVREIVSVLKERVVKRRKSVGLKKKKQEGQEEEEEAEEEQEKR  485

Query  896  ALESPKR  916
            AL+SP R
Sbjct  486  ALDSPNR  492



>ref|NP_194754.2| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 gb|AEE85743.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=519

 Score =   366 bits (939),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 198/307 (64%), Positives = 234/307 (76%), Gaps = 6/307 (2%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPW+SV FKHPSTFDTLAMDP KK+ I  DL++FANG+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  197  HPWDSVRFKHPSTFDTLAMDPEKKKRIMEDLREFANGQGFYQKTGRAWKRGYLLYGPPGT  256

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSS+IAAMAN+LGYDIYD+ELTEV  NSELRKLLMKTSSKSIIVIEDIDCS++LT R +
Sbjct  257  GKSSLIAAMANYLGYDIYDLELTEVQNNSELRKLLMKTSSKSIIVIEDIDCSISLTKRGK  316

Query  362  MNGGGSTREYSSAATQGG--EDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
                  + EY    T G   E+ G+ +TLSGLLNFTDGLWSCCGSE+IFVFTTNH+EKLD
Sbjct  317  NKKKNGSYEYDPGLTNGSGLEEPGSSVTLSGLLNFTDGLWSCCGSEKIFVFTTNHIEKLD  376

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
             AL+RSGRMDMH+HM +C FPALKILLKNYL LE          E    +      AE+T
Sbjct  377  SALMRSGRMDMHVHMGFCKFPALKILLKNYLRLEEEDMDSVVLKEMEECVE----EAEIT  432

Query  716  PADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeedeeqeKR  895
            PADVSEVLIRNR + E+A+ E+V + + R  +     G ++    G++  EE +EEQEKR
Sbjct  433  PADVSEVLIRNRSDAEKAVREIVSVLKERVVKRRKSVGLKKKKQEGQEEEEEAEEEQEKR  492

Query  896  ALESPKR  916
            AL+SP R
Sbjct  493  ALDSPNR  499



>ref|XP_010525735.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Tarenaya 
hassleriana]
Length=525

 Score =   365 bits (938),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 187/276 (68%), Positives = 220/276 (80%), Gaps = 8/276 (3%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPW+SV FKHPSTFDTLAMDP +K  I  DL++FA+G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  195  HPWDSVRFKHPSTFDTLAMDPERKRMIMEDLREFASGQGFYQKTGRAWKRGYLLYGPPGT  254

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSS+IAAMAN+LGYDIYD+ELTEV  NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR +
Sbjct  255  GKSSLIAAMANYLGYDIYDLELTEVQNNSELRKLLMKTSSKSIIVIEDIDCSINLTNRAK  314

Query  362  MNG------GGSTREYS--SAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTN  517
              G      G    E+S  S +    +D G+ +TLSGLLNFTDGLWSCCGSE+IFVFTTN
Sbjct  315  QRGTKPSSPGCFDPEFSNGSGSISAIDDPGSSVTLSGLLNFTDGLWSCCGSEKIFVFTTN  374

Query  518  HVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVI  697
            HVEKLDPALLRSGR+DMHIHM +        LLKNYL  E   E +  +G  LR++ EV+
Sbjct  375  HVEKLDPALLRSGRLDMHIHMGFXXXXXXXXLLKNYLRCEEEEEDDAIDGVVLREMEEVV  434

Query  698  DAAEMTPADVSEVLIRNRRNKERALWELVEISRMRA  805
              AEMTPADVSEVLIRNRR++++A+ EL+E+ + RA
Sbjct  435  GKAEMTPADVSEVLIRNRRDRKKAVKELMEVLKERA  470



>ref|XP_009401058.1| PREDICTED: 26S protease regulatory subunit 6A-like [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   364 bits (935),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 187/252 (74%), Positives = 208/252 (83%), Gaps = 8/252 (3%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTFDTLAMDP +KE I ADL DFA G+AFY++TGRAWKRGYLLYGPPGTG
Sbjct  190  PWESVPFKHPSTFDTLAMDPARKELIMADLNDFAQGKAFYEKTGRAWKRGYLLYGPPGTG  249

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN+LGYD+YD+ELTEVHTNSELRKLLMKT+SKSIIVIEDIDCSVNL+NR   
Sbjct  250  KSSMIAAMANYLGYDVYDLELTEVHTNSELRKLLMKTTSKSIIVIEDIDCSVNLSNRSSK  309

Query  365  NGGGSTREYSSAATQGG-EDGGN---RITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
                     S     GG EDGG     ITLSGLLNFTDGLWSCCGSERIFVFTTNH+EKL
Sbjct  310  KPVPPCEPPSDLRPTGGTEDGGGAARTITLSGLLNFTDGLWSCCGSERIFVFTTNHIEKL  369

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPAL+RSGRMDMH+ MSYC+F ALKIL+KNY       E  E+  E + +LAEV+D AE+
Sbjct  370  DPALVRSGRMDMHVFMSYCSFLALKILMKNY----LGWEDGEQNDELMWELAEVVDEAEI  425

Query  713  TPADVSEVLIRN  748
            TPADVSE+LI+N
Sbjct  426  TPADVSEILIKN  437



>ref|XP_002462425.1| hypothetical protein SORBIDRAFT_02g025400 [Sorghum bicolor]
 gb|EER98946.1| hypothetical protein SORBIDRAFT_02g025400 [Sorghum bicolor]
Length=537

 Score =   365 bits (936),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 207/322 (64%), Positives = 238/322 (74%), Gaps = 16/322 (5%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PW+ VPFKHPSTFDTLAMDP +K  I ADL+DFA+G AFY+RTGRAWKRGYLLYGPPGTG
Sbjct  190  PWDPVPFKHPSTFDTLAMDPARKAAIMADLRDFADGSAFYERTGRAWKRGYLLYGPPGTG  249

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMANFLGYD+YD+ELTEV +N+ELRKLLMKT+SKSIIVIEDIDCSV+LTNR   
Sbjct  250  KSSMIAAMANFLGYDVYDLELTEVSSNAELRKLLMKTTSKSIIVIEDIDCSVDLTNRAAA  309

Query  365  NGGGSTREYSSAATQGG--------EDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNH  520
                      S    G            G  ITLSGLLNFTDGLWSCCG+ERIFVFTTNH
Sbjct  310  PPKPKPNPRPSITVDGAMVNQDGGAGGAGQSITLSGLLNFTDGLWSCCGAERIFVFTTNH  369

Query  521  VEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYl-gleaaaeqeeeegealrqlaeVI  697
            +EKLDPALLRSGRMDMH+ MSYC+FPALKILLKNYL   +        + +A+R L E +
Sbjct  370  IEKLDPALLRSGRMDMHVFMSYCSFPALKILLKNYLGFQDDEELDRLSDSDAMRGLEEWV  429

Query  698  DAAEMTPADVSEVLIRNRRN-KERALWELVEISRMRAE------RNTgkkggernsggge  856
            DAAE+TPADVSEVLI+NRR+ K  A+  L++  R RAE       +         + GG+
Sbjct  430  DAAEITPADVSEVLIKNRRSGKTEAMQGLLDEFRARAETRGRGFSDGAAAAAGNEAAGGD  489

Query  857  dvfeeedeeqeKRALESPKRNG  922
               EEE+EE+EKRALESPK  G
Sbjct  490  GENEEEEEEEEKRALESPKEAG  511



>ref|XP_010438199.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=517

 Score =   364 bits (934),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 200/309 (65%), Positives = 238/309 (77%), Gaps = 7/309 (2%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPW+SV FKHPSTFDTLAMDP KK+ I  DL++FA+G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  199  HPWDSVRFKHPSTFDTLAMDPEKKKRIMEDLREFASGQGFYQKTGRAWKRGYLLYGPPGT  258

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSS+IAAMAN+LGYDIYD+ELTEV  NS LRKLLMKTSSKSIIVIEDIDCS+NLT   +
Sbjct  259  GKSSLIAAMANYLGYDIYDLELTEVQNNSVLRKLLMKTSSKSIIVIEDIDCSINLTKLGK  318

Query  362  MNGGGSTREYSSAATQGG--EDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
                  + EY      G   E+ G+ +TLSGLLNFTDGLWSCCGSE+IFVFTTNH+EKLD
Sbjct  319  NKKKNGSYEYDPGLINGSGLEEPGSSVTLSGLLNFTDGLWSCCGSEKIFVFTTNHIEKLD  378

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
             ALLRSGRMDMHIHM +C FPALKILLKNY       E++E +G  L ++   ++ AE+T
Sbjct  379  SALLRSGRMDMHIHMGFCKFPALKILLKNY----LRLEEDEIDGVDLEEMEGCVEEAEIT  434

Query  716  PADVSEVLIRNRRNKERALWELVEISRMR-AERNTgkkggernsgggedvfeeedeeqeK  892
            PADVSEVLIRNR + E+A+ ELV + + R  +R       ++   G E+  EE +EEQEK
Sbjct  435  PADVSEVLIRNRSDAEKAVRELVCVLKERVVKRKKSVGLKKKKEEGEEEEEEEAEEEQEK  494

Query  893  RALESPKRN  919
            RAL+SP RN
Sbjct  495  RALDSPNRN  503



>emb|CDX68638.1| BnaC01g08150D [Brassica napus]
Length=516

 Score =   362 bits (930),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 182/271 (67%), Positives = 217/271 (80%), Gaps = 6/271 (2%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPW+SV FKHPSTF+TLAMDP +K+ I  DL++FANG+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  199  HPWDSVRFKHPSTFETLAMDPERKKRIMEDLREFANGQGFYQKTGRAWKRGYLLYGPPGT  258

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSS+IAAMAN+LGYDIYD+ELTEV  NSELRKLLMKTSSKSIIVIEDIDCS++LT RE+
Sbjct  259  GKSSLIAAMANYLGYDIYDLELTEVQNNSELRKLLMKTSSKSIIVIEDIDCSISLTKREK  318

Query  362  MNGGGSTREYSSAATQGG---EDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
            +N   S   Y    T G    ++ G+ +TLSGLLNFTDGLWSCCGSERIFVFTTNH+EKL
Sbjct  319  VNKKKSNGCYDPNLTNGSGLMDEPGSSVTLSGLLNFTDGLWSCCGSERIFVFTTNHIEKL  378

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            D AL+RSGRMDMHIHM +C F ALKILLKNYL +E   + +    + + +  E    AE+
Sbjct  379  DSALMRSGRMDMHIHMGFCRFQALKILLKNYLRMEEEEDVDGAVLKEMEECVE---EAEI  435

Query  713  TPADVSEVLIRNRRNKERALWELVEISRMRA  805
            TPADVSEVLIRNR + E+A+ EL+ + + R 
Sbjct  436  TPADVSEVLIRNRSDAEKAVRELLCVLKERV  466



>ref|XP_006412729.1| hypothetical protein EUTSA_v10024925mg [Eutrema salsugineum]
 gb|ESQ54182.1| hypothetical protein EUTSA_v10024925mg [Eutrema salsugineum]
Length=522

 Score =   362 bits (929),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 185/273 (68%), Positives = 214/273 (78%), Gaps = 9/273 (3%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPW+SV FKHPSTF+TLAMDP KK+ I  DL++FANG+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  196  HPWDSVRFKHPSTFETLAMDPEKKKRIMEDLREFANGQGFYQKTGRAWKRGYLLYGPPGT  255

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSS+IAAMAN LGYDIYD+ELTEV  NSELRKLLMKTSSKSIIVIEDIDCS+NLTNR +
Sbjct  256  GKSSLIAAMANHLGYDIYDLELTEVQNNSELRKLLMKTSSKSIIVIEDIDCSINLTNRGK  315

Query  362  M---NGGGSTREYS--SAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVE  526
            +   NG     + +  S +    ++ G+ +TLSGLLNFTDGLWSCCGSERIFVFTTNHVE
Sbjct  316  IKKRNGSSFDPDLTNGSGSIPSMDEPGSSVTLSGLLNFTDGLWSCCGSERIFVFTTNHVE  375

Query  527  KLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAA  706
            KLD ALLRSGRMDMHIHM +C FPA+KILLKNYL +E          E    +      A
Sbjct  376  KLDSALLRSGRMDMHIHMGFCRFPAMKILLKNYLRVEEDEIDGVVLKEMEECVE----EA  431

Query  707  EMTPADVSEVLIRNRRNKERALWELVEISRMRA  805
            E+TPADVSEVLIRNR + E+A+ ELV + + R 
Sbjct  432  EITPADVSEVLIRNRSDAEKAVRELVGVLKERV  464



>ref|XP_010447746.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=518

 Score =   361 bits (927),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 201/309 (65%), Positives = 233/309 (75%), Gaps = 7/309 (2%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPW+SV FKHPSTFDTLAMDP KK+ I  DL++FA+G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  199  HPWDSVRFKHPSTFDTLAMDPEKKKRIMEDLREFASGQGFYQKTGRAWKRGYLLYGPPGT  258

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSS+IAAMAN+LGYDIYD+ELTEV  NSELRKLLMKTSSKSIIVIEDIDCS+NLT R +
Sbjct  259  GKSSLIAAMANYLGYDIYDLELTEVQNNSELRKLLMKTSSKSIIVIEDIDCSINLTKRGK  318

Query  362  MNGGGSTREYSSAATQGG--EDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
                  + EY      G   E+ G+ +TLSGLLNFTDGLWSCCGSE+IFVFTTNH+EKLD
Sbjct  319  NKKKNGSYEYDPGLINGSGLEEPGSSVTLSGLLNFTDGLWSCCGSEKIFVFTTNHIEKLD  378

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
             ALLRSGRMDMHIHM +C FPALKILLKNYL LE          E    +      AE+T
Sbjct  379  SALLRSGRMDMHIHMGFCKFPALKILLKNYLRLEEDEMDGVVLEEMEECVE----EAEIT  434

Query  716  PADVSEVLIRNRRNKERALWELVEISRMR-AERNTgkkggernsgggedvfeeedeeqeK  892
            PADVSEVLIRNR +  +A+ ELV + + R  +R       ++   G E+  +E DEEQEK
Sbjct  435  PADVSEVLIRNRSDAVKAVRELVCVLKERVVKRKKSVGLKKKKEEGDEEEEDEADEEQEK  494

Query  893  RALESPKRN  919
            RAL+SP RN
Sbjct  495  RALDSPNRN  503



>ref|XP_006285065.1| hypothetical protein CARUB_v10006378mg [Capsella rubella]
 gb|EOA17963.1| hypothetical protein CARUB_v10006378mg [Capsella rubella]
Length=523

 Score =   360 bits (925),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 182/270 (67%), Positives = 212/270 (79%), Gaps = 6/270 (2%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPW+SV FKHPSTFDTLAMDP +K+ I  DL++FA+G+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  198  HPWDSVRFKHPSTFDTLAMDPERKKRIMEDLREFASGQGFYQKTGRAWKRGYLLYGPPGT  257

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSS+IAAMAN+LGYDIYD+ELTEV  NSELRKLLMKTSSKSIIVIEDIDCS++LT R +
Sbjct  258  GKSSLIAAMANYLGYDIYDLELTEVQNNSELRKLLMKTSSKSIIVIEDIDCSISLTKRGK  317

Query  362  MNGGGSTREYSSAATQGG--EDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
                  + EY    T G   ++ G+ +TLSGLLNFTDGLWSCCGSE+IFVFTTNH+EKLD
Sbjct  318  NKKRNGSYEYDPGLTNGSGLDEPGSSVTLSGLLNFTDGLWSCCGSEKIFVFTTNHIEKLD  377

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
             ALLRSGRMDMHIHM +C FPALKILLKNYL LE          E    +      AE+T
Sbjct  378  SALLRSGRMDMHIHMGFCKFPALKILLKNYLRLEEDEIDGVVLEEMEECVE----EAEIT  433

Query  716  PADVSEVLIRNRRNKERALWELVEISRMRA  805
            PADVSEVLIR+R + E+A+ ELV + + R 
Sbjct  434  PADVSEVLIRSRSDAEKAVRELVCVLKERV  463



>ref|XP_009127960.1| PREDICTED: uncharacterized protein LOC103852809 [Brassica rapa]
Length=577

 Score =   357 bits (917),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 200/313 (64%), Positives = 234/313 (75%), Gaps = 14/313 (4%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPW+SV FKHPSTF+TLAMDP +K+ I  DL++FANG+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  254  HPWDSVRFKHPSTFETLAMDPERKKRIMEDLREFANGQGFYQKTGRAWKRGYLLYGPPGT  313

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSS+IAAMAN+LGYDIYD+ELTEV  NSELRKLLMKTSSKSIIVIEDIDCS++LT RE+
Sbjct  314  GKSSLIAAMANYLGYDIYDLELTEVQNNSELRKLLMKTSSKSIIVIEDIDCSISLTKREK  373

Query  362  M----NGGGSTREYSSAATQGG---EDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNH  520
            +    N  G    Y    T G    ++ G+ +TLSGLLNFTDGLWSCCGSERIFVFTTNH
Sbjct  374  VKRKNNNNGC---YDPDLTNGSGLMDEPGSSVTLSGLLNFTDGLWSCCGSERIFVFTTNH  430

Query  521  VEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVID  700
            +EKLD ALLRSGRMDMHIHM +C F ALKILLKNYL +E          E    +     
Sbjct  431  IEKLDSALLRSGRMDMHIHMGFCRFQALKILLKNYLRMEEGEVDGVVLKEMEECVE----  486

Query  701  AAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeede  880
             AE+TPADVSEVLIRNR + E+A+ EL+ + + R  R     G ++    GE   EE +E
Sbjct  487  EAEITPADVSEVLIRNRSDAEKAVRELLCVLKERVVRRRKSGGVKKKKEEGEHEDEEAEE  546

Query  881  eqeKRALESPKRN  919
            EQEKRAL+SP  N
Sbjct  547  EQEKRALDSPNGN  559



>ref|XP_009401574.1| PREDICTED: mitochondrial chaperone BCS1-like [Musa acuminata 
subsp. malaccensis]
Length=504

 Score =   355 bits (910),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 184/252 (73%), Positives = 203/252 (81%), Gaps = 8/252 (3%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWESVPFKHPSTFDTLAMDP +KE I ADL DFA G+AFY+ TGRAWKRGYLLYGPPGTG
Sbjct  190  PWESVPFKHPSTFDTLAMDPARKELIMADLNDFAQGKAFYENTGRAWKRGYLLYGPPGTG  249

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMAN L YDIYD+ELTEV TNSELRKLLMKT+SKSIIVIEDIDCSVNL NR   
Sbjct  250  KSSMIAAMANHLSYDIYDLELTEVQTNSELRKLLMKTTSKSIIVIEDIDCSVNLINRSSK  309

Query  365  NGGGSTREYSSA-ATQGGEDGG---NRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
                     S     +G EDGG     ITLSGLL+FTDGLWSCCGSERIFVFTTNH+EKL
Sbjct  310  KPAPPCEPPSDLRPARGTEDGGAAARTITLSGLLSFTDGLWSCCGSERIFVFTTNHIEKL  369

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPAL+RSGRMDMH+ MSYC+F ALKIL+KNY       E  E+  E +R+LAEV+D AE+
Sbjct  370  DPALVRSGRMDMHVFMSYCSFQALKILMKNY----LGWEDSEQSDELMRELAEVVDEAEI  425

Query  713  TPADVSEVLIRN  748
            TPADVS +LI+N
Sbjct  426  TPADVSGILIKN  437



>emb|CDY28172.1| BnaA01g06770D [Brassica napus]
Length=513

 Score =   355 bits (910),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 199/310 (64%), Positives = 230/310 (74%), Gaps = 17/310 (5%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPW+SV FKHPSTF+TLAMDP +K+ I  DL++FANG+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  199  HPWDSVRFKHPSTFETLAMDPERKKRIMEDLREFANGQGFYQKTGRAWKRGYLLYGPPGT  258

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSS+IAAMAN+LGYDIYD+ELTEV  NSELRKLLMKTSSKSIIVIEDIDCS++LT RE+
Sbjct  259  GKSSLIAAMANYLGYDIYDLELTEVQNNSELRKLLMKTSSKSIIVIEDIDCSISLTKREK  318

Query  362  M----NGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
            +    N  G    Y    T G       +TLSGLLNFTDGLWSCCGSERIFVFTTNH+EK
Sbjct  319  VKRKNNNNGC---YDPDLTNGS------VTLSGLLNFTDGLWSCCGSERIFVFTTNHIEK  369

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LD ALLRSGRMDMHIHM +C F ALKILLKNYL +E          E    +      AE
Sbjct  370  LDSALLRSGRMDMHIHMGFCRFQALKILLKNYLRMEEGEVDGVVLKEMEECVE----EAE  425

Query  710  MTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeedeeqe  889
            +TPADVSEVLIRNR + E+A+ EL+ + + R  R     G ++    GE   EE +EEQE
Sbjct  426  ITPADVSEVLIRNRSDAEKAVRELLCVLKERVVRRRKSGGVKKKKEEGEHEDEEAEEEQE  485

Query  890  KRALESPKRN  919
            KRAL+SP  N
Sbjct  486  KRALDSPNGN  495



>gb|KFK29582.1| hypothetical protein AALP_AA7G153000 [Arabis alpina]
Length=518

 Score =   355 bits (910),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 190/308 (62%), Positives = 232/308 (75%), Gaps = 6/308 (2%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPW+SV FKHPSTF+TLAM+P KK+ I  DL++FANG+ FYQ+TGRAWKRGYLLYGPPGT
Sbjct  199  HPWDSVRFKHPSTFETLAMEPEKKKRIMEDLREFANGQGFYQKTGRAWKRGYLLYGPPGT  258

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSS+IAAMAN+LGYDIYD+ELTEV  NSELRKLLMKTSSKS+IVIEDIDCSVNL+ R +
Sbjct  259  GKSSLIAAMANYLGYDIYDLELTEVQNNSELRKLLMKTSSKSLIVIEDIDCSVNLSKRGK  318

Query  362  MNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPA  541
            +     + +       G ++ G+ +TLSGLLNFTDGLWSCCGSERIFVFTTNH+EKLD A
Sbjct  319  VKKKNGSYDPDLINGSGLDEPGSSVTLSGLLNFTDGLWSCCGSERIFVFTTNHIEKLDSA  378

Query  542  LLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPA  721
            LLRSGRMDMHIHM +C F ALKILLKNYL +E          E    +      AE+TPA
Sbjct  379  LLRSGRMDMHIHMGFCGFEALKILLKNYLRIEEDEIGGVVLKEMEECVE----EAEITPA  434

Query  722  DVSEVLIRNRRNKERALWELVEISRMRA--ERNTgkkggernsgggedvfeeedeeqeKR  895
            DVSEVLIRNR +  +A+ E++ + + R    R    +  ++  G   +  ++++EEQEKR
Sbjct  435  DVSEVLIRNRSDSGKAVREILSVLKERVVKRRKCVGEKKKKKKGEEGEEEDDDEEEQEKR  494

Query  896  ALESPKRN  919
            AL+SP RN
Sbjct  495  ALDSPNRN  502



>ref|XP_010048638.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
 gb|KCW80962.1| hypothetical protein EUGRSUZ_C02324 [Eucalyptus grandis]
Length=392

 Score =   346 bits (887),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 178/275 (65%), Positives = 203/275 (74%), Gaps = 10/275 (4%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWES PFKHPSTFDTLAMDP +K +I  DL+ FA G+A YQR GRAW R YLLYG PGT
Sbjct  71   HPWESEPFKHPSTFDTLAMDPERKRDIVEDLRYFAAGQALYQRAGRAWNRVYLLYGSPGT  130

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSII-VIEDIDCSVNLTNRE  358
            GKSSMIAAMANFLGYDIY +EL  VHTNSELRKLLM TSSKSII VI   DCSVNL+NR 
Sbjct  131  GKSSMIAAMANFLGYDIYQLELPHVHTNSELRKLLMNTSSKSIIVVITGTDCSVNLSNRS  190

Query  359  RMNGGGSTREY----SSAATQGGEDGGNR-ITLSGLLNFTDGLWSCCGSERIFVFTTNHV  523
                  + R Y    +  AT+G EDG N  +T SGL NFT GLWSCCGSERIFV TTNH+
Sbjct  191  EAPYATAPRSYYDPGAPEATRGSEDGNNSMVTPSGLFNFTHGLWSCCGSERIFVLTTNHI  250

Query  524  EKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDA  703
            EKLDPA L   R++M IHMSYC++PALKILL NY      +  E+       +L E ++ 
Sbjct  251  EKLDPAFLERSRINMRIHMSYCSYPALKILLHNY----LGSTAEDLSEVVSSELREAVEK  306

Query  704  AEMTPADVSEVLIRNRRNKERALWELVEISRMRAE  808
            A+MTPAD+SEVLI NRRNKERA+ EL+E+ R R E
Sbjct  307  AKMTPADISEVLIENRRNKERAVSELLEVLRAREE  341



>ref|XP_010051018.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
 gb|KCW81093.1| hypothetical protein EUGRSUZ_C02465 [Eucalyptus grandis]
Length=501

 Score =   348 bits (894),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 180/273 (66%), Positives = 216/273 (79%), Gaps = 11/273 (4%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP +K  I  DL+DF +G+AFYQRTGRAWKR YLLYGPPGT
Sbjct  196  HPWESVPFKHPSTFDTLAMDPKRKTAIMDDLRDFRDGQAFYQRTGRAWKRCYLLYGPPGT  255

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSSMIAAMANFL YDIYD++L EV +NS+L+KLLMKTSSKSIIVIEDIDCSVNL+N  +
Sbjct  256  GKSSMIAAMANFLDYDIYDLKLAEVPSNSKLQKLLMKTSSKSIIVIEDIDCSVNLSNMSK  315

Query  362  MNGGGSTREY----SSAATQGGEDG-GNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVE  526
                 + R Y    +  A++ GEDG  N I LSGLL  TDGLWSCC  ERIFVFTT+H+E
Sbjct  316  APHTVAPRRYYDPSAPNASRRGEDGNSNTIALSGLL--TDGLWSCCLCERIFVFTTSHIE  373

Query  527  KLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAA  706
            KLDPAL++SG MDMHI M+YC++PALKILL+NY      +E E+       +L E ++ A
Sbjct  374  KLDPALIQSGLMDMHISMTYCSYPALKILLRNY----LGSEAEDLGEAVASELREAVEKA  429

Query  707  EMTPADVSEVLIRNRRNKERALWELVEISRMRA  805
            +MTPAD+S+VLI+N RNKERA+ EL+E+ + RA
Sbjct  430  KMTPADISKVLIKNWRNKERAVSELLEVLKGRA  462



>gb|KCW80938.1| hypothetical protein EUGRSUZ_C02297, partial [Eucalyptus grandis]
Length=494

 Score =   346 bits (887),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 192/308 (62%), Positives = 227/308 (74%), Gaps = 14/308 (5%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWE+V FK+ STFDTLAMDP KK +I  DL DF  G+AFYQRTGRAWKR YLLYGPP TG
Sbjct  192  PWEAVLFKYLSTFDTLAMDPEKKRDIMEDLSDFMAGQAFYQRTGRAWKRVYLLYGPPRTG  251

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMANFL Y IY ++L EVH+NSELRKLLMKTSSKSII I DIDC +NL+N+ + 
Sbjct  252  KSSMIAAMANFLSYHIYYLQLAEVHSNSELRKLLMKTSSKSIIAI-DIDCLLNLSNKSKA  310

Query  365  NGGGSTREYSSA----ATQGGEDG-GNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
            +       Y +       +G EDG GN ITL+GLLN T+GLWSCCGSERIFVFTTNH++K
Sbjct  311  SQAAVPWSYYNPRVPEPARGDEDGNGNTITLTGLLNLTNGLWSCCGSERIFVFTTNHIDK  370

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPALLRSGRMDMHI MSYC++PALKILL NY      +E E+    A  +L E ++ A+
Sbjct  371  LDPALLRSGRMDMHICMSYCSYPALKILLHNY----LGSEGEDLSEAAASELREAVEKAK  426

Query  710  MTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeedeeqe  889
            MTPAD+SEVLI+ RRN+E+A+ EL+E+ + RAE N              +    E EEQE
Sbjct  427  MTPADISEVLIKKRRNREKAVSELLEVMKARAEGN----EEYGGLREKCESNGVEKEEQE  482

Query  890  KRALESPK  913
            KRALESPK
Sbjct  483  KRALESPK  490



>ref|XP_010048620.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
Length=511

 Score =   346 bits (887),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 192/308 (62%), Positives = 227/308 (74%), Gaps = 14/308 (5%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTG  184
            PWE+V FK+ STFDTLAMDP KK +I  DL DF  G+AFYQRTGRAWKR YLLYGPP TG
Sbjct  192  PWEAVLFKYLSTFDTLAMDPEKKRDIMEDLSDFMAGQAFYQRTGRAWKRVYLLYGPPRTG  251

Query  185  KSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM  364
            KSSMIAAMANFL Y IY ++L EVH+NSELRKLLMKTSSKSII I DIDC +NL+N+ + 
Sbjct  252  KSSMIAAMANFLSYHIYYLQLAEVHSNSELRKLLMKTSSKSIIAI-DIDCLLNLSNKSKA  310

Query  365  NGGGSTREYSSA----ATQGGEDG-GNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
            +       Y +       +G EDG GN ITL+GLLN T+GLWSCCGSERIFVFTTNH++K
Sbjct  311  SQAAVPWSYYNPRVPEPARGDEDGNGNTITLTGLLNLTNGLWSCCGSERIFVFTTNHIDK  370

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPALLRSGRMDMHI MSYC++PALKILL NY      +E E+    A  +L E ++ A+
Sbjct  371  LDPALLRSGRMDMHICMSYCSYPALKILLHNY----LGSEGEDLSEAAASELREAVEKAK  426

Query  710  MTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeeedeeqe  889
            MTPAD+SEVLI+ RRN+E+A+ EL+E+ + RAE N              +    E EEQE
Sbjct  427  MTPADISEVLIKKRRNREKAVSELLEVMKARAEGN----EEYGGLREKCESNGVEKEEQE  482

Query  890  KRALESPK  913
            KRALESPK
Sbjct  483  KRALESPK  490



>ref|XP_006360731.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Solanum 
tuberosum]
Length=497

 Score =   338 bits (868),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 193/316 (61%), Positives = 220/316 (70%), Gaps = 38/316 (12%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTF+TLAMDP KK EI ADL DFANGE+FYQRTGRAWKRGYLL+GPP  
Sbjct  189  HPWESVPFKHPSTFETLAMDPQKKAEIMADLLDFANGESFYQRTGRAWKRGYLLFGPP--  246

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
                                   EVHTNSELRKLLMKTSSKSIIVIEDIDCS+NLTNR+ 
Sbjct  247  -----------------------EVHTNSELRKLLMKTSSKSIIVIEDIDCSINLTNRKN  283

Query  362  MNGGGSTREYS--------SAATQGGEDGG-NRITLSGLLNFTDGLWSCCGSERIFVFTT  514
             +   S+   S               EDGG N ITLSGLLNFTDGLWSCCGSERIFVFTT
Sbjct  284  NSSNSSSYNVSPPGSGGVGCGGGSNSEDGGGNTITLSGLLNFTDGLWSCCGSERIFVFTT  343

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NH+EKLDPALLRSGRMDMHIHMSY +F ALKILLKNY        +++ E E L QL +V
Sbjct  344  NHIEKLDPALLRSGRMDMHIHMSYSSFAALKILLKNY----LGYSEDDVEKELLDQLEQV  399

Query  695  IDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTgkkggernsgggedvfeee  874
            +  AEMTPAD+SEVLI+NRRNK++A+WEL+E  + RAERN  K           +  E+E
Sbjct  400  MWRAEMTPADISEVLIKNRRNKDKAVWELLEALKTRAERNDKKSNNNAGKSKENNTIEDE  459

Query  875  deeqeKRALESPKRNG  922
            ++ +    +ESPK  G
Sbjct  460  EQVKRALLVESPKEGG  475



>ref|XP_004163178.1| PREDICTED: LOW QUALITY PROTEIN: probable mitochondrial chaperone 
BCS1-A-like [Cucumis sativus]
Length=452

 Score =   335 bits (860),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/262 (63%), Positives = 203/262 (77%), Gaps = 21/262 (8%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFA-NGEAFYQRTGRAWKRGYLLYGPPGT  181
            PWE+VPFKHPSTF+TLA+DP+KK+EI  DL+DF  NG++FY++TGRAWKRGYLLYGPPGT
Sbjct  190  PWEAVPFKHPSTFETLAIDPIKKQEIMEDLRDFTRNGKSFYKKTGRAWKRGYLLYGPPGT  249

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSS+IAAMANFL +DIYD+ELTEV +NSEL+ LLMKT+SKSI+VIEDIDCS++L+NR+ 
Sbjct  250  GKSSLIAAMANFLEFDIYDLELTEVESNSELKTLLMKTTSKSIVVIEDIDCSIDLSNRKN  309

Query  362  MNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPA  541
               G S                  ITLSGLLNF DGLWSCCGSE+IFVFTTNHVEKLDPA
Sbjct  310  SKNGDS------------------ITLSGLLNFMDGLWSCCGSEKIFVFTTNHVEKLDPA  351

Query  542  LLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPA  721
            L+RSGRMDMHI MS+C+FP LKIL +NYL      E  +       + +  I+ AEM+ A
Sbjct  352  LVRSGRMDMHILMSFCSFPLLKILFRNYLDWNEEEEGWDGGVLKELEES--IERAEMSVA  409

Query  722  DVSEVLIRNRRNKERALWELVE  787
            DV E+LI+NRR K +A+  ++E
Sbjct  410  DVCEILIKNRREKGKAMRRVLE  431



>gb|KGN61090.1| hypothetical protein Csa_2G047830 [Cucumis sativus]
Length=445

 Score =   331 bits (849),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 202/262 (77%), Gaps = 21/262 (8%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFA-NGEAFYQRTGRAWKRGYLLYGPPGT  181
            PWE+VPFKHPSTF+TLA+DP+KK+EI  DL+DF  NG++FY++TGRAWKRGYLLYGP GT
Sbjct  183  PWEAVPFKHPSTFETLAIDPIKKQEIMEDLRDFTRNGKSFYKKTGRAWKRGYLLYGPLGT  242

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSS+IAAMANFL +DIYD+ELTEV +NSEL+ LLMKT+SKSI+VIEDIDCS++L+NR+ 
Sbjct  243  GKSSLIAAMANFLEFDIYDLELTEVESNSELKTLLMKTTSKSIVVIEDIDCSIDLSNRKN  302

Query  362  MNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPA  541
               G S                  ITLSGLLNF DGLWSCCGSE+IFVFTTNHVEKLDPA
Sbjct  303  SKNGDS------------------ITLSGLLNFMDGLWSCCGSEKIFVFTTNHVEKLDPA  344

Query  542  LLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPA  721
            L+RSGRMDMHI MS+C+FP LKIL +NYL      E  +       + +  I+ AEM+ A
Sbjct  345  LVRSGRMDMHILMSFCSFPLLKILFRNYLDWNEEEEGWDGGVLKELEES--IERAEMSVA  402

Query  722  DVSEVLIRNRRNKERALWELVE  787
            DV E+LI+NRR K +A+  ++E
Sbjct  403  DVCEILIKNRREKGKAMRRVLE  424



>ref|XP_004149097.1| PREDICTED: probable mitochondrial chaperone bcs1-like [Cucumis 
sativus]
Length=452

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 202/262 (77%), Gaps = 21/262 (8%)
 Frame = +2

Query  5    PWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFA-NGEAFYQRTGRAWKRGYLLYGPPGT  181
            PWE+VPFKHPSTF+TLA+DP+KK+EI  DL+DF  NG++FY++TGRAWKRGYLLYGP GT
Sbjct  190  PWEAVPFKHPSTFETLAIDPIKKQEIMEDLRDFTRNGKSFYKKTGRAWKRGYLLYGPLGT  249

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GKSS+IAAMANFL +DIYD+ELTEV +NSEL+ LLMKT+SKSI+VIEDIDCS++L+NR+ 
Sbjct  250  GKSSLIAAMANFLEFDIYDLELTEVESNSELKTLLMKTTSKSIVVIEDIDCSIDLSNRKN  309

Query  362  MNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPA  541
               G S                  ITLSGLLNF DGLWSCCGSE+IFVFTTNHVEKLDPA
Sbjct  310  SKNGDS------------------ITLSGLLNFMDGLWSCCGSEKIFVFTTNHVEKLDPA  351

Query  542  LLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPA  721
            L+RSGRMDMHI MS+C+FP LKIL +NYL      E  +       + +  I+ AEM+ A
Sbjct  352  LVRSGRMDMHILMSFCSFPLLKILFRNYLDWNEEEEGWDGGVLKELEES--IERAEMSVA  409

Query  722  DVSEVLIRNRRNKERALWELVE  787
            DV E+LI+NRR K +A+  ++E
Sbjct  410  DVCEILIKNRREKGKAMRRVLE  431



>gb|KHN22702.1| Putative mitochondrial chaperone BCS1-B [Glycine soja]
Length=326

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 182/278 (65%), Positives = 201/278 (72%), Gaps = 41/278 (15%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWESVPFKHPSTFDTLAMDP KK+EI  DL DFANG++FY +TGRAWKRGYLLYGPPGT
Sbjct  30   HPWESVPFKHPSTFDTLAMDPHKKKEIMEDLLDFANGQSFYHKTGRAWKRGYLLYGPPGT  89

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRER  361
            GK                              KLLMKTSSKSIIVIEDIDCS+NLT R+ 
Sbjct  90   GK------------------------------KLLMKTSSKSIIVIEDIDCSINLTGRKN  119

Query  362  MNGGGS---TREYSS----AATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNH  520
             NG  S   +R Y      A    GE+GGN ITLSGLLNFTDGLWSCCGSERIFVFTTNH
Sbjct  120  NNGSVSVSASRSYYDSEIRAGGGCGEEGGNNITLSGLLNFTDGLWSCCGSERIFVFTTNH  179

Query  521  VEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVID  700
            +EKLDPALLRSGRMDMHI MSYC+FPALKILLKNY       E  E E   L+QL EV+D
Sbjct  180  IEKLDPALLRSGRMDMHIFMSYCSFPALKILLKNY----LGCEACELEESILKQLEEVVD  235

Query  701  AAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
             A MTPAD+SEVLI+NRR KE+A+ EL+E  ++RAE N
Sbjct  236  VARMTPADISEVLIKNRRKKEKAVEELLETLKLRAEMN  273



>gb|KCW80930.1| hypothetical protein EUGRSUZ_C02289 [Eucalyptus grandis]
Length=409

 Score =   325 bits (833),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 176/207 (85%), Gaps = 6/207 (3%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  VPFKHPSTFDTLAMDP +K +I  DL+DF  G+AFYQRTGRAWKRGYLLYGPPGTGK
Sbjct  179  WRQVPFKHPSTFDTLAMDPERKRDIMEDLRDFVAGKAFYQRTGRAWKRGYLLYGPPGTGK  238

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SSMIAAMANFLGYDIYD+ELT+V +NS+LR+ L  TSSKSIIVIEDIDCSV+L   +R+N
Sbjct  239  SSMIAAMANFLGYDIYDLELTKVRSNSQLREFLTNTSSKSIIVIEDIDCSVSLP--KRLN  296

Query  368  GGGSTREYSSAATQGGED-GGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
               +       A  GGED   N ITLSGLLNFTDGLWSCCGSERIFVFT+NH++KLDPAL
Sbjct  297  AQQAA---PRRAAHGGEDRNDNTITLSGLLNFTDGLWSCCGSERIFVFTSNHIKKLDPAL  353

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNY  625
            LRSGRMDMHI+MSYC++PALKILL+NY
Sbjct  354  LRSGRMDMHIYMSYCSYPALKILLRNY  380



>ref|XP_010048637.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
Length=397

 Score =   321 bits (823),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 171/277 (62%), Positives = 201/277 (73%), Gaps = 14/277 (5%)
 Frame = +2

Query  2    HPWESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGT  181
            HPWES PFKHPSTFDTLAMDP +K +I  DL+ FA G+A YQR GRAW R YLLYG PGT
Sbjct  75   HPWESEPFKHPSTFDTLAMDPERKRDIMEDLRYFAAGQALYQRAGRAWNRVYLLYGQPGT  134

Query  182  GKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSI-IVIEDIDCSVNLTNRE  358
            GKSSMIAAMANFLGYDIY +EL  VHTNSELRKLLM TSSKSI +VI   DCSV+L+NR 
Sbjct  135  GKSSMIAAMANFLGYDIYQLELPHVHTNSELRKLLMNTSSKSIVVVITGTDCSVSLSNRS  194

Query  359  RMNGGGSTREYSSA----ATQGGEDGGNR-ITLSGLLNFTDGLWSCCGSERIFVFTTNHV  523
                  + R Y       AT+G ++G N  +T SGL NFT GLWSC GSERIFV TTNH+
Sbjct  195  EAPYATAPRSYYDPGVPEATRGSDEGNNNMVTPSGLFNFTHGLWSCRGSERIFVLTTNHI  254

Query  524  EKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDA  703
            EKLDPA     R++M IHMSYC++PALKILL+NY      +E E+       +L E ++ 
Sbjct  255  EKLDPAFHERRRINMRIHMSYCSYPALKILLRNY----LGSEAEDLSEVVSSELREAVEK  310

Query  704  AEMTPADVSEVLIRNRRNKERALWELVEISRMRAERN  814
            A+MTPAD+SEVL    RNKERA  +L+E+ + RAERN
Sbjct  311  AKMTPADISEVL----RNKERAASKLLEVLKERAERN  343



>gb|EMT02652.1| Putative mitochondrial chaperone BCS1-B [Aegilops tauschii]
Length=390

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 172/262 (66%), Positives = 197/262 (75%), Gaps = 9/262 (3%)
 Frame = +2

Query  137  RAWKRGYLLYGPPGTGKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIV  316
            R   RGYLLYGPPGTGKSSMIAAMANFLGYD+YD+ELTEV +N+ELRKLLMKT+SKSIIV
Sbjct  110  RGAARGYLLYGPPGTGKSSMIAAMANFLGYDVYDLELTEVSSNAELRKLLMKTTSKSIIV  169

Query  317  IEDIDCSVNLTNRERMNGGGSTREYSSAATQG--GEDGGNRITLSGLLNFTDGLWSCCGS  490
            IEDIDCSV+LTNR  +      R     A     G   G  ITLSGLLNFTDGLWSCCGS
Sbjct  170  IEDIDCSVDLTNRAALPPAPKPRSTLDGAIDQDVGAASGRSITLSGLLNFTDGLWSCCGS  229

Query  491  ERIFVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeege  670
            ERIFVFTTNH+EKLDPALLRSGRMDMH+ MSYC FPALKILLKNYL LE +A+   E   
Sbjct  230  ERIFVFTTNHIEKLDPALLRSGRMDMHVFMSYCTFPALKILLKNYLCLEDSADDGAEVMR  289

Query  671  alrqlaeVIDAAEMTPADVSEVLIRNRRN-KERALWELVEISRMRAERNTgkkggernsg  847
             L +    I+AAE+TPADVSEVLI+NRRN KERA+ EL+E+ + RAE+    +       
Sbjct  290  GLEEW---IEAAEITPADVSEVLIKNRRNGKERAMEELLEVLKARAEKR---RLDGGKVA  343

Query  848  ggedvfeeedeeqeKRALESPK  913
                  + ++EE+EKRALESPK
Sbjct  344  AAAAPRDNDEEEEEKRALESPK  365



>gb|KDP20377.1| hypothetical protein JCGZ_05260 [Jatropha curcas]
Length=518

 Score =   298 bits (762),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/260 (57%), Positives = 183/260 (70%), Gaps = 9/260 (3%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTFDTLA++P  K++I  DLK FANG  FY + GRAWKRGYLLYGPPG+GK
Sbjct  183  WVSVPFRHPSTFDTLALEPQLKKQIMEDLKAFANGREFYHKVGRAWKRGYLLYGPPGSGK  242

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS+IAAMAN+L YD+YD+ELT+V  NSELR LL++T+++SIIVIEDIDCSV+LT  +RM 
Sbjct  243  SSLIAAMANYLCYDVYDLELTKVTDNSELRALLIQTTNRSIIVIEDIDCSVDLT-ADRMV  301

Query  368  GGGSTREYSSAATQGGEDGGN-RITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
                 R +SSA      D  N R+TLSGLLNFTDGLWSCCG ERI VFTTNH + +DPAL
Sbjct  302  KATRKRSHSSAGKDSANDEENGRVTLSGLLNFTDGLWSCCGEERIIVFTTNHRDNVDPAL  361

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPAD  724
            +R GRMD+H+ +  C   A K L  NY          E         + +     +TPA 
Sbjct  362  VRCGRMDVHVSLGNCGIHAFKALAMNY-------LGIESHSLYDVVESCIRSGGALTPAQ  414

Query  725  VSEVLIRNRRNKERALWELV  784
            + E+L+RNRRN + A+ E+V
Sbjct  415  IGEILLRNRRNADLAMKEVV  434



>gb|ADE76156.1| unknown [Picea sitchensis]
Length=478

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/274 (55%), Positives = 195/274 (71%), Gaps = 14/274 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F HP+TF TLA++P  K++I  DL+ F  GE +Y++ GRAWKRGYLLYGPPGTGK
Sbjct  192  WTPVVFDHPATFGTLALEPELKQDIMEDLQRFLRGEKYYRQVGRAWKRGYLLYGPPGTGK  251

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM-  364
            SSMIAAMANFL YDIYD+ELT+V  N+ELRKLL  T++KSIIVIEDIDCS++L++R++  
Sbjct  252  SSMIAAMANFLDYDIYDLELTQVKNNTELRKLLFTTTNKSIIVIEDIDCSLDLSDRKKKK  311

Query  365  --NGGGSTREYSSAATQGGEDGGN---RITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                 G   E  S   +  E   N   ++TLSG+LNFTDGLWSCCGSER+FVFTTNHV++
Sbjct  312  KPQKDGEEDEKPSKPGKPDERESNEDSKVTLSGVLNFTDGLWSCCGSERLFVFTTNHVDR  371

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPALLRSGRMD HI +++C F A KIL +NY           E+ E    + ++ +AA+
Sbjct  372  LDPALLRSGRMDKHILLTFCTFGAFKILARNY--------LSIEDHELFPDIGDLTEAAQ  423

Query  710  MTPADVSEVLIRNRRNKERALWELVEISRMRAER  811
            MTPADV+E L++   +  RAL  L++  R   ER
Sbjct  424  MTPADVTEHLMKMADHPSRALENLIQALREAKER  457



>gb|ABR16643.1| unknown [Picea sitchensis]
Length=473

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 195/274 (71%), Gaps = 14/274 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SV F HP+TF TLA++  +K+EI  DL+ F+  E +Y++ GRAWKRGYLLYGPPGTGK
Sbjct  185  WTSVVFDHPATFGTLALETEQKQEILEDLERFSKAEKYYRQVGRAWKRGYLLYGPPGTGK  244

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SSMIAAMANFL YDIYD+ELT+V  N+ELRKLL+ T++KSIIVIEDIDCS++L++R++  
Sbjct  245  SSMIAAMANFLDYDIYDLELTQVKNNTELRKLLVATTNKSIIVIEDIDCSLDLSDRKKKK  304

Query  368  GGGSTREYSSAATQGGEDGGN------RITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                  E     ++  +   N      ++TLSG+LNFTDGLWSCCGSER+FVFTTNH+++
Sbjct  305  KPEKDSEEKEKPSEPSKPEENEPKEDSKVTLSGVLNFTDGLWSCCGSERLFVFTTNHIDR  364

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPALLRSGRMD HI +++C F A K L +NY           E+ E   ++ ++++A E
Sbjct  365  LDPALLRSGRMDKHILLTFCKFGAFKTLARNY--------LSIEDHELFPEIQDLMEAVE  416

Query  710  MTPADVSEVLIRNRRNKERALWELVEISRMRAER  811
            MTPADV+E L++   N   AL  L+E  R   ER
Sbjct  417  MTPADVAEHLMKTSGNPTSALQSLIEALRDAKER  450



>ref|XP_010425638.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=477

 Score =   292 bits (747),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 180/253 (71%), Gaps = 17/253 (7%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+ F+TLAMDP KKEEI +DL  F+NG+ +Y++ G+AWKRGYLLYGPPGTGK
Sbjct  193  WRYIDFEHPANFETLAMDPKKKEEILSDLVAFSNGKEYYKKIGKAWKRGYLLYGPPGTGK  252

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L Y IYD+ELT +  NSELRKLL  TSSKSIIVIEDIDCS++LT + + N
Sbjct  253  STMIAAMANLLNYSIYDLELTAIQNNSELRKLLTATSSKSIIVIEDIDCSLDLTGKRKKN  312

Query  368  GGGSTREYSSAATQGGEDGGNR----ITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
                   YS++  + GE G       +TLSGLLNF DG+WS CG ERI VFTTNH+EKLD
Sbjct  313  -----ESYSTSLRKDGEKGNAEDKSFVTLSGLLNFIDGVWSACGQERIIVFTTNHLEKLD  367

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PAL+R GRMDMHI +SYC F A KIL KNY         + +     +++  ++   ++ 
Sbjct  368  PALIRRGRMDMHIELSYCTFEAFKILAKNY--------LDLDSHPLFKKIESLMKETKIA  419

Query  716  PADVSEVLIRNRR  754
            PADV+E L++  R
Sbjct  420  PADVAENLMKKNR  432



>ref|NP_001066678.1| Os12g0431100 [Oryza sativa Japonica Group]
 dbj|BAF29697.1| Os12g0431100, partial [Oryza sativa Japonica Group]
Length=466

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 150/286 (52%), Positives = 192/286 (67%), Gaps = 32/286 (11%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  VPF+HP++FDTLAMDP  K+ I  DL  F +G+ +Y + G+ WKRGYLLYGPPGTGK
Sbjct  142  WSHVPFEHPASFDTLAMDPGDKDAIVVDLVAFRDGKDYYAKVGKPWKRGYLLYGPPGTGK  201

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT V  N+ELRKL ++T+ KSIIVIEDIDCS++LT + + +
Sbjct  202  STMIAAMANFLDYDVYDLELTAVKNNTELRKLYIETTGKSIIVIEDIDCSIDLTGKRKKS  261

Query  368  GGGSTREYSSAATQGGE---------------DGGNRITLSGLLNFTDGLWSCCGSERIF  502
             G      + A+  GGE               DGG+++TLSGLLNF DGLWS CG ERI 
Sbjct  262  SGD-----NKASDGGGEGSDDKPKLPTEADKDDGGSKVTLSGLLNFIDGLWSACGGERII  316

Query  503  VFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrq  682
            +FTTNH EKLDPAL+R GRMD+HI MSYC F A K+L  NY           E+ E L  
Sbjct  317  IFTTNHKEKLDPALIRRGRMDVHIEMSYCGFEAFKVLASNY--------LGVEQHELLGD  368

Query  683  laeVIDAAEMTPADVSEVLI----RNRRNKERALWELVEISRMRAE  808
            +  +++ A+M+PADV+E L+    R +R+ +  L  LVE   M  E
Sbjct  369  IRRLLEEADMSPADVAENLMPMSKRKKRDPDACLAGLVEALNMAKE  414



>ref|XP_002512196.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF50230.1| ATP binding protein, putative [Ricinus communis]
Length=517

 Score =   291 bits (744),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/265 (53%), Positives = 181/265 (68%), Gaps = 7/265 (3%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K++I  DLK F+NG+AFY R GRAWKRGYLL+GPPG+GK
Sbjct  183  WVSVPFRHPSTFETLALEPQLKKQIMGDLKAFSNGKAFYHRVGRAWKRGYLLHGPPGSGK  242

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS+IAAMAN+L YD+YD+ELT+V  NSELR LL++T+++SIIVIEDIDCSV+LT    + 
Sbjct  243  SSLIAAMANYLCYDVYDLELTKVTDNSELRALLIQTTNRSIIVIEDIDCSVDLTTDRMVK  302

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
                    SS      E+   R+TLSGLLNFTDGLWSCCG E+I VFTTNH + +DPAL+
Sbjct  303  TSRKRSNLSSCKDSSNEEESGRVTLSGLLNFTDGLWSCCGEEKIIVFTTNHRDNVDPALV  362

Query  548  RSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPADV  727
            R GRMD+H+ +  C   A K L  NY          +         + +     +TPA +
Sbjct  363  RCGRMDVHVSLGTCGMHAFKALAMNY-------LGIDSHSLFDVAESCIRSGGALTPAQI  415

Query  728  SEVLIRNRRNKERALWELVEISRMR  802
             E+L+RNR N + AL E+V   + R
Sbjct  416  GEILLRNRGNTDVALKEVVSAMQAR  440



>ref|XP_009122028.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Brassica 
rapa]
Length=479

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/263 (55%), Positives = 187/263 (71%), Gaps = 13/263 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP++F TLAMDPVKKEEI  DL+ F NG+ +Y++ G+AWKRGYLL+GPPGTGK
Sbjct  195  WRHIDFEHPASFQTLAMDPVKKEEILNDLEAFRNGKEYYKKIGKAWKRGYLLHGPPGTGK  254

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L Y+IYD+ELT +  NSELRKLL  TSS+SIIVIEDIDCSV+LT + R  
Sbjct  255  STMIAAMANHLNYNIYDLELTAIQNNSELRKLLTATSSRSIIVIEDIDCSVDLTGKRRKR  314

Query  368  GGGSTREYSSAATQGGED-GGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
             G  +        QG ED   +R+TLSGLLNF DG+WS CG ERI +FTTNH+EKLDPAL
Sbjct  315  DGDLS--VKKDGEQGKEDQNQSRVTLSGLLNFIDGIWSACGQERIIIFTTNHIEKLDPAL  372

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPAD  724
            +R GRMDMHI +SYC F A K+L KNY         + +      ++  ++   ++ PAD
Sbjct  373  IRRGRMDMHIELSYCGFEAFKVLAKNY--------LDVDSHPLFGEIESLLKETKIAPAD  424

Query  725  VSEVLI--RNRRNKERALWELVE  787
            V+E L+   ++ + + +L +LVE
Sbjct  425  VAEKLMAKNHKVDVDGSLKDLVE  447



>ref|XP_007014067.1| ATP binding protein, putative [Theobroma cacao]
 gb|EOY31686.1| ATP binding protein, putative [Theobroma cacao]
Length=519

 Score =   289 bits (740),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/271 (54%), Positives = 184/271 (68%), Gaps = 10/271 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SV F+HPSTFDTLA++P  K++I  DL  FA G  FY R GRAWKRGYLLYGPPG+GK
Sbjct  180  WVSVSFRHPSTFDTLALEPELKKQIMEDLTAFAKGREFYHRVGRAWKRGYLLYGPPGSGK  239

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS+IAAMAN+L YD+YD+ELT+V  NSELR LL++T+++S+IVIEDIDCSV+LT      
Sbjct  240  SSLIAAMANYLCYDVYDLELTKVTDNSELRALLVQTTNRSVIVIEDIDCSVDLTMDRLSK  299

Query  368  GGGSTREYSSAATQGGEDGGN-RITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
                +R  S A  +G  D  N R+TLSGLLNFTDGLWSCCG ERI VFTTNH + +DPAL
Sbjct  300  RSLRSRAQSHATIKGDADQENGRVTLSGLLNFTDGLWSCCGEERIIVFTTNHRDNVDPAL  359

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPAD  724
            +R GRMD+H+ +  C   A K+L KNY          +           +     +TPA 
Sbjct  360  VRCGRMDVHVSLGRCGMHAFKVLAKNY-------LNLDSHPMFQLVETCISSGGSLTPAQ  412

Query  725  VSEVLIRNRRNKERALWELVEISRMRAERNT  817
            + EVL+RNR N + A+ E+V  S M+++  T
Sbjct  413  IGEVLLRNRWNADVAMKEVV--SAMQSQLQT  441



>ref|XP_002466265.1| hypothetical protein SORBIDRAFT_01g004740 [Sorghum bicolor]
 gb|EER93263.1| hypothetical protein SORBIDRAFT_01g004740 [Sorghum bicolor]
Length=529

 Score =   290 bits (741),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 178/255 (70%), Gaps = 25/255 (10%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP TFDTLAMDPV+K+ IKADL  F +G+ +Y+R G+AWKRGYLLYGPPGTGK
Sbjct  211  WSHVVFEHPKTFDTLAMDPVQKKRIKADLDMFKSGKDYYKRVGKAWKRGYLLYGPPGTGK  270

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTN-RER-  361
            S+MIAAMAN L YDIYD+ELT VHTN++LRKL ++T+SKSIIVIEDIDCS++LT  RE+ 
Sbjct  271  SAMIAAMANHLDYDIYDIELTSVHTNTDLRKLFIETTSKSIIVIEDIDCSLDLTGAREKK  330

Query  362  ---------MNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTT  514
                       GGG  R          +D  +++TLSGLLNF DGLWS CG ERI VFTT
Sbjct  331  AAAEEDDKDKKGGGPVRPGEK------KDTSSKVTLSGLLNFIDGLWSACGGERIIVFTT  384

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NHVEKLDPAL+R GRMD HI MSYC F A K L K Y         + +       + E+
Sbjct  385  NHVEKLDPALIRRGRMDKHIEMSYCGFEAFKFLAKTY--------LDVDSHPLFDTVGEL  436

Query  695  IDAAEMTPADVSEVL  739
            +   +MTPADV+E L
Sbjct  437  LREVQMTPADVAENL  451



>gb|KCW45486.1| hypothetical protein EUGRSUZ_L00796, partial [Eucalyptus grandis]
Length=318

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/251 (57%), Positives = 173/251 (69%), Gaps = 14/251 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V FKHPSTFDTLAM+P KK EI  DL  F  G+ +Y+R G+AWKRGYLLYGPPGTGK
Sbjct  55   WSHVAFKHPSTFDTLAMEPSKKREIMNDLLKFQRGKEYYERIGKAWKRGYLLYGPPGTGK  114

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT------  349
            S+M AAMANFL YD+YD+ELT V  N+ELRKLL+ TS K+IIVIEDIDCS++LT      
Sbjct  115  STMTAAMANFLNYDVYDVELTTVKDNTELRKLLIDTSEKAIIVIEDIDCSLDLTGQRKTK  174

Query  350  NRERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
             +E+ + G         A  G E   +++TLSGLLNF+DGLWS CG ERI VFTTN VEK
Sbjct  175  KQEKDDDGEKADPVKRMAKGGEESKDSKVTLSGLLNFSDGLWSACGGERIIVFTTNFVEK  234

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI M YC F + K+L +NY           E       + ++++  E
Sbjct  235  LDPALIRRGRMDKHIEMLYCCFESFKVLARNY--------LGIESHPLFTSVRQLLEGTE  286

Query  710  MTPADVSEVLI  742
            MTPADV+E L+
Sbjct  287  MTPADVAENLM  297



>ref|XP_006285394.1| hypothetical protein CARUB_v10006799mg [Capsella rubella]
 gb|EOA18292.1| hypothetical protein CARUB_v10006799mg [Capsella rubella]
Length=470

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 186/258 (72%), Gaps = 14/258 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W S+ F+HP++F+TLAMDP KKEEI +DL  F+NG+ +Y++ G+AWKRGYLLYGPPGTGK
Sbjct  194  WRSIEFEHPASFETLAMDPKKKEEILSDLIAFSNGKEYYKKIGKAWKRGYLLYGPPGTGK  253

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MI+AMAN L Y+IYD+ELT V  NSEL+KLL  TSSKSIIVIEDIDCSV  T      
Sbjct  254  STMISAMANLLNYNIYDLELTAVKNNSELKKLLTATSSKSIIVIEDIDCSVEFT------  307

Query  368  GGGSTREYSSAATQGGEDGG-NRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
            G    +E SS    G ED   N +TLSGLLNF DG+WS CG ERI VFTTNH+EKLDPAL
Sbjct  308  GNRIKKENSSRERYGKEDKDENSVTLSGLLNFIDGIWSACGQERIVVFTTNHLEKLDPAL  367

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPAD  724
            +R GRMDMHI +SYC + A KIL KNY          +E     R++  +++   ++PAD
Sbjct  368  IRRGRMDMHIELSYCTYEAFKILAKNY-----LDLDGDEAHPLFREIKTLLEETMISPAD  422

Query  725  VSEVLI-RNRR-NKERAL  772
            V+E L+ RN + N E++L
Sbjct  423  VAENLMARNHQINVEKSL  440



>gb|ABA97668.2| Cell Division Protein AAA ATPase family, putative, expressed 
[Oryza sativa Japonica Group]
Length=523

 Score =   289 bits (740),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/281 (53%), Positives = 190/281 (68%), Gaps = 22/281 (8%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  VPF+HP++FDTLAMDP  K+ I  DL  F +G+ +Y + G+ WKRGYLLYGPPGTGK
Sbjct  199  WSHVPFEHPASFDTLAMDPGDKDAIVVDLVAFRDGKDYYAKVGKPWKRGYLLYGPPGTGK  258

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT V  N+ELRKL ++T+ KSIIVIEDIDCS++LT + + +
Sbjct  259  STMIAAMANFLDYDVYDLELTAVKNNTELRKLYIETTGKSIIVIEDIDCSIDLTGKRKKS  318

Query  368  GG----------GSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTN  517
             G          GS  +         +DGG+++TLSGLLNF DGLWS CG ERI +FTTN
Sbjct  319  SGDNKASDGGGEGSDDKPKLPTEADKDDGGSKVTLSGLLNFIDGLWSACGGERIIIFTTN  378

Query  518  HVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVI  697
            H EKLDPAL+R GRMD+HI MSYC F A K+L  NY           E+ E L  +  ++
Sbjct  379  HKEKLDPALIRRGRMDVHIEMSYCGFEAFKVLASNY--------LGVEQHELLGDIRRLL  430

Query  698  DAAEMTPADVSEVLI----RNRRNKERALWELVEISRMRAE  808
            + A+M+PADV+E L+    R +R+ +  L  LVE   M  E
Sbjct  431  EEADMSPADVAENLMPMSKRKKRDPDACLAGLVEALNMAKE  471



>ref|XP_010514564.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X1 
[Camelina sativa]
 ref|XP_010514565.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X2 
[Camelina sativa]
Length=477

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 176/249 (71%), Gaps = 9/249 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+ F+TLAMDP KKEEI +DL  F+ G+ +Y++ G+AWKRGYLLYGPPGTGK
Sbjct  193  WRYIDFEHPANFETLAMDPKKKEEILSDLVAFSIGKEYYKKIGKAWKRGYLLYGPPGTGK  252

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L Y IYD+ELT +  NSELRKLL  TSSKSIIVIEDIDCS++LT + + N
Sbjct  253  STMIAAMANLLNYSIYDLELTAIQNNSELRKLLTATSSKSIIVIEDIDCSLDLTGKRKKN  312

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
               ST           ED  + +TLSGLLNF DG+WS CG ERI VFTTNH+EKLDPAL+
Sbjct  313  ESYSTSLRKDRGKSNAED-ESFVTLSGLLNFIDGVWSACGQERIIVFTTNHLEKLDPALI  371

Query  548  RSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPADV  727
            R GRMDMHI +SYC F A KIL KNY         + +     +++  ++   ++ PADV
Sbjct  372  RRGRMDMHIELSYCTFEAFKILAKNY--------LDLDSHPLFKKIESLMKETKIAPADV  423

Query  728  SEVLIRNRR  754
            +E L++  R
Sbjct  424  AENLMKKNR  432



>ref|XP_002267624.1| PREDICTED: uncharacterized protein LOC100263212 [Vitis vinifera]
Length=516

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/271 (54%), Positives = 188/271 (69%), Gaps = 12/271 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  +++I  DL  FANG+ FY R GRAWKRGYLLYGPPG+GK
Sbjct  180  WVSVPFRHPSTFETLALEPQLRQQITDDLTAFANGKEFYHRVGRAWKRGYLLYGPPGSGK  239

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS+IAAMAN+L YD+YD+ELT+V  NSELR LL++T+++SIIVIEDIDCSV+LT  +R++
Sbjct  240  SSLIAAMANYLCYDVYDLELTKVSDNSELRALLIQTTNRSIIVIEDIDCSVDLTA-DRLS  298

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
                T     ++   GE+ G R+TLSGLLNFTDGLWSCCG ERI VFTTNH + +DPAL+
Sbjct  299  KTKRTTPAKGSSRDEGEENG-RVTLSGLLNFTDGLWSCCGEERIIVFTTNHRDNVDPALV  357

Query  548  RSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPADV  727
            R GRMD+H+ +  C   A K L  NY          E         + +     +TPA V
Sbjct  358  RCGRMDVHVSLGTCGIHAFKALAANY-------LGLESHPLFDVVESCIRSGGTLTPAQV  410

Query  728  SEVLIRNRRNKERALWELVEISRMR---AER  811
             E+L+RNRR+ E A+  ++   + R   AER
Sbjct  411  GEILLRNRRDAEVAIKAVISAMQARILGAER  441



>ref|XP_008808726.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
Length=513

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/251 (56%), Positives = 177/251 (71%), Gaps = 12/251 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HPSTFDTLAMDP KK EIK DL  F  G+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  195  WSHVLFEHPSTFDTLAMDPGKKLEIKKDLDAFRKGKDYYAKIGKAWKRGYLLYGPPGTGK  254

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SSMI AMANFL YD+YD+ELT V  N ELRKL ++T+ KSIIVIEDIDCS++LT + +  
Sbjct  255  SSMIGAMANFLDYDVYDLELTTVKNNVELRKLFIETTGKSIIVIEDIDCSLDLTGKRKQK  314

Query  368  G----GGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
            G    G S  + +    Q  +D  +++TLSGLLNF DG+WS CG ER+ VFTTNH+EKLD
Sbjct  315  GKKEEGASEEKKNLPPGQEEKDESSKVTLSGLLNFIDGIWSACGGERLIVFTTNHIEKLD  374

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PAL+R GRMD HI MSYC F A K+L +NY         + +       + ++++  ++T
Sbjct  375  PALIRRGRMDKHIEMSYCGFEAFKVLARNY--------LDVDSHPLFDTIRDLMEEVKIT  426

Query  716  PADVSEVLIRN  748
            PADV+E L+R 
Sbjct  427  PADVAEKLMRK  437



>ref|XP_010040094.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
Length=383

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/251 (57%), Positives = 173/251 (69%), Gaps = 14/251 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V FKHPSTFDTLAM+P KK EI  DL  F  G+ +Y+R G+AWKRGYLLYGPPGTGK
Sbjct  62   WSHVAFKHPSTFDTLAMEPSKKREIMNDLLKFQRGKEYYERIGKAWKRGYLLYGPPGTGK  121

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT------  349
            S+M AAMANFL YD+YD+ELT V  N+ELRKLL+ TS K+IIVIEDIDCS++LT      
Sbjct  122  STMTAAMANFLNYDVYDVELTTVKDNTELRKLLIDTSEKAIIVIEDIDCSLDLTGQRKTK  181

Query  350  NRERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
             +E+ + G         A  G E   +++TLSGLLNF+DGLWS CG ERI VFTTN VEK
Sbjct  182  KQEKDDDGEKADPVKRMAKGGEESKDSKVTLSGLLNFSDGLWSACGGERIIVFTTNFVEK  241

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI M YC F + K+L +NY           E       + ++++  E
Sbjct  242  LDPALIRRGRMDKHIEMLYCCFESFKVLARNY--------LGIESHPLFTSVRQLLEGTE  293

Query  710  MTPADVSEVLI  742
            MTPADV+E L+
Sbjct  294  MTPADVAENLM  304



>ref|XP_006651919.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, mitochondrial-like 
[Oryza brachyantha]
Length=394

 Score =   284 bits (727),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 177/255 (69%), Gaps = 27/255 (11%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP TFDTLAMDP KK+EI  DL  F NG+ +Y R G+AWKRGYLLYGPPGTGK
Sbjct  100  WSHVVFEHPKTFDTLAMDPAKKKEILDDLTMFKNGKEYYARVGKAWKRGYLLYGPPGTGK  159

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN+L YDIYD+ELT VH+N++LRKL ++T+SKSIIVIEDIDCS++LT      
Sbjct  160  SAMIAAMANYLDYDIYDIELTSVHSNTDLRKLFIETTSKSIIVIEDIDCSLDLT------  213

Query  368  GGGSTREYSSAATQGGEDG-----------GNRITLSGLLNFTDGLWSCCGSERIFVFTT  514
              G+ ++  +AA    +DG            +++TLSGLLNF DGLWS CG ER+ VFTT
Sbjct  214  --GARKKKEAAADDDKKDGPPKPPDMKKDTSSKVTLSGLLNFIDGLWSACGGERLIVFTT  271

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NHV+KLDPAL+R GRMD HI MSYC F A K L K Y         E +       + ++
Sbjct  272  NHVKKLDPALIRRGRMDKHIEMSYCCFEAFKFLAKTY--------LEVDSHGLFPAVKKL  323

Query  695  IDAAEMTPADVSEVL  739
            +   +MTPADV+E L
Sbjct  324  LSEVDMTPADVAENL  338



>gb|KCW45481.1| hypothetical protein EUGRSUZ_L007902, partial [Eucalyptus grandis]
Length=310

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/251 (56%), Positives = 174/251 (69%), Gaps = 14/251 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TFDTLAM+P KK EI  DL  F  G+ +Y+R G+AWKRGYLLYGPPGTGK
Sbjct  4    WSHVAFEHPATFDTLAMEPNKKSEIMNDLLRFRRGKEYYERIGKAWKRGYLLYGPPGTGK  63

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT------  349
            S+MIAAMANFL YD+YD+ELT V  N+ELRKLL++TS+KSIIVIEDIDCS++LT      
Sbjct  64   STMIAAMANFLNYDVYDLELTTVKDNTELRKLLIETSAKSIIVIEDIDCSLDLTGQRKTK  123

Query  350  NRERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
             RE+ +           A  G E   +++TLSGLLNF DGLWS CG ERI VFTTN VE+
Sbjct  124  KREKDDDEEKVDPVKRMAKGGEESKDSKVTLSGLLNFIDGLWSACGGERIIVFTTNFVER  183

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI MSYC F + K+L +NY           E       + +++   +
Sbjct  184  LDPALIRRGRMDKHIEMSYCCFESFKVLARNY--------LGVESHPLFATVRQLLAETK  235

Query  710  MTPADVSEVLI  742
            MTPADV+E L+
Sbjct  236  MTPADVAENLM  246



>gb|ABK27085.1| unknown [Picea sitchensis]
Length=341

 Score =   282 bits (721),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/260 (54%), Positives = 184/260 (71%), Gaps = 20/260 (8%)
 Frame = +2

Query  17   VPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGKSSM  196
            VPFKHPS+FD+LA+DP  K +I  DL  F  G+ F+ R GR WKRGYLLYGPPGTGKSS+
Sbjct  41   VPFKHPSSFDSLALDPTHKNKIIRDLDRFRQGKEFHSRVGRPWKRGYLLYGPPGTGKSSL  100

Query  197  IAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNR----ERM  364
            +AA+AN++ Y++YD+ELT+V  NSELR LL++T++KS+IVIEDIDCS++L+NR     ++
Sbjct  101  VAAIANYMKYNVYDLELTKVTDNSELRTLLIQTTNKSMIVIEDIDCSLDLSNRLSKPPKL  160

Query  365  NGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
            +GG    E         E  G+R+TLSG+LNFTDGLWSCCG ERI +FTTNH ++LDPAL
Sbjct  161  DGGNMDDE---------EKSGSRVTLSGILNFTDGLWSCCGEERIIIFTTNHKDRLDPAL  211

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPAD  724
            LR GRMDM I++S+C FPA K L  NYL +E        E             AEMTPA+
Sbjct  212  LRPGRMDMRIYLSFCTFPAFKCLAFNYLQIEDHPLFSAVEERMSG-------GAEMTPAE  264

Query  725  VSEVLIRNRRNKERALWELV  784
            +SE+LI +  +  +AL  ++
Sbjct  265  ISEILIEHLDDSLKALNAVI  284



>ref|XP_002276524.2| PREDICTED: probable mitochondrial chaperone BCS1-B [Vitis vinifera]
Length=446

 Score =   285 bits (729),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 143/251 (57%), Positives = 178/251 (71%), Gaps = 14/251 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TF+TLA+DP KK+EI  DL  F+ GE FY R GRAWKRGYLLYGPPGTGK
Sbjct  174  WNQVVFQHPATFETLALDPEKKKEIMDDLMAFSKGEQFYARIGRAWKRGYLLYGPPGTGK  233

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTN-----  352
            S+MIAAMAN L YD+YD+ELT V +N+EL+KLLM+ SSKSIIVIEDIDCS++LT      
Sbjct  234  STMIAAMANLLNYDVYDLELTGVKSNTELKKLLMEISSKSIIVIEDIDCSLDLTAPRKKA  293

Query  353  -RERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
              +++  G    +   +AT+   +    +TLSGLLNF DG+WS CG ER+ VFTTNHVEK
Sbjct  294  PTDKLADGEGDDKVKKSATKSKSNETRNVTLSGLLNFIDGIWSSCGGERLIVFTTNHVEK  353

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI ++YC+F A KIL KNY           E   A  ++ E++    
Sbjct  354  LDPALIRKGRMDKHIELAYCSFQAFKILAKNY--------LSLESHPAFPKIGELLGQVN  405

Query  710  MTPADVSEVLI  742
            MTPADV+E L+
Sbjct  406  MTPADVAEHLM  416



>gb|KCW52812.1| hypothetical protein EUGRSUZ_J021472, partial [Eucalyptus grandis]
Length=359

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/251 (55%), Positives = 176/251 (70%), Gaps = 14/251 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TFDTLAM+P KK EI  DL  F  G+ +Y+R G+AWKRGYLLYGPPGTGK
Sbjct  66   WSHVAFEHPATFDTLAMEPNKKSEIMNDLLRFRRGKEYYERIGKAWKRGYLLYGPPGTGK  125

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT V  N+ELRKLL++TS+KSIIVIEDIDCS++LT + +  
Sbjct  126  STMIAAMANFLNYDVYDLELTTVKDNTELRKLLIETSAKSIIVIEDIDCSLDLTGQRKTK  185

Query  368  GGGSTREYSSA------ATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                  +   A         G E   +++TLSGLLNF DGLWS CG ERI VFTTN+VEK
Sbjct  186  KQEKDEDEEKADPVKRMVKGGDESKDSKVTLSGLLNFIDGLWSACGGERIIVFTTNYVEK  245

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI MSYC + + K+L++NY         + E       +  +++  +
Sbjct  246  LDPALIRRGRMDKHIEMSYCCYESFKVLVRNY--------LDVESHPLFATVRRLLEETK  297

Query  710  MTPADVSEVLI  742
            MTPADV+E L+
Sbjct  298  MTPADVAENLM  308



>gb|KCW52814.1| hypothetical protein EUGRSUZ_J021482, partial [Eucalyptus grandis]
Length=330

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/268 (53%), Positives = 182/268 (68%), Gaps = 16/268 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TFDTLAM+P KK +I  DL  F   + +Y R G+AWKRGYLLYGPPGTGK
Sbjct  28   WSHVVFEHPATFDTLAMEPSKKRQIMNDLLKFQQAKEYYARIGKAWKRGYLLYGPPGTGK  87

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT V  N+ELRKLL++TS+KSIIVIEDIDCS++LT + +  
Sbjct  88   STMIAAMANFLNYDVYDLELTTVKDNTELRKLLIETSAKSIIVIEDIDCSLDLTGQRKTK  147

Query  368  GGGSTREYSSA------ATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                  +   A         G E   +++TLSGLLNF DGLWS CG ERI VFTTN+VEK
Sbjct  148  KQEKDEDEEKADPVKRMVKGGDESKDSKVTLSGLLNFIDGLWSACGGERIIVFTTNYVEK  207

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI MSYC + + K+L++NY         + E       +  +++  +
Sbjct  208  LDPALIRRGRMDKHIEMSYCCYESFKVLVRNY--------LDVESHPLFATVRRLLEETK  259

Query  710  MTPADVSEVLI--RNRRNKERALWELVE  787
            MTPADV+E L+   +  ++E  L  L+E
Sbjct  260  MTPADVAENLMPKSDDEDEEACLEGLIE  287



>ref|XP_008777474.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
Length=509

 Score =   286 bits (733),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/250 (56%), Positives = 177/250 (71%), Gaps = 12/250 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HPS+FDTLAMDP KK EIK DL  F  G+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  194  WSHVLFEHPSSFDTLAMDPGKKLEIKKDLDAFRKGKDYYAKIGKAWKRGYLLYGPPGTGK  253

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SSMI AMANFL YD+YD+ELT V  N ELRKL ++T+ KSIIVIEDIDCS++LT + +  
Sbjct  254  SSMIVAMANFLDYDVYDLELTTVKNNVELRKLFIETTGKSIIVIEDIDCSLDLTGKRKQK  313

Query  368  G----GGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
            G    G S  + +    Q  +D  +++TLSGLLNF DG+WS CG ER+ VFTTNH+EKLD
Sbjct  314  GKKEEGASEDKKNLPPGQEEKDESSKVTLSGLLNFIDGIWSACGGERLIVFTTNHIEKLD  373

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PAL+R GRMD HI MSYC F A K+L KNY         + +       + ++++  ++T
Sbjct  374  PALIRRGRMDKHIEMSYCCFGAFKVLAKNY--------LDVDSHPMFDTIRDLMEEVKIT  425

Query  716  PADVSEVLIR  745
            PADV+E L+R
Sbjct  426  PADVAENLMR  435



>gb|KFK33171.1| hypothetical protein AALP_AA6G339600 [Arabis alpina]
Length=507

 Score =   286 bits (732),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/261 (54%), Positives = 183/261 (70%), Gaps = 9/261 (3%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TFDTLAMD  KKE+IK DL  F+N + +Y++ G+AWKRGYLLYGPPGTGK
Sbjct  194  WSHVTFEHPATFDTLAMDNNKKEDIKNDLTKFSNSQDYYKKIGKAWKRGYLLYGPPGTGK  253

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+M+AA+ANFL YDIYD+ELT V  N+ELR+LL++TS KSIIVIEDIDCS++LT + +  
Sbjct  254  STMVAAIANFLDYDIYDLELTTVKDNTELRRLLIETSGKSIIVIEDIDCSLDLTGQRKKK  313

Query  368  GGGSTREYSSAATQ------GGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                  E  ++  +       GE+ G+++TLSGLLNF DGLWS CG ERI VFTTN ++K
Sbjct  314  EEEDEYEDETSPMEKQMKKDQGENKGSKVTLSGLLNFIDGLWSACGGERIIVFTTNFIDK  373

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI MSYC F A K+L KNY+  E     E  +          ++  +
Sbjct  374  LDPALIRKGRMDKHIEMSYCGFEAFKVLAKNYMDAEEEENDELFKEIKRLLE---VEEIK  430

Query  710  MTPADVSEVLIRNRRNKERAL  772
            MTPADV E L+R   ++ + +
Sbjct  431  MTPADVGENLLRKSEDEAKEI  451



>ref|XP_009125282.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Brassica 
rapa]
Length=462

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 162/206 (79%), Gaps = 2/206 (1%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP++F TLAMDP KKEE+ +DL+ F NG+ +Y++ G+AWKRGYLLYGPPGTGK
Sbjct  196  WRRIDFEHPASFQTLAMDPWKKEEVLSDLEAFRNGKDYYKKIGKAWKRGYLLYGPPGTGK  255

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            ++MIAA+AN L Y+IYD+ELT + +NSELRKLL  TSSKSIIVIEDIDCS++LT  ER  
Sbjct  256  TTMIAAIANHLNYNIYDLELTAIKSNSELRKLLTATSSKSIIVIEDIDCSLDLTTGERKR  315

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
             G      S   ++  E   +R+TLSGLLNF DG+WS CG ERI +FTTNH+EKLDPAL+
Sbjct  316  DGDDLS--SKKDSEKKEQSESRVTLSGLLNFIDGIWSVCGQERIIIFTTNHMEKLDPALI  373

Query  548  RSGRMDMHIHMSYCNFPALKILLKNY  625
            R GRMDMHI +SYC+F A K+L KNY
Sbjct  374  RRGRMDMHIELSYCSFEAFKVLAKNY  399



>ref|XP_006292778.1| hypothetical protein CARUB_v10019028mg [Capsella rubella]
 gb|EOA25676.1| hypothetical protein CARUB_v10019028mg [Capsella rubella]
Length=476

 Score =   284 bits (727),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 181/262 (69%), Gaps = 10/262 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+ F TLAMDP KKEEI  DL  F+NG+ +Y++ G+AWKRGYLLYGPPGTGK
Sbjct  191  WRYIDFEHPANFKTLAMDPKKKEEILNDLVAFSNGKDYYKKIGKAWKRGYLLYGPPGTGK  250

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L Y IYD+ELT +  NSEL+KLL  TS+KSIIVIEDIDCS++LT + +  
Sbjct  251  STMIAAMANLLNYSIYDLELTAIRNNSELKKLLTATSNKSIIVIEDIDCSLDLTGKRKKK  310

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
               ST           E+  + +TLSGLLNF DG+WS CG ERI VFTTNH+ KLDPAL+
Sbjct  311  ESNSTNLSKDGQQGNEEEDKSFVTLSGLLNFIDGIWSACGQERIIVFTTNHLAKLDPALI  370

Query  548  RSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPADV  727
            R GRMDMHI +SYC F A KIL KNY         + +     +Q+  +I   ++ PADV
Sbjct  371  RRGRMDMHIELSYCTFEAFKILAKNY--------LDLDSHPLFKQIESLIKETKIAPADV  422

Query  728  SEVLIRNRR--NKERALWELVE  787
            +E L++  R  + E +L +L++
Sbjct  423  AENLMKKNREIDVEGSLKDLIQ  444



>ref|NP_198816.1| AAA-type ATPase family protein [Arabidopsis thaliana]
 gb|AED94500.1| AAA-type ATPase family protein [Arabidopsis thaliana]
Length=470

 Score =   284 bits (726),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/251 (57%), Positives = 182/251 (73%), Gaps = 13/251 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W S+ F+HP++F TLAMDP KKEEI  DL  F+NG+ +Y++ G+AWKRGYLLYGPPGTGK
Sbjct  195  WRSIEFEHPASFQTLAMDPKKKEEIVNDLIAFSNGKEYYKKIGKAWKRGYLLYGPPGTGK  254

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MI+AMAN L Y+IYD+ELT V  NSEL+KLL  TSSKSIIVIEDIDCS + T+  R+ 
Sbjct  255  STMISAMANLLNYNIYDLELTAVKNNSELKKLLTATSSKSIIVIEDIDCSADFTSN-RIK  313

Query  368  GGGSTREYSSAATQGGEDGG-NRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
               ++RE       G ED   N +TLSGLLNF DG+WS CG ERI VFTTNH+EKLDPAL
Sbjct  314  KESNSRE-----RYGKEDKDENSVTLSGLLNFIDGIWSACGQERIVVFTTNHLEKLDPAL  368

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPAD  724
            +R GRMDMHI +SYC + A KIL KNY          ++      ++  +++  +++PAD
Sbjct  369  IRRGRMDMHIELSYCTYEAFKILAKNY-----LDLDGDDAHPLFSEIKALLEETKISPAD  423

Query  725  VSEVLI-RNRR  754
            V+E L+ RN++
Sbjct  424  VAENLMARNQQ  434



>dbj|BAB10224.1| unnamed protein product [Arabidopsis thaliana]
Length=469

 Score =   284 bits (726),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/251 (57%), Positives = 182/251 (73%), Gaps = 13/251 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W S+ F+HP++F TLAMDP KKEEI  DL  F+NG+ +Y++ G+AWKRGYLLYGPPGTGK
Sbjct  194  WRSIEFEHPASFQTLAMDPKKKEEIVNDLIAFSNGKEYYKKIGKAWKRGYLLYGPPGTGK  253

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MI+AMAN L Y+IYD+ELT V  NSEL+KLL  TSSKSIIVIEDIDCS + T+  R+ 
Sbjct  254  STMISAMANLLNYNIYDLELTAVKNNSELKKLLTATSSKSIIVIEDIDCSADFTSN-RIK  312

Query  368  GGGSTREYSSAATQGGEDGG-NRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
               ++RE       G ED   N +TLSGLLNF DG+WS CG ERI VFTTNH+EKLDPAL
Sbjct  313  KESNSRE-----RYGKEDKDENSVTLSGLLNFIDGIWSACGQERIVVFTTNHLEKLDPAL  367

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPAD  724
            +R GRMDMHI +SYC + A KIL KNY          ++      ++  +++  +++PAD
Sbjct  368  IRRGRMDMHIELSYCTYEAFKILAKNY-----LDLDGDDAHPLFSEIKALLEETKISPAD  422

Query  725  VSEVLI-RNRR  754
            V+E L+ RN++
Sbjct  423  VAENLMARNQQ  433



>ref|XP_010098650.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
 gb|EXB75451.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
Length=538

 Score =   286 bits (731),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 187/266 (70%), Gaps = 7/266 (3%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++   K +I  DL  FANG+ FY R GRAWKRGYLLYGPPG+GK
Sbjct  193  WVSVPFRHPSTFETLALETQLKNQITQDLTSFANGKDFYHRVGRAWKRGYLLYGPPGSGK  252

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS+IAAMAN+L YD+YD+ELT+V  NSELR LL++T+++SIIVIEDIDC+V+LT      
Sbjct  253  SSLIAAMANYLCYDVYDLELTKVSDNSELRALLIQTTNRSIIVIEDIDCTVDLTTDRAAV  312

Query  368  GGGSTREYSSAATQG-----GEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
                 R+ SS++        G+D   R+TLSGLLNFTDGLWSCCG ERI VFTTNH + +
Sbjct  313  SSKPGRKRSSSSQPSDHHDQGQDQSGRVTLSGLLNFTDGLWSCCGEERIIVFTTNHKDNV  372

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNY--lgleaaaeqeeeegealrqlaeVIDAA  706
            DPALLR GRMD+H+ +  C   A ++L++NY  L ++   E+EE           +  + 
Sbjct  373  DPALLRCGRMDVHVSLGTCGPAAFRVLVRNYLGLEMDETEEEEEHRRLMEAAEECLRSSG  432

Query  707  EMTPADVSEVLIRNRRNKERALWELV  784
             +TPA + E+L+RNR +   A+ E+V
Sbjct  433  ALTPAQIGEILLRNRSDAAAAMREVV  458



>gb|KEH38185.1| chaperone BCS1-A-like protein, putative [Medicago truncatula]
Length=520

 Score =   285 bits (728),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 188/273 (69%), Gaps = 15/273 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K++IK DL  FA+G+ FY R GRAWKRGYLL+GPPG+GK
Sbjct  183  WVSVPFRHPSTFETLALEPDLKKQIKDDLTAFASGKEFYHRVGRAWKRGYLLHGPPGSGK  242

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM-  364
            SS+IAAMANFL YD+YD+ELT+V  NSELR LL++T+++SIIVIEDIDCSV+LT  +RM 
Sbjct  243  SSLIAAMANFLCYDVYDLELTKVSDNSELRSLLIQTTNRSIIVIEDIDCSVDLTA-DRMS  301

Query  365  --NGGGSTREYSSAATQGGE----DGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVE  526
              NG  S  +     T        D  +R+TLSGLLNFTDGLWSCCG ER+ VFTTNH +
Sbjct  302  KKNGAKSLSKSKKHKTTSFSGSSCDESSRVTLSGLLNFTDGLWSCCGEERLVVFTTNHRD  361

Query  527  KLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAA  706
             +DPAL+R GRMD+H+ +S C   A + L KNY          E           +    
Sbjct  362  SVDPALVRCGRMDVHVSLSTCGVHAFRELAKNY-------LGLESHVMFEAIEGCIRSGG  414

Query  707  EMTPADVSEVLIRNRRNKERALWELVEISRMRA  805
             +TPA V E+L+RNRR+ + A+ E++ + + R 
Sbjct  415  SLTPAHVGEILLRNRRDVDVAMREVLSLMQGRV  447



>ref|XP_004488574.1| PREDICTED: uncharacterized protein LOC101489676 [Cicer arietinum]
Length=521

 Score =   285 bits (728),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 142/267 (53%), Positives = 182/267 (68%), Gaps = 13/267 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K++IK DL  FA+G+ FY R GRAWKRGYLL+GPPG+GK
Sbjct  183  WVSVPFRHPSTFETLALEPDLKKQIKDDLTAFASGKEFYHRVGRAWKRGYLLHGPPGSGK  242

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS+IAAMANFL YD+YD+ELT+V  NSELR LL++T+++SIIVIEDIDCSV+LT      
Sbjct  243  SSLIAAMANFLCYDVYDLELTKVSDNSELRSLLIQTTNRSIIVIEDIDCSVDLTADRTTK  302

Query  368  GGGSTREYSSAATQ------GGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
               +     S   +       G D  +R+TLSGLLNFTDGLWSCCG ER+ VFTTNH + 
Sbjct  303  KNATKLSSKSKKHKTTSFAGSGCDENSRVTLSGLLNFTDGLWSCCGEERLVVFTTNHRDS  362

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            +DPAL+R GRMD+H+ +S C   A + L KNY          E           +     
Sbjct  363  VDPALVRCGRMDVHVSLSTCGVHAFRELAKNY-------LGVESHVMFEAVEGCIRSGGS  415

Query  710  MTPADVSEVLIRNRRNKERALWELVEI  790
            +TPA V E+L+RNRRN + A+ EL+ +
Sbjct  416  LTPAHVGEILLRNRRNVDVAMRELLSV  442



>ref|XP_008777056.1| PREDICTED: mitochondrial chaperone BCS1-like [Phoenix dactylifera]
Length=491

 Score =   284 bits (726),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 186/265 (70%), Gaps = 20/265 (8%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W S+PF HPSTFDTLAMDP  KEEIK DL  F   + FY R GRAWKRGYLLYGPPGTGK
Sbjct  189  WTSIPFTHPSTFDTLAMDPGLKEEIKNDLLKFVGRKEFYARVGRAWKRGYLLYGPPGTGK  248

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            +S+IAA+ANFL +DIYD+ELT V +NS LRKLL+ T++KS+I++ED+DC+VNL  R    
Sbjct  249  TSLIAAIANFLDFDIYDLELTSVRSNSHLRKLLVATATKSVIIVEDVDCTVNLAGR----  304

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
              G+ R       + G +    I+LSG+LNF DGLWS CG ER+ VFTTNH E LD ALL
Sbjct  305  --GTKR------ARNGMEVRQLISLSGVLNFVDGLWSSCGGERLMVFTTNHKENLDTALL  356

Query  548  RSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPADV  727
            R GRMD HI+M YC F A K+L+KNY           +E   ++++ E + +A+MTPA+V
Sbjct  357  RPGRMDKHINMGYCGFAAFKMLIKNY--------LGVDEHLLMKEVEETLSSAQMTPAEV  408

Query  728  SEVLIRNRRNKERALWELVEISRMR  802
            +EVL+ +  + ++ L ++VE  R R
Sbjct  409  AEVLMGSEDDPDQGLKDVVEAIRKR  433



>ref|XP_003577966.1| PREDICTED: peroxisomal biogenesis factor 6-like [Brachypodium 
distachyon]
Length=529

 Score =   285 bits (729),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 140/258 (54%), Positives = 180/258 (70%), Gaps = 13/258 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  VPF+HP+TFDTLAMDPV+K+ +  DL  F   + +Y + G+AWKRGYLLYGPPGTGK
Sbjct  200  WSHVPFEHPATFDTLAMDPVEKDAVIDDLMAFRESKEYYAKVGKAWKRGYLLYGPPGTGK  259

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT V  N++LRKL ++T+ KSIIVIEDIDCSV+LT + R +
Sbjct  260  STMIAAMANFLDYDVYDLELTAVKNNTDLRKLFIETTGKSIIVIEDIDCSVDLTGKRRKD  319

Query  368  GGGSTR-----EYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
              GS       +     T   +D   ++TLSGLLNF DGLWS CG ERI +FTTNH EKL
Sbjct  320  KKGSKESDDDGDKPKLPTDPEKDDATKVTLSGLLNFIDGLWSACGGERIIIFTTNHKEKL  379

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPAL+R GRMD HI MSYC F   K+L KNY         + +E E   ++  +++  +M
Sbjct  380  DPALIRRGRMDKHIEMSYCRFEGFKVLAKNY--------LDVDEHELFGEIRRMLEETDM  431

Query  713  TPADVSEVLIRNRRNKER  766
            +PADV+E L+   + K+R
Sbjct  432  SPADVAENLMPMSKKKKR  449



>ref|XP_006405564.1| hypothetical protein EUTSA_v10028293mg [Eutrema salsugineum]
 gb|ESQ47017.1| hypothetical protein EUTSA_v10028293mg [Eutrema salsugineum]
Length=467

 Score =   283 bits (724),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 141/251 (56%), Positives = 180/251 (72%), Gaps = 16/251 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP++F+TLAMDP KKEEI  DL  F NG+ +Y++ G+AWKRGYLLYGPPGTGK
Sbjct  195  WRFIDFEHPASFETLAMDPEKKEEIMNDLTAFRNGKDYYKKIGKAWKRGYLLYGPPGTGK  254

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT-NRERM  364
            S+MI+AMANFL Y+IYD+ELT +  NSELRKLL  TSSKSI+VIEDIDCSV+LT NR + 
Sbjct  255  STMISAMANFLNYNIYDLELTAIKNNSELRKLLTATSSKSIVVIEDIDCSVDLTGNRIKK  314

Query  365  NGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
            +     R       +G +   N +TLSGLLNF DG+WS CG ERI VFTTNH+EKLDPAL
Sbjct  315  DRNSMER------NRGQDKDENSVTLSGLLNFIDGIWSACGQERIVVFTTNHLEKLDPAL  368

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPAD  724
            +R GRMDMHI +SYC + A  IL KNY         + ++     ++  ++   E++PAD
Sbjct  369  IRRGRMDMHIELSYCTYEAFTILAKNY--------LDLDDHPLFGKIKSLLKETEISPAD  420

Query  725  VSEVLI-RNRR  754
            V+E L+ RN +
Sbjct  421  VAENLMARNHQ  431



>ref|NP_001169714.1| hypothetical protein precursor [Zea mays]
 gb|ACN34622.1| unknown [Zea mays]
 tpg|DAA47717.1| TPA: hypothetical protein ZEAMMB73_180572 [Zea mays]
Length=529

 Score =   285 bits (728),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 185/268 (69%), Gaps = 15/268 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  VPF+HP+TFDTLAMDP  KE+I  +L+ F + +A+Y + G+ WKRGYLLYGPPGTGK
Sbjct  197  WSHVPFEHPATFDTLAMDPDDKEDILDELRAFRDAKAYYTKVGKPWKRGYLLYGPPGTGK  256

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNR---E  358
            S+MIAAMANFL YD+YD+ELT V  N+ELRKL ++T+ KSIIVIEDIDCS++LT +   +
Sbjct  257  STMIAAMANFLDYDVYDLELTAVKNNTELRKLFIETTGKSIIVIEDIDCSIDLTGKRKDD  316

Query  359  RMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
            +        +     T   +D G+++TLSGLLNF DGLWS CG ERI +FTTNH +KLDP
Sbjct  317  KKRASAEADDKPKTPTDPDKDEGSKVTLSGLLNFIDGLWSACGGERIIIFTTNHKDKLDP  376

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTP  718
            AL+R GRMD HI MSYC F   K+L KNY          EE  E   Q+ ++++  +M+P
Sbjct  377  ALIRRGRMDRHIEMSYCRFRTFKVLAKNY-------LDVEEPHELFGQIEKLLEETDMSP  429

Query  719  ADVSEVLI-----RNRRNKERALWELVE  787
            ADV+E L+     + RR+    L  LVE
Sbjct  430  ADVAENLMPMSKKKKRRDANACLESLVE  457



>gb|EMS56860.1| putative mitochondrial chaperone BCS1-B [Triticum urartu]
Length=389

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 171/247 (69%), Gaps = 11/247 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  VPF+HP TF TLAMDP  K+E+  DL  F  G+ +Y+R G+AWKRGYLL+GPPGTGK
Sbjct  97   WTHVPFQHPKTFATLAMDPASKKEVIDDLDAFKAGKEWYERVGKAWKRGYLLHGPPGTGK  156

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L YD+YD+ELT VH+N++LRKL + T+SKSIIVIEDIDCS++LT      
Sbjct  157  SAMIAAMANHLDYDVYDIELTSVHSNTDLRKLFIGTTSKSIIVIEDIDCSLDLTGAREKK  216

Query  368  GGGSTREYSSAA---TQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
               +  E   A+    +G  D  +++TLSGLLNF DGLWS CG ER+ VFTTNH+EKLDP
Sbjct  217  KDAAPEEVDKASKGDKKGAADASSKVTLSGLLNFIDGLWSACGGERVIVFTTNHLEKLDP  276

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTP  718
            AL+R GRMD HI MSYC  PA + L K Y           +E E    +  ++   +MTP
Sbjct  277  ALIRRGRMDKHIEMSYCRGPAFEFLAKAY--------LGVDEHELFGAVGALLREVDMTP  328

Query  719  ADVSEVL  739
            ADV+E L
Sbjct  329  ADVAENL  335



>ref|XP_002443666.1| hypothetical protein SORBIDRAFT_08g023140 [Sorghum bicolor]
 gb|EES17504.1| hypothetical protein SORBIDRAFT_08g023140 [Sorghum bicolor]
Length=513

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/258 (56%), Positives = 183/258 (71%), Gaps = 13/258 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  VPF+HP+TFDTLAMDPV KEEI  +L+ F   + +Y + G+AWKRGYLLYGPPGTGK
Sbjct  197  WSHVPFEHPATFDTLAMDPVDKEEILDELQAFKEAKDYYTKVGKAWKRGYLLYGPPGTGK  256

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT V  N+ELRKL ++T+ KSIIVIEDIDCSV+LT + +  
Sbjct  257  STMIAAMANFLDYDVYDLELTAVKNNTELRKLFIETTGKSIIVIEDIDCSVDLTGKRKDK  316

Query  368  GGGSTREYSSA-----ATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
                  E   A      T   +D G ++TLSGLLNF DGLWS CG ERI +FTTNH +KL
Sbjct  317  KAEKKAEADGADKPTLPTDPDKDDGTKVTLSGLLNFIDGLWSACGGERIIIFTTNHKDKL  376

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPAL+R GRMD HI MSYC F A K+L KNY         + +E E   Q+A++++  +M
Sbjct  377  DPALIRRGRMDRHIEMSYCRFQAFKVLAKNY--------LDVKEHELFGQIAQLLEETDM  428

Query  713  TPADVSEVLIRNRRNKER  766
            +PADV+E L+   + K++
Sbjct  429  SPADVAENLMPMSKMKKK  446



>ref|XP_010040092.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
Length=518

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/251 (57%), Positives = 173/251 (69%), Gaps = 14/251 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V FKHPSTFDTLAM+P KK EI  DL  F  G+ +Y+R G+AWKRGYLLYGPPGTGK
Sbjct  197  WSHVAFKHPSTFDTLAMEPSKKREIMNDLLKFQRGKEYYERIGKAWKRGYLLYGPPGTGK  256

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT------  349
            S+M AAMANFL YD+YD+ELT V  N+ELRKLL+ TS K+IIVIEDIDCS++LT      
Sbjct  257  STMTAAMANFLNYDVYDVELTTVKDNTELRKLLIDTSEKAIIVIEDIDCSLDLTGQRKTK  316

Query  350  NRERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
             +E+ + G         A  G E   +++TLSGLLNF+DGLWS CG ERI VFTTN VEK
Sbjct  317  KQEKDDDGEKADPVKRMAKGGEESKDSKVTLSGLLNFSDGLWSACGGERIIVFTTNFVEK  376

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI M YC F + K+L +NY           E       + ++++  E
Sbjct  377  LDPALIRRGRMDKHIEMLYCCFESFKVLARNY--------LGIESHPLFTSVRQLLEGTE  428

Query  710  MTPADVSEVLI  742
            MTPADV+E L+
Sbjct  429  MTPADVAENLM  439



>ref|XP_009139945.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Brassica 
rapa]
Length=470

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/246 (56%), Positives = 179/246 (73%), Gaps = 15/246 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W S+ F+HP++F+TLAM+  KKEEI +DL  F NG+ +Y++ G+AWKRGYLLYGPPGTGK
Sbjct  195  WRSIEFEHPASFETLAMEQEKKEEIMSDLTAFTNGKDYYKKIGKAWKRGYLLYGPPGTGK  254

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MI+AM NFL Y+IYD+ELT +  NSELRKLL  TSSKSI+VIEDIDCSV+LT      
Sbjct  255  STMISAMVNFLNYNIYDLELTAIKNNSELRKLLTSTSSKSIVVIEDIDCSVDLT------  308

Query  368  GGGSTREYSSAATQGGEDGG-NRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
            G  + ++ +S    G +D   + +TLSGLLNF DG+WS CG ERI VFTTNH+EKLDPAL
Sbjct  309  GNRNKKDRNSMERNGEQDKDESSVTLSGLLNFIDGIWSACGQERIVVFTTNHLEKLDPAL  368

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPAD  724
            +R GRMDMHI +SYC + A KIL KNY         + ++    + +  ++   E++PAD
Sbjct  369  IRRGRMDMHIELSYCTYEAFKILAKNY--------LDLDDHPLFKNIKSLLKEIEISPAD  420

Query  725  VSEVLI  742
            V+E L+
Sbjct  421  VAENLM  426



>ref|XP_011093400.1| PREDICTED: mitochondrial chaperone BCS1-like [Sesamum indicum]
Length=513

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 191/271 (70%), Gaps = 14/271 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K ++  DL  FA+G+ FYQ+ GRAWKRGYLLYGPPG+GK
Sbjct  181  WSSVPFRHPSTFETLALEPELKNQLVDDLTAFADGKEFYQKIGRAWKRGYLLYGPPGSGK  240

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT----NR  355
            SS+IAAMANFL YD+YD+EL++V  NSELR LL++T+++SIIVIEDIDCS++LT     +
Sbjct  241  SSLIAAMANFLCYDVYDLELSKVADNSELRALLIQTTNRSIIVIEDIDCSIDLTGDRLTK  300

Query  356  ERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
             R +   S  + +  A+  GE+ G R+TLSGLLNFTDGLWSCCG ER+ +FTTNH + +D
Sbjct  301  TRRSSSSSIAKKARTASDHGEENG-RVTLSGLLNFTDGLWSCCGEERVIIFTTNHRDTVD  359

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PALLR GRMD+H+ +  C   A K L+KNY          +         + V     +T
Sbjct  360  PALLRCGRMDVHVSLGTCGVHAFKQLVKNY-------LGLDSHMLFDVAESCVRAGGALT  412

Query  716  PADVSEVLIRNRRNKERALWELVEISRMRAE  808
            PA + E+L+RNRR+ + AL  +V  S M+A+
Sbjct  413  PAQIGEILLRNRRDADVALKAVV--SAMQAK  441



>ref|XP_010034623.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
Length=472

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/251 (55%), Positives = 176/251 (70%), Gaps = 14/251 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TFDTLAM+P KK EI  DL  F  G+ +Y+R G+AWKRGYLLYGPPGTGK
Sbjct  179  WSHVAFEHPATFDTLAMEPNKKSEIMNDLLRFRRGKEYYERIGKAWKRGYLLYGPPGTGK  238

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT V  N+ELRKLL++TS+KSIIVIEDIDCS++LT + +  
Sbjct  239  STMIAAMANFLNYDVYDLELTTVKDNTELRKLLIETSAKSIIVIEDIDCSLDLTGQRKTK  298

Query  368  GGGSTREYSSA------ATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                  +   A         G E   +++TLSGLLNF DGLWS CG ERI VFTTN+VEK
Sbjct  299  KQEKDEDEEKADPVKRMVKGGDESKDSKVTLSGLLNFIDGLWSACGGERIIVFTTNYVEK  358

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI MSYC + + K+L++NY         + E       +  +++  +
Sbjct  359  LDPALIRRGRMDKHIEMSYCCYESFKVLVRNY--------LDVESHPLFATVRRLLEETK  410

Query  710  MTPADVSEVLI  742
            MTPADV+E L+
Sbjct  411  MTPADVAENLM  421



>gb|KCW45485.1| hypothetical protein EUGRSUZ_L00795 [Eucalyptus grandis]
Length=517

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/251 (57%), Positives = 173/251 (69%), Gaps = 14/251 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V FKHPSTFDTLAM+P KK EI  DL  F  G+ +Y+R G+AWKRGYLLYGPPGTGK
Sbjct  196  WSHVAFKHPSTFDTLAMEPSKKREIMNDLLKFQRGKEYYERIGKAWKRGYLLYGPPGTGK  255

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT------  349
            S+M AAMANFL YD+YD+ELT V  N+ELRKLL+ TS K+IIVIEDIDCS++LT      
Sbjct  256  STMTAAMANFLNYDVYDVELTTVKDNTELRKLLIDTSEKAIIVIEDIDCSLDLTGQRKTK  315

Query  350  NRERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
             +E+ + G         A  G E   +++TLSGLLNF+DGLWS CG ERI VFTTN VEK
Sbjct  316  KQEKDDDGEKADPVKRMAKGGEESKDSKVTLSGLLNFSDGLWSACGGERIIVFTTNFVEK  375

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI M YC F + K+L +NY           E       + ++++  E
Sbjct  376  LDPALIRRGRMDKHIEMLYCCFESFKVLARNY--------LGIESHPLFTSVRQLLEGTE  427

Query  710  MTPADVSEVLI  742
            MTPADV+E L+
Sbjct  428  MTPADVAENLM  438



>ref|XP_010257525.1| PREDICTED: uncharacterized protein LOC104597594 [Nelumbo nucifera]
Length=516

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/279 (52%), Positives = 192/279 (69%), Gaps = 23/279 (8%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  KE++  DL  FANG  FY R GR+WKRGYLLYGPPG+GK
Sbjct  180  WVSVPFRHPSTFETLALEPELKEQLTEDLTAFANGRDFYHRVGRSWKRGYLLYGPPGSGK  239

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS+IAAMANFL YD+YD+ELT+V  NSELR LL++T+++SIIVIEDIDCS++LT  +R+ 
Sbjct  240  SSLIAAMANFLCYDVYDLELTKVSDNSELRALLIQTTNRSIIVIEDIDCSLDLTA-DRL-  297

Query  368  GGGSTREYSSAA-------TQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVE  526
               S R+ SS          + GE+ G R+TLSGLLNFTDGLWSCCG ERI VFTTNH +
Sbjct  298  ---SKRKKSSTPMPESHRRCEDGEENG-RVTLSGLLNFTDGLWSCCGEERIIVFTTNHRD  353

Query  527  KLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAA  706
             +DPAL+R GRMD+H+ +  C   A K L KNY          E         + +    
Sbjct  354  NVDPALVRCGRMDVHVRLGTCGVHAFKALAKNY-------LGVESHILFEVVESCIRAGG  406

Query  707  EMTPADVSEVLIRNRRNKERALWELV---EISRMRAERN  814
             +TPA + E+L+RNRR+ + A+  ++   + S +R +R+
Sbjct  407  ALTPAQIGEILLRNRRDADAAIKAVISALQESILRGDRD  445



>emb|CAN62143.1| hypothetical protein VITISV_023956 [Vitis vinifera]
Length=501

 Score =   283 bits (723),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 166/272 (61%), Positives = 196/272 (72%), Gaps = 14/272 (5%)
 Frame = +2

Query  122  YQRTGRAWKRGYLLYGPPGTGKSSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSS  301
            + R+ R +KR  +L       + SMIAAMANFLGYD+YD+ELTEVHTNSELRKLLMKTSS
Sbjct  215  HGRSQRLFKRPDILPEDRPRLEESMIAAMANFLGYDVYDLELTEVHTNSELRKLLMKTSS  274

Query  302  KSIIVIEDIDCSVNLTNRERMNGGGST-------REYSSAATQGGEDGGNRITLSGLLNF  460
            KSIIVIEDIDCS+NL NR++ N GG                   GEDG N ITLSGLLNF
Sbjct  275  KSIIVIEDIDCSINLGNRKKSNSGGRQGYDGTPHEMRGGGGAGAGEDGVNSITLSGLLNF  334

Query  461  TDGLWSCCGSERIFVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlglea  640
            TDGLWSCCGSERIFVFTTNH+EKLDPALLRSGRMDMHI MSYC FPALKILL+NY     
Sbjct  335  TDGLWSCCGSERIFVFTTNHIEKLDPALLRSGRMDMHIFMSYCTFPALKILLQNY----L  390

Query  641  aaeqeeeegealrqlaeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAERNTg  820
               + +   + + ++  VID A+MTPAD+SEVLI+NRR+K++AL EL+E  R  AER   
Sbjct  391  GFSEPDMGLQIMEEIEAVIDKAQMTPADISEVLIKNRRHKDKALSELLEALRNMAERR--  448

Query  821  kkggernsgggedvfeeedeeqeKRALESPKR  916
             K     S   ++  E E+EEQEKRALE+PK+
Sbjct  449  -KKENWRSAREKNSTEVEEEEQEKRALENPKQ  479



>ref|XP_004151742.1| PREDICTED: probable mitochondrial chaperone BCS1-A-like [Cucumis 
sativus]
 ref|XP_004172622.1| PREDICTED: probable mitochondrial chaperone BCS1-A-like [Cucumis 
sativus]
 gb|KGN58634.1| ATP binding protein [Cucumis sativus]
Length=503

 Score =   282 bits (722),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 183/266 (69%), Gaps = 16/266 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++   K++I  DL  FA G  FY R GRAWKRGYLLYGPPG+GK
Sbjct  181  WVSVPFRHPSTFETLALETELKKQIMNDLMAFAAGREFYSRVGRAWKRGYLLYGPPGSGK  240

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS+IAAMANFL YD+YD+ELT+V  NSELR LL++T+++S+IVIEDIDCSV+LT      
Sbjct  241  SSLIAAMANFLCYDVYDLELTKVSDNSELRSLLIQTTNRSVIVIEDIDCSVDLT------  294

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
               + R    AA +  E+   R+TLSGLLNFTDGLWSCCG ERI VFTTN+ EK+DPAL+
Sbjct  295  ---ADRVTKVAAREDHEEEMGRVTLSGLLNFTDGLWSCCGEERIVVFTTNYREKIDPALV  351

Query  548  RSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPADV  727
            R GRMD+H+ +  C   A + L+KNY        + E         + +     +TPA +
Sbjct  352  RCGRMDVHVSLGTCGPAAFRTLVKNY-------LEIESHALFDVVDSCIRSGGGLTPAQI  404

Query  728  SEVLIRNRRNKERALWELVEISRMRA  805
             E+L+RNRR+ + A+ E+V   + R 
Sbjct  405  GEILLRNRRDADVAMREVVAALQARV  430



>ref|XP_010255848.1| PREDICTED: mitochondrial respiratory chain complexes assembly 
protein rca1-like [Nelumbo nucifera]
Length=539

 Score =   283 bits (725),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 177/249 (71%), Gaps = 12/249 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TFDTLAMDPVKK++I  DL  F+ G+ +Y++ G+AWKRGYLLYGPPGTGK
Sbjct  214  WNHVVFEHPATFDTLAMDPVKKQDIIDDLLTFSKGKDYYKKIGKAWKRGYLLYGPPGTGK  273

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT-NRERM  364
            S+MIAAMAN L YD+YD+ELT V  N+ELRKLL++TSSKSIIVIEDIDCS++LT  R++ 
Sbjct  274  STMIAAMANLLDYDVYDVELTAVKNNTELRKLLIETSSKSIIVIEDIDCSLDLTGQRKKK  333

Query  365  NGGGSTRE---YSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
               G   E         +   +  +++TLSGLLNF DGLWS CG ER+ VFTTNHVEKLD
Sbjct  334  KEEGDDDEKDRLPKPLKEEAREKDSKVTLSGLLNFIDGLWSACGGERLIVFTTNHVEKLD  393

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PAL+R GRMD HI +SYC++ A KIL KNY           +       +  +++   MT
Sbjct  394  PALIRKGRMDKHIQLSYCSYEAFKILAKNY--------LNLDSHRLFGTIGRLLEETNMT  445

Query  716  PADVSEVLI  742
            PADV+E L+
Sbjct  446  PADVAECLM  454



>ref|XP_010502856.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=478

 Score =   281 bits (720),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 172/249 (69%), Gaps = 8/249 (3%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+ F+TLAMDP KKEEI +DL  F+NG+ +Y++ G+A KRGYLLYGPPGTGK
Sbjct  193  WRYIDFEHPANFETLAMDPKKKEEILSDLVAFSNGKDYYKKIGKARKRGYLLYGPPGTGK  252

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L Y IYD+ELT +  NSELRKLL  TS+KSIIVIEDIDCS+++T   +  
Sbjct  253  STMIAAMANLLNYSIYDLELTAIQNNSELRKLLTATSNKSIIVIEDIDCSLDVTGNRKKK  312

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
                TR          ED  + +TLSGLLNF DG+WS CG ERI VFTTNH+ KLDPAL+
Sbjct  313  ESYWTRLTKDGQQGDEEDKSSFVTLSGLLNFIDGIWSACGQERIIVFTTNHLAKLDPALI  372

Query  548  RSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPADV  727
            R GRMDMHI +SYC F A KIL KNY         + +      ++  +I   ++ PADV
Sbjct  373  RRGRMDMHIELSYCTFEAFKILAKNY--------LDLDSHPLFEKIESLIKETKIAPADV  424

Query  728  SEVLIRNRR  754
            +E L++  R
Sbjct  425  AEKLMKKNR  433



>ref|XP_009614445.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Nicotiana 
tomentosiformis]
Length=499

 Score =   282 bits (721),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 180/259 (69%), Gaps = 27/259 (10%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+TFDTLAMDP KKEEI  DL  F+ G+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  195  WRDINFEHPATFDTLAMDPKKKEEIIIDLIAFSKGKDYYSKVGKAWKRGYLLYGPPGTGK  254

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT------  349
            S+MIAA+ANFL YDIYD+ELT V  NS L+KLLM+T+SKSIIVIEDIDCS++LT      
Sbjct  255  STMIAAIANFLNYDIYDLELTSVKDNSGLKKLLMETTSKSIIVIEDIDCSIDLTGKRKKK  314

Query  350  --------NRERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFV  505
                    N ++ +   S++E +S   + G     ++TLSGLLNF DG+WS CG ERI +
Sbjct  315  KKKSEETVNEDQEDDSDSSKEKASENKETG-----KLTLSGLLNFIDGIWSACGQERIII  369

Query  506  FTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrql  685
            FTTNH +KLDPAL+R GRMDMHI MSYC + A K+L KNY         E E     +Q+
Sbjct  370  FTTNHKDKLDPALIRRGRMDMHIEMSYCKYEAFKVLAKNY--------LEVETHPLFQQI  421

Query  686  aeVIDAAEMTPADVSEVLI  742
              +++   M+P DV+E L+
Sbjct  422  QGLLEEVNMSPCDVAENLM  440



>gb|KFK33165.1| hypothetical protein AALP_AA6G338900 [Arabis alpina]
Length=467

 Score =   281 bits (719),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 157/206 (76%), Gaps = 8/206 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W S+ F+HP++F+TLAMDP KKEEI  DL  F+NG+ +Y++ G+AWKRGYLLYGPPGTGK
Sbjct  195  WRSIEFEHPASFETLAMDPEKKEEILNDLVAFSNGKEYYKKIGKAWKRGYLLYGPPGTGK  254

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MI+AMAN L Y+IYD+ELT +  NSELRKLL  TS+KSIIVIEDIDCS +LT      
Sbjct  255  STMISAMANHLNYNIYDLELTAIKNNSELRKLLTATSNKSIIVIEDIDCSADLTANRIKK  314

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
               ST+E         +   N +TLSGLLNF DG+WS CG ERI VFTTNH+EKLDPAL+
Sbjct  315  ESNSTKE--------QDKDENAVTLSGLLNFIDGIWSACGQERIVVFTTNHLEKLDPALI  366

Query  548  RSGRMDMHIHMSYCNFPALKILLKNY  625
            R GRMDMHI +SYC + A KIL KNY
Sbjct  367  RRGRMDMHIELSYCTYEAFKILAKNY  392



>ref|XP_010265413.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Nelumbo nucifera]
Length=521

 Score =   283 bits (723),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 141/276 (51%), Positives = 190/276 (69%), Gaps = 19/276 (7%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF HPSTFDT+A+DP  K+EIK DL  F N   FY R GRAWKRGYLLYGPPGTGK
Sbjct  189  WSSVPFSHPSTFDTVAIDPALKKEIKEDLMKFVNRREFYSRVGRAWKRGYLLYGPPGTGK  248

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            +S+IAA+ANFL +DIYD+ELT V +NS+LRKLL+ TSSKS+IV+ED+DCS++L++R++  
Sbjct  249  TSLIAAIANFLEFDIYDLELTAVSSNSQLRKLLISTSSKSVIVVEDVDCSLDLSDRKKKE  308

Query  368  G---------GGSTREY--SSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTT  514
                      G   R +   S   +G    G+ ++LSG+LNF DGLWS CG ER+ +FTT
Sbjct  309  SFEVEENEKYGEEKRWWRQRSHNGRGSNSFGSTVSLSGVLNFVDGLWSSCGGERLMIFTT  368

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NH EKLDPALLR+GRMD HI++SYC F A K L KNY         E ++ + +++  EV
Sbjct  369  NHKEKLDPALLRAGRMDKHINLSYCEFNAFKTLAKNY--------LEIDDHKLMKEAKEV  420

Query  695  IDAAEMTPADVSEVLIRNRRNKERALWELVEISRMR  802
            +   +MTPA ++E+ +    + E  +  +++  + R
Sbjct  421  LPLVKMTPAHIAEIFMSCEDDAEMGMKNVIDEMKRR  456



>gb|AGT16562.1| hypothetical protein SHCRBa_008_G08_R_120 [Saccharum hybrid cultivar 
R570]
Length=466

 Score =   281 bits (718),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 140/261 (54%), Positives = 184/261 (70%), Gaps = 13/261 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W +V  +HPSTFDTLAMD   K  +  DL+ F   + +Y+R GRAWKRGYLLYGPPGTGK
Sbjct  200  WTAVDLRHPSTFDTLAMDDKLKSSVIEDLQRFVRRKDYYRRIGRAWKRGYLLYGPPGTGK  259

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS++AAMANFL +DIYD+ELTEV +NS+LR+LL+ TS++SI+V+EDIDCS+ L  R+   
Sbjct  260  SSLVAAMANFLKFDIYDLELTEVKSNSDLRRLLVGTSNRSILVVEDIDCSIELQQRDEGE  319

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
               +TR  +SA    GE+  +++TLSGLLNF DGLWS  G ERI VFTTN+ E+LDPALL
Sbjct  320  RRATTRPTASA----GEENDDKVTLSGLLNFVDGLWSTSGEERIIVFTTNYRERLDPALL  375

Query  548  RSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPADV  727
            R GRMDMHIHM YC   + +IL +NY           E      ++ ++I    ++PA+V
Sbjct  376  RPGRMDMHIHMGYCTPESFRILARNY--------HSVENHVMYPEIEQLIQEVMVSPAEV  427

Query  728  SEVLIRNRRNKERALWELVEI  790
            +EVL+RN  N +  L +L+EI
Sbjct  428  AEVLMRN-DNSDVVLQDLLEI  447



>ref|XP_007032414.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY03340.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=444

 Score =   280 bits (716),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 176/249 (71%), Gaps = 12/249 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TF TLAM+P K++EI  DL  F+  E FY R GRAWKRGYLLYGPPGTGK
Sbjct  150  WSHVVFEHPATFQTLAMEPEKEQEIMEDLTTFSKAEEFYSRIGRAWKRGYLLYGPPGTGK  209

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN LGYDIYD+ELT V  N+ELRKLL++ SSKSIIVIEDIDCS++LT + RM 
Sbjct  210  STMIAAMANLLGYDIYDLELTAVKDNTELRKLLIEPSSKSIIVIEDIDCSLDLTGQRRMK  269

Query  368  GGGS----TREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
                     ++     T+  E   +++TLSGLLNF +GLWS CG ER+ VFTTN V KLD
Sbjct  270  NEKEEPEDMKDPRQKLTKDQEPKSSQVTLSGLLNFINGLWSACGGERLIVFTTNFVGKLD  329

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PAL+R GRMD HI +SYC F A K+L  NY        Q+ E     R++ E+++ A MT
Sbjct  330  PALIRKGRMDKHIELSYCGFEAFKVLANNY--------QKLESHNMFRRIQELLEDARMT  381

Query  716  PADVSEVLI  742
            PA+V+E L+
Sbjct  382  PAEVAEHLM  390



>ref|XP_009369380.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Pyrus x bretschneideri]
Length=524

 Score =   282 bits (722),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 181/258 (70%), Gaps = 22/258 (9%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+TF+T+A+DP KK+EI  DL  F+  + FY R G+AWKRGYLLYGPPGTGK
Sbjct  203  WSHIVFEHPATFETMALDPEKKKEIIEDLVTFSKSKDFYARIGKAWKRGYLLYGPPGTGK  262

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNR----  355
            S+MIAAMAN LGYDIYD+ELT V  N+ELRKLL++T+SKSIIVIEDIDCS++LT +    
Sbjct  263  STMIAAMANLLGYDIYDLELTAVKDNTELRKLLIETTSKSIIVIEDIDCSLDLTGQRKKR  322

Query  356  ---------ERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVF  508
                     E + G G+ +E    A + G  GG+++TLSGLLNF DGLWS CG ER  VF
Sbjct  323  GAAEKGFSEEEVKGSGAGKERVKEAKEEGY-GGSKVTLSGLLNFIDGLWSACGGERGVVF  381

Query  509  TTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqla  688
            TTN+VEKLDPAL+R GRMD HI +SYC F   ++L KNY           E  E   ++ 
Sbjct  382  TTNYVEKLDPALIRRGRMDKHIELSYCTFDGFRVLAKNY--------LRIERHEMFEEIE  433

Query  689  eVIDAAEMTPADVSEVLI  742
            +++   +MTPADV+E L+
Sbjct  434  KLMGVTKMTPADVAENLM  451



>gb|ACG28844.1| ATPase 3 [Zea mays]
Length=493

 Score =   281 bits (720),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 183/256 (71%), Gaps = 13/256 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  VPF+HPSTFDTLAMDP  KE +  DL+ F   + +Y + G+AWKRGYLLYGPPGTGK
Sbjct  195  WSHVPFEHPSTFDTLAMDPDDKEAVVDDLEAFREAKDYYTKVGKAWKRGYLLYGPPGTGK  254

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L YD+YD+ELT V+ N++LRKL ++T+ KSIIV+EDIDCSV+LT + +  
Sbjct  255  STMIAAMANLLDYDVYDLELTAVNNNTDLRKLFIETTGKSIIVVEDIDCSVDLTGKRK--  312

Query  368  GGGSTREYSSAAT---QGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
               S RE         +  +D G++ITLSG+LNF DGLWS CG ERI +FTTNH +KL+P
Sbjct  313  DKKSEREADDKPKLPMEPEKDEGSKITLSGMLNFIDGLWSACGGERIIIFTTNHKDKLEP  372

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTP  718
            AL+R GRMD HI MSYC FPA K+L KNY         + EE E   Q+ ++++  +M+P
Sbjct  373  ALIRRGRMDRHIEMSYCRFPAFKVLAKNY--------LDVEEHELFDQIGQLLEETDMSP  424

Query  719  ADVSEVLIRNRRNKER  766
            ADV+E L+   + K+R
Sbjct  425  ADVAENLMSMSKKKKR  440



>ref|XP_008393095.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X1 
[Malus domestica]
Length=483

 Score =   281 bits (719),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 181/263 (69%), Gaps = 21/263 (8%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+TF+T+A+DP KK+EI  DL  F+  + FY R G+AWKRGYLLYGPPGTGK
Sbjct  203  WSHIVFEHPATFETMALDPXKKKEIIEDLVTFSKSKDFYARIGKAWKRGYLLYGPPGTGK  262

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNR----  355
            S+MIAAMAN LGYDIYD+ELT V  N+ELRKLL++T+SKSIIVIEDIDCS++LT +    
Sbjct  263  STMIAAMANLLGYDIYDLELTAVKDNTELRKLLIETTSKSIIVIEDIDCSLDLTGQMKKR  322

Query  356  ---------ERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVF  508
                     E + GGG+ +E      +    G +++TLSGLLNF DGLWS CG ER+ VF
Sbjct  323  GAAEKGFLEEEVKGGGAWKERIKEPKEEVYGGSSKVTLSGLLNFIDGLWSACGGERLVVF  382

Query  509  TTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqla  688
            TTN+VEKLDPAL+R GRMD HI +SYC F   ++L KNY           E  E   ++ 
Sbjct  383  TTNYVEKLDPALIRRGRMDKHIALSYCTFDGFRVLAKNY--------LRIERHETFDEIE  434

Query  689  eVIDAAEMTPADVSEVLIRNRRN  757
            +++   +MTPADV+E L+    N
Sbjct  435  KLMGVTKMTPADVAENLMPKSPN  457



>gb|ACF83668.1| unknown [Zea mays]
 tpg|DAA37186.1| TPA: ATPase 3 [Zea mays]
Length=498

 Score =   281 bits (720),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 182/259 (70%), Gaps = 14/259 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  VPF+HPSTFDTLAMDP  KE +  DL+ F   + +Y + G+AWKRGYLLYGPPGTGK
Sbjct  195  WSHVPFEHPSTFDTLAMDPDDKEAVVDDLEAFREAKDYYTKVGKAWKRGYLLYGPPGTGK  254

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L YD+YD+ELT V+ N++LRKL ++T+ KSIIV+EDIDCSV+LT + +  
Sbjct  255  STMIAAMANLLDYDVYDLELTAVNNNTDLRKLFIETTGKSIIVVEDIDCSVDLTGKRKDK  314

Query  368  GGGSTREYSSA------ATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                 +    A        +  +D G++ITLSG+LNF DGLWS CG ERI +FTTNH +K
Sbjct  315  KQADKKSEREADDKPKLPMEPEKDEGSKITLSGMLNFIDGLWSACGGERIIIFTTNHKDK  374

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            L+PAL+R GRMD HI MSYC FPA K+L KNY         + EE E   Q+ ++++  +
Sbjct  375  LEPALIRRGRMDRHIEMSYCRFPAFKVLAKNY--------LDVEEHELFDQIGQLLEETD  426

Query  710  MTPADVSEVLIRNRRNKER  766
            M+PADV+E L+   + K+R
Sbjct  427  MSPADVAENLMSMSKKKKR  445



>ref|XP_011009649.1| PREDICTED: uncharacterized protein LOC105114707 [Populus euphratica]
Length=524

 Score =   282 bits (722),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 144/279 (52%), Positives = 186/279 (67%), Gaps = 22/279 (8%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K+++  DLK FA+G  FY R GRAWKRGYLLYGPPG+GK
Sbjct  183  WVSVPFRHPSTFETLALEPHLKKQMMEDLKAFASGREFYHRVGRAWKRGYLLYGPPGSGK  242

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNL-------  346
            SS+IAAMAN+L YD+YD+ELT+V  NSELR LL++TS++SIIVIEDIDCS++L       
Sbjct  243  SSLIAAMANYLCYDVYDLELTKVTDNSELRALLIQTSNRSIIVIEDIDCSLDLTADRMMK  302

Query  347  ------TNRERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVF  508
                  T R+R +  G  ++  +   Q  E+ G R+TLSGLLNFTDGLWSCCG ERI VF
Sbjct  303  ATTATATRRKRSSSSGYNKDLGTGNDQLLEESG-RVTLSGLLNFTDGLWSCCGEERIIVF  361

Query  509  TTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqla  688
            TTNH E +DPAL+R GRMD+H+ +  C   A K L  NY          E         +
Sbjct  362  TTNHRENVDPALVRCGRMDVHVSLGTCGMHAFKALAMNY-------LGIEWHSSFDVVES  414

Query  689  eVIDAAEMTPADVSEVLIRNR-RNKERALWELVEISRMR  802
             +     +TPA + E+L+RNR  N + A+ E+V   + R
Sbjct  415  CIRSGGALTPAQIGEILLRNRGSNADLAMTEVVSAMQAR  453



>ref|XP_010243399.1| PREDICTED: ATPase family gene 2 protein-like [Nelumbo nucifera]
Length=524

 Score =   282 bits (721),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 184/273 (67%), Gaps = 13/273 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTFDTLA++   KE+I  DL  FANG  FY R GR+WKRGYLLYGPPG+GK
Sbjct  180  WVSVPFRHPSTFDTLALELELKEQITEDLTAFANGREFYHRVGRSWKRGYLLYGPPGSGK  239

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS+IAAMANFL YD+YD+ELT+V  NSELR LL++T+++SIIVIEDIDCS++LT    + 
Sbjct  240  SSLIAAMANFLCYDVYDLELTKVSDNSELRALLIQTTNRSIIVIEDIDCSLDLTTDRLLK  299

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
               S+         GGE+ G R+TLSGLLNFTDGLWSCCG ERI VFTTNH + +DPAL+
Sbjct  300  TKKSSPSIMENG-DGGEENG-RVTLSGLLNFTDGLWSCCGEERIIVFTTNHRDNVDPALV  357

Query  548  RSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPADV  727
            R GRMD+H+ +  C   A K L  NY          E         + +     +TPA +
Sbjct  358  RCGRMDVHVRLGTCGIHAFKALAMNY-------LGLEWHVLFHVVESCIRAGGALTPAQI  410

Query  728  SEVLIRNRRNKERALWELV----EISRMRAERN  814
             E+L+RNRR+ + A+  +V    E   +R +RN
Sbjct  411  GEILLRNRRDADVAIKAVVSALQESISLRRDRN  443



>ref|XP_009365053.1| PREDICTED: uncharacterized protein LOC103954926 [Pyrus x bretschneideri]
Length=556

 Score =   283 bits (724),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 183/269 (68%), Gaps = 17/269 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K ++  DL  FA G+ FY R GRAWKRGYLLYGPPG+GK
Sbjct  192  WVSVPFRHPSTFETLALEPQLKNQLTGDLTAFAEGKEFYHRVGRAWKRGYLLYGPPGSGK  251

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT-NRERM  364
            SS+IAAMAN+L YD+YD+ELT+V  NSELR LL++T+++SI+VIEDIDCS++LT +R++ 
Sbjct  252  SSLIAAMANYLCYDVYDLELTKVSDNSELRALLIQTTNRSIVVIEDIDCSLDLTADRQQQ  311

Query  365  NGGGST-----REYSSAATQGGED----GGNRITLSGLLNFTDGLWSCCGSERIFVFTTN  517
                ST     R     A Q  +D    GG R+TLSGLLNFTDGLWSCCG ERI VFTTN
Sbjct  312  MISNSTSKARLRSSRKQAQQKQDDDEQNGGGRVTLSGLLNFTDGLWSCCGDERIIVFTTN  371

Query  518  HVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVI  697
            H + +DPALLR GRMD+H+ +  C   A + L KNY          +           V 
Sbjct  372  HRDNVDPALLRCGRMDVHVSLGTCGPHAFRQLAKNY-------LGLDAHPLFEAADGCVR  424

Query  698  DAAEMTPADVSEVLIRNRRNKERALWELV  784
                +TPA V E+L+RNR + + A+ E+V
Sbjct  425  SGGVLTPAQVGEILLRNRGDADVAMKEVV  453



>ref|XP_007032410.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY03336.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=518

 Score =   282 bits (721),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 175/249 (70%), Gaps = 12/249 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TFDTLAMD  KKEEIK DL  F+ G+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  197  WSHVVFEHPATFDTLAMDAKKKEEIKKDLIKFSKGKEYYAKIGKAWKRGYLLYGPPGTGK  256

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT V  N ELR+LL++TS+KSIIVIEDIDCS++LT +    
Sbjct  257  STMIAAMANFLNYDVYDLELTTVKNNIELRRLLIETSNKSIIVIEDIDCSLDLTGQREKK  316

Query  368  GGGSTREYS----SAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
                  E      S   +  E   + +TLSGLLNF DGLWS CG ERI VFTTN+VEKLD
Sbjct  317  KKKDENEEEMDPISKKAKEEEQKDSEVTLSGLLNFIDGLWSACGGERIIVFTTNYVEKLD  376

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PAL+R GRMD HI MSYC F A K+L KNY         + E      +++ +++  +MT
Sbjct  377  PALIRRGRMDKHIEMSYCRFEAFKVLAKNY--------LDIELHPLFGEISSLLEETDMT  428

Query  716  PADVSEVLI  742
            PADV+E L+
Sbjct  429  PADVAENLM  437



>ref|XP_008351823.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X1 
[Malus domestica]
Length=483

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 181/263 (69%), Gaps = 21/263 (8%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+TF+T+A+DP KK+EI  DL  F+  + FY R G+AWKRGYLLYGPPGTGK
Sbjct  203  WSHIVFEHPATFETMALDPEKKKEIIEDLVTFSKSKDFYARIGKAWKRGYLLYGPPGTGK  262

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNR----  355
            S+MIAAMAN LGYDIYD+ELT V  N+ELRKLL++T+SKSIIVIEDIDCS++LT +    
Sbjct  263  STMIAAMANLLGYDIYDLELTAVKDNTELRKLLIETTSKSIIVIEDIDCSLDLTGQMKKR  322

Query  356  ---------ERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVF  508
                     E + GGG+ +E      +    G +++TLSGLLNF DGLWS CG ER+ VF
Sbjct  323  GAAEKGFLEEEVKGGGAWKERIKEPKEEVYGGSSKVTLSGLLNFIDGLWSACGGERLVVF  382

Query  509  TTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqla  688
            TTN+VEKLDPAL+R GRMD HI +SYC F   ++L KNY           E  E   ++ 
Sbjct  383  TTNYVEKLDPALIRRGRMDKHIALSYCTFDGFRVLAKNY--------LRIERHETFDEIE  434

Query  689  eVIDAAEMTPADVSEVLIRNRRN  757
            +++   +MTPADV+E L+    N
Sbjct  435  KLMGVTKMTPADVAENLMPKSPN  457



>emb|CAH10048.1| Cell Division Protein AAA ATPase family [Triticum aestivum]
 emb|CAJ13544.1| unnamed protein product [Triticum aestivum]
Length=496

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/258 (53%), Positives = 181/258 (70%), Gaps = 13/258 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W+ V F+HP+TFDTLAMD  +KE I  DL  F +G+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  197  WDYVKFEHPATFDTLAMDTDQKEAIMDDLIAFKDGKEYYTKVGKAWKRGYLLYGPPGTGK  256

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT V  N+ELRKL ++ +SKSIIVIEDIDCS++LT + R  
Sbjct  257  STMIAAMANFLDYDVYDLELTSVKNNTELRKLFIEMTSKSIIVIEDIDCSIDLTGKRRKG  316

Query  368  GGGST-----REYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
               S+      EY +  T+  +D  +++TLSGLLNF DGLWS  G ERI +FTTNH EKL
Sbjct  317  KKASSNKDSDNEYEADPTEPQKDDESKVTLSGLLNFIDGLWSASGGERIIIFTTNHKEKL  376

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPAL+R GRMD HI MSYC F   K+L KNY         +  E     ++ ++++  +M
Sbjct  377  DPALIRRGRMDKHIEMSYCRFEGFKVLAKNY--------LDIVEHVLFGEIQQLLEETDM  428

Query  713  TPADVSEVLIRNRRNKER  766
            +PADV+E L+   + K++
Sbjct  429  SPADVAENLMPVSKKKKK  446



>ref|XP_010441108.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=470

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 158/207 (76%), Gaps = 7/207 (3%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W S+ F+HP++F+TLAMDP KKEEI +DL  F+NG+ +Y++ G+AWKRGYLLYGPPGTGK
Sbjct  194  WRSIAFEHPASFETLAMDPKKKEEIVSDLIAFSNGKEYYKKIGKAWKRGYLLYGPPGTGK  253

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MI+AMAN L Y IYD+ELT V  NSEL+KLL  TSSKSIIVIEDIDCS   T   R+ 
Sbjct  254  STMISAMANLLNYHIYDLELTAVKNNSELKKLLTATSSKSIIVIEDIDCSAEFT-ANRIK  312

Query  368  GGGSTREYSSAATQGGEDGG-NRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
               S RE       G +D   N +TLSGLLNF DG+WS CG ERI VFTTNH+EKLDPAL
Sbjct  313  KESSIRE-----RYGRDDKDENAVTLSGLLNFIDGIWSACGQERIVVFTTNHLEKLDPAL  367

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNY  625
            +R GRMDMHI +SYC + A KIL KNY
Sbjct  368  IRRGRMDMHIELSYCTYEAFKILAKNY  394



>ref|XP_006658361.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Oryza 
brachyantha]
Length=466

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/245 (56%), Positives = 170/245 (69%), Gaps = 8/245 (3%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HPSTF+TLAMDP KK+EI  DL  F  G+ +Y R G+AWKRGYLL+GPPGTGK
Sbjct  189  WSYVAFEHPSTFETLAMDPAKKKEIMDDLDAFRKGKDYYARIGKAWKRGYLLHGPPGTGK  248

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN+L YD+YD+ELT V TN++LR+L ++T  KSIIVIEDIDCSV+LT + +  
Sbjct  249  STMIAAMANYLDYDVYDVELTSVATNTDLRRLFIETKGKSIIVIEDIDCSVDLTGKRKKK  308

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
               S     +A     ++   ++TLSGLLN  DGLWS CG ERI VFTTNHV+KLDPAL+
Sbjct  309  TPTSADPDEAAHRASKDESATKVTLSGLLNVIDGLWSACGGERIVVFTTNHVDKLDPALI  368

Query  548  RSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPADV  727
            R GRMD HI MSYC F   KIL KNY           +       +  ++  A++TPADV
Sbjct  369  RRGRMDKHIEMSYCCFETFKILAKNY--------LAMDAHHLFDDVESLLHDAKITPADV  420

Query  728  SEVLI  742
            +E L+
Sbjct  421  AEHLM  425



>ref|XP_003531459.1| PREDICTED: uncharacterized protein LOC100783574 [Glycine max]
Length=516

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/264 (52%), Positives = 183/264 (69%), Gaps = 12/264 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K++IK DL  FA+G+ FY+R GRAWKRGYLL+GPPG+GK
Sbjct  184  WVSVPFRHPSTFETLALEPELKKQIKNDLTAFADGKEFYKRVGRAWKRGYLLHGPPGSGK  243

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT-----N  352
            SS+IAAMANFL YD+YD+ELT+V  NSELR LL++T+++SIIVIEDIDCSV++T      
Sbjct  244  SSLIAAMANFLCYDVYDLELTKVSDNSELRSLLIQTTNRSIIVIEDIDCSVDITADRTVK  303

Query  353  RERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
             ++  G   +   S+   Q G +   R+TLSGLLNFTDGLWSCCG ERI VFTTNH + +
Sbjct  304  VKKSQGAKLSLRSSNKKGQTGCEESGRVTLSGLLNFTDGLWSCCGEERIVVFTTNHRDSV  363

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPALLR GRMD+H+ +  C   A + L +NY          +           +     +
Sbjct  364  DPALLRCGRMDVHVSLGTCGTHAFRELARNY-------LGVDSHVLFEAVEGCIRSGGSL  416

Query  713  TPADVSEVLIRNRRNKERALWELV  784
            TPA V E+L+RNR + + A+ E++
Sbjct  417  TPAHVGEILLRNRGDVDVAMREVL  440



>ref|XP_003578011.1| PREDICTED: uncharacterized protein LOC100830055 [Brachypodium 
distachyon]
Length=506

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/257 (54%), Positives = 179/257 (70%), Gaps = 12/257 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TFDTLAMD  +KE I +DL  F  G+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  198  WSHVKFEHPATFDTLAMDTDQKESIISDLMAFQEGKEYYAKVGKAWKRGYLLYGPPGTGK  257

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT +  N+ELRKL ++T+ KSIIVIEDIDCS++LT +   +
Sbjct  258  STMIAAMANFLDYDVYDLELTAIKNNTELRKLFIETTGKSIIVIEDIDCSIDLTGKRHKD  317

Query  368  GGGSTR----EYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
              G+      E     T   +D  +++TLSGLLNF DGLWS CG ERI +FTTNH EKLD
Sbjct  318  KKGAKESDEDEKPKLPTDPEKDEASKVTLSGLLNFIDGLWSSCGGERIIIFTTNHREKLD  377

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PAL+R GRMD HI MSYC F   K+L KNY         +  E E   ++ ++++  +M+
Sbjct  378  PALIRHGRMDKHIEMSYCRFEGFKVLCKNY--------LDVVEHELFNEIRQLLEETDMS  429

Query  716  PADVSEVLIRNRRNKER  766
            PADV+E L+   + K+R
Sbjct  430  PADVAENLMPMSKKKKR  446



>ref|XP_004233689.1| PREDICTED: mitochondrial chaperone BCS1-like [Solanum lycopersicum]
Length=487

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/277 (51%), Positives = 190/277 (69%), Gaps = 18/277 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W ++ F+HP+TFDTLAMDP KKEEI  DL  F+ G+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  192  WRNINFEHPATFDTLAMDPTKKEEIINDLVAFSKGKDYYSKVGKAWKRGYLLYGPPGTGK  251

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAA+AN+L YDIYD+ELT V  NSEL+KLLM+T+SKSIIVIEDIDCS++LT + +  
Sbjct  252  STMIAAIANYLNYDIYDLELTSVKDNSELKKLLMETTSKSIIVIEDIDCSIDLTGKRKKK  311

Query  368  GGGSTREYSSAAT-------QGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVE  526
                T               +  ++  +++TLSGLLNF DG+WS CG ERI +FTTNHV+
Sbjct  312  NKKETTNEEEEEDSDSTTEKKNDKNESSKLTLSGLLNFIDGIWSACGQERIIIFTTNHVD  371

Query  527  KLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAA  706
            KLDPAL+R GRMDMHI MSYC + A K+L KNY           E     +++  +++  
Sbjct  372  KLDPALIRRGRMDMHIEMSYCKYEAFKVLAKNY--------LGIETHPLFQEIQSLLEEV  423

Query  707  EMTPADVSEVLIRNRR--NKERALWELVEISRMRAER  811
            +++P DV+E L+      N E  L  LV++  ++A+R
Sbjct  424  DVSPCDVAENLMPKNASGNPEICLESLVKV-LIKAKR  459



>ref|XP_002443667.1| hypothetical protein SORBIDRAFT_08g023150 [Sorghum bicolor]
 gb|EES17505.1| hypothetical protein SORBIDRAFT_08g023150 [Sorghum bicolor]
Length=505

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 191/270 (71%), Gaps = 21/270 (8%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TFDTLAMDP +KEEI  DL+ F   + +Y + G+AWKRGYLLYGPPGTGK
Sbjct  195  WSHVAFEHPATFDTLAMDPEEKEEILDDLEAFREAKDYYTKVGKAWKRGYLLYGPPGTGK  254

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT-----N  352
            S+MIAAMANFL YD+YD+ELT V+ N++LRKL ++T+ KSIIVIEDIDCSV+LT     +
Sbjct  255  STMIAAMANFLDYDVYDLELTAVNNNTDLRKLFIETTGKSIIVIEDIDCSVDLTGKRKDD  314

Query  353  RERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
            +++ +GG    +      +  +D G+++TLSGLLNF DGLWS CG ERI +FTTNH +KL
Sbjct  315  KKQADGGA---DKPKLPMEPEKDEGSKVTLSGLLNFIDGLWSACGGERIIIFTTNHKDKL  371

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPAL+R GRMD HI MSYC F A K+L KNY         + EE E   Q+ ++++  +M
Sbjct  372  DPALIRRGRMDRHIEMSYCRFRAFKVLAKNY--------LDVEEHELFGQIGQLLEETDM  423

Query  713  TPADVSEVLI-----RNRRNKERALWELVE  787
            +PADV+E L+     + +R+    L  LVE
Sbjct  424  SPADVAENLMPMSKKKKKRDANVCLENLVE  453



>gb|EMS53863.1| putative mitochondrial chaperone BCS1-B [Triticum urartu]
Length=517

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/259 (53%), Positives = 181/259 (70%), Gaps = 14/259 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  VPF+HP+TFDTLAMDP +KE++  DL  F   + +Y + G+AWKRGYLLYGPPGTGK
Sbjct  191  WSHVPFEHPATFDTLAMDPKQKEDVIDDLMAFQESKEYYAKVGKAWKRGYLLYGPPGTGK  250

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT ++ N+ELRKL ++T+ KSIIVIEDIDCS +LT + R +
Sbjct  251  STMIAAMANFLDYDVYDLELTAINNNTELRKLFIETTGKSIIVIEDIDCSADLTGKRRKD  310

Query  368  GGGSTREYSSA------ATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
               S  + S          +  +D   ++TLSGLLNF DGLWS CG ERI +FTTN+ EK
Sbjct  311  KKASRDKDSDGNDKPKLPIEPEKDDATKVTLSGLLNFIDGLWSACGGERIIIFTTNYKEK  370

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI MSYC F + K+L KNY         +  E E   ++ ++++  +
Sbjct  371  LDPALIRRGRMDKHIEMSYCRFESFKVLAKNY--------LDVVEHELFGEIQQLLEETD  422

Query  710  MTPADVSEVLIRNRRNKER  766
            M+PADV+E L+   + K+R
Sbjct  423  MSPADVAENLMPMSKKKKR  441



>dbj|BAB02175.1| mitochondrial protein-like [Arabidopsis thaliana]
Length=475

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 178/247 (72%), Gaps = 12/247 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP++F TLAMD  KKEEI  DL  F+NG+ +Y++ G+AWKRGYLL+GPPGTGK
Sbjct  190  WRYIDFEHPASFHTLAMDTKKKEEILNDLAAFSNGKEYYKKIGKAWKRGYLLHGPPGTGK  249

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT-NRERM  364
            S+MIAAMAN L Y IYD+ELT +  NSELRKLL  TSSKSIIVIEDIDCS++LT  R++ 
Sbjct  250  STMIAAMANHLNYSIYDLELTAIRNNSELRKLLTATSSKSIIVIEDIDCSLDLTGKRKKE  309

Query  365  NGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
                ++RE      QG E+  + +TLSGLLNF DG+WS CG ERI +FTTNH EKLDPAL
Sbjct  310  KNLMTSRE---DGEQGTEEDKSFVTLSGLLNFIDGIWSACGQERIIIFTTNHFEKLDPAL  366

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPAD  724
            +R GRMDMHI +SYC+F A KIL KNY         + +     +++  ++   ++ PAD
Sbjct  367  IRRGRMDMHIELSYCSFEAFKILAKNY--------LDLDTHPLFKKIESLLKETKIAPAD  418

Query  725  VSEVLIR  745
            V+E L++
Sbjct  419  VAENLMK  425



>ref|XP_002441611.1| hypothetical protein SORBIDRAFT_09g030310 [Sorghum bicolor]
 gb|EES20041.1| hypothetical protein SORBIDRAFT_09g030310 [Sorghum bicolor]
Length=465

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/261 (53%), Positives = 181/261 (69%), Gaps = 14/261 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W +V  +HPSTFDTLAMD   K  +  DL+ F   + +Y+R GRAWKRGYLLYGPPGTGK
Sbjct  200  WTAVDLRHPSTFDTLAMDDKLKSSVVQDLQRFVRRKDYYRRIGRAWKRGYLLYGPPGTGK  259

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS++AAMANFL +DIYD+ELTEV +NS+LR+LL+ TS++SI+V+EDIDCS+ L  R+   
Sbjct  260  SSLVAAMANFLKFDIYDLELTEVKSNSDLRRLLVGTSNRSILVVEDIDCSIELQQRDE--  317

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
                 R  +   T  GE+  +++TLSGLLNF DGLWS  G ERI VFTTN+ E+LDPALL
Sbjct  318  ---GERRATRPTTSAGEENDDKVTLSGLLNFVDGLWSTSGEERIIVFTTNYRERLDPALL  374

Query  548  RSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPADV  727
            R GRMDMHIHM YC   + +IL +NY           E      ++ ++I    ++PA+V
Sbjct  375  RPGRMDMHIHMGYCTPESFRILARNY--------HSVENHAMYAEIEQLIQEVMVSPAEV  426

Query  728  SEVLIRNRRNKERALWELVEI  790
            +EVL+RN  N + AL +L+E 
Sbjct  427  AEVLMRN-DNSDVALQDLLEF  446



>ref|NP_189501.2| AAA-type ATPase family protein [Arabidopsis thaliana]
 gb|AEE77464.1| AAA-type ATPase family protein [Arabidopsis thaliana]
Length=477

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 178/247 (72%), Gaps = 12/247 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP++F TLAMD  KKEEI  DL  F+NG+ +Y++ G+AWKRGYLL+GPPGTGK
Sbjct  192  WRYIDFEHPASFHTLAMDTKKKEEILNDLAAFSNGKEYYKKIGKAWKRGYLLHGPPGTGK  251

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT-NRERM  364
            S+MIAAMAN L Y IYD+ELT +  NSELRKLL  TSSKSIIVIEDIDCS++LT  R++ 
Sbjct  252  STMIAAMANHLNYSIYDLELTAIRNNSELRKLLTATSSKSIIVIEDIDCSLDLTGKRKKE  311

Query  365  NGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
                ++RE      QG E+  + +TLSGLLNF DG+WS CG ERI +FTTNH EKLDPAL
Sbjct  312  KNLMTSRE---DGEQGTEEDKSFVTLSGLLNFIDGIWSACGQERIIIFTTNHFEKLDPAL  368

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPAD  724
            +R GRMDMHI +SYC+F A KIL KNY         + +     +++  ++   ++ PAD
Sbjct  369  IRRGRMDMHIELSYCSFEAFKILAKNY--------LDLDTHPLFKKIESLLKETKIAPAD  420

Query  725  VSEVLIR  745
            V+E L++
Sbjct  421  VAENLMK  427



>ref|XP_008231398.1| PREDICTED: uncharacterized protein LOC103330578 [Prunus mume]
Length=561

 Score =   282 bits (722),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/277 (51%), Positives = 187/277 (68%), Gaps = 19/277 (7%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTFDTLA++P  K ++  DLK FANG+ FY R GRAWKRGY LYGPPG+GK
Sbjct  192  WVSVPFRHPSTFDTLALEPQLKSQLTGDLKAFANGKDFYHRVGRAWKRGYFLYGPPGSGK  251

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT-NRERM  364
            SS+IAAMAN+L YD+YD+ELT+V  NSELR LL++T+++SI+VIEDIDCS++LT +R+++
Sbjct  252  SSLIAAMANYLCYDVYDLELTKVSDNSELRALLIQTTNRSIVVIEDIDCSLDLTADRQQL  311

Query  365  NGGGSTREYSSAA-----TQGGED------GGNRITLSGLLNFTDGLWSCCGSERIFVFT  511
                +T+   S A      Q  ED         R+TLSGLLNFTDGLWSCCG ERI +FT
Sbjct  312  RLSMNTKSTRSKARVRSRQQKQEDEDCDEQNAGRVTLSGLLNFTDGLWSCCGEERIIIFT  371

Query  512  TNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlae  691
            TNH + +DPALLR GRMD+H+++  C   A + + KNY          +           
Sbjct  372  TNHRDNVDPALLRCGRMDVHVNLGNCGPHAFRAMAKNY-------LGLDSHPLFEAVDRC  424

Query  692  VIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMR  802
            V     +TPA V E+L+RNR + + A+ ++V   + R
Sbjct  425  VRSGGALTPAQVGEILLRNRGDADVAMKDVVSAMQAR  461



>ref|XP_006338493.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Solanum 
tuberosum]
Length=509

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 179/259 (69%), Gaps = 24/259 (9%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+TFDTLAMDP KK EI  DL  F+NG+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  198  WRDINFEHPATFDTLAMDPKKKAEIINDLIAFSNGKDYYSKVGKAWKRGYLLYGPPGTGK  257

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNL-------  346
            S+MIAA+AN+L YDIYD+ELT V  NS L+KLLM+T+SKSIIVIEDIDCS++L       
Sbjct  258  STMIAAIANYLNYDIYDLELTSVKDNSGLKKLLMETTSKSIIVIEDIDCSIDLTGKRKKK  317

Query  347  -------TNRERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFV  505
                   T+ ++     S+ E    +T+  E G  ++TLSGLLNF DG+WS CG ERI +
Sbjct  318  KKKEKETTSEDQEEDSDSSTEKEKESTENKESG--KLTLSGLLNFIDGIWSACGQERIII  375

Query  506  FTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrql  685
            FTTNH +KLDPAL+R GRMDMHI MSYC + A K+L KNY           E     +Q+
Sbjct  376  FTTNHKDKLDPALIRRGRMDMHIEMSYCKYEAFKVLAKNY--------LNLETHTLFQQI  427

Query  686  aeVIDAAEMTPADVSEVLI  742
              +++  +M+P DV+E L+
Sbjct  428  QGLLEEVDMSPCDVAEHLM  446



>ref|XP_006482802.1| PREDICTED: uncharacterized protein LOC102622284 [Citrus sinensis]
Length=530

 Score =   281 bits (720),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 147/287 (51%), Positives = 189/287 (66%), Gaps = 29/287 (10%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K++I  DL  FANG+ FY R GRAWKRGYLLYGPPG+GK
Sbjct  182  WVSVPFRHPSTFETLALEPQLKKQITEDLTAFANGKEFYHRVGRAWKRGYLLYGPPGSGK  241

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS+IAAMAN+L YD+YD+ELT+V  NSELR LL++T+++SIIVIEDIDCSV+LT    + 
Sbjct  242  SSLIAAMANYLCYDVYDLELTKVTDNSELRALLLQTTNRSIIVIEDIDCSVDLTADRMLK  301

Query  368  GGGS-----TREYSSAATQG---------------GEDGGNRITLSGLLNFTDGLWSCCG  487
               +     T+  SS    G               GE+ G R+TLSGLLNFTDGLWSCC 
Sbjct  302  SSNTSTTAKTKRSSSIKEMGSRIASSTCGNNNNNNGEESG-RVTLSGLLNFTDGLWSCCS  360

Query  488  SERIFVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeeg  667
             E+I VFTTNH + +DPAL+R GRMD+H+ +  C   A K+L KNY         E    
Sbjct  361  EEKIIVFTTNHRDSVDPALIRCGRMDVHVSLGTCGPHAFKVLAKNY------LGIESHHA  414

Query  668  ealrqlaeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAE  808
                  + +     +TPA + EVL+RNR N + A+ E+V  S M+A+
Sbjct  415  LFDVVESCIRAGGALTPAQIGEVLLRNRGNVDLAMKEVV--SAMQAK  459



>ref|XP_006439008.1| hypothetical protein CICLE_v10031208mg [Citrus clementina]
 gb|ESR52248.1| hypothetical protein CICLE_v10031208mg [Citrus clementina]
Length=530

 Score =   281 bits (720),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 147/287 (51%), Positives = 189/287 (66%), Gaps = 29/287 (10%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K++I  DL  FANG+ FY R GRAWKRGYLLYGPPG+GK
Sbjct  182  WVSVPFRHPSTFETLALEPQLKKQITEDLTAFANGKEFYHRVGRAWKRGYLLYGPPGSGK  241

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS+IAAMAN+L YD+YD+ELT+V  NSELR LL++T+++SIIVIEDIDCSV+LT    + 
Sbjct  242  SSLIAAMANYLCYDVYDLELTKVTDNSELRALLLQTTNRSIIVIEDIDCSVDLTADRMLK  301

Query  368  GGGS-----TREYSSAATQG---------------GEDGGNRITLSGLLNFTDGLWSCCG  487
               +     T+  SS    G               GE+ G R+TLSGLLNFTDGLWSCC 
Sbjct  302  SSNTSTTAKTKRSSSIKEMGSRIASSTCGNNNNNNGEESG-RVTLSGLLNFTDGLWSCCS  360

Query  488  SERIFVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeeg  667
             E+I VFTTNH + +DPAL+R GRMD+H+ +  C   A K+L KNY         E    
Sbjct  361  EEKIIVFTTNHRDSVDPALIRCGRMDVHVSLGTCGPHAFKVLAKNY------LGIESHHA  414

Query  668  ealrqlaeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAE  808
                  + +     +TPA + EVL+RNR N + A+ E+V  S M+A+
Sbjct  415  LFDVVESCIRAGGALTPAQIGEVLLRNRGNVDLAMKEVV--SAMQAK  459



>gb|KDO46037.1| hypothetical protein CISIN_1g009640mg [Citrus sinensis]
Length=530

 Score =   281 bits (720),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 147/287 (51%), Positives = 189/287 (66%), Gaps = 29/287 (10%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K++I  DL  FANG+ FY R GRAWKRGYLLYGPPG+GK
Sbjct  182  WVSVPFRHPSTFETLALEPQLKKQITEDLTAFANGKEFYHRVGRAWKRGYLLYGPPGSGK  241

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS+IAAMAN+L YD+YD+ELT+V  NSELR LL++T+++SIIVIEDIDCSV+LT    + 
Sbjct  242  SSLIAAMANYLCYDVYDLELTKVTDNSELRALLLQTTNRSIIVIEDIDCSVDLTADRMLK  301

Query  368  GGGS-----TREYSSAATQG---------------GEDGGNRITLSGLLNFTDGLWSCCG  487
               +     T+  SS    G               GE+ G R+TLSGLLNFTDGLWSCC 
Sbjct  302  SSNTSTTAKTKRSSSIKEMGSRIASSTCGNNNNNNGEESG-RVTLSGLLNFTDGLWSCCS  360

Query  488  SERIFVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeeg  667
             E+I VFTTNH + +DPAL+R GRMD+H+ +  C   A K+L KNY         E    
Sbjct  361  EEKIIVFTTNHRDSVDPALIRCGRMDVHVSLGTCGPHAFKVLAKNY------LGIESHHA  414

Query  668  ealrqlaeVIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAE  808
                  + +     +TPA + EVL+RNR N + A+ E+V  S M+A+
Sbjct  415  LFDVVESCIRAGGALTPAQIGEVLLRNRGNVDLAMKEVV--SAMQAK  459



>ref|NP_001051601.1| Os03g0802500 [Oryza sativa Japonica Group]
 gb|AAO72381.1| putative AAA-type ATPase [Oryza sativa Japonica Group]
 gb|ABF99403.1| ATPase 2, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13515.1| Os03g0802500 [Oryza sativa Japonica Group]
 dbj|BAG92114.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96889.1| unnamed protein product [Oryza sativa Japonica Group]
Length=520

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/251 (55%), Positives = 174/251 (69%), Gaps = 15/251 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP TFDTLAMDP KK+EI  DL  F NG+ +Y R G+AWKRGYLL+GPPGTGK
Sbjct  222  WSHVVFEHPKTFDTLAMDPAKKKEIMDDLDMFKNGKDYYARVGKAWKRGYLLHGPPGTGK  281

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN+L YDIYD+ELT VH+N++LRKL ++T+SKSIIVIEDIDCS++LT   +  
Sbjct  282  SAMIAAMANYLDYDIYDIELTSVHSNTDLRKLFIETTSKSIIVIEDIDCSLDLTGARKKK  341

Query  368  GGGSTREYSSAATQGG-------EDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVE  526
               +  +   +   G        +D  +++TLSGLLNF DGLWS CG ER+ VFTTNHV+
Sbjct  342  KEAADDDDGGSKDGGAPPKPDMKKDASSKVTLSGLLNFIDGLWSACGGERLIVFTTNHVK  401

Query  527  KLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAA  706
            KLDPAL+R GRMD HI MSYC F A K L K Y         + +       + E++   
Sbjct  402  KLDPALIRRGRMDKHIEMSYCCFEAFKFLAKTY--------LDVDSHRLFAAVDELLSEV  453

Query  707  EMTPADVSEVL  739
            +MTPADV+E L
Sbjct  454  DMTPADVAENL  464



>dbj|BAJ92113.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=514

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/269 (52%), Positives = 181/269 (67%), Gaps = 15/269 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF HPSTF+TLA+DP  K  + ADL  FA+G  FY+RTGR WKRGYLL+GPPG+GK
Sbjct  190  WSSVPFCHPSTFETLALDPELKARLLADLTAFADGREFYRRTGRPWKRGYLLHGPPGSGK  249

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT------  349
            SS+IAAMAN L YD++D+ELT V TN++LR LL++T+++S+IVIEDIDCS++LT      
Sbjct  250  SSLIAAMANHLRYDVFDLELTRVTTNADLRALLIQTTNRSLIVIEDIDCSLHLTGDRGLA  309

Query  350  ----NRERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTN  517
                ++ R          S     G ++   ++TLSGLLNFTDGLWSCCG ERI VFTTN
Sbjct  310  SMRRHKRRRTAASDDSSDSDDDVMGADNHRGKVTLSGLLNFTDGLWSCCGEERIIVFTTN  369

Query  518  HVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVI  697
            HV+ +DPALLR GRMD+H+ +  C   A++ L++ Y           ++         + 
Sbjct  370  HVDGIDPALLRPGRMDVHVRLGPCGVHAMRELVERY-----VGVSVGDQDMLDAAEGCIR  424

Query  698  DAAEMTPADVSEVLIRNRRNKERALWELV  784
            D AEMTPA+V EVL+RNR   E A+ EL 
Sbjct  425  DGAEMTPAEVGEVLLRNRDEPETAVTELA  453



>ref|XP_009791983.1| PREDICTED: ATPase family gene 2 protein-like [Nicotiana sylvestris]
Length=514

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/259 (53%), Positives = 180/259 (69%), Gaps = 13/259 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K ++  DL  F+ G+ FY + GRAWKRGYLLYGPPG+GK
Sbjct  180  WSSVPFRHPSTFETLALEPELKTQLMDDLTAFSEGKDFYHKIGRAWKRGYLLYGPPGSGK  239

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM-  364
            SS+IAAMANFL YD+YD+EL++V  NSELR LL++T+++SIIVIEDIDCS+NLT  +RM 
Sbjct  240  SSLIAAMANFLCYDVYDLELSKVSDNSELRALLIQTTNRSIIVIEDIDCSINLTG-DRMT  298

Query  365  ---NGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
               N     ++         ED G R+TLSGLLNFTDGLWSCCG E++ VFTTNH + +D
Sbjct  299  KTRNNHSMHKKNRHVIGDNAEDNG-RVTLSGLLNFTDGLWSCCGEEKVIVFTTNHKDNVD  357

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PAL+R GRMDMH+ +  C   A K+L+KNY          +         + +     +T
Sbjct  358  PALVRCGRMDMHVSLGTCGMHAFKVLVKNY-------LGLDSHALFDVVESCIRSGGTLT  410

Query  716  PADVSEVLIRNRRNKERAL  772
            PA + E+L+RNRR+ + A+
Sbjct  411  PAHIGEILLRNRRDADVAV  429



>ref|XP_009343451.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X1 
[Pyrus x bretschneideri]
Length=528

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/258 (54%), Positives = 180/258 (70%), Gaps = 21/258 (8%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+TF+T+A+DP KK+EI  DL  F+  + FY R G+AWKRGYLLYGPPGTGK
Sbjct  203  WSHIVFEHPATFETMALDPEKKKEIIEDLVTFSKSKDFYARIGKAWKRGYLLYGPPGTGK  262

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNR----  355
            S+MIAAMAN LGYDIYD+ELT V  N+ELRKLL++T+SKSIIVIEDIDCS++LT +    
Sbjct  263  STMIAAMANLLGYDIYDLELTAVKDNTELRKLLIETTSKSIIVIEDIDCSLDLTGQMKKR  322

Query  356  ---------ERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVF  508
                     E + GGG+ +E      +    G +++TLSGLLNF DGLWS CG ER+ VF
Sbjct  323  GAAEKGFLEEEVKGGGAWKERIKEPKEEVYGGSSKVTLSGLLNFIDGLWSACGGERLVVF  382

Query  509  TTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqla  688
            TTN+VEKLDPAL+R GRMD HI +SYC F   ++L KNY           E  E   ++ 
Sbjct  383  TTNYVEKLDPALIRRGRMDKHIALSYCTFDGFRVLAKNY--------LRIERHETFDEIE  434

Query  689  eVIDAAEMTPADVSEVLI  742
            +++   +MTPADV+E L+
Sbjct  435  KLMGVTKMTPADVAENLM  452



>ref|XP_010040090.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
Length=506

 Score =   280 bits (717),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/251 (55%), Positives = 174/251 (69%), Gaps = 14/251 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TFDTLAM+P KK +I  DL  F   + +Y R G+AWKRGYLLYGPPGTGK
Sbjct  196  WSHVVFEHPATFDTLAMEPSKKRQIMNDLLKFQQAKEYYARIGKAWKRGYLLYGPPGTGK  255

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT V  N+ELRKLL++TS+KSIIVIEDIDCS++LT + +  
Sbjct  256  STMIAAMANFLNYDVYDLELTTVKDNTELRKLLIETSAKSIIVIEDIDCSLDLTGQRKTK  315

Query  368  GGGSTREYSSA------ATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                  +   A         G E   +++TLSGLLNF DGLWS CG ERI VFTTN+VEK
Sbjct  316  KQEKDEDEEKADPVKRMVKGGNESKDSKVTLSGLLNFIDGLWSACGGERIIVFTTNYVEK  375

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI MSYC + + K+L++NY         + E       +  +++  +
Sbjct  376  LDPALIRRGRMDKHIEMSYCCYESFKVLVRNY--------LDVESHPLFATVRRLLEETK  427

Query  710  MTPADVSEVLI  742
            MTPADV+E L+
Sbjct  428  MTPADVAENLM  438



>ref|XP_004961038.1| PREDICTED: probable mitochondrial chaperone bcs1-like isoform 
X2 [Setaria italica]
Length=458

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/268 (53%), Positives = 190/268 (71%), Gaps = 18/268 (7%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W +V  +HPSTFDTLAMD   K+ +  DL+ F   + +Y+R GRAWKRGYLLYGPPGTGK
Sbjct  194  WTAVDLRHPSTFDTLAMDKKLKQSVMDDLERFVKRKDYYRRIGRAWKRGYLLYGPPGTGK  253

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS+IAAMAN+L +DIYD+ELTEV +NS+LR+LL+  S++SI+V+EDIDCS++L  RE   
Sbjct  254  SSLIAAMANYLKFDIYDLELTEVKSNSDLRRLLVGMSNRSILVVEDIDCSIDLRQREE--  311

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
              G  R  SS+    GE+  +++TLSGLLNF DGLWS  G ERI VFTTN+ E+LDPALL
Sbjct  312  --GEKRVRSSST---GEENDDKVTLSGLLNFVDGLWSTSGEERIIVFTTNYRERLDPALL  366

Query  548  RSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPADV  727
            R GRMDMHIHM YC   +++IL +NY           E      ++ ++I+   ++PA+V
Sbjct  367  RPGRMDMHIHMGYCTAESVRILARNY--------HSVENHAMYPEIEQLIEEVMVSPAEV  418

Query  728  SEVLIRNRRNKERALWELVEISRMRAER  811
            +EVL+RN  N +  L +L+E   ++A+R
Sbjct  419  AEVLMRN-ENSDAVLQDLLEF--LKAKR  443



>ref|XP_010450752.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Camelina 
sativa]
Length=470

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 158/207 (76%), Gaps = 7/207 (3%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W S+ F+HP++F+TLAMDP KKEEI +DL  F+NG+ +Y++ G+AWKRGYLLYGPPGTGK
Sbjct  194  WRSIAFEHPASFETLAMDPKKKEEIVSDLIAFSNGKEYYKKIGKAWKRGYLLYGPPGTGK  253

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MI+AMAN L Y IYD+ELT V  NSEL+KLL  TSSKSIIVIEDIDCS   T   R+ 
Sbjct  254  STMISAMANLLNYHIYDLELTAVKNNSELKKLLTATSSKSIIVIEDIDCSAEFT-ANRIK  312

Query  368  GGGSTREYSSAATQGGEDGG-NRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
               + RE       G ED   N +TLSGLLNF DG+WS CG ERI VFTTNH+EKLDPAL
Sbjct  313  KESNIRE-----RYGREDKDENSVTLSGLLNFIDGIWSACGQERIVVFTTNHLEKLDPAL  367

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNY  625
            +R GRMDMHI +SYC + A KIL KNY
Sbjct  368  IRRGRMDMHIELSYCTYEAFKILAKNY  394



>ref|XP_010033227.1| PREDICTED: mitochondrial respiratory chain complexes assembly 
protein rca1-like [Eucalyptus grandis]
Length=504

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/268 (53%), Positives = 182/268 (68%), Gaps = 16/268 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TFDTLAM+P KK +I  DL  F   + +Y R G+AWKRGYLLYGPPGTGK
Sbjct  195  WSHVVFEHPATFDTLAMEPSKKRQIMNDLLKFQQAKEYYARIGKAWKRGYLLYGPPGTGK  254

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT V  N+ELRKLL++TS+KSIIVIEDIDCS++LT + +  
Sbjct  255  STMIAAMANFLNYDVYDLELTTVKDNTELRKLLIETSAKSIIVIEDIDCSLDLTGQRKTK  314

Query  368  GGGSTREYSSA------ATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                  +   A         G E   +++TLSGLLNF DGLWS CG ERI VFTTN+VEK
Sbjct  315  KQEKDEDEEKADPVKRMVKGGDESKDSKVTLSGLLNFIDGLWSACGGERIIVFTTNYVEK  374

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI MSYC + + K+L++NY         + E       +  +++  +
Sbjct  375  LDPALIRRGRMDKHIEMSYCCYESFKVLVRNY--------LDVESHPLFATVRRLLEETK  426

Query  710  MTPADVSEVLI--RNRRNKERALWELVE  787
            MTPADV+E L+   +  ++E  L  L+E
Sbjct  427  MTPADVAENLMPKSDDEDEEACLEGLIE  454



>ref|XP_004229339.1| PREDICTED: putative cell division cycle ATPase [Solanum lycopersicum]
Length=512

 Score =   280 bits (717),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 180/257 (70%), Gaps = 11/257 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K ++  DL  F+ G+ FY   GRAWKRGYLLYGPPG+GK
Sbjct  180  WSSVPFRHPSTFETLALEPDLKTQLMDDLTAFSQGKEFYHNIGRAWKRGYLLYGPPGSGK  239

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS+IAAMANFL YD+YD+EL++V  NSELR LL++T+++SIIVIEDIDCS+NLT  +RM 
Sbjct  240  SSLIAAMANFLCYDVYDLELSKVSDNSELRALLIQTTNRSIIVIEDIDCSINLTG-DRMA  298

Query  368  GGGST--REYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPA  541
               S   +  +   +   ED G R+TLSGLLNFTDGLWSCCG E++ VFTTNH + +DPA
Sbjct  299  KMRSNHKKNRNVMMSDNAEDNG-RVTLSGLLNFTDGLWSCCGEEKVIVFTTNHKDNVDPA  357

Query  542  LLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPA  721
            L+R GRMDMH+ +  C   A K+L+KNY          +         + +     +TPA
Sbjct  358  LVRCGRMDMHVSLGTCGMHAFKVLVKNY-------LGLDSHVLFDVVESCIRSGGTLTPA  410

Query  722  DVSEVLIRNRRNKERAL  772
             + E+L+RNRR+ + A+
Sbjct  411  HIGEILLRNRRDADVAV  427



>ref|XP_009396944.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Musa acuminata 
subsp. malaccensis]
Length=480

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 177/256 (69%), Gaps = 26/256 (10%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HPSTFDTLAMDP KK E+  DL  F NG+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  198  WSHVVFEHPSTFDTLAMDPRKKRELMDDLIAFRNGKDYYTKIGKAWKRGYLLYGPPGTGK  257

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAA+ANFL YD+YD+ELT V  N+ELRKL ++T+SKSIIVIEDIDCS++LT + +  
Sbjct  258  STMIAAIANFLDYDVYDLELTSVKNNTELRKLFIETTSKSIIVIEDIDCSLDLTGKRK--  315

Query  368  GGGSTREYSSAATQGGEDGG-----------NRITLSGLLNFTDGLWSCCGSERIFVFTT  514
                 R  S    +GG+D             +++TLSGLLNF DGLWS CG ER+ +FTT
Sbjct  316  -----RTKSKKEDEGGDDKPKVPGEKEDKEESKVTLSGLLNFIDGLWSACGGERLIIFTT  370

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NHVEKLDPAL+R GRMD HI +SYC+F A  +L KNY         + +       +  +
Sbjct  371  NHVEKLDPALIRRGRMDKHIELSYCHFEAFMVLAKNY--------LDIDSHPLFDTIKGL  422

Query  695  IDAAEMTPADVSEVLI  742
            ++  +MTPADV+E L+
Sbjct  423  MEEVKMTPADVAENLM  438



>ref|XP_007149116.1| hypothetical protein PHAVU_005G042400g [Phaseolus vulgaris]
 gb|ESW21110.1| hypothetical protein PHAVU_005G042400g [Phaseolus vulgaris]
Length=518

 Score =   280 bits (717),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 182/263 (69%), Gaps = 11/263 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K +IK DL  FA+G+ FY R GRAWKRGYLL+GPPG+GK
Sbjct  184  WVSVPFRHPSTFETLALEPELKRQIKNDLTAFADGKEFYNRVGRAWKRGYLLHGPPGSGK  243

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNL----TNR  355
            SS+IAAMANFL YD+YD+ELT+V  NSELR LL++T+++SIIVIEDIDCSV+L    T +
Sbjct  244  SSLIAAMANFLCYDVYDLELTKVADNSELRSLLIQTTNRSIIVIEDIDCSVDLTADRTTK  303

Query  356  ERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
            +      S R+ S  A+    +   R+TLSGLLNFTDGLWSCCG ERI VFTTNH + +D
Sbjct  304  KTQAAKMSKRKKSQTASFTRCEESGRVTLSGLLNFTDGLWSCCGEERIVVFTTNHRDSVD  363

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PAL+R GRMD+H+ ++ C   A + L +NY          +           +     +T
Sbjct  364  PALVRCGRMDVHVSLNTCGVHAFRELARNY-------LGVDSHVLFEAVEGCIRSGGSLT  416

Query  716  PADVSEVLIRNRRNKERALWELV  784
            PA V E+L+RNR + + A+ E++
Sbjct  417  PAHVGEILLRNRGDADVAMREVL  439



>ref|XP_006369479.1| hypothetical protein POPTR_0001s23830g [Populus trichocarpa]
 gb|ERP66048.1| hypothetical protein POPTR_0001s23830g [Populus trichocarpa]
Length=563

 Score =   281 bits (720),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/279 (52%), Positives = 186/279 (67%), Gaps = 22/279 (8%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K+++  DLK FA+G  FY R GRAWKRGYLLYGPPG+GK
Sbjct  183  WVSVPFRHPSTFETLALEPHLKKQMMEDLKAFASGREFYHRVGRAWKRGYLLYGPPGSGK  242

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNL-------  346
            SS+IAAMAN+L YD+YD+ELT+V  NSELR LL++TS++SIIVIEDIDCS++L       
Sbjct  243  SSLIAAMANYLCYDVYDLELTKVTDNSELRALLIQTSNRSIIVIEDIDCSLDLTADRMMK  302

Query  347  ------TNRERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVF  508
                  T R+R +  G  ++  +   Q  E+ G R+TLSGLLNFTDGLWSCCG ERI VF
Sbjct  303  ATTATATRRKRSSSSGYNKDLGTGNDQLLEESG-RVTLSGLLNFTDGLWSCCGEERIIVF  361

Query  509  TTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqla  688
            TTNH E +DPAL+R GRMD+H+ +  C   A K L  NY          E         +
Sbjct  362  TTNHRENVDPALVRCGRMDVHVSLGTCGMHAFKALAMNY-------LGIEWHSSFDVVES  414

Query  689  eVIDAAEMTPADVSEVLIRNR-RNKERALWELVEISRMR  802
             +     +TPA + E+L+RNR  N + A+ E+V   + R
Sbjct  415  CIRSGGALTPAQIGEILLRNRGNNVDLAIKEVVSAMQAR  453



>ref|NP_189502.2| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 dbj|BAB02176.1| mitochondrial protein-like [Arabidopsis thaliana]
 gb|AEE77465.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=474

 Score =   279 bits (713),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/262 (53%), Positives = 180/262 (69%), Gaps = 11/262 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+TF+TLAMDP KKE+I  DL  F NG+ +Y++ G+AWKRGYLLYGPPGTGK
Sbjct  191  WRYIDFEHPATFETLAMDPKKKEQILNDLAAFNNGKDYYKKIGKAWKRGYLLYGPPGTGK  250

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L Y IYD+ELT +  NSELRK+L  TS+KSIIVIEDIDCS++LT + R  
Sbjct  251  STMIAAMANLLNYSIYDLELTAIQNNSELRKILTATSNKSIIVIEDIDCSLDLTGK-RKK  309

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
               +   +     Q  E+  + +TLSGLLNF DG+WS CG ERI VFTTNH+ KLDPAL+
Sbjct  310  KESNLMIWRKDGDQDNEENKSFVTLSGLLNFIDGIWSACGQERIIVFTTNHLAKLDPALI  369

Query  548  RSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPADV  727
            R GRMDMHI +SYC F A K L KNY         + +      ++  ++    + PADV
Sbjct  370  RRGRMDMHIELSYCTFEAFKTLAKNY--------LDLDSHPLFSKIESLMKETNIAPADV  421

Query  728  SEVLIRNRR--NKERALWELVE  787
            +E L++  R  + + +L +L+E
Sbjct  422  AENLMKKNRETDADGSLNDLIE  443



>ref|XP_008670935.1| PREDICTED: uncharacterized protein LOC103648227 [Zea mays]
 tpg|DAA42482.1| TPA: hypothetical protein ZEAMMB73_227679 [Zea mays]
Length=531

 Score =   281 bits (718),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 173/255 (68%), Gaps = 23/255 (9%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F HP+TFDTLAMD  KK +I  DL  F N   FY+R G+ WKRGYLLYGPPGTGK
Sbjct  226  WSYIDFDHPTTFDTLAMDRAKKRDIIHDLDTFRNSREFYRRAGKPWKRGYLLYGPPGTGK  285

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTN-----  352
            S+M+AAMAN+L YDIYD+ELT VHTNS+LRKLL+ T+SKSIIVIEDIDC++++T      
Sbjct  286  STMVAAMANYLDYDIYDVELTVVHTNSDLRKLLIDTTSKSIIVIEDIDCTLDVTGDRAGR  345

Query  353  -RERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
             R R NGGG   +             + +TLSGLLNF DGLWS C  ERI VFTTNHVE+
Sbjct  346  PRRRANGGGDADDRPR----------DSVTLSGLLNFIDGLWSACTGERIVVFTTNHVER  395

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMDMHI MSYC F A + L KNY          ++  +    + EV+    
Sbjct  396  LDPALIRRGRMDMHIEMSYCRFEAFQTLAKNY-------LDIDDHDDLFAAVGEVLREEN  448

Query  710  MTPADVSEVLIRNRR  754
            +TPADV+E L+  RR
Sbjct  449  LTPADVAECLMAARR  463



>emb|CAH10203.1| Cell Division Protein AAA ATPase family [Triticum aestivum]
 emb|CAJ15424.1| unnamed protein product [Triticum aestivum]
 gb|ACJ22519.1| unknown [Triticum aestivum]
Length=496

 Score =   280 bits (715),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 137/258 (53%), Positives = 180/258 (70%), Gaps = 13/258 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W+ V F+HP+TFDTLAMD  +KE I  DL  F +G+ +Y + G+ WKRGYLLYGPPGTGK
Sbjct  197  WDHVKFEHPATFDTLAMDTDQKEAIMDDLIAFKDGKEYYTKVGKPWKRGYLLYGPPGTGK  256

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIA MANFL YD+YD+ELT V  N+ELRKL ++ +SKSIIVIEDIDCS++LT + R +
Sbjct  257  STMIATMANFLDYDVYDLELTSVKNNTELRKLFIEMTSKSIIVIEDIDCSIDLTGKRRKD  316

Query  368  GGGST-----REYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
               S+      EY    T+  +D  +++TLSGLLNF DGLWS  G ERIF+FTTNH EKL
Sbjct  317  KKASSNKDSDNEYEPDPTEPRKDDESKVTLSGLLNFIDGLWSASGGERIFIFTTNHKEKL  376

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPAL+R GRMD HI MSYC F   K+L KNY         +  E     ++ ++++  +M
Sbjct  377  DPALIRRGRMDKHIEMSYCRFEGFKVLAKNY--------LDIVEHVLFGEIRQLLEETDM  428

Query  713  TPADVSEVLIRNRRNKER  766
            +PADV+E L+   + K++
Sbjct  429  SPADVAENLMPMSKKKKK  446



>emb|CDP07666.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   281 bits (718),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/279 (49%), Positives = 190/279 (68%), Gaps = 22/279 (8%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K+++  DLK F+ G+ FYQ+ GRAWKRGYLL+GPPG+GK
Sbjct  180  WSSVPFRHPSTFETLALEPELKDQLMDDLKAFSEGKEFYQKIGRAWKRGYLLHGPPGSGK  239

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTN-----  352
            SS+IAAMANFL YD+YD+EL++V  NSELR LL++T+++SIIVIEDIDCS++LT      
Sbjct  240  SSLIAAMANFLCYDVYDLELSKVSDNSELRALLIQTTNRSIIVIEDIDCSIDLTGDRLAK  299

Query  353  -------RERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFT  511
                        G  S  ++   +  GG D G R+TLSGLLNFTDGLWSCCG E++ VFT
Sbjct  300  TRGESSIHNHKKGPPSRHDHRGCSDSGGGDDG-RVTLSGLLNFTDGLWSCCGEEKVIVFT  358

Query  512  TNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlae  691
            TNH + +DPAL+R GRMD+H+ +  C   A K L+K+Y          +         + 
Sbjct  359  TNHRDNVDPALVRCGRMDVHVSLGTCGMHAFKALVKSY-------LGVDSNASFDVAESC  411

Query  692  VIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMRAE  808
            +     +TPA ++E+L+RNRR+ + A+  +  IS M+A+
Sbjct  412  IRSGGALTPAQIAEILLRNRRDADVAVKAV--ISAMQAK  448



>ref|XP_002313465.2| hypothetical protein POPTR_0009s02930g [Populus trichocarpa]
 gb|EEE87420.2| hypothetical protein POPTR_0009s02930g [Populus trichocarpa]
Length=505

 Score =   280 bits (716),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 144/279 (52%), Positives = 187/279 (67%), Gaps = 22/279 (8%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K +I  DLK F++G  +Y R GRAWKRGYLLYGPPG+GK
Sbjct  183  WVSVPFRHPSTFETLALEPQLKRQIMEDLKAFSSGREYYHRVGRAWKRGYLLYGPPGSGK  242

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNL-------  346
            SS+IAAMAN+L YD+YD+ELT+V  NS+LR LL++TS++SIIVIEDIDCS++L       
Sbjct  243  SSLIAAMANYLCYDVYDLELTKVTDNSDLRALLIQTSNRSIIVIEDIDCSLDLTADRMLK  302

Query  347  ------TNRERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVF  508
                  T R+R +  G  ++  S   Q  E+ G R+TLSGLLNFTDGLWSCCG ERI VF
Sbjct  303  ATTATATRRKRSSSSGYNKDPGSGNYQLLEESG-RVTLSGLLNFTDGLWSCCGEERIIVF  361

Query  509  TTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqla  688
            TTNH +K+DPAL+R GRMD+H+ +  C   A K L  NY          EE        +
Sbjct  362  TTNHRDKVDPALVRCGRMDVHVSLGPCGMHAFKALAMNY-------LGIEEHSLFDVVES  414

Query  689  eVIDAAEMTPADVSEVLIRNR-RNKERALWELVEISRMR  802
             +     +TPA + E+L+RNR  N + A+ E+V   + R
Sbjct  415  CIRSGGALTPAQIGEILLRNRGSNADLAMTEVVSAMQTR  453



>ref|XP_007218964.1| hypothetical protein PRUPE_ppa003630mg [Prunus persica]
 gb|EMJ20163.1| hypothetical protein PRUPE_ppa003630mg [Prunus persica]
Length=560

 Score =   281 bits (720),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/277 (51%), Positives = 187/277 (68%), Gaps = 19/277 (7%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTFDTLA++P  K ++  DLK FANG+ FY R GRAWKRGY LYGPPG+GK
Sbjct  191  WVSVPFRHPSTFDTLALEPQLKSQLTGDLKAFANGKDFYHRVGRAWKRGYFLYGPPGSGK  250

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT-NRERM  364
            SS+IAAMAN+L YD+YD+ELT+V  NSELR LL++T+++SI+VIEDIDCS++LT +R+++
Sbjct  251  SSLIAAMANYLCYDVYDLELTKVSDNSELRALLIQTTNRSIVVIEDIDCSLDLTADRQQL  310

Query  365  NGGGSTREYSSAA-----TQGGED------GGNRITLSGLLNFTDGLWSCCGSERIFVFT  511
                +T+   S A      Q  ED         R+TLSGLLNFTDGLWSCCG ERI +FT
Sbjct  311  RLSMNTKSTRSKARVRSRQQKQEDEDCDEQNAGRVTLSGLLNFTDGLWSCCGEERIIIFT  370

Query  512  TNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlae  691
            TNH + +DPALLR GRMD+H+++  C   A + + KNY          +           
Sbjct  371  TNHRDNVDPALLRCGRMDVHVNLGNCGPHAFRAMAKNY-------LGLDSHPLFEAVDRC  423

Query  692  VIDAAEMTPADVSEVLIRNRRNKERALWELVEISRMR  802
            V     +TPA V E+L+RNR + + A+ ++V   + R
Sbjct  424  VRLGGALTPAQVGEILLRNRGDADVAMKDVVSAMQAR  460



>ref|XP_010236721.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Brachypodium distachyon]
Length=523

 Score =   280 bits (717),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 180/264 (68%), Gaps = 18/264 (7%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F HP+TFDTLAMDP KK  I  DL DF N   +Y R G+AWKRGYLL+GPPGTGK
Sbjct  221  WSYIDFDHPTTFDTLAMDPAKKRAIMDDLDDFRNNGDYYHRIGKAWKRGYLLHGPPGTGK  280

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT-NRERM  364
            ++MIAAMAN+LGYDIYD+ELT +H+N++LRKL ++T+ +SIIVIEDIDCS++LT +R R 
Sbjct  281  TTMIAAMANYLGYDIYDIELTTMHSNNDLRKLFVETTGRSIIVIEDIDCSLDLTGSRARA  340

Query  365  NGG---------GSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTN  517
              G         G    Y    T+  ++ GN +TLSGLLNF DGLWS    ERI VFTTN
Sbjct  341  TAGTTFQGWQGDGDLDAYGMRNTKTRDERGNIMTLSGLLNFIDGLWSVHSGERIIVFTTN  400

Query  518  HVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVI  697
            H++KLDPAL+R GRMDMHI MSYC F A K L +NY           +       + E++
Sbjct  401  HLDKLDPALIRRGRMDMHIEMSYCEFEAFKKLAENY--------LGVDAHPLFDAVRELL  452

Query  698  DAAEMTPADVSEVLIRNRRNKERA  769
             A E+TPADV+E LI ++R+   A
Sbjct  453  RAVEITPADVAECLITSKRSARDA  476



>ref|XP_006600663.1| PREDICTED: probable mitochondrial chaperone bcs1-like [Glycine 
max]
 gb|KHN18510.1| Putative mitochondrial chaperone BCS1-B [Glycine soja]
Length=511

 Score =   280 bits (716),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 137/255 (54%), Positives = 176/255 (69%), Gaps = 18/255 (7%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+TFDT+AM+P KK+EI  DL  F+  + FY R G+AWKRGYLLYGPPGTGK
Sbjct  196  WSHIVFEHPATFDTMAMEPEKKKEIIEDLVTFSKSKDFYARIGKAWKRGYLLYGPPGTGK  255

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L YD+YD+ELT V  N+ELRKLL++T+SKSIIVIEDIDCS++LT + +  
Sbjct  256  STMIAAMANLLAYDVYDLELTAVKDNTELRKLLIETTSKSIIVIEDIDCSLDLTGQRKKK  315

Query  368  GGGSTRE----------YSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTN  517
            G  S+ +             A  +GG  G +++TLSGLLNF DG+WS CG ER+ VFTTN
Sbjct  316  GDKSSWDEDEAEKDVIGRKEAKEEGGSSGCSKVTLSGLLNFIDGIWSACGGERLIVFTTN  375

Query  518  HVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVI  697
            +VEKLDPAL+R GRMD HI +SYC F   K+L  NY         + E       +  +I
Sbjct  376  YVEKLDPALIRRGRMDKHIQLSYCTFDGFKVLANNY--------LKLETHPLFDTIESLI  427

Query  698  DAAEMTPADVSEVLI  742
               ++TPADV+E L+
Sbjct  428  GEVKITPADVAENLM  442



>ref|NP_198817.1| AAA-ATPase 1 [Arabidopsis thaliana]
 dbj|BAB10225.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED94501.1| AAA-ATPase 1 [Arabidopsis thaliana]
Length=514

 Score =   280 bits (716),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 178/252 (71%), Gaps = 9/252 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TFDTLAM+  KKEEIK DL  F+N + +Y++ G+AWKRGYLL+GPPGTGK
Sbjct  197  WSHVTFEHPATFDTLAMEYKKKEEIKNDLIKFSNSKDYYKKIGKAWKRGYLLFGPPGTGK  256

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L YD+YD+ELT V  N+ELR+LL++TS KSIIVIEDIDCS++LT + +  
Sbjct  257  STMIAAMANLLEYDVYDLELTTVKDNTELRRLLIETSGKSIIVIEDIDCSLDLTGQRKQK  316

Query  368  GGGSTREYSSAATQ------GGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                  E  ++  +       GE+ G+++TLSGLLNF DGLWS CG ERI VFTTN ++K
Sbjct  317  KDEEEDEDETSPIEKQMKKDQGENKGSKVTLSGLLNFIDGLWSACGGERIIVFTTNFIDK  376

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI MSYC F A K+L  NYL  +   + E  +          ++  +
Sbjct  377  LDPALIRKGRMDKHIEMSYCGFEAFKVLANNYLDAKEEDDNELFDEIKRLLE---VEEIK  433

Query  710  MTPADVSEVLIR  745
            MTPADV E L++
Sbjct  434  MTPADVGENLLK  445



>ref|XP_008461752.1| PREDICTED: mitochondrial chaperone BCS1-like [Cucumis melo]
Length=503

 Score =   280 bits (715),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 140/266 (53%), Positives = 183/266 (69%), Gaps = 16/266 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++   K++I  DLK F+ G  FY R GRAWKRGYLLYGPPG+GK
Sbjct  181  WVSVPFRHPSTFETLALETELKKQIMDDLKAFSAGREFYSRVGRAWKRGYLLYGPPGSGK  240

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS+IAAMANFL YD+YD+ELT+V  NSELR LL++T+++S+IVIEDIDCSV+LT      
Sbjct  241  SSLIAAMANFLCYDVYDLELTKVSDNSELRSLLIQTTNRSVIVIEDIDCSVDLT------  294

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
               + R    AA +  E+   R+TLSGLLNFTDGLWSCCG ERI VFTTN+ EK+D AL+
Sbjct  295  ---ADRVSKVAAREDHEEEIGRVTLSGLLNFTDGLWSCCGEERIVVFTTNYREKIDSALI  351

Query  548  RSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPADV  727
            R GRMD+H+ +  C   A + L+KNY        + E         + +     +TPA +
Sbjct  352  RCGRMDVHVSLGTCGPAAFRTLVKNY-------LEIESHPLFDVVDSCIRSGGGLTPAQI  404

Query  728  SEVLIRNRRNKERALWELVEISRMRA  805
             E+L+RNRR+ + A+ E+V   + R 
Sbjct  405  GEILLRNRRDADVAMREVVAALQARV  430



>ref|XP_010917250.1| PREDICTED: uncharacterized protein LOC105041886 [Elaeis guineensis]
Length=535

 Score =   280 bits (717),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 143/276 (52%), Positives = 184/276 (67%), Gaps = 24/276 (9%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HP+TF TLA+DP  K  + ADL  FA G  FY+RTGR WKRGYLL+GPPG+GK
Sbjct  192  WSSVPFRHPATFATLALDPALKSRLLADLSAFAAGRDFYRRTGRPWKRGYLLHGPPGSGK  251

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            SS+IAAMAN L YD+YD+ELT V  NS+LR LL++T+++S+IVIEDIDCS++LT   R +
Sbjct  252  SSLIAAMANHLRYDVYDLELTRVSHNSDLRSLLIQTTNRSLIVIEDIDCSLDLTGDRRRS  311

Query  368  GGGSTR----------------EYSSAATQGG-EDGGNRITLSGLLNFTDGLWSCCGSER  496
               +T                 E S +   GG +D   R+TLSGLLNFTDGLWSCCG ER
Sbjct  312  TKSTTATSDARNRNKRQRIRCYEDSDSINDGGADDSDGRVTLSGLLNFTDGLWSCCGEER  371

Query  497  IFVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegeal  676
            I VFTTN+ + +DPALLR+GRMD+H+ +  C   A++ L++ Y           E     
Sbjct  372  IIVFTTNYADGVDPALLRAGRMDVHVRLGACGAHAVRELVERY-------VGVAEHELLG  424

Query  677  rqlaeVIDAAEMTPADVSEVLIRNRRNKERALWELV  784
               + +   AEMTPA+V EVL+RNR   E+A+ ELV
Sbjct  425  VAESCIRAGAEMTPAEVGEVLLRNRDEPEKAMRELV  460



>ref|XP_010029271.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
 gb|KCW56153.1| hypothetical protein EUGRSUZ_I01907 [Eucalyptus grandis]
Length=496

 Score =   279 bits (714),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 181/269 (67%), Gaps = 17/269 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+ F TLAMDP +K+EI  DL  F+  E FY R GRAWKRGYLL+GPPGTGK
Sbjct  200  WTHVVFEHPANFKTLAMDPSEKQEIINDLITFSKNEEFYARIGRAWKRGYLLFGPPGTGK  259

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNR----  355
            S+MIAAMAN L YDIYD+ELT V  N+ LR+LL++TSSKSIIVIEDIDCS++LT +    
Sbjct  260  STMIAAMANLLNYDIYDLELTAVKDNTSLRRLLIETSSKSIIVIEDIDCSLDLTGQRKKA  319

Query  356  ---ERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVE  526
               E +  G ++ +   A      +  +R+TLSGLLNF DGLWS CG ER+ VFTTNH+E
Sbjct  320  AKVEEVKDGEASNQAKRAEKDPDGEKASRVTLSGLLNFIDGLWSSCGGERLLVFTTNHIE  379

Query  527  KLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAA  706
            KLDPAL+R GRMD H+ +SYC F A K+L KNY         E +       + ++++  
Sbjct  380  KLDPALIRKGRMDKHVKLSYCRFEAFKVLAKNY--------LEIDTHPLFDHIGKLLNEV  431

Query  707  EMTPADVSEVLI--RNRRNKERALWELVE  787
            ++TPADV+E L+      N E  L  LVE
Sbjct  432  DLTPADVAEHLMPKSASNNVEVCLESLVE  460



>dbj|BAK01905.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=518

 Score =   280 bits (715),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 137/271 (51%), Positives = 183/271 (68%), Gaps = 18/271 (7%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  +PF+HP+TFDTLAMDP +KE I  DL  F   + +Y + G+AWKRGYLLYGPPGTGK
Sbjct  199  WSHIPFEHPATFDTLAMDPKQKEAIIDDLMAFQKSKEYYAKVGKAWKRGYLLYGPPGTGK  258

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT +  N+ELRKL ++T+ KSIIVIEDIDCS++LT + R  
Sbjct  259  STMIAAMANFLDYDVYDLELTAIKNNTELRKLFIETTGKSIIVIEDIDCSLDLTGKRRKE  318

Query  368  GGGSTREYSSAATQGG------EDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
               +  + S    +        +D   ++TLSGLLNF DGLWS CG ERI +FTTNH EK
Sbjct  319  KKAAGDKDSDDNDKAKLPMEPEKDDETKVTLSGLLNFIDGLWSACGGERIIIFTTNHKEK  378

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI MSYC F + K+L KNY         +        ++ ++++  +
Sbjct  379  LDPALIRRGRMDKHIEMSYCRFESFKVLAKNY--------LDIVGHGLFSEIQKLLEETD  430

Query  710  MTPADVSEVLI----RNRRNKERALWELVEI  790
            M+PADV+E L+    + +R+ +  L  L+E+
Sbjct  431  MSPADVAENLMPMSKKKKRDPDVCLAGLIEV  461



>ref|XP_008354934.1| PREDICTED: uncharacterized protein LOC103418605 [Malus domestica]
Length=556

 Score =   281 bits (718),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 181/269 (67%), Gaps = 17/269 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA +P  K ++  DL  FA G+ FY R GRAWKRGYLLYGPPG+GK
Sbjct  192  WVSVPFRHPSTFETLAXEPQLKNQLTGDLTAFAEGKEFYHRVGRAWKRGYLLYGPPGSGK  251

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT---NRE  358
            SS+IAAMAN+L YD+YD+ELT+V  NSELR LL++T+++SI+VIEDIDCS++LT    ++
Sbjct  252  SSLIAAMANYLCYDVYDLELTKVSDNSELRALLIQTTNRSIVVIEDIDCSLDLTADRQQK  311

Query  359  RMNGGGSTREYSSAATQGG-------EDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTN  517
             ++   S     S+  Q         ++GG R+TLSGLLNFTDGLWSCCG ERI VFTTN
Sbjct  312  MISNSTSKARLRSSRMQAQQKQDNDEQNGGGRVTLSGLLNFTDGLWSCCGDERIIVFTTN  371

Query  518  HVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVI  697
            H + +DPALLR GRMD+H+ +  C   A + L KNY          +           V 
Sbjct  372  HRDNVDPALLRCGRMDVHVSLGTCGPLAFRQLAKNY-------LGLDAHPLFEAADGCVR  424

Query  698  DAAEMTPADVSEVLIRNRRNKERALWELV  784
                +TPA V E+L+RNR N + A+ E+V
Sbjct  425  SGGVLTPAQVGEILLRNRGNADVAMKEVV  453



>ref|XP_006602892.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Glycine 
max]
 gb|KHN20483.1| Putative mitochondrial chaperone BCS1-B [Glycine soja]
Length=500

 Score =   279 bits (714),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 136/248 (55%), Positives = 178/248 (72%), Gaps = 11/248 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+TF+TLAMD  KKEEI  DL  F NG+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  197  WSHIVFEHPATFETLAMDHRKKEEIINDLVKFRNGKDYYAKIGKAWKRGYLLYGPPGTGK  256

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANF+ YD+YD+ELT V  N+ELRKLL++TSSK+IIV+EDIDCS++LT +  M 
Sbjct  257  STMIAAMANFMNYDVYDLELTAVKDNTELRKLLIETSSKAIIVVEDIDCSLDLTGQRNMR  316

Query  368  GGGSTREYSSAATQGGEDGGN---RITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
                  E     ++  E+ GN   ++TLSGLLNF DG+WS CG ERI +FTTN V+KLDP
Sbjct  317  RERGEEEEPKDPSKKDEEEGNKNSKVTLSGLLNFIDGIWSACGGERIIIFTTNFVDKLDP  376

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTP  718
            AL+R+GRMD HI +SYC F A K+L KNY         + +      ++A +++   +TP
Sbjct  377  ALIRTGRMDKHIELSYCRFEAFKVLAKNY--------LDVDSHNLFARIANLLEVTNVTP  428

Query  719  ADVSEVLI  742
            ADV+E L+
Sbjct  429  ADVAENLM  436



>ref|XP_006603849.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like isoform 
X2 [Glycine max]
Length=448

 Score =   277 bits (709),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 157/209 (75%), Gaps = 3/209 (1%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TF TLAMDP +KE I  DL  F+    FY R GRAWKRGYLLYGPPGTGK
Sbjct  155  WSHVVFEHPATFQTLAMDPKEKEMIIDDLITFSKAGEFYARIGRAWKRGYLLYGPPGTGK  214

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFLGYD+YD+ELT V  N+ELRKLL++TSSKSIIVIEDIDCS++LT + R  
Sbjct  215  STMIAAMANFLGYDLYDLELTAVKDNTELRKLLIETSSKSIIVIEDIDCSLDLTGQRRKK  274

Query  368  GGGSTREYSSAATQGGED---GGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
                  +      QG ++     +++TLSGLLNF DGLWS CG ER+ VFTTN+VEKLDP
Sbjct  275  KEEVEEKDQRQKQQGMQEREVKSSQVTLSGLLNFIDGLWSACGGERLIVFTTNYVEKLDP  334

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNY  625
            AL+R GRMD HI +SYC + A K+L +NY
Sbjct  335  ALVRKGRMDKHIELSYCGYEAFKLLARNY  363



>ref|XP_003525061.1| PREDICTED: probable mitochondrial chaperone bcs1-like [Glycine 
max]
Length=507

 Score =   279 bits (714),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 176/254 (69%), Gaps = 19/254 (7%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+TFDT+AMDP KK+EI  DL  F+  + FY R G+AWKRGYLLYGPPGTGK
Sbjct  196  WSHIVFEHPATFDTMAMDPEKKQEIIEDLDTFSKSKDFYARIGKAWKRGYLLYGPPGTGK  255

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L YD+YD+ELT V  N+ELRKLL++T+SKSIIVIEDIDCS++LT + +  
Sbjct  256  STMIAAMANLLAYDVYDLELTAVKDNTELRKLLIETTSKSIIVIEDIDCSLDLTGQRKKK  315

Query  368  GGGSTREYSS---------AATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNH  520
            G  S  +  +         A  +GG   G+++TLSGLLNF DG+WS CG ER+ VFTTN+
Sbjct  316  GDKSPSDDEADKDVVGRKEAKEEGG--SGSKVTLSGLLNFIDGIWSACGGERLIVFTTNY  373

Query  521  VEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVID  700
            VEKLDPAL+R GRMD HI +SYC F   K+L  NY         + E       +  +I 
Sbjct  374  VEKLDPALIRRGRMDKHIQLSYCTFDGFKVLANNY--------LKLEAHPLFDTIERLIG  425

Query  701  AAEMTPADVSEVLI  742
              ++TPADV+E L+
Sbjct  426  EVKITPADVAENLM  439



>ref|XP_009594242.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Nicotiana 
tomentosiformis]
Length=499

 Score =   279 bits (713),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 163/220 (74%), Gaps = 19/220 (9%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+TFDTLAMDP KKEEI  DL  F+ G+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  195  WRDINFEHPATFDTLAMDPKKKEEIVIDLIAFSKGKDYYSKVGKAWKRGYLLYGPPGTGK  254

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT------  349
            S+MIAA+ANFL YDIYD+ELT V  NS L+KLLM+T+SKSIIVIEDIDCS++LT      
Sbjct  255  STMIAAIANFLNYDIYDLELTSVKDNSGLKKLLMETTSKSIIVIEDIDCSIDLTGKRKKK  314

Query  350  --------NRERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFV  505
                    N ++ +   S++E +S   +      +++TLSGLLNF DG+WS CG ERI +
Sbjct  315  KKKSEETVNEDQEDDSDSSKEKASENKE-----TSKLTLSGLLNFIDGIWSACGQERIII  369

Query  506  FTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNY  625
            FTTNH +KLDPAL+R GRMDMHI MSYC + A K+L KNY
Sbjct  370  FTTNHKDKLDPALIRRGRMDMHIEMSYCKYEAFKVLAKNY  409



>ref|XP_010042533.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Eucalyptus grandis]
Length=518

 Score =   279 bits (714),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 142/251 (57%), Positives = 173/251 (69%), Gaps = 14/251 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V FKHPSTFDTLAM+P KK+EI  DL  F   + +Y+R G+AWKRGYLLYGPPGTGK
Sbjct  196  WSHVLFKHPSTFDTLAMEPSKKKEIMNDLLRFQRAKEYYERIGKAWKRGYLLYGPPGTGK  255

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT V  N+ELRKLL+ TS KSIIVIEDIDCS++LT + +  
Sbjct  256  STMIAAMANFLNYDVYDLELTTVKDNTELRKLLIDTSEKSIIVIEDIDCSLDLTGQRKTK  315

Query  368  GGGSTREYSSA-----ATQGGEDGG-NRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                  +   A       +G E+   +++TLSGLLNF DGLWS CG ERI VFTTN VEK
Sbjct  316  KQEKEDDEEKADPVKKMMKGEEESKESKVTLSGLLNFIDGLWSACGGERIIVFTTNFVEK  375

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI MSYC F + K+L +NY           E      ++  ++   E
Sbjct  376  LDPALIRRGRMDKHIKMSYCCFESFKVLARNY--------LGVESHPLFARVRLLLKETE  427

Query  710  MTPADVSEVLI  742
            MTPADV+E L+
Sbjct  428  MTPADVAENLM  438



>ref|XP_009617194.1| PREDICTED: ATPase family gene 2 protein-like [Nicotiana tomentosiformis]
Length=514

 Score =   279 bits (714),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 135/259 (52%), Positives = 180/259 (69%), Gaps = 13/259 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA++P  K ++  DL  F+ G+ FY + GRAWKRGYLLYGPPG+GK
Sbjct  180  WSSVPFRHPSTFETLALEPELKTQLMDDLTAFSEGKEFYHKIGRAWKRGYLLYGPPGSGK  239

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERM-  364
            SS+IAAMANFL YD+YD+EL++V  NSELR LL++T+++SIIVIEDIDCS+NLT  +RM 
Sbjct  240  SSLIAAMANFLCYDVYDLELSKVSDNSELRALLIQTTNRSIIVIEDIDCSINLTG-DRMT  298

Query  365  ---NGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
               N     ++         E+ G R+TLSGLLNFTDGLWSCCG E++ VFTTNH + +D
Sbjct  299  KTRNNHSMHKKNRHVIGDNAENNG-RVTLSGLLNFTDGLWSCCGEEKVIVFTTNHKDNVD  357

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PAL+R GRMDMH+ +  C   A K+L+KNY          +         + +     +T
Sbjct  358  PALVRCGRMDMHVSLGTCGMHAFKVLVKNY-------LGLDSHALFDVVESCIRSGGTLT  410

Query  716  PADVSEVLIRNRRNKERAL  772
            PA + E+L+RNRR+ + A+
Sbjct  411  PAHIGEILLRNRRDADVAV  429



>ref|XP_010906692.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Elaeis guineensis]
Length=479

 Score =   278 bits (711),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 134/250 (54%), Positives = 178/250 (71%), Gaps = 12/250 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  VPF+HP+TFDTLAM+P KK++I  DL  F   + +Y R G+ WKRGYLLYGPPGTGK
Sbjct  195  WSHVPFEHPATFDTLAMEPDKKQDIIQDLLAFRESKEYYARIGKPWKRGYLLYGPPGTGK  254

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MI+AMAN L YD+YD+ELT V  N+ LRKLL++T+SKSIIVIEDIDCS++L+ + +  
Sbjct  255  STMISAMANLLDYDVYDLELTAVKDNTALRKLLIETTSKSIIVIEDIDCSLDLSGKRKSE  314

Query  368  G---GGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
                GGS  +   A  +  ++ GN++TLSGLLNF DGLWS CG ER+ VFTTNHV+KLDP
Sbjct  315  APSEGGSEEDKKKAVMKEDKE-GNKVTLSGLLNFIDGLWSACGGERLIVFTTNHVDKLDP  373

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTP  718
            AL+R GRMD HI +SYC+F   ++L +NY            E +    +  +++  ++TP
Sbjct  374  ALIRRGRMDKHIELSYCSFEGFQVLARNY--------LGVGEHQLFESIRRLMEEKQITP  425

Query  719  ADVSEVLIRN  748
            ADV+E L+R 
Sbjct  426  ADVAENLMRK  435



>ref|XP_010272180.1| PREDICTED: peroxisomal biogenesis factor 6 [Nelumbo nucifera]
Length=573

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 178/249 (71%), Gaps = 12/249 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TF TLAMDP KK+EI  DL  F  G+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  194  WSHVVFEHPATFQTLAMDPDKKQEIIDDLSTFRKGKEYYAKIGKAWKRGYLLYGPPGTGK  253

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L YD+YD+ELT +  N+ELRKLL++TSS+SIIVIEDIDCS++LT + +  
Sbjct  254  STMIAAMANHLDYDVYDVELTTLKNNTELRKLLIETSSRSIIVIEDIDCSLDLTGQRKKE  313

Query  368  GGGSTREYSS----AATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
                  +  +    AA    +D G+++TLSGLLNF DGLWS CGSER+ VFTTNH+EKLD
Sbjct  314  KKEEEEDKEAHPVKAARDQAKDEGSKVTLSGLLNFIDGLWSACGSERLVVFTTNHIEKLD  373

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PAL+R GRMD HI +SYC F A K+L KNY           +  E   ++  +++  ++T
Sbjct  374  PALIRRGRMDKHIELSYCTFEAFKVLAKNY--------LNLDSHELFEKIGRLMEETKIT  425

Query  716  PADVSEVLI  742
            PADV+E L+
Sbjct  426  PADVAENLM  434



>ref|NP_001148126.1| ATPase 3 [Zea mays]
 gb|ACG29825.1| ATPase 3 [Zea mays]
Length=493

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 178/247 (72%), Gaps = 13/247 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  VPF+HPSTFDTLAMDP  KE +  DL+ F   + +Y + G+AWKRGYLLYGPPGTGK
Sbjct  195  WSHVPFEHPSTFDTLAMDPEDKEAVVDDLEAFREAKDYYTKVGKAWKRGYLLYGPPGTGK  254

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L YD+YD+ELT V+ N++LRKL ++T+ KSIIV+EDIDCSV+LT + +  
Sbjct  255  STMIAAMANLLDYDVYDLELTAVNNNTDLRKLFIETTGKSIIVVEDIDCSVDLTGKRK--  312

Query  368  GGGSTREYSSAAT---QGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
               S RE         +  +D G++ITLSG+LNF DGLWS CG ERI +FTTNH +KL+P
Sbjct  313  DKKSEREADDKPKLPMEPDKDEGSKITLSGMLNFIDGLWSACGGERIIIFTTNHKDKLEP  372

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTP  718
            AL+R GRMD HI MSYC FPA K+L KNY         + EE E   Q+ ++++  +M+P
Sbjct  373  ALIRRGRMDRHIEMSYCRFPAFKVLAKNY--------LDVEEHELFDQIGQLLEETDMSP  424

Query  719  ADVSEVL  739
            ADV+E L
Sbjct  425  ADVAENL  431



>gb|AAV49983.1| ATPase 2 [Hordeum vulgare subsp. vulgare]
Length=518

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/271 (51%), Positives = 182/271 (67%), Gaps = 18/271 (7%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  +PF+HP+TFDTLAMDP +KE I  DL  F   + +Y + G+AWKRGYLLYGPPGTGK
Sbjct  199  WSHIPFEHPATFDTLAMDPKQKEAIIDDLMAFQKSKEYYAKVGKAWKRGYLLYGPPGTGK  258

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT +  N+ELRKL ++T+ KSIIVIEDIDCS++LT + R  
Sbjct  259  STMIAAMANFLDYDVYDLELTAIKNNTELRKLFIETTGKSIIVIEDIDCSLDLTGKRRKE  318

Query  368  GGGSTREYSSAATQGG------EDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
               +  + S    +        +D   ++TLSGLLNF DGLWS CG ERI +FTTNH EK
Sbjct  319  KKAAGDKDSDDNDKAKLPMEPEKDDETKVTLSGLLNFIDGLWSACGGERIIIFTTNHKEK  378

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI MSYC F + K+L KNY         +        ++ ++++   
Sbjct  379  LDPALIRRGRMDKHIEMSYCRFESFKVLAKNY--------LDIVGHGLFSEIQKLLEETN  430

Query  710  MTPADVSEVLI----RNRRNKERALWELVEI  790
            M+PADV+E L+    + +R+ +  L  L+E+
Sbjct  431  MSPADVAENLMPMSKKKKRDPDVCLAGLIEV  461



>dbj|BAJ97121.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=536

 Score =   280 bits (715),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/259 (53%), Positives = 181/259 (70%), Gaps = 14/259 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  VPF+HP+TFDTLAMDP +KE++  DL  F   + +Y + G+AWKRGYLLYGPPGTGK
Sbjct  199  WSHVPFEHPATFDTLAMDPKQKEDVIDDLMAFQESKEYYAKVGKAWKRGYLLYGPPGTGK  258

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YDIYD+ELT +  N+ELRKL ++T+ KSIIVIEDIDCS +LT + R +
Sbjct  259  STMIAAMANFLDYDIYDLELTAIKNNTELRKLFIETTGKSIIVIEDIDCSADLTGKRRKD  318

Query  368  GGGSTREYSS------AATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
               S  + S+         +  +D   ++TLSGLLNF DGLWS CG ERI +FTTN+ E+
Sbjct  319  KKASGDKDSNDNDKPKLPVEPEKDDETKVTLSGLLNFIDGLWSACGGERIIIFTTNYKEE  378

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI MSYC F + KIL KNY         +  E +   ++ ++++  +
Sbjct  379  LDPALIRRGRMDKHIEMSYCRFESFKILAKNY--------LDVIEHKLFGEIQQLLEETD  430

Query  710  MTPADVSEVLIRNRRNKER  766
            M+PADV+E L+   + K+R
Sbjct  431  MSPADVAENLMPMSKKKKR  449



>ref|XP_006439684.1| hypothetical protein CICLE_v10019846mg [Citrus clementina]
 gb|ESR52924.1| hypothetical protein CICLE_v10019846mg [Citrus clementina]
Length=496

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/251 (53%), Positives = 176/251 (70%), Gaps = 14/251 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+TF+T+A++P KK+EI  DL  F+    FY R G+AWKRGYLLYGPPGTGK
Sbjct  198  WSHIVFEHPATFETMALEPEKKQEIIEDLVTFSKSRDFYARIGKAWKRGYLLYGPPGTGK  257

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L YD+YD+ELT V  N+ELRKLL++T+SKSIIVIEDIDCS++LT + +  
Sbjct  258  STMIAAMANLLNYDVYDLELTAVKDNTELRKLLIETTSKSIIVIEDIDCSLDLTGQRKKK  317

Query  368  GGGSTREYSS------AATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
               S+ +         +  +  E+G +++TLSGLLNF DGLWS CG ER+ VFTTN+VEK
Sbjct  318  AEKSSDDEKEKLDKEISRKEPKEEGSSKVTLSGLLNFIDGLWSACGGERLIVFTTNYVEK  377

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI +SYC F   K+L KNY           E       + ++++  +
Sbjct  378  LDPALIRRGRMDKHIELSYCTFQGFKVLAKNY--------LNVETHTLFETIQKLMEDTK  429

Query  710  MTPADVSEVLI  742
            +TPADV+E L+
Sbjct  430  ITPADVAENLM  440



>ref|XP_004302367.1| PREDICTED: mitochondrial chaperone BCS1-like [Fragaria vesca 
subsp. vesca]
Length=472

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/251 (56%), Positives = 173/251 (69%), Gaps = 14/251 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TF TLAM+P KK++I  DL  F+  E FY R GRAWKRGYLL+GPPGTGK
Sbjct  186  WSHVVFQHPATFQTLAMEPEKKKDIIEDLMAFSKAEEFYTRIGRAWKRGYLLHGPPGTGK  245

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTN---RE  358
            S+MIAAMAN LGYD+YD+ELT V  N+ELRKLL++TSSKSIIVIEDIDCS++LT    ++
Sbjct  246  STMIAAMANLLGYDLYDLELTAVKDNTELRKLLIETSSKSIIVIEDIDCSLDLTGQRRKQ  305

Query  359  RMNGGGSTREY---SSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
            R + G    E         +  E   +++TLSGLLNF DGLWS C  ER+ VFTTNHVEK
Sbjct  306  RKDKGDDEEEKDPREKVPKEERESKPSQVTLSGLLNFIDGLWSACRGERLIVFTTNHVEK  365

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LD AL+R GRMD HI MSYCNF + K+L +NY         + E       +  ++    
Sbjct  366  LDAALIRKGRMDKHIEMSYCNFESFKVLARNY--------LKLESHSLFSTICLLLGEVN  417

Query  710  MTPADVSEVLI  742
            MTPADV+E L+
Sbjct  418  MTPADVAEHLM  428



>ref|XP_010040096.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Eucalyptus 
grandis]
Length=606

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 183/268 (68%), Gaps = 16/268 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V FKHPSTFDTLAM+P KK EI  DL  F  G+ +Y+R G+AWKRGYLLYGPPGTGK
Sbjct  197  WSHVTFKHPSTFDTLAMEPSKKREIMNDLLKFQRGKEYYERIGKAWKRGYLLYGPPGTGK  256

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT V  N+ELR LL++TS K+IIVIEDIDCS++LT + +  
Sbjct  257  STMIAAMANFLNYDVYDLELTTVKNNTELRNLLIETSEKAIIVIEDIDCSLDLTGQRKTK  316

Query  368  GGGSTREYSSA----ATQGGEDGG--NRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                  +   A        GE+G   +++TLSGLLNF DGLWS CG ERI VFTTN VEK
Sbjct  317  KQEKEDDEEKADPVKKMMKGEEGSKESKVTLSGLLNFIDGLWSACGGERIIVFTTNFVEK  376

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI MSYC F + K+L +NY           E      ++ ++++  +
Sbjct  377  LDPALIRRGRMDKHIEMSYCCFESFKVLARNY--------LGVESHPLFTRVRQLLEETK  428

Query  710  MTPADVSEVLI--RNRRNKERALWELVE  787
            M+PADV+E L+   +  +KE  L  L+E
Sbjct  429  MSPADVAESLMPKSDNEDKEACLEGLIE  456



>ref|XP_006664528.1| PREDICTED: vesicle-fusing ATPase 1-like [Oryza brachyantha]
Length=581

 Score =   280 bits (717),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/261 (54%), Positives = 182/261 (70%), Gaps = 16/261 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  VPF+HP+ FDTLAMDP +K+ +  DL  F + + +Y + G+ WKRGYLL+GPPGTGK
Sbjct  261  WSHVPFEHPARFDTLAMDPGQKDAVVDDLMAFRDSKDYYAKVGKPWKRGYLLHGPPGTGK  320

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT------  349
            S+MIAAMANFL YD+YD+ELT V  N+ELRKL ++T+ KSIIVIEDIDCSV+LT      
Sbjct  321  STMIAAMANFLDYDVYDLELTAVKNNTELRKLYIETTGKSIIVIEDIDCSVDLTGKRKEA  380

Query  350  --NRERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHV  523
              +R+   G GS  +         +D G+++TLSGLLNF DGLWS CG ERI +FTTNH 
Sbjct  381  SGDRKDDGGEGSDDKPKLPTDADRDDSGSKVTLSGLLNFIDGLWSACGGERIIIFTTNHK  440

Query  524  EKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDA  703
            EKLDPAL+R GRMD+HI MSYC F A ++L KNY           E+ E   ++  +++ 
Sbjct  441  EKLDPALIRRGRMDVHIEMSYCRFEAFRVLAKNY--------LGVEQHELFGEIGRLLEE  492

Query  704  AEMTPADVSEVLIRNRRNKER  766
            A+M+PADV+E L+   R K+R
Sbjct  493  ADMSPADVAENLMPMSRTKKR  513



>ref|XP_010435957.1| PREDICTED: 26S protease regulatory subunit 6A homolog [Camelina 
sativa]
Length=513

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 177/252 (70%), Gaps = 9/252 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TFDTLAM+  KKEEIK DL  F+N + +Y++ G+AWKRGYLL+GPPGTGK
Sbjct  198  WSHVTFEHPATFDTLAMEDKKKEEIKNDLIKFSNSKDYYKKIGKAWKRGYLLFGPPGTGK  257

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT V  N+ELR+LL++TS KSIIVIEDIDCS++LT + +  
Sbjct  258  STMIAAMANFLEYDVYDLELTTVKDNTELRRLLIETSVKSIIVIEDIDCSLDLTGQRKQK  317

Query  368  GGGSTREYSS------AATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                     +         + GE+ G+++TLSGLLNF DGLWS CG ERI VFTTN ++K
Sbjct  318  EEEEEDGDETNPIEKQMKKEKGENKGSKVTLSGLLNFIDGLWSSCGGERIIVFTTNFIDK  377

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD  I MSYC F A K+L +NYL  +   + E  +          ++  +
Sbjct  378  LDPALIRKGRMDKRIEMSYCGFEAFKLLARNYLDAKEEDDSELFDEIKRLLE---VEKIK  434

Query  710  MTPADVSEVLIR  745
            MTPADV E L++
Sbjct  435  MTPADVGENLLK  446



>ref|XP_009795973.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X1 
[Nicotiana sylvestris]
 ref|XP_009795974.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X2 
[Nicotiana sylvestris]
Length=500

 Score =   278 bits (711),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 162/220 (74%), Gaps = 19/220 (9%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+TFDTLAMDP KKEEI  DL  F+ G+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  195  WRDINFEHPATFDTLAMDPKKKEEIVIDLVAFSKGKDYYSKVGKAWKRGYLLYGPPGTGK  254

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT------  349
            S+MIAA+ANFL YDIYD+ELT V  NS L+KLLM+T+SKSIIVIEDIDCS++LT      
Sbjct  255  STMIAAIANFLNYDIYDLELTSVKDNSGLKKLLMETTSKSIIVIEDIDCSIDLTGKRKKK  314

Query  350  --------NRERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFV  505
                    N ++ +    ++E +S   + G     ++TLSGLLNF DG+WS CG ERI +
Sbjct  315  KKKNEETVNEDQEDDSDLSKEKASENKETG-----KLTLSGLLNFIDGIWSACGQERIII  369

Query  506  FTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNY  625
            FTTNH +KLDPAL+R GRMDMHI MSYC + A K+L KNY
Sbjct  370  FTTNHKDKLDPALIRRGRMDMHIEMSYCKYEAFKVLAKNY  409



>emb|CDY00125.1| BnaC09g01760D [Brassica napus]
Length=466

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 174/248 (70%), Gaps = 19/248 (8%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP++FDTLAMD  KKEEI  DL  F+NG+ +Y++ G+AWKRGYLLYGPPGTGK
Sbjct  193  WRCIDFEHPASFDTLAMDSKKKEEILNDLAAFSNGKEYYKKIGKAWKRGYLLYGPPGTGK  252

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L Y IYD+ELT +  NSELRKLL+ T++KSIIVIEDIDCS++LT +   +
Sbjct  253  STMIAAMANLLNYSIYDVELTAIKDNSELRKLLIGTATKSIIVIEDIDCSLDLTGQRNKD  312

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
                         +G E+  + +TLSGLLNF DG+WS CG ERI VFTTNH+ KLDPAL+
Sbjct  313  -----------QEEGKEENKSFVTLSGLLNFIDGIWSACGQERIIVFTTNHLAKLDPALI  361

Query  548  RSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPADV  727
            R GRMDMHI +SYC F A KIL KNY         + +      ++  ++   ++ PADV
Sbjct  362  RRGRMDMHIELSYCTFEAFKILAKNY--------LDLDTHPLYTKIESLLKETKIAPADV  413

Query  728  SEVLIRNR  751
            +E L++ +
Sbjct  414  AENLMKKK  421



>ref|XP_010933985.1| PREDICTED: mitochondrial chaperone BCS1-like isoform X3 [Elaeis 
guineensis]
Length=488

 Score =   278 bits (710),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 174/247 (70%), Gaps = 9/247 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HPS+F+TLAMDP KK EI  DL  F  G+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  171  WSHVVFEHPSSFETLAMDPGKKREIMKDLDAFRKGKDYYAKIGKAWKRGYLLYGPPGTGK  230

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT-NRERM  364
            S+MI+AMANFL YD+YD+ELT V  N ELRKL ++T SKSIIVIEDIDCS++LT  R++ 
Sbjct  231  STMISAMANFLDYDVYDLELTTVKNNIELRKLFIETKSKSIIVIEDIDCSLDLTGKRKQK  290

Query  365  NGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
            +     +          E+  +++TLSGLLNF DGLWS CG ER+ VFTTNH+EKLDPAL
Sbjct  291  SKKEEDKSEKKKKLPPEEEESSKVTLSGLLNFIDGLWSACGGERLIVFTTNHIEKLDPAL  350

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPAD  724
            +R GRMD HI MSYC F A K+L +NY         + E       + ++++  ++TPAD
Sbjct  351  IRRGRMDKHIEMSYCCFEAFKVLARNY--------LDVESHPLFDTIRDLMEEVKITPAD  402

Query  725  VSEVLIR  745
            V+E L+R
Sbjct  403  VAENLMR  409



>ref|XP_007139617.1| hypothetical protein PHAVU_008G044800g [Phaseolus vulgaris]
 gb|ESW11611.1| hypothetical protein PHAVU_008G044800g [Phaseolus vulgaris]
Length=488

 Score =   278 bits (710),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 177/248 (71%), Gaps = 11/248 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+TF+TLAM+  KKEEI  DL  F NG+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  182  WSHIVFEHPATFETLAMEQRKKEEIINDLVKFRNGKDYYAKIGKAWKRGYLLYGPPGTGK  241

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANF+ YD+YD+ELT V  N+ELRKLL++TSSK+IIV+EDIDCS++LT +  M 
Sbjct  242  STMIAAMANFMNYDVYDLELTAVKDNTELRKLLIETSSKAIIVVEDIDCSLDLTGQRNMR  301

Query  368  GGGSTREYSSAATQGGEDGGN---RITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
               S  E      +  E+  N   ++TLSGLLNF DG+WS CG ERI +FTTN V+KLDP
Sbjct  302  KERSEEEEPKDPNKKEEEESNKSSKVTLSGLLNFIDGIWSACGGERIIIFTTNFVDKLDP  361

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTP  718
            AL+R+GRMD HI +SYC F A K+L KNY         + +      +++ +++   +TP
Sbjct  362  ALIRTGRMDKHIELSYCRFEAFKVLAKNY--------LDVDSHHLFPRISNLLEVTNVTP  413

Query  719  ADVSEVLI  742
            ADV+E L+
Sbjct  414  ADVAENLM  421



>ref|XP_009150457.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Brassica 
rapa]
Length=502

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/252 (56%), Positives = 176/252 (70%), Gaps = 12/252 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TFDTLAM+  KKEEIK DL  F+N +  Y+R G+AWKRGYLL+GPPGTGK
Sbjct  197  WSHVTFEHPATFDTLAMESEKKEEIKNDLTKFSNSQDCYKRIGKAWKRGYLLHGPPGTGK  256

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+M+AAMANFL YD+YD+ELT V  N+ELR+LL++TS KSIIVIEDIDCS++LT + +  
Sbjct  257  STMVAAMANFLDYDVYDLELTTVKDNTELRRLLIETSGKSIIVIEDIDCSLDLTGQRKQK  316

Query  368  GGGSTREYSSAA-------TQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVE  526
                  +    +        +  E  G+++TLSGLLNF DGLWS CG ERI VFTTN ++
Sbjct  317  KEEEEDDEDEISPIEKQMKKEKSEGTGSKVTLSGLLNFIDGLWSACGGERIIVFTTNFID  376

Query  527  KLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAA  706
            KLDPAL+R GRMD HI MSYC F A K+L +NYL  E   E  +E    L      ++  
Sbjct  377  KLDPALIRKGRMDKHIEMSYCGFEAFKVLARNYLYAEEEGELFQEIQRLLE-----VEKI  431

Query  707  EMTPADVSEVLI  742
            +MTPADV E L+
Sbjct  432  KMTPADVGENLL  443



>gb|KHN34192.1| Putative mitochondrial chaperone BCS1-B [Glycine soja]
Length=482

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 157/209 (75%), Gaps = 3/209 (1%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TF TLAMDP +KE I  DL  F+    FY R GRAWKRGYLLYGPPGTGK
Sbjct  189  WSHVVFEHPATFQTLAMDPKEKEMIIDDLITFSKAGEFYARIGRAWKRGYLLYGPPGTGK  248

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFLGYD+YD+ELT V  N+ELRKLL++TSSKSIIVIEDIDCS++LT + R  
Sbjct  249  STMIAAMANFLGYDLYDLELTAVKDNTELRKLLIETSSKSIIVIEDIDCSLDLTGQRRKK  308

Query  368  GGGSTREYSSAATQGGED---GGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
                  +      QG ++     +++TLSGLLNF DGLWS CG ER+ VFTTN+VEKLDP
Sbjct  309  KEEVEEKDQRQKQQGMQEREVKSSQVTLSGLLNFIDGLWSACGGERLIVFTTNYVEKLDP  368

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNY  625
            AL+R GRMD HI +SYC + A K+L +NY
Sbjct  369  ALVRKGRMDKHIELSYCGYEAFKLLARNY  397



>gb|EMT21356.1| Putative mitochondrial chaperone bcs1 [Aegilops tauschii]
Length=528

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 177/259 (68%), Gaps = 14/259 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W   PFKHP+TFDTLAMDP +KE I  DL  F   + +Y + G+ WKRGYLLYGPPGTGK
Sbjct  217  WSHAPFKHPATFDTLAMDPKQKETIIDDLMAFQENKEYYIKVGKPWKRGYLLYGPPGTGK  276

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT +  N+ELRKL ++T+ KSIIVIEDIDCS++LT + R  
Sbjct  277  STMIAAMANFLDYDVYDLELTAIKNNTELRKLFIETTGKSIIVIEDIDCSIDLTGKRRKG  336

Query  368  GGGSTREYSS------AATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
              GS  + S          +  +D   ++TLSGLLNF DGLWS CG ERI +FTTNH EK
Sbjct  337  KKGSGDKDSDDNDRPKLPMEPEKDDDTKVTLSGLLNFIDGLWSACGGERIIIFTTNHKEK  396

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI MSYC F   K+L KNY         +  E E   ++ ++++  +
Sbjct  397  LDPALIRRGRMDKHIEMSYCRFEGFKVLAKNY--------LDVVEHELFGEIWQLLEETD  448

Query  710  MTPADVSEVLIRNRRNKER  766
            M+PADV+E L+   + K+R
Sbjct  449  MSPADVAENLMPMSKKKKR  467



>gb|ACU20008.1| unknown [Glycine max]
Length=373

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 156/209 (75%), Gaps = 3/209 (1%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TF TLAMDP +KE I  DL  F+    FY R GRAWKRGYLLYGPPGTGK
Sbjct  126  WSHVVFEHPATFQTLAMDPKEKEMIIDDLITFSKAGEFYARIGRAWKRGYLLYGPPGTGK  185

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFLGYD+YD+ELT V  N+ELRKLL++TSSKSIIVIEDIDCS++LT + R  
Sbjct  186  STMIAAMANFLGYDLYDLELTAVKDNTELRKLLIETSSKSIIVIEDIDCSLDLTGQRRKK  245

Query  368  GGGSTREYSSAATQGGED---GGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDP  538
                  +      QG ++     +++TLSGLLNF DGLWS CG ER+ VFTTN+VEKLDP
Sbjct  246  KEEVEEKDQRQKQQGMQEREVKSSQVTLSGLLNFIDGLWSACGGERLIVFTTNYVEKLDP  305

Query  539  ALLRSGRMDMHIHMSYCNFPALKILLKNY  625
            AL+R  RMD HI +SYC + A K+L +NY
Sbjct  306  ALVRKRRMDKHIELSYCGYEAFKLLARNY  334



>ref|XP_010670348.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Beta vulgaris 
subsp. vulgaris]
Length=466

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/284 (52%), Positives = 188/284 (66%), Gaps = 26/284 (9%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HPSTF+TLAM+  KKEEI  DL  F+ G+ FY R GRAWKRGYLLYGPPGTGK
Sbjct  188  WSHVVFEHPSTFETLAMESKKKEEIVEDLITFSKGQEFYARIGRAWKRGYLLYGPPGTGK  247

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L YDIYD+ELT V  N+ELR+LL++TSSKSIIVIEDIDCS +LT + +  
Sbjct  248  STMIAAMANLLKYDIYDLELTAVKDNTELRRLLIETSSKSIIVIEDIDCSRDLTGQRKKK  307

Query  368  GGGSTREYSSA-----------ATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTT  514
                 +E S+A           A +  E   +++TLSGLLNF DGLWS CG ER+ VFTT
Sbjct  308  --PDKKEDSTADDDQKNAIDTLAKEDQEASQSKVTLSGLLNFIDGLWSACGGERLIVFTT  365

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NHV+KLD AL+R GRMD H+ +SYC + A KIL KNY           +       + ++
Sbjct  366  NHVDKLDAALIRRGRMDKHVELSYCGYEAFKILAKNY--------MYIDSHPLFPTVEKL  417

Query  695  IDAAEMTPADVSEVLI--RNRRNKERALWELV---EISRMRAER  811
            +   +MTPADV+E L+   +  N   +L +L+   E+ +  AE+
Sbjct  418  LGEVKMTPADVAENLMPKTSSANATSSLQDLIHALELVKQEAEQ  461



>ref|XP_006409417.1| hypothetical protein EUTSA_v10023056mg, partial [Eutrema salsugineum]
 gb|ESQ50870.1| hypothetical protein EUTSA_v10023056mg, partial [Eutrema salsugineum]
Length=468

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 158/212 (75%), Gaps = 12/212 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + FKHP++F TLAM+  KKEEI  DL+ F+NG+ +Y++ G+AWKRGYLL+GPPGTGK
Sbjct  195  WRHIDFKHPASFQTLAMESKKKEEILNDLEAFSNGKEYYKKIGKAWKRGYLLHGPPGTGK  254

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L Y IYD+ELT +  NSELRKLL  TSSKSIIVI DIDCSV+LT      
Sbjct  255  STMIAAMANHLNYSIYDLELTAIQNNSELRKLLTATSSKSIIVIGDIDCSVDLT------  308

Query  368  GGGSTREYSSAATQGGEDG------GNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
            G  S R+    +   GE G       +R+TLSGLLNF DG+WS CG ERI VFTTNH+EK
Sbjct  309  GKRSKRDSDLFSKNDGEKGKEEQNQSSRVTLSGLLNFIDGIWSACGQERIIVFTTNHMEK  368

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNY  625
            LDPAL+R GRMDMHI +SYC+F   K+L KNY
Sbjct  369  LDPALIRRGRMDMHIELSYCSFEGFKVLAKNY  400



>gb|KCW49361.1| hypothetical protein EUGRSUZ_K02905, partial [Eucalyptus grandis]
Length=484

 Score =   277 bits (708),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/270 (53%), Positives = 179/270 (66%), Gaps = 18/270 (7%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+TFDT+AMDP KK +I  DL  F+  + FY R G+AWKRGYLLYGPPGTGK
Sbjct  194  WSHIAFEHPATFDTMAMDPEKKRDILEDLVTFSKSKDFYARIGKAWKRGYLLYGPPGTGK  253

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT V  N++LRKLL++T+SKSIIVIEDIDCS++LT + +  
Sbjct  254  STMIAAMANFLHYDVYDLELTAVKDNTDLRKLLIETTSKSIIVIEDIDCSLDLTGQRKKK  313

Query  368  GGGSTREYSSA--------ATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHV  523
            G     E  +              ED  +R+TLSGLLNF DGLWS CG ERI VFTTN+V
Sbjct  314  GEKLPVEDDNVDKLNKDVPRKDSYEDTTSRVTLSGLLNFIDGLWSACGGERIIVFTTNYV  373

Query  524  EKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDA  703
            EKLDPAL+R GRMD HI +SYC F   K+L KNY           E       +  ++  
Sbjct  374  EKLDPALIRRGRMDKHIELSYCCFEGFKVLAKNY--------LSLETHAMFDAVRGLMSE  425

Query  704  AEMTPADVSEVLIRNRRN--KERALWELVE  787
             ++TPADV+E L+    N   E+ L  L++
Sbjct  426  VKITPADVAENLMPKSPNDDAEKCLSRLIQ  455



>ref|XP_010933978.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X2 
[Elaeis guineensis]
Length=504

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 174/247 (70%), Gaps = 9/247 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HPS+F+TLAMDP KK EI  DL  F  G+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  189  WSHVVFEHPSSFETLAMDPGKKREIMKDLDAFRKGKDYYAKIGKAWKRGYLLYGPPGTGK  248

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT-NRERM  364
            S+MI+AMANFL YD+YD+ELT V  N ELRKL ++T SKSIIVIEDIDCS++LT  R++ 
Sbjct  249  STMISAMANFLDYDVYDLELTTVKNNIELRKLFIETKSKSIIVIEDIDCSLDLTGKRKQK  308

Query  365  NGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
            +     +          E+  +++TLSGLLNF DGLWS CG ER+ VFTTNH+EKLDPAL
Sbjct  309  SKKEEDKSEKKKKLPPEEEESSKVTLSGLLNFIDGLWSACGGERLIVFTTNHIEKLDPAL  368

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPAD  724
            +R GRMD HI MSYC F A K+L +NY         + E       + ++++  ++TPAD
Sbjct  369  IRRGRMDKHIEMSYCCFEAFKVLARNY--------LDVESHPLFDTIRDLMEEVKITPAD  420

Query  725  VSEVLIR  745
            V+E L+R
Sbjct  421  VAENLMR  427



>ref|XP_004981386.1| PREDICTED: uncharacterized protein LOC101785894 [Setaria italica]
Length=500

 Score =   277 bits (709),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/253 (56%), Positives = 171/253 (68%), Gaps = 17/253 (7%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP TF TLAMDP KK+EI  DL  F NG+ +Y R G+AWKRGYLLYGPPGTGK
Sbjct  211  WSHVVFEHPKTFATLAMDPAKKKEITDDLDMFKNGKDYYARVGKAWKRGYLLYGPPGTGK  270

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN+L YDIYD+ELT VH+N++LRKL ++T+SKSIIVIEDIDCS++LT   +  
Sbjct  271  SAMIAAMANYLDYDIYDIELTSVHSNTDLRKLFIETTSKSIIVIEDIDCSLDLTGARKKK  330

Query  368  GGGSTREYSSAATQGG---------EDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNH  520
               +  +                  +D  +++TLSGLLNF DGLWS CG ERI VFTTNH
Sbjct  331  KAAAEDDDKKDGAAAAAKAAAGGDRKDTSSKVTLSGLLNFIDGLWSACGGERIIVFTTNH  390

Query  521  VEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVID  700
            VEKLDPAL+R GRMD HI MSYC F A K L K Y         + +       + E++ 
Sbjct  391  VEKLDPALIRRGRMDKHIEMSYCGFEAFKFLAKTY--------LDVDAHPLFDAVEELLR  442

Query  701  AAEMTPADVSEVL  739
              EMTPADV+E L
Sbjct  443  EVEMTPADVAENL  455



>ref|XP_010678629.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Beta vulgaris 
subsp. vulgaris]
Length=537

 Score =   278 bits (712),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/266 (53%), Positives = 184/266 (69%), Gaps = 21/266 (8%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  +PF+HP+TFDTLAMD  KK+EI  DL++F+  + FY R G+AWKRGYLLYGPPGTGK
Sbjct  226  WSHIPFEHPATFDTLAMDSDKKKEIMDDLENFSKSKDFYARIGKAWKRGYLLYGPPGTGK  285

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L YD++D+ELT V  N+ELRKLL+ T+SKSIIVIEDIDCS+ LT + + N
Sbjct  286  STMIAAMANLLKYDVFDLELTAVKDNTELRKLLIDTTSKSIIVIEDIDCSLELTGQRKKN  345

Query  368  --GGGSTREYSSAATQGGE-----------------DGGNRITLSGLLNFTDGLWSCCGS  490
               G +  +Y      G +                 +G + +TLSGLLNF DG+WS CG 
Sbjct  346  KKKGEAEMDYKELENDGDQKKVDNAKVAAENNGNVGNGSSAVTLSGLLNFIDGIWSSCGG  405

Query  491  ERIFVFTTNHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeege  670
            ERI VFTTN+VEKLDPAL+R GRMD HI MSYC+F   K+L KNYL L+   + + ++  
Sbjct  406  ERIIVFTTNYVEKLDPALIRRGRMDKHIEMSYCSFEGFKVLAKNYLLLDEVEDNDADDQY  465

Query  671  alr--qlaeVIDAAEMTPADVSEVLI  742
                 ++ +++   ++TPADV+E L+
Sbjct  466  YEMFDEIKKLLSEVKITPADVAENLM  491



>ref|XP_006359141.1| PREDICTED: putative cell division cycle ATPase-like [Solanum 
tuberosum]
Length=516

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 179/260 (69%), Gaps = 13/260 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF+HPSTF+TLA+ P  K ++  DL  F+ G+ FY + GRAWKRGYLLYGPPG+GK
Sbjct  180  WSSVPFRHPSTFETLALKPELKTQLMDDLTAFSQGKEFYHKIGRAWKRGYLLYGPPGSGK  239

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTN---RE  358
            SS+IAA+ANFL YD+YD+EL++V  NSELR LL++T+++SIIVIEDIDCS+NLT     +
Sbjct  240  SSLIAAIANFLCYDVYDLELSKVSDNSELRALLIQTTNRSIIVIEDIDCSINLTGDRMAK  299

Query  359  RMNGGGSTREYSSAATQG--GEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKL  532
            R N     ++       G   ED G R+TLSGLLNFTDGLWSCCG E++ VFTTNH + +
Sbjct  300  RRNVHTMQKKNHRHVMMGDNAEDNG-RVTLSGLLNFTDGLWSCCGEEKVIVFTTNHKDNV  358

Query  533  DPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEM  712
            DPAL+R GRMDMH+ +  C   A K+L+KNY          +         + +     +
Sbjct  359  DPALVRCGRMDMHVSLGTCGMHAFKVLVKNY-------LGLDSHVLFDVVESCIRSGGTL  411

Query  713  TPADVSEVLIRNRRNKERAL  772
            TPA + E+L+RNRR+ + A+
Sbjct  412  TPAHIGEILLRNRRDADVAV  431



>ref|XP_004299617.1| PREDICTED: uncharacterized protein LOC101309636 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=490

 Score =   277 bits (708),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 181/262 (69%), Gaps = 11/262 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  + F+HP+TF+T+A++P  K+EI  DL  F+    FY R G+AWKRGYLLYGPPGTGK
Sbjct  200  WSHIVFEHPATFETMALEPEMKKEIIEDLVTFSQSRDFYARIGKAWKRGYLLYGPPGTGK  259

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMAN L YD+YD+ELT V  N+ELRKLL++T+SKSIIVIEDIDCS++LT + +  
Sbjct  260  STMIAAMANLLNYDVYDLELTAVKDNTELRKLLIETTSKSIIVIEDIDCSLDLTGQRKKK  319

Query  368  GGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPALL  547
                T        +GG  G +++TLSGLLNF DGLWS CG ER+ VFTTN++EKLDPAL+
Sbjct  320  AEKGTERIKDPKEEGG-SGSSKVTLSGLLNFIDGLWSSCGGERLVVFTTNYIEKLDPALI  378

Query  548  RSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPADV  727
            R GRMD HI +SYC+F   K+L KNY         + E  E    + +++   +MTPADV
Sbjct  379  RRGRMDKHIELSYCSFEGFKVLAKNY--------LKLESHEMFDMIEKLMGDIKMTPADV  430

Query  728  SEVLIRN--RRNKERALWELVE  787
            +E L+    + + ER L   ++
Sbjct  431  AENLMPKSPQDDPERCLSNFIQ  452



>ref|XP_006292928.1| hypothetical protein CARUB_v10019198mg [Capsella rubella]
 gb|EOA25826.1| hypothetical protein CARUB_v10019198mg [Capsella rubella]
Length=510

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/251 (56%), Positives = 178/251 (71%), Gaps = 12/251 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TFDTLAM+  KKEEIK+DL  F+  + +Y++ G+AWKRGYLL+GPPGTGK
Sbjct  194  WSHVSFEHPATFDTLAMEETKKEEIKSDLVKFSKSKDYYKKIGKAWKRGYLLFGPPGTGK  253

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YD+YD+ELT V  N+ LR+LL++TS+KSIIVIEDIDCS+NLT + +  
Sbjct  254  STMIAAMANFLEYDVYDLELTTVKDNTHLRRLLIETSAKSIIVIEDIDCSLNLTGQRKKK  313

Query  368  GGGSTREYSSAATQG------GEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEK  529
                       A +       GE+  +++TLSGLLNF DGLWS CG ERI VFTTN V+K
Sbjct  314  EEEEEDGDDKNAIEKKMMKSEGENKESKVTLSGLLNFIDGLWSACGGERIIVFTTNFVDK  373

Query  530  LDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAE  709
            LDPAL+R GRMD HI MSYC F A K+L KNYL +E +   +E +          ++  +
Sbjct  374  LDPALIRKGRMDKHIEMSYCCFEAFKVLAKNYLDVEESELFDEIKRLLE------VEEIK  427

Query  710  MTPADVSEVLI  742
            MTPADV E L+
Sbjct  428  MTPADVGENLL  438



>gb|ACO87685.1| AAA-ATPase [Brachypodium sylvaticum]
Length=489

 Score =   277 bits (708),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/257 (54%), Positives = 178/257 (69%), Gaps = 12/257 (5%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HP+TFDTLAMD  +KE I +DL  F   + +Y + G+AWKRGYLLYGPPGTGK
Sbjct  194  WSHVKFEHPATFDTLAMDTDQKESIISDLMAFQESKEYYTKVGKAWKRGYLLYGPPGTGK  253

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAAMANFL YDIYD+ELT V  N+ELRKL ++T+ KSIIVIEDIDCS++LT +   +
Sbjct  254  STMIAAMANFLDYDIYDLELTAVKNNTELRKLFIETTGKSIIVIEDIDCSIDLTGKRLKD  313

Query  368  GGGSTR----EYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLD  535
              G+      E     T   +D  +++TLSGLLNF DGLWS CG ERI +FTTNH EKLD
Sbjct  314  KKGTKESDDDEKPKLPTDAEKDETSKVTLSGLLNFIDGLWSACGGERIIIFTTNHKEKLD  373

Query  536  PALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMT  715
            PAL+R GRMD HI MSYC F   K+L  NY         +  E E  R++ ++++  +M+
Sbjct  374  PALIRRGRMDKHIEMSYCRFEGFKVLANNY--------LDVAEHELFREIRQLLEETDMS  425

Query  716  PADVSEVLIRNRRNKER  766
            PADV+E ++   + K+R
Sbjct  426  PADVAENMMPMSQKKKR  442



>ref|XP_006661289.1| PREDICTED: mitochondrial chaperone BCS1-like [Oryza brachyantha]
Length=437

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 187/269 (70%), Gaps = 17/269 (6%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W SVPF HPSTFDT+A+DP  K  + ADL  FA+G  FY+RTGR WKRGYLL+GPPG+GK
Sbjct  116  WSSVPFCHPSTFDTIALDPDLKARLLADLTAFADGREFYRRTGRPWKRGYLLHGPPGSGK  175

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT------  349
            SS+IAAMAN L YD++D+ELT V TN++LR LL++T+++S+IVIEDIDCS++LT      
Sbjct  176  SSLIAAMANHLRYDVFDLELTRVATNADLRALLIQTTNRSLIVIEDIDCSLHLTGDRGLA  235

Query  350  ----NRERMNGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTN  517
                N+ R     S+ + S + + GG++   R+TLSGLLNFTDGLWSCCG ERI VFTTN
Sbjct  236  SKRRNKRRRLHATSSDDSSDSDSDGGDNHRARVTLSGLLNFTDGLWSCCGEERIIVFTTN  295

Query  518  HVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVI  697
            HV+ +DPALLR GRMD+H+ +  C   A++ L+  Y          E+          + 
Sbjct  296  HVDGIDPALLRPGRMDVHVRLGACGAHAMRELVDRY-------VGVEDHEMLDAAEGCIR  348

Query  698  DAAEMTPADVSEVLIRNRRNKERALWELV  784
            D AEMTPA+V EVL+RNR + + A+ EL 
Sbjct  349  DGAEMTPAEVGEVLLRNRDDPDAAVTELA  377



>ref|XP_010933968.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X1 
[Elaeis guineensis]
Length=506

 Score =   277 bits (709),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 136/248 (55%), Positives = 174/248 (70%), Gaps = 9/248 (4%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HPS+F+TLAMDP KK EI  DL  F  G+ +Y + G+AWKRGYLLYGPPGTGK
Sbjct  189  WSHVVFEHPSSFETLAMDPGKKREIMKDLDAFRKGKDYYAKIGKAWKRGYLLYGPPGTGK  248

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLT-NRERM  364
            S+MI+AMANFL YD+YD+ELT V  N ELRKL ++T SKSIIVIEDIDCS++LT  R++ 
Sbjct  249  STMISAMANFLDYDVYDLELTTVKNNIELRKLFIETKSKSIIVIEDIDCSLDLTGKRKQK  308

Query  365  NGGGSTREYSSAATQGGEDGGNRITLSGLLNFTDGLWSCCGSERIFVFTTNHVEKLDPAL  544
            +     +          E+  +++TLSGLLNF DGLWS CG ER+ VFTTNH+EKLDPAL
Sbjct  309  SKKEEDKSEKKKKLPPEEEESSKVTLSGLLNFIDGLWSACGGERLIVFTTNHIEKLDPAL  368

Query  545  LRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeVIDAAEMTPAD  724
            +R GRMD HI MSYC F A K+L +NY         + E       + ++++  ++TPAD
Sbjct  369  IRRGRMDKHIEMSYCCFEAFKVLARNY--------LDVESHPLFDTIRDLMEEVKITPAD  420

Query  725  VSEVLIRN  748
            V+E L+R 
Sbjct  421  VAENLMRK  428



>ref|XP_009396943.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Musa acuminata 
subsp. malaccensis]
Length=480

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 174/256 (68%), Gaps = 26/256 (10%)
 Frame = +2

Query  8    WESVPFKHPSTFDTLAMDPVKKEEIKADLKDFANGEAFYQRTGRAWKRGYLLYGPPGTGK  187
            W  V F+HPSTFDTLAMDP KK E+  DL  F N + +Y + G+AWKRGYLLYGPPGTGK
Sbjct  198  WSHVVFEHPSTFDTLAMDPGKKRELMDDLIAFRNSKDYYAKIGKAWKRGYLLYGPPGTGK  257

Query  188  SSMIAAMANFLGYDIYDMELTEVHTNSELRKLLMKTSSKSIIVIEDIDCSVNLTNRERMN  367
            S+MIAA+ANFL YD+YD+ELT V  N+ELRKL + T+SKSIIVIEDIDCS++LT + +  
Sbjct  258  STMIAAIANFLDYDVYDLELTSVKNNTELRKLFIGTTSKSIIVIEDIDCSLDLTGKRK--  315

Query  368  GGGSTREYSSAATQGGEDGG-----------NRITLSGLLNFTDGLWSCCGSERIFVFTT  514
                 R  S    +GGED             +++TLSGLLNF DGLWS CG ER+ +FTT
Sbjct  316  -----RTKSKKEDEGGEDKTKLPGEEEDKEESKVTLSGLLNFIDGLWSACGGERLIIFTT  370

Query  515  NHVEKLDPALLRSGRMDMHIHMSYCNFPALKILLKNYlgleaaaeqeeeegealrqlaeV  694
            NHVEKLDPAL+R GRMD HI MSYC+F A  +L  NY           +       + E+
Sbjct  371  NHVEKLDPALIRRGRMDKHIEMSYCHFEAFMVLANNY--------LGIDSHPLFDTIKEL  422

Query  695  IDAAEMTPADVSEVLI  742
            ++  +MTPADV+E L+
Sbjct  423  MEEVKMTPADVAENLM  438



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3025133731368