BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19793_g2_i1 len=403 path=[275:0-116 392:117-402]

Length=403
                                                                      Score     E

ref|XP_009597434.1|  PREDICTED: probable protein S-acyltransferas...    124   4e-30   
ref|XP_004239090.1|  PREDICTED: probable protein S-acyltransferas...    122   2e-29   
ref|XP_009770437.1|  PREDICTED: probable protein S-acyltransferas...    121   3e-29   
ref|XP_009770431.1|  PREDICTED: probable protein S-acyltransferas...    121   3e-29   
ref|XP_006348734.1|  PREDICTED: probable protein S-acyltransferas...    117   6e-28   
emb|CDY51503.1|  BnaC06g43440D                                          113   2e-26   
gb|KDO83043.1|  hypothetical protein CISIN_1g046435mg                   113   2e-26   
ref|XP_006483090.1|  PREDICTED: probable protein S-acyltransferas...    113   2e-26   
gb|KFK41358.1|  hypothetical protein AALP_AA2G119800                    113   3e-26   
ref|XP_006483092.1|  PREDICTED: probable protein S-acyltransferas...    113   3e-26   
ref|XP_006438765.1|  hypothetical protein CICLE_v10030950mg             110   2e-25   
ref|XP_011075548.1|  PREDICTED: probable protein S-acyltransferas...    110   2e-25   
ref|XP_002887235.1|  zinc finger family protein                         110   2e-25   
ref|XP_008446403.1|  PREDICTED: probable protein S-acyltransferas...    110   2e-25   
ref|XP_004135155.1|  PREDICTED: probable S-acyltransferase At1g69...    109   5e-25   
gb|KGN51955.1|  hypothetical protein Csa_5G606460                       109   6e-25   
ref|XP_006391018.1|  hypothetical protein EUTSA_v10018316mg             109   7e-25   
emb|CDP00383.1|  unnamed protein product                                109   7e-25   
ref|XP_011017951.1|  PREDICTED: probable protein S-acyltransferas...    108   2e-24   
ref|XP_004155378.1|  PREDICTED: probable S-acyltransferase At1g69...    109   2e-24   
ref|XP_010258225.1|  PREDICTED: probable protein S-acyltransferas...    107   4e-24   
ref|XP_009127730.1|  PREDICTED: probable protein S-acyltransferas...    107   4e-24   
ref|XP_002312266.2|  zinc finger family protein                         107   5e-24   Populus trichocarpa [western balsam poplar]
ref|NP_177101.2|  putative S-acyltransferase                            106   7e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CDY44067.1|  BnaA02g14310D                                          105   9e-24   
ref|XP_004490123.1|  PREDICTED: probable S-acyltransferase At1g69...    105   1e-23   
emb|CBI22303.3|  unnamed protein product                                105   1e-23   
ref|XP_003613938.1|  Palmitoyltransferase                               105   1e-23   
emb|CDY40920.1|  BnaC06g30580D                                          105   1e-23   
emb|CDX95936.1|  BnaA07g27950D                                          105   1e-23   
ref|XP_010066871.1|  PREDICTED: probable protein S-acyltransferas...    105   2e-23   
ref|XP_004490124.1|  PREDICTED: probable S-acyltransferase At1g69...    105   2e-23   
ref|XP_004490122.1|  PREDICTED: probable S-acyltransferase At1g69...    105   2e-23   
ref|XP_010511969.1|  PREDICTED: probable protein S-acyltransferas...    105   2e-23   
ref|XP_009105487.1|  PREDICTED: probable protein S-acyltransferas...    105   2e-23   
gb|AES96896.2|  DHHC-type zinc finger protein                           105   2e-23   
emb|CDY28549.1|  BnaC02g19180D                                          104   2e-23   
ref|XP_010258671.1|  PREDICTED: probable protein S-acyltransferas...    104   3e-23   
ref|XP_004297270.1|  PREDICTED: probable S-acyltransferase At1g69...    104   3e-23   
ref|XP_004490121.1|  PREDICTED: probable S-acyltransferase At1g69...    104   3e-23   
ref|XP_010532679.1|  PREDICTED: probable protein S-acyltransferas...    104   4e-23   
ref|XP_008339848.1|  PREDICTED: probable protein S-acyltransferas...    103   6e-23   
ref|XP_002315025.1|  zinc finger family protein                         103   6e-23   Populus trichocarpa [western balsam poplar]
ref|XP_007157706.1|  hypothetical protein PHAVU_002G091400g             103   6e-23   
ref|XP_007045986.1|  DHHC-type zinc finger family protein isoform 1     103   8e-23   
ref|XP_007045987.1|  DHHC-type zinc finger family protein isoform 2     103   1e-22   
ref|XP_004514247.1|  PREDICTED: probable S-acyltransferase At1g69...    103   1e-22   
ref|XP_010108730.1|  putative S-acyltransferase                         102   2e-22   
ref|XP_006302036.1|  hypothetical protein CARUB_v10020019mg             102   2e-22   
ref|XP_011012654.1|  PREDICTED: probable protein S-acyltransferas...    102   2e-22   
ref|XP_002268416.1|  PREDICTED: probable protein S-acyltransferas...    102   2e-22   Vitis vinifera
ref|XP_010551409.1|  PREDICTED: probable protein S-acyltransferas...    102   2e-22   
ref|XP_003529465.1|  PREDICTED: probable protein S-acyltransferas...    102   2e-22   
gb|KHN42929.1|  Putative S-acyltransferase                              102   2e-22   
ref|XP_010470928.1|  PREDICTED: probable protein S-acyltransferas...    102   2e-22   
ref|XP_002522494.1|  zinc finger protein, putative                      102   3e-22   Ricinus communis
ref|XP_010683094.1|  PREDICTED: probable protein S-acyltransferas...    102   3e-22   
gb|KHN37442.1|  Putative S-acyltransferase                              100   8e-22   
ref|XP_003516296.1|  PREDICTED: probable protein S-acyltransferas...    100   8e-22   
ref|XP_003518747.1|  PREDICTED: probable protein S-acyltransferas...    100   9e-22   
gb|KHN01993.1|  Putative S-acyltransferase                              100   1e-21   
ref|XP_010551408.1|  PREDICTED: probable protein S-acyltransferas...  99.4    2e-21   
gb|AAG52492.1|AC018364_10  hypothetical protein; 3218-172             97.4    8e-21   Arabidopsis thaliana [mouse-ear cress]
gb|EYU28813.1|  hypothetical protein MIMGU_mgv1a003797mg              97.4    1e-20   
ref|XP_009356348.1|  PREDICTED: probable protein S-acyltransferas...  97.4    1e-20   
ref|XP_008389437.1|  PREDICTED: probable protein S-acyltransferas...  97.4    1e-20   
ref|XP_010551410.1|  PREDICTED: probable protein S-acyltransferas...  97.1    2e-20   
ref|XP_010552564.1|  PREDICTED: probable protein S-acyltransferas...  96.3    3e-20   
ref|XP_008221561.1|  PREDICTED: probable protein S-acyltransferas...  95.9    4e-20   
ref|XP_003556715.1|  PREDICTED: probable protein S-acyltransferas...  95.1    7e-20   
ref|XP_010938763.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  94.7    9e-20   
ref|XP_007222005.1|  hypothetical protein PRUPE_ppa002901mg           94.0    2e-19   
ref|XP_007157852.1|  hypothetical protein PHAVU_002G103600g           93.6    3e-19   
gb|AES89967.2|  DHHC-type zinc finger protein                         92.0    9e-19   
ref|XP_010923563.1|  PREDICTED: probable protein S-acyltransferas...  92.0    9e-19   
ref|XP_009403762.1|  PREDICTED: probable protein S-acyltransferas...  90.9    2e-18   
tpg|DAA41304.1|  TPA: hypothetical protein ZEAMMB73_825108            88.6    2e-18   
ref|XP_010936509.1|  PREDICTED: probable protein S-acyltransferas...  89.4    9e-18   
ref|XP_008785932.1|  PREDICTED: probable protein S-acyltransferas...  87.8    3e-17   
ref|XP_008785930.1|  PREDICTED: probable protein S-acyltransferas...  87.8    3e-17   
ref|XP_008787100.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  87.0    5e-17   
ref|XP_008650952.1|  PREDICTED: hypothetical protein isoform X1       86.3    9e-17   
ref|XP_002463125.1|  hypothetical protein SORBIDRAFT_02g038270        86.3    1e-16   Sorghum bicolor [broomcorn]
ref|XP_011075549.1|  PREDICTED: probable protein S-acyltransferas...  84.7    3e-16   
ref|XP_008667938.1|  PREDICTED: LOC100281655 isoform X1               84.7    3e-16   
tpg|DAA41303.1|  TPA: metal ion binding protein                       84.7    3e-16   
ref|XP_006657912.1|  PREDICTED: probable protein S-acyltransferas...  84.3    4e-16   
gb|EMT08286.1|  Putative S-acyltransferase                            84.3    4e-16   
ref|NP_001148046.1|  LOC100281655                                     84.3    4e-16   Zea mays [maize]
ref|NP_001167661.1|  metal ion binding protein                        84.3    4e-16   Zea mays [maize]
ref|XP_009421083.1|  PREDICTED: probable protein S-acyltransferas...  82.4    2e-15   
ref|NP_001175284.1|  Os07g0596000                                     76.6    2e-14   
ref|XP_006661701.1|  PREDICTED: probable protein S-acyltransferas...  76.6    2e-13   
gb|EAZ40525.1|  hypothetical protein OsJ_24981                        76.3    3e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EPS59037.1|  hypothetical protein M569_15773                       71.2    3e-13   
gb|EEC66754.1|  hypothetical protein OsI_33126                        75.9    3e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_010236066.1|  PREDICTED: probable protein S-acyltransferas...  75.9    3e-13   
gb|EAZ04575.1|  hypothetical protein OsI_26727                        75.9    4e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001064375.1|  Os10g0337500                                     75.1    6e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006844837.1|  hypothetical protein AMTR_s00058p00078640        75.1    7e-13   
ref|XP_008228407.1|  PREDICTED: probable protein S-acyltransferas...  70.9    8e-13   
ref|XP_008228408.1|  PREDICTED: probable protein S-acyltransferas...  70.5    9e-13   
gb|EEC74735.1|  hypothetical protein OsI_10473                        73.2    3e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001049335.1|  Os03g0209500                                     71.2    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAN77310.1|  Putative DHHC-type zinc finger protein                70.9    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003607770.1|  CG17075                                          69.7    6e-11   
ref|XP_006649604.1|  PREDICTED: probable protein S-acyltransferas...  68.2    2e-10   
ref|XP_010939066.1|  PREDICTED: probable protein S-acyltransferas...  67.4    2e-10   
ref|XP_004983277.1|  PREDICTED: probable S-acyltransferase At1g69...  67.4    3e-10   
tpg|DAA43859.1|  TPA: hypothetical protein ZEAMMB73_048113            65.9    9e-10   
ref|XP_004985257.1|  PREDICTED: probable S-acyltransferase At1g69...  65.5    1e-09   
ref|NP_001168890.1|  uncharacterized protein LOC100382695             64.7    2e-09   Zea mays [maize]
gb|AFW81950.1|  hypothetical protein ZEAMMB73_895981                  63.5    2e-09   
ref|XP_008652038.1|  PREDICTED: probable protein S-acyltransferas...  64.7    2e-09   
ref|XP_008652044.1|  PREDICTED: probable protein S-acyltransferas...  64.7    2e-09   
ref|XP_003558529.1|  PREDICTED: probable protein S-acyltransferas...  64.3    3e-09   
dbj|BAJ99767.1|  predicted protein                                    63.9    4e-09   
ref|XP_002465665.1|  hypothetical protein SORBIDRAFT_01g043340        63.5    5e-09   Sorghum bicolor [broomcorn]
tpg|DAA46878.1|  TPA: hypothetical protein ZEAMMB73_779274            63.5    6e-09   
tpg|DAA46877.1|  TPA: hypothetical protein ZEAMMB73_779274            63.5    6e-09   
emb|CDY07350.1|  BnaA07g24290D                                        63.5    6e-09   
gb|AAM00987.1|AC090482_16  Putative DHHC-type zinc finger protein     57.4    7e-07   Oryza sativa [red rice]
ref|XP_002961604.1|  hypothetical protein SELMODRAFT_164924           49.3    3e-04   
ref|XP_002971197.1|  hypothetical protein SELMODRAFT_95335            48.9    3e-04   
gb|AAM76752.1|  hypothetical protein                                  47.8    8e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180922.2|  DHHC-type zinc finger family protein                47.8    9e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509854.1|  PREDICTED: protein S-acyltransferase 21-like     47.8    0.001   
ref|XP_002879462.1|  zinc finger family protein                       47.8    0.001   



>ref|XP_009597434.1| PREDICTED: probable protein S-acyltransferase 22 [Nicotiana tomentosiformis]
Length=624

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 96/144 (67%), Gaps = 17/144 (12%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            KLFQYIVMGLY+PLI+   GLYIWCA +DPAD GVFKSKKYI+  DN K  Q KESKLG 
Sbjct  39   KLFQYIVMGLYTPLIISAFGLYIWCAGADPADPGVFKSKKYIKKLDNKKQVQLKESKLGC  98

Query  185  D---SVQDA-------NITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpca  334
            +   S+QDA       N +  +N     AA H A  T+KKI  +HQ      LL LLPCA
Sbjct  99   ETNSSIQDANAASIGENASVKSNKGVEPAADHNA--TQKKITATHQ----RGLLALLPCA  152

Query  335  flcNCSDQREESSEQT-SEDGMFY  403
             +CNC+ + EESS+Q  SEDGMFY
Sbjct  153  LICNCTGRHEESSQQQFSEDGMFY  176



>ref|XP_004239090.1| PREDICTED: probable protein S-acyltransferase 22 [Solanum lycopersicum]
Length=630

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 97/142 (68%), Gaps = 9/142 (6%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            KLFQYIVMGLY+PLI+   GLYIWCAA+DPAD GVF+SKKYI+  D+ K  Q KESKLG 
Sbjct  39   KLFQYIVMGLYTPLIISAFGLYIWCAAADPADPGVFRSKKYIKKLDHEKQVQLKESKLGC  98

Query  185  D---SVQDANITF--DNNSKDPHAATHLAA---QTKKKIETSHQascfsallpllpcafl  340
            +   S+QDAN     +N S   +     AA   +T++KI  + + S  S LL LLPCA +
Sbjct  99   ETNSSIQDANAASIGENASGKSNKGAEPAADHNETEQKITATRERSFSSGLLALLPCALI  158

Query  341  cNCSDQREESS-EQTSEDGMFY  403
             NC+ + EESS +Q SEDGMFY
Sbjct  159  SNCTGRHEESSQQQLSEDGMFY  180



>ref|XP_009770437.1| PREDICTED: probable protein S-acyltransferase 22 isoform X2 [Nicotiana 
sylvestris]
Length=625

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 95/145 (66%), Gaps = 19/145 (13%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            KLFQYIVMGLY+PLI+   GLYIWCA +DPAD GVFKSKKY++  DN K  Q KESKLG 
Sbjct  39   KLFQYIVMGLYTPLIISAFGLYIWCAGADPADPGVFKSKKYLKKLDNKKQDQLKESKLGC  98

Query  185  D---SVQDANITF--------DNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpc  331
            +   S+QDAN            N   +P A  ++   T+KKI  +HQ      LL LLPC
Sbjct  99   ETNSSIQDANAASIGENASVKSNKGAEPAAGHNV---TQKKITATHQ----RGLLALLPC  151

Query  332  aflcNCSDQREESS-EQTSEDGMFY  403
            A +CNC+ + EESS +Q SEDGMFY
Sbjct  152  ALICNCTGRHEESSQQQLSEDGMFY  176



>ref|XP_009770431.1| PREDICTED: probable protein S-acyltransferase 22 isoform X1 [Nicotiana 
sylvestris]
Length=627

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 95/145 (66%), Gaps = 19/145 (13%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            KLFQYIVMGLY+PLI+   GLYIWCA +DPAD GVFKSKKY++  DN K  Q KESKLG 
Sbjct  41   KLFQYIVMGLYTPLIISAFGLYIWCAGADPADPGVFKSKKYLKKLDNKKQDQLKESKLGC  100

Query  185  D---SVQDANITF--------DNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpc  331
            +   S+QDAN            N   +P A  ++   T+KKI  +HQ      LL LLPC
Sbjct  101  ETNSSIQDANAASIGENASVKSNKGAEPAAGHNV---TQKKITATHQ----RGLLALLPC  153

Query  332  aflcNCSDQREESS-EQTSEDGMFY  403
            A +CNC+ + EESS +Q SEDGMFY
Sbjct  154  ALICNCTGRHEESSQQQLSEDGMFY  178



>ref|XP_006348734.1| PREDICTED: probable protein S-acyltransferase 22-like [Solanum 
tuberosum]
Length=630

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 96/142 (68%), Gaps = 9/142 (6%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            KL QYIVMGLY+PLI+   GLYIWCAA+DPAD GVFKSKKY++  D+ K  Q KESKLG 
Sbjct  39   KLLQYIVMGLYTPLIISAFGLYIWCAAADPADPGVFKSKKYLKKLDHKKQVQLKESKLGC  98

Query  185  D---SVQDANITF--DNNSKDPHAATHLAA---QTKKKIETSHQascfsallpllpcafl  340
            +   S+QDAN     +N S   +     AA   +T++KI  +   SC S LL LLPCA +
Sbjct  99   ETNSSIQDANAASIGENASGKSNKGAEPAADHNETEQKITDTRHRSCSSGLLALLPCAII  158

Query  341  cNCSDQREESS-EQTSEDGMFY  403
             NC+ + EESS +Q SEDGMFY
Sbjct  159  SNCAGRHEESSQQQLSEDGMFY  180



>emb|CDY51503.1| BnaC06g43440D [Brassica napus]
Length=587

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 81/134 (60%), Gaps = 6/134 (4%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLG  181
            +KL QYI MG+YSPLI CV+GLYIWCAASDPAD GVF+SKKY++V +N K  Q+K++K G
Sbjct  38   SKLHQYIAMGIYSPLITCVVGLYIWCAASDPADRGVFRSKKYLKVPENEKFTQSKDTKDG  97

Query  182  GDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQR  361
              S           S D         +T KK+E+S Q S    LL          CS + 
Sbjct  98   CGSTPGG-----AKSHDSTCVQDQENRTSKKLESS-QKSSIMRLLCSPCALLCGCCSGRG  151

Query  362  EESSEQTSEDGMFY  403
            E S +QTSEDGMFY
Sbjct  152  ESSEQQTSEDGMFY  165



>gb|KDO83043.1| hypothetical protein CISIN_1g046435mg [Citrus sinensis]
Length=630

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 85/143 (59%), Gaps = 11/143 (8%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            ++ Q I+MG+YSPLI CV GLYIWCAA+DPADSGVFKSKKY+++ D+ KS++ K+SKLGG
Sbjct  39   RILQLIIMGIYSPLIGCVFGLYIWCAAADPADSGVFKSKKYLKIPDSGKSSRPKDSKLGG  98

Query  185  D---SVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflc----  343
            D   S+ DAN     + K     T  A  T K + +  Q     +         L     
Sbjct  99   DSTSSINDANAATVGH-KPVEMDTMDAETTSKDLNSEVQEKNALSPNSSCCTLVLSPCAF  157

Query  344  --NCSDQREESSE-QTSEDGMFY  403
              NC    EESSE Q SEDGMFY
Sbjct  158  ICNCFGSSEESSEQQMSEDGMFY  180



>ref|XP_006483090.1| PREDICTED: probable protein S-acyltransferase 22-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483091.1| PREDICTED: probable protein S-acyltransferase 22-like isoform 
X2 [Citrus sinensis]
Length=630

 Score =   113 bits (283),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 68/143 (48%), Positives = 85/143 (59%), Gaps = 11/143 (8%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            ++ Q I+MG+YSPLI CV GLYIWCAA+DPADSGVFKSKKY+++ D+ KS++ K+SKLGG
Sbjct  39   RILQLIIMGIYSPLIGCVFGLYIWCAAADPADSGVFKSKKYLKIPDSGKSSRPKDSKLGG  98

Query  185  D---SVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflc----  343
            D   S+ DAN     + K     T  A  T K + +  Q     +         L     
Sbjct  99   DSTSSINDANAATVGH-KPVEMDTMDAETTSKDLNSEVQEKNALSPNSSCCTLVLSPCAF  157

Query  344  --NCSDQREESSE-QTSEDGMFY  403
              NC    EESSE Q SEDGMFY
Sbjct  158  ICNCFGSSEESSEQQMSEDGMFY  180



>gb|KFK41358.1| hypothetical protein AALP_AA2G119800 [Arabis alpina]
Length=593

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 90/135 (67%), Gaps = 9/135 (7%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLG  181
            +K+ QYI +G+Y+PLI CV+GLYIWCAASDPAD GVF+SKKY+++ +N K  Q+K+SK G
Sbjct  38   SKMHQYIAIGIYTPLITCVVGLYIWCAASDPADRGVFRSKKYLKIPENGKFPQSKDSKDG  97

Query  182  GDSVQDANITFDNNS-KDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQ  358
              S      + D+   +DP        ++KKK+E+S +       L   PCA LC+C + 
Sbjct  98   CGSTTGGAKSHDSTCVQDPE------IESKKKLESSEK--LSLLRLLCFPCALLCSCCNG  149

Query  359  REESSEQTSEDGMFY  403
             +ESSEQ SEDGMFY
Sbjct  150  SDESSEQMSEDGMFY  164



>ref|XP_006483092.1| PREDICTED: probable protein S-acyltransferase 22-like isoform 
X3 [Citrus sinensis]
Length=609

 Score =   113 bits (282),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 68/143 (48%), Positives = 85/143 (59%), Gaps = 11/143 (8%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            ++ Q I+MG+YSPLI CV GLYIWCAA+DPADSGVFKSKKY+++ D+ KS++ K+SKLGG
Sbjct  18   RILQLIIMGIYSPLIGCVFGLYIWCAAADPADSGVFKSKKYLKIPDSGKSSRPKDSKLGG  77

Query  185  D---SVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflc----  343
            D   S+ DAN     + K     T  A  T K + +  Q     +         L     
Sbjct  78   DSTSSINDANAATVGH-KPVEMDTMDAETTSKDLNSEVQEKNALSPNSSCCTLVLSPCAF  136

Query  344  --NCSDQREESSE-QTSEDGMFY  403
              NC    EESSE Q SEDGMFY
Sbjct  137  ICNCFGSSEESSEQQMSEDGMFY  159



>ref|XP_006438765.1| hypothetical protein CICLE_v10030950mg [Citrus clementina]
 gb|ESR52005.1| hypothetical protein CICLE_v10030950mg [Citrus clementina]
Length=630

 Score =   110 bits (276),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 67/143 (47%), Positives = 84/143 (59%), Gaps = 11/143 (8%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            ++ Q I+ G+YSPLI CV GLYIWCAA+DPADSGVFKSKKY+++ D+ KS++ K+SKLGG
Sbjct  39   RILQLIITGIYSPLIGCVFGLYIWCAAADPADSGVFKSKKYLKIPDSGKSSRPKDSKLGG  98

Query  185  D---SVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflc----  343
            D   S+ DAN     + K     T  A  T K + +  Q     +         L     
Sbjct  99   DSTSSINDANAATVGH-KPVEMDTMDAETTSKDLNSEVQEKNALSPNSSCCTLVLSPCAF  157

Query  344  --NCSDQREESSE-QTSEDGMFY  403
              NC    EESSE Q SEDGMFY
Sbjct  158  ICNCFGSSEESSEQQMSEDGMFY  180



>ref|XP_011075548.1| PREDICTED: probable protein S-acyltransferase 22 isoform X1 [Sesamum 
indicum]
Length=627

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 87/141 (62%), Gaps = 10/141 (7%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            +LFQYIVMG+Y+PL++C  GLYIWCA +DPAD GVF+SKKY+ + D+ K A+ +ESK GG
Sbjct  39   QLFQYIVMGIYTPLLICAFGLYIWCAGADPADPGVFRSKKYLNILDHKKHAKFRESKHGG  98

Query  185  D---SVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpl--lpcaflcNC  349
            +   S+QDAN       ++ +A   +  ++     T H+    S+      +    L  C
Sbjct  99   ESTSSIQDANAA--AIGEEANAKGKIVVESAAGCNTEHEKKNSSSQKSTCFIGMLALLPC  156

Query  350  S---DQREESSEQTSEDGMFY  403
            +   +  EESS+Q SEDGMFY
Sbjct  157  AYICNSHEESSDQQSEDGMFY  177



>ref|XP_002887235.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63494.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=596

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 83/133 (62%), Gaps = 7/133 (5%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+ QYI MG+Y+PLI CV+GLYIWCAASDPAD GVF+SKKY+++ +N K   +K+ K G 
Sbjct  39   KIHQYIAMGIYTPLITCVVGLYIWCAASDPADRGVFRSKKYLKIPENGKFPLSKDIKDGC  98

Query  185  DSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQRE  364
             S      T    S+D         +T KK+E+S +           PCA LC+C   R+
Sbjct  99   GSA-----TGGAKSRDGTCVEDPENETNKKLESSEK--STLLRSLCSPCALLCSCCGGRD  151

Query  365  ESSEQTSEDGMFY  403
            ESSEQ SEDGMFY
Sbjct  152  ESSEQMSEDGMFY  164



>ref|XP_008446403.1| PREDICTED: probable protein S-acyltransferase 22 [Cucumis melo]
 ref|XP_008446404.1| PREDICTED: probable protein S-acyltransferase 22 [Cucumis melo]
Length=626

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 92/145 (63%), Gaps = 16/145 (11%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQY+++G+Y+PLI  V GLYIWCAA+DPADSGVFKSKKY+ + D  K +  K SKLGG
Sbjct  39   KIFQYVMIGIYTPLITSVFGLYIWCAAADPADSGVFKSKKYVNIPDEGKCSHKKCSKLGG  98

Query  185  D-----------SVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpc  331
            +           SV++ ++  D    D ++   L  QT+K  +++         L   PC
Sbjct  99   ESMSFTHDPNAASVEEKSVDKDTTGADANSKDLL--QTRK--DSAQSKKLSFLSLACFPC  154

Query  332  aflcNCSDQREESSEQ-TSEDGMFY  403
            A++CNC   +EESSEQ TSEDGMFY
Sbjct  155  AYVCNCLSSKEESSEQHTSEDGMFY  179



>ref|XP_004135155.1| PREDICTED: probable S-acyltransferase At1g69420-like [Cucumis 
sativus]
Length=626

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 90/143 (63%), Gaps = 12/143 (8%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQY+++G+Y+PLI  V GLYIWCAA+DPADSGVFKSKKY+ + D  K +  K SKLGG
Sbjct  39   KIFQYVMIGIYTPLITSVFGLYIWCAAADPADSGVFKSKKYVNIPDEGKCSHKKCSKLGG  98

Query  185  DSV---QDANI------TFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaf  337
            DSV    D N       + D ++    A +    QT+K  +++         L   PCA+
Sbjct  99   DSVSFTHDPNAASVEEKSVDKDTTGADANSKDLLQTQK--DSAPSKKLSFLSLACFPCAY  156

Query  338  lcNCSDQREESSEQ-TSEDGMFY  403
            +CNC   +EESSEQ  SEDGMFY
Sbjct  157  VCNCLSSKEESSEQHMSEDGMFY  179



>gb|KGN51955.1| hypothetical protein Csa_5G606460 [Cucumis sativus]
Length=626

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 90/143 (63%), Gaps = 12/143 (8%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQY+++G+Y+PLI  V GLYIWCAA+DPADSGVFKSKKY+ + D  K +  K SKLGG
Sbjct  39   KIFQYVMIGIYTPLITSVFGLYIWCAAADPADSGVFKSKKYVNIPDEGKCSHKKCSKLGG  98

Query  185  DSV---QDANI------TFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaf  337
            DSV    D N       + D ++    A +    QT+K  +++         L   PCA+
Sbjct  99   DSVSFTHDPNAASVEEKSVDKDTTGADANSKDLLQTQK--DSAPSKKLSFLSLACFPCAY  156

Query  338  lcNCSDQREESSEQ-TSEDGMFY  403
            +CNC   +EESSEQ  SEDGMFY
Sbjct  157  VCNCLSSKEESSEQHMSEDGMFY  179



>ref|XP_006391018.1| hypothetical protein EUTSA_v10018316mg [Eutrema salsugineum]
 ref|XP_006391019.1| hypothetical protein EUTSA_v10018316mg [Eutrema salsugineum]
 ref|XP_006391020.1| hypothetical protein EUTSA_v10018316mg [Eutrema salsugineum]
 gb|ESQ28304.1| hypothetical protein EUTSA_v10018316mg [Eutrema salsugineum]
 gb|ESQ28305.1| hypothetical protein EUTSA_v10018316mg [Eutrema salsugineum]
 gb|ESQ28306.1| hypothetical protein EUTSA_v10018316mg [Eutrema salsugineum]
Length=596

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 80/134 (60%), Gaps = 6/134 (4%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLG  181
            NK+ QYI MG+Y+PLI CV+GLYIWCAASDPAD GVF+SKKY+++ +N K  Q+K++K G
Sbjct  38   NKIHQYIAMGIYTPLITCVVGLYIWCAASDPADRGVFRSKKYLKIPENGKFPQSKDTKDG  97

Query  182  GDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQR  361
              S      T    S D          T KK+E+S ++     L         C CS + 
Sbjct  98   CGST-----TGGAKSHDGTCVQDAENGTNKKLESSERSPLRRLLCSPCALLCGC-CSGRD  151

Query  362  EESSEQTSEDGMFY  403
            E S +Q SEDGMFY
Sbjct  152  ESSDQQMSEDGMFY  165



>emb|CDP00383.1| unnamed protein product [Coffea canephora]
Length=626

 Score =   109 bits (272),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 69/142 (49%), Positives = 85/142 (60%), Gaps = 11/142 (8%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            KL+QYIVMGLY+PLIV    LYIWCAA+DPAD GVFKSKKY+++ +  K  Q K+SKLGG
Sbjct  39   KLYQYIVMGLYTPLIVSAFSLYIWCAAADPADPGVFKSKKYLKIQE--KPLQQKQSKLGG  96

Query  185  D---SVQDA------NITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaf  337
            D   S+QDA      + TFD  +K+  A    AAQ +K    + +    + L  L     
Sbjct  97   DSTSSIQDAKAATTGDKTFDEANKEVEAKAEHAAQMEKNASPNQRGHLMALLTFLPCAFL  156

Query  338  lcNCSDQREESSEQTSEDGMFY  403
                S   E S  QTSEDGMFY
Sbjct  157  CKCSSSHEESSEHQTSEDGMFY  178



>ref|XP_011017951.1| PREDICTED: probable protein S-acyltransferase 22 [Populus euphratica]
Length=619

 Score =   108 bits (269),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 67/142 (47%), Positives = 82/142 (58%), Gaps = 11/142 (8%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            KLFQYI MG+Y+PLI C  GLYIWCAA+DPAD GVF+SKKY+++ D+ K    K+SKLGG
Sbjct  39   KLFQYIAMGIYTPLITCAFGLYIWCAAADPADPGVFRSKKYLKIPDSEKHNPQKDSKLGG  98

Query  185  ---DSVQDANI-TFDNNSKDPHAATHLAAQTKKKIET-----SHQascfsallpllpcaf  337
                S+ DAN  T   NS +       A  TKK+ +T     S   S    L+       
Sbjct  99   GSTSSIHDANASTVVGNSLEKEVVG--AESTKKEPKTQIDKLSSGNSSCFQLVFFPCAFI  156

Query  338  lcNCSDQREESSEQTSEDGMFY  403
              +CS   E S  Q SEDGMFY
Sbjct  157  CNHCSSSDESSELQMSEDGMFY  178



>ref|XP_004155378.1| PREDICTED: probable S-acyltransferase At1g69420-like [Cucumis 
sativus]
Length=1028

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 90/143 (63%), Gaps = 12/143 (8%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQY+++G+Y+PLI  V GLYIWCAA+DPADSGVFKSKKY+ + D  K +  K SKLGG
Sbjct  441  KIFQYVMIGIYTPLITSVFGLYIWCAAADPADSGVFKSKKYVNIPDEGKCSHKKCSKLGG  500

Query  185  DSV---QDANI------TFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaf  337
            DSV    D N       + D ++    A +    QT+K  +++         L   PCA+
Sbjct  501  DSVSFTHDPNAASVEEKSVDKDTTGADANSKDLLQTQK--DSAPSKKLSFLSLACFPCAY  558

Query  338  lcNCSDQREESSEQ-TSEDGMFY  403
            +CNC   +EESSEQ  SEDGMFY
Sbjct  559  VCNCLSSKEESSEQHMSEDGMFY  581



>ref|XP_010258225.1| PREDICTED: probable protein S-acyltransferase 22 [Nelumbo nucifera]
Length=629

 Score =   107 bits (267),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 71/144 (49%), Positives = 86/144 (60%), Gaps = 11/144 (8%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQY+VMGLY+PLI  V GLYIWCAA+DPAD GVFKSKKY+    +     +KESKLGG
Sbjct  39   KVFQYVVMGLYTPLITFVFGLYIWCAAADPADPGVFKSKKYVNTVIDGMHCLSKESKLGG  98

Query  185  DSV---QDANIT------FDNNSKDPHAATHLAAQTK-KKIETSHQascfsallpllpca  334
            +S     D N         D    D  A T +   ++ +K  +SH  SC   LL   PC 
Sbjct  99   ESSSSKHDVNAAIVGDKPMDECKVDNDATTEVGPTSEIEKNTSSHSPSCCIYLLGFCPCV  158

Query  335  flcNCSDQREESSE-QTSEDGMFY  403
             + NC    E+SSE QTSEDGMFY
Sbjct  159  VMYNCLSPHEQSSELQTSEDGMFY  182



>ref|XP_009127730.1| PREDICTED: probable protein S-acyltransferase 22 [Brassica rapa]
 ref|XP_009127731.1| PREDICTED: probable protein S-acyltransferase 22 [Brassica rapa]
Length=589

 Score =   107 bits (266),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 64/136 (47%), Positives = 81/136 (60%), Gaps = 9/136 (7%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESK--  175
            NK+ QYI MG+Y+PLI CV+GLYIWCAASDPAD GVF+SKKY+++ +N K  Q+K +K  
Sbjct  38   NKIHQYIAMGIYTPLITCVVGLYIWCAASDPADPGVFRSKKYLKIPENEKFPQSKGTKDS  97

Query  176  LGGDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSD  355
             GG ++  A       S D          T KK E+S Q SC   +L          CS 
Sbjct  98   CGGSAIGGA------KSHDSTCVKDQENGTNKKHESS-QRSCLLRVLCSPCALICGCCSG  150

Query  356  QREESSEQTSEDGMFY  403
            + E S +Q SEDGMFY
Sbjct  151  RDESSEQQMSEDGMFY  166



>ref|XP_002312266.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE89633.2| zinc finger family protein [Populus trichocarpa]
Length=603

 Score =   107 bits (266),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 59/133 (44%), Positives = 78/133 (59%), Gaps = 9/133 (7%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            KLFQYI MG+Y+PLI C  GLYIWCAA+DPAD GVF+SKKY+++ D+ K    K+SKLGG
Sbjct  39   KLFQYIAMGIYTPLITCAFGLYIWCAAADPADPGVFRSKKYLKIPDSEKHNPQKDSKLGG  98

Query  185  DSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQRE  364
             S    +        D +A+T +    +K++ +S   S     +         +CS   E
Sbjct  99   GSTSSIH--------DANASTVVGNSLEKEVVSSGN-SSCFQWVFFPCAFICNHCSSSDE  149

Query  365  ESSEQTSEDGMFY  403
             S  Q SEDGMFY
Sbjct  150  SSELQMSEDGMFY  162



>ref|NP_177101.2| putative S-acyltransferase [Arabidopsis thaliana]
 ref|NP_974114.1| putative S-acyltransferase [Arabidopsis thaliana]
 sp|Q9C533.2|ZDHC1_ARATH RecName: Full=Probable protein S-acyltransferase 22; AltName: 
Full=Probable palmitoyltransferase At1g69420; AltName: Full=Zinc 
finger DHHC domain-containing protein At1g69420 [Arabidopsis 
thaliana]
 gb|AEE34922.1| putative S-acyltransferase [Arabidopsis thaliana]
 gb|AEE34923.1| putative S-acyltransferase [Arabidopsis thaliana]
Length=596

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 82/133 (62%), Gaps = 7/133 (5%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+ QYI MG+Y+PLI CV+GLYIWCAASDPAD GVF+SKKY+++ +N K   AK+ K G 
Sbjct  39   KIHQYIAMGIYTPLITCVVGLYIWCAASDPADRGVFRSKKYLKIPENGKFPLAKDIKDGC  98

Query  185  DSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQRE  364
             S      T    S D          + KK+E+S +       L   PCA LC+C   ++
Sbjct  99   GSA-----TGGAKSHDGTCVEDTENGSNKKLESSER--SSLLRLLCSPCALLCSCCSGKD  151

Query  365  ESSEQTSEDGMFY  403
            ESSEQ SEDGMFY
Sbjct  152  ESSEQMSEDGMFY  164



>emb|CDY44067.1| BnaA02g14310D [Brassica napus]
Length=569

 Score =   105 bits (263),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 64/136 (47%), Positives = 80/136 (59%), Gaps = 9/136 (7%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESK--  175
            NK  QYI MG+Y+PLI CV+GLYIWCAASDPAD GVF+SKKY+++ +N K  Q+K +K  
Sbjct  38   NKTHQYIAMGIYTPLITCVVGLYIWCAASDPADPGVFRSKKYLKIPENEKFPQSKGTKDS  97

Query  176  LGGDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSD  355
             GG ++  A       S D          T KK E+S Q SC   +L          CS 
Sbjct  98   CGGSAIGGA------KSHDSTCVKDQENGTNKKHESS-QRSCLLRVLCSPCALICGCCSG  150

Query  356  QREESSEQTSEDGMFY  403
            + E S +Q SEDGMFY
Sbjct  151  RDESSEQQMSEDGMFY  166



>ref|XP_004490123.1| PREDICTED: probable S-acyltransferase At1g69420-like isoform 
X3 [Cicer arietinum]
Length=628

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 88/142 (62%), Gaps = 9/142 (6%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K++QYIV GLY+PLI CV GLYIWCAA+DPAD GVFKSKKY+++ D+ K    K+SKLGG
Sbjct  39   KIYQYIVTGLYTPLITCVFGLYIWCAAADPADPGVFKSKKYLKIPDSKKRGGLKDSKLGG  98

Query  185  D---SVQDANI-TFDNNSKDPHA----ATHLAAQTKKKIETSHQascfsallpllpcafl  340
            +   SV D N  T    S D  A    AT   A +  + + +   S    L    PCA++
Sbjct  99   ESNSSVNDGNASTVGPKSVDKEALGTEATLKDASSSIENKIAPSPSSSCFLWLFSPCAYV  158

Query  341  cNCSDQREESS-EQTSEDGMFY  403
            C CS   + SS +Q SEDGMFY
Sbjct  159  CGCSSSHDNSSDQQASEDGMFY  180



>emb|CBI22303.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   105 bits (262),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 75/134 (56%), Positives = 95/134 (71%), Gaps = 9/134 (7%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+ QY+VMG+Y+PLI+CV  LY+WCAA+DPADSGVFKSKKY+++ DN K  + KESKLGG
Sbjct  39   KMSQYVVMGVYTPLIICVFSLYVWCAAADPADSGVFKSKKYLKIPDNGKHNRPKESKLGG  98

Query  185  DSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNC-SDQR  361
            +S    N        D +AAT     T++K   S+ +SCF+ LL  +PCAFLCNC S Q 
Sbjct  99   ESTSSIN--------DANAATTGQKPTERKNAPSNHSSCFTGLLVFIPCAFLCNCSSSQE  150

Query  362  EESSEQTSEDGMFY  403
            E S +Q SEDGMFY
Sbjct  151  ESSEQQMSEDGMFY  164



>ref|XP_003613938.1| Palmitoyltransferase [Medicago truncatula]
Length=633

 Score =   105 bits (263),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 67/142 (47%), Positives = 87/142 (61%), Gaps = 9/142 (6%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K++QYIV GLY+PLI CV GLYIWCAA+DPAD GVFKSKKY+++ D+ K +  K+SKLGG
Sbjct  39   KIYQYIVTGLYTPLITCVFGLYIWCAAADPADPGVFKSKKYLKIPDSKKLSGFKDSKLGG  98

Query  185  ---DSVQDANI-TFDNNSKDPHAATHLAAQTKKKIETSHQascfsall----pllpcafl  340
                SV D N  T    S D  A    A+     I    +++   +         PCA++
Sbjct  99   GSNSSVNDGNASTIGPKSMDKEAFGTEASLKDASISIEKKSASPPSPSCFLWLFSPCAYI  158

Query  341  cNCSDQREESSE-QTSEDGMFY  403
            C+C+   E SS+ Q SEDGMFY
Sbjct  159  CSCASSHEHSSDLQASEDGMFY  180



>emb|CDY40920.1| BnaC06g30580D [Brassica napus]
Length=577

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 80/134 (60%), Gaps = 4/134 (3%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLG  181
            +K+ QYI MG+Y+PLI CV+GLYIWCAASDPAD GVF+SKKY++V +N K  Q+K SK  
Sbjct  38   SKIHQYIAMGIYTPLITCVVGLYIWCAASDPADRGVFRSKKYLKVPENGKFPQSKGSK--  95

Query  182  GDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQR  361
             D    + +     S D          T KK+E+S Q SC   +L          CS + 
Sbjct  96   -DGCGGSALGGGAKSHDSTCVQDQENGTNKKLESS-QRSCLLRVLCSPCALICGCCSGRD  153

Query  362  EESSEQTSEDGMFY  403
            E S +Q SEDGMF+
Sbjct  154  ESSEQQMSEDGMFF  167



>emb|CDX95936.1| BnaA07g27950D [Brassica napus]
Length=552

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 81/136 (60%), Gaps = 13/136 (10%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESK--  175
            +K+ QYI MG+Y+PLI CV+GLYIWCAASDPAD GVF+SKKY++V +N K  Q+K SK  
Sbjct  38   SKIHQYIAMGIYTPLITCVVGLYIWCAASDPADRGVFRSKKYLKVPENGKLPQSKGSKDG  97

Query  176  LGGDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSD  355
             GG    D+    D  +              KK+++S Q SCF  +L          CS 
Sbjct  98   CGGAKSHDSTCVQDQEN----------GTNTKKLDSS-QRSCFLRVLCSPCALICGCCSG  146

Query  356  QREESSEQTSEDGMFY  403
            + E S +Q SEDGMFY
Sbjct  147  RDESSEQQMSEDGMFY  162



>ref|XP_010066871.1| PREDICTED: probable protein S-acyltransferase 22 [Eucalyptus 
grandis]
Length=624

 Score =   105 bits (262),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 64/140 (46%), Positives = 80/140 (57%), Gaps = 7/140 (5%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQYI MG+Y+PLI CV GLYIWCAA+DPAD GVFKSKKY++V DN K  + K+SKLGG
Sbjct  39   KMFQYIAMGIYTPLITCVFGLYIWCAAADPADPGVFKSKKYLKVLDNGKYVRQKDSKLGG  98

Query  185  D---SVQDA-NITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCS  352
            +   S+ DA N      S D  A    A ++  + E +   S  +    L        C 
Sbjct  99   ESTSSIHDANNAAAGGKSLDKDAEIAAAKESTAEAERNSAPSKHTTCCALALFPCALMCQ  158

Query  353  ---DQREESSEQTSEDGMFY  403
                  E S +  SEDGMFY
Sbjct  159  CCSSSDESSEKHISEDGMFY  178



>ref|XP_004490124.1| PREDICTED: probable S-acyltransferase At1g69420-like isoform 
X4 [Cicer arietinum]
Length=615

 Score =   105 bits (262),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 70/142 (49%), Positives = 88/142 (62%), Gaps = 9/142 (6%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K++QYIV GLY+PLI CV GLYIWCAA+DPAD GVFKSKKY+++ D+ K    K+SKLGG
Sbjct  39   KIYQYIVTGLYTPLITCVFGLYIWCAAADPADPGVFKSKKYLKIPDSKKRGGLKDSKLGG  98

Query  185  D---SVQDANI-TFDNNSKDPHA----ATHLAAQTKKKIETSHQascfsallpllpcafl  340
            +   SV D N  T    S D  A    AT   A +  + + +   S    L    PCA++
Sbjct  99   ESNSSVNDGNASTVGPKSVDKEALGTEATLKDASSSIENKIAPSPSSSCFLWLFSPCAYV  158

Query  341  cNCSDQREESS-EQTSEDGMFY  403
            C CS   + SS +Q SEDGMFY
Sbjct  159  CGCSSSHDNSSDQQASEDGMFY  180



>ref|XP_004490122.1| PREDICTED: probable S-acyltransferase At1g69420-like isoform 
X2 [Cicer arietinum]
Length=639

 Score =   105 bits (262),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 70/142 (49%), Positives = 88/142 (62%), Gaps = 9/142 (6%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K++QYIV GLY+PLI CV GLYIWCAA+DPAD GVFKSKKY+++ D+ K    K+SKLGG
Sbjct  63   KIYQYIVTGLYTPLITCVFGLYIWCAAADPADPGVFKSKKYLKIPDSKKRGGLKDSKLGG  122

Query  185  D---SVQDANI-TFDNNSKDPHA----ATHLAAQTKKKIETSHQascfsallpllpcafl  340
            +   SV D N  T    S D  A    AT   A +  + + +   S    L    PCA++
Sbjct  123  ESNSSVNDGNASTVGPKSVDKEALGTEATLKDASSSIENKIAPSPSSSCFLWLFSPCAYV  182

Query  341  cNCSDQREESS-EQTSEDGMFY  403
            C CS   + SS +Q SEDGMFY
Sbjct  183  CGCSSSHDNSSDQQASEDGMFY  204



>ref|XP_010511969.1| PREDICTED: probable protein S-acyltransferase 22 [Camelina sativa]
Length=595

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 82/134 (61%), Gaps = 9/134 (7%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+ QYI MG+Y+PLI CV+GLYIWCAASDPAD GVF+SKKY+++ +N K   +K++K G 
Sbjct  39   KMHQYIAMGIYTPLITCVVGLYIWCAASDPADRGVFRSKKYLKIPENGKFPLSKDAKDGC  98

Query  185  DSVQDANITFDNNS-KDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQR  361
             S      T D    +DP   T+   ++ KK             L   PCA LCNC    
Sbjct  99   GSATGGAKTRDGTCLQDPENETNKKLESSKKSSV--------LRLLCSPCALLCNCCSGG  150

Query  362  EESSEQTSEDGMFY  403
            +ESSEQ SEDGMFY
Sbjct  151  DESSEQMSEDGMFY  164



>ref|XP_009105487.1| PREDICTED: probable protein S-acyltransferase 22 [Brassica rapa]
Length=597

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 81/136 (60%), Gaps = 13/136 (10%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESK--  175
            +K+ QYI MG+Y+PLI CV+GLYIWCAASDPAD GVF+SKKY++V +N K  Q+K SK  
Sbjct  38   SKIHQYIAMGIYTPLITCVVGLYIWCAASDPADRGVFRSKKYLKVPENGKFPQSKGSKDG  97

Query  176  LGGDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSD  355
             GG    D+    D  +              KK+++S Q SCF  +L          CS 
Sbjct  98   CGGAKSHDSTCVQDQEN----------GTNTKKLDSS-QGSCFLRVLCSPCALICGCCSG  146

Query  356  QREESSEQTSEDGMFY  403
            + E S +Q SEDGMFY
Sbjct  147  RDESSEQQMSEDGMFY  162



>gb|AES96896.2| DHHC-type zinc finger protein [Medicago truncatula]
Length=617

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 87/142 (61%), Gaps = 9/142 (6%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K++QYIV GLY+PLI CV GLYIWCAA+DPAD GVFKSKKY+++ D+ K +  K+SKLGG
Sbjct  39   KIYQYIVTGLYTPLITCVFGLYIWCAAADPADPGVFKSKKYLKIPDSKKLSGFKDSKLGG  98

Query  185  ---DSVQDANI-TFDNNSKDPHAATHLAAQTKKKIETSHQascfsall----pllpcafl  340
                SV D N  T    S D  A    A+     I    +++   +         PCA++
Sbjct  99   GSNSSVNDGNASTIGPKSMDKEAFGTEASLKDASISIEKKSASPPSPSCFLWLFSPCAYI  158

Query  341  cNCSDQREESSE-QTSEDGMFY  403
            C+C+   E SS+ Q SEDGMFY
Sbjct  159  CSCASSHEHSSDLQASEDGMFY  180



>emb|CDY28549.1| BnaC02g19180D [Brassica napus]
Length=571

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 79/136 (58%), Gaps = 9/136 (7%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESK--  175
            NK+ QYIVMG+Y+PLI CV+GLYIWC ASD AD GVF+SKKY+++ +N K  Q+K +K  
Sbjct  38   NKIHQYIVMGIYTPLITCVVGLYIWCVASDSADPGVFRSKKYLKIPENEKFTQSKGTKDS  97

Query  176  LGGDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSD  355
             GG ++  A       S D          T KK E+S Q S    +L          CS 
Sbjct  98   CGGSAIGGA------KSHDSTCVNDQENGTNKKQESS-QRSRLLRVLCSPCALICGCCSG  150

Query  356  QREESSEQTSEDGMFY  403
            + E S +Q SEDGMFY
Sbjct  151  RDESSEQQISEDGMFY  166



>ref|XP_010258671.1| PREDICTED: probable protein S-acyltransferase 22 [Nelumbo nucifera]
Length=627

 Score =   104 bits (260),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 69/142 (49%), Positives = 89/142 (63%), Gaps = 9/142 (6%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQ---AKESK  175
            K+FQY+VMGLY+PLI CV  LYIWCAA+DPAD GVFKSKKY+  + + K  Q   +K   
Sbjct  39   KVFQYVVMGLYTPLITCVFSLYIWCAAADPADPGVFKSKKYVNTSTDEKYPQPKGSKLGG  98

Query  176  LGGDSVQDANITF-DNNSKDPHAATHL----AAQTKKKIETSHQascfsallpllpcafl  340
                S QDAN +   + + D    + +    +++T+KK  +SH  SC   LL     AF 
Sbjct  99   GSSSSKQDANASLVGDKTIDSAMGSAIGEDPSSETEKKNTSSHSQSCCMYLLGFCSSAFT  158

Query  341  cNCSDQREESSE-QTSEDGMFY  403
            CNCS   E+SSE QTSEDG+FY
Sbjct  159  CNCSSPSEQSSELQTSEDGLFY  180



>ref|XP_004297270.1| PREDICTED: probable S-acyltransferase At1g69420-like [Fragaria 
vesca subsp. vesca]
Length=628

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 90/142 (63%), Gaps = 9/142 (6%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQYIV+GLY+PLI CV  LYIWCAA+DPAD GVF+SKKY+ +  N K  ++K+SKL G
Sbjct  39   KIFQYIVIGLYTPLITCVFSLYIWCAAADPADPGVFRSKKYLNIPANEKHPRSKDSKLCG  98

Query  185  DSV------QDANITFDNNSKDPHA--ATHLAAQTKKKIETSHQascfsallpllpcafl  340
            +S        D+ +      KD      T  A+ +  +++ +   +    +L L PCA++
Sbjct  99   ESTSSMHEANDSTVGGRPLDKDTLGKLGTPKASNSDIEMKGASSENSSCLMLLLSPCAYI  158

Query  341  cNCSDQREESS-EQTSEDGMFY  403
            CNCS   EESS  QTSE+GMFY
Sbjct  159  CNCSGSSEESSLHQTSEEGMFY  180



>ref|XP_004490121.1| PREDICTED: probable S-acyltransferase At1g69420-like isoform 
X1 [Cicer arietinum]
Length=652

 Score =   104 bits (260),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 70/142 (49%), Positives = 88/142 (62%), Gaps = 9/142 (6%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K++QYIV GLY+PLI CV GLYIWCAA+DPAD GVFKSKKY+++ D+ K    K+SKLGG
Sbjct  63   KIYQYIVTGLYTPLITCVFGLYIWCAAADPADPGVFKSKKYLKIPDSKKRGGLKDSKLGG  122

Query  185  D---SVQDANI-TFDNNSKDPHA----ATHLAAQTKKKIETSHQascfsallpllpcafl  340
            +   SV D N  T    S D  A    AT   A +  + + +   S    L    PCA++
Sbjct  123  ESNSSVNDGNASTVGPKSVDKEALGTEATLKDASSSIENKIAPSPSSSCFLWLFSPCAYV  182

Query  341  cNCSDQREESS-EQTSEDGMFY  403
            C CS   + SS +Q SEDGMFY
Sbjct  183  CGCSSSHDNSSDQQASEDGMFY  204



>ref|XP_010532679.1| PREDICTED: probable protein S-acyltransferase 22 [Tarenaya hassleriana]
Length=597

 Score =   104 bits (259),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 57/135 (42%), Positives = 76/135 (56%), Gaps = 2/135 (1%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLG-  181
            K++QYIVMG+Y+PLI CV GLYIWC A+DPAD GVF+SKKY++V  N K ++ KE+K G 
Sbjct  39   KMYQYIVMGIYTPLITCVFGLYIWCGAADPADPGVFRSKKYLKVIGNEKFSREKETKDGC  98

Query  182  -GDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQ  358
               +V     + +N    P           K+   S + S    LL          C+ +
Sbjct  99   VSSAVTGGGRSPENTISHPGTCVQDPENDPKEKPKSSENSSSPLLLCSPCAVICNCCNPR  158

Query  359  REESSEQTSEDGMFY  403
             E S +Q SEDGMFY
Sbjct  159  NESSKQQMSEDGMFY  173



>ref|XP_008339848.1| PREDICTED: probable protein S-acyltransferase 22 [Malus domestica]
Length=621

 Score =   103 bits (258),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 66/136 (49%), Positives = 82/136 (60%), Gaps = 4/136 (3%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQYIVMGLY+PLI CV GLYIWCAA+DPAD  VF+SKKY+ +  + K  + K+SKL G
Sbjct  39   KIFQYIVMGLYTPLITCVFGLYIWCAAADPADPRVFRSKKYLNIPADEKHTRTKDSKLCG  98

Query  185  D---SVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSD  355
            +   S+ DAN       KD       +  +      S        LL   PCA++CNCS 
Sbjct  99   ESTSSMNDANAAGKPLDKDVLGKDGTSKMSSSDGGKSPSEHTSCFLLACSPCAYVCNCSG  158

Query  356  QREESSEQTSEDGMFY  403
              EES +Q SEDGMFY
Sbjct  159  SSEESLQQ-SEDGMFY  173



>ref|XP_002315025.1| zinc finger family protein [Populus trichocarpa]
 gb|EEF01196.1| zinc finger family protein [Populus trichocarpa]
Length=625

 Score =   103 bits (258),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 67/140 (48%), Positives = 81/140 (58%), Gaps = 7/140 (5%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            KLFQ+I MG+Y+PLI C  GLYIWCAA+DPAD GVF+SKKY+++ D+ K    K+SKLGG
Sbjct  39   KLFQHIAMGIYTPLITCAFGLYIWCAAADPADPGVFRSKKYLKIPDSEKHNPQKDSKLGG  98

Query  185  DSV---QDANI-TFDNNSKDPHAATHLAA--QTKKKIETSHQascfsallpllpcaflcN  346
             S     DAN  T    S D  A    A   +   +IE     +         PCA +CN
Sbjct  99   GSTSSKHDANASTVGGKSLDKEAVGSDATLKEPNTQIEKVSSGNSSCFQWVFFPCALICN  158

Query  347  -CSDQREESSEQTSEDGMFY  403
             CS   E S  Q SEDGMFY
Sbjct  159  WCSSSDESSELQMSEDGMFY  178



>ref|XP_007157706.1| hypothetical protein PHAVU_002G091400g [Phaseolus vulgaris]
 gb|ESW29700.1| hypothetical protein PHAVU_002G091400g [Phaseolus vulgaris]
Length=626

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 87/143 (61%), Gaps = 10/143 (7%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K++QYIVMGLY+PLI CV  LYIWCAASDPAD GVFKSKKY+++ D+ +    K SKLGG
Sbjct  39   KIYQYIVMGLYTPLITCVFALYIWCAASDPADPGVFKSKKYLKIPDSKQLDGLKNSKLGG  98

Query  185  D---SVQDANI------TFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaf  337
            +   S+ D N       + D       A+   AA + +K   S   S    LL   PCA+
Sbjct  99   ESTSSMHDGNASTVGPKSVDKEELGTEASFKGAAISVEKKNASSSPSSSCLLLLCSPCAY  158

Query  338  lcNCSDQREESS-EQTSEDGMFY  403
            +C CS   +ES  +Q SEDGMFY
Sbjct  159  ICGCSSSSKESCDQQASEDGMFY  181



>ref|XP_007045986.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao]
 gb|EOY01818.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao]
Length=627

 Score =   103 bits (257),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 47/72 (65%), Positives = 59/72 (82%), Gaps = 3/72 (4%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQYIVMG+Y+PLI+C  GLYIWCAA+DPAD GVFKSKKY+++ +N K + AK+SKLGG
Sbjct  39   KMFQYIVMGIYTPLIMCCFGLYIWCAAADPADPGVFKSKKYLKIPNNGKYSGAKDSKLGG  98

Query  185  D---SVQDANIT  211
            D   S+ D N T
Sbjct  99   DSTASMHDHNTT  110



>ref|XP_007045987.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao]
 gb|EOY01819.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao]
Length=606

 Score =   103 bits (256),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/72 (65%), Positives = 59/72 (82%), Gaps = 3/72 (4%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQYIVMG+Y+PLI+C  GLYIWCAA+DPAD GVFKSKKY+++ +N K + AK+SKLGG
Sbjct  39   KMFQYIVMGIYTPLIMCCFGLYIWCAAADPADPGVFKSKKYLKIPNNGKYSGAKDSKLGG  98

Query  185  D---SVQDANIT  211
            D   S+ D N T
Sbjct  99   DSTASMHDHNTT  110



>ref|XP_004514247.1| PREDICTED: probable S-acyltransferase At1g69420-like [Cicer arietinum]
Length=625

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 89/144 (62%), Gaps = 11/144 (8%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLG  181
            NK++QYIV+ LY+PLI  V GLYIWCAA+DP+D GVFKSKKY+++ DN K    K SKLG
Sbjct  38   NKMYQYIVIALYTPLITVVFGLYIWCAAADPSDPGVFKSKKYLKIPDNKKVVGHKSSKLG  97

Query  182  GD---SVQDAN------ITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpca  334
             +   S+ DAN       + DN +         A+ + +K   S  +     LL   PCA
Sbjct  98   EESTPSMHDANDSTVGGNSMDNETFGTEGNMKNASNSVEKANAS-SSCLSCFLLVCSPCA  156

Query  335  flcNCSDQREESSE-QTSEDGMFY  403
            ++C CS   EESS+ QTSEDGMFY
Sbjct  157  YICRCSGSSEESSDKQTSEDGMFY  180



>ref|XP_010108730.1| putative S-acyltransferase [Morus notabilis]
 gb|EXC20041.1| putative S-acyltransferase [Morus notabilis]
Length=628

 Score =   102 bits (255),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 62/144 (43%), Positives = 82/144 (57%), Gaps = 12/144 (8%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQYI MGLY+PLI CV  LYIWCAA+DPAD GVFKSKKY+++ D+ K +  K SKLGG
Sbjct  39   KMFQYIAMGLYTPLITCVFSLYIWCAAADPADPGVFKSKKYLKIVDSGKHSGQKGSKLGG  98

Query  185  DSVQDANITF-----------DNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpc  331
            +S    + T            D+  KDP++    A  T+KK  +  ++S F         
Sbjct  99   ESTSSLHDTTSLKCGEKPLDEDSFGKDPNSKV-AATDTEKKNTSQDRSSWFLLACCSPCA  157

Query  332  aflcNCSDQREESSEQTSEDGMFY  403
                      E S++Q SE+GMFY
Sbjct  158  YICSCSGSGSESSTQQMSEEGMFY  181



>ref|XP_006302036.1| hypothetical protein CARUB_v10020019mg [Capsella rubella]
 gb|EOA34934.1| hypothetical protein CARUB_v10020019mg [Capsella rubella]
Length=595

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 81/134 (60%), Gaps = 9/134 (7%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+ QYI MG+Y+PLI CV+GLYIWCAASDPAD GVF+SKKY+++ +N K   +K++K G 
Sbjct  39   KIHQYIAMGIYTPLITCVVGLYIWCAASDPADRGVFRSKKYLKIPENGKFPLSKDTKDGC  98

Query  185  DSVQDANITFDNNS-KDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQR  361
             S      T D     DP   T+   ++ KK             L   PCA LC+C    
Sbjct  99   GSAMGGAKTCDGTCLHDPENDTNKKLESSKKSSV--------LRLLCSPCALLCSCCSGG  150

Query  362  EESSEQTSEDGMFY  403
            +ESSEQ SEDGMFY
Sbjct  151  DESSEQMSEDGMFY  164



>ref|XP_011012654.1| PREDICTED: probable protein S-acyltransferase 22 [Populus euphratica]
Length=626

 Score =   102 bits (254),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 69/140 (49%), Positives = 83/140 (59%), Gaps = 7/140 (5%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            KLFQ+I MG+Y+PLI C  GLYIWCAA+DPADSGVF+SKKY+++ D+ K    K+SK GG
Sbjct  39   KLFQHIAMGIYTPLITCAFGLYIWCAAADPADSGVFRSKKYLKIPDSEKHNPQKDSKPGG  98

Query  185  DSV---QDANI-TFDNNSKDPHAATHLAA--QTKKKIETSHQascfsallpllpcaflcN  346
             S     DAN  T    S D  A    A   +   +IE     + F  L    PCA +CN
Sbjct  99   GSTSSKHDANASTVGGKSLDKEAVGSDATLKEPNTQIEKVSSGNSFCFLWVFFPCALICN  158

Query  347  -CSDQREESSEQTSEDGMFY  403
             CS   E S  Q SEDGMFY
Sbjct  159  WCSSSDESSELQMSEDGMFY  178



>ref|XP_002268416.1| PREDICTED: probable protein S-acyltransferase 22 [Vitis vinifera]
Length=632

 Score =   102 bits (254),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 58/70 (83%), Gaps = 3/70 (4%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+ QY+VMG+Y+PLI+CV  LY+WCAA+DPADSGVFKSKKY+++ DN K  + KESKLGG
Sbjct  39   KMSQYVVMGVYTPLIICVFSLYVWCAAADPADSGVFKSKKYLKIPDNGKHNRPKESKLGG  98

Query  185  D---SVQDAN  205
            +   S+ DAN
Sbjct  99   ESTSSINDAN  108



>ref|XP_010551409.1| PREDICTED: probable protein S-acyltransferase 22 isoform X2 [Tarenaya 
hassleriana]
Length=597

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 86/145 (59%), Gaps = 14/145 (10%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLG-  181
            K++QYI MG+Y+PLI CV  LYIWCAA+DPAD GVF SKKY++V +N K  +AKE K G 
Sbjct  39   KMYQYIAMGIYTPLIACVFSLYIWCAAADPADPGVFLSKKYLKVLENGKFPRAKEMKNGY  98

Query  182  ---------GDSVQDANITFDNNSKDPHAATH-LAAQTKKKIETSHQascfsallpllpc  331
                     G +      + +N    P  +   +  +  KK+++S         L   PC
Sbjct  99   GSTSSRMHNGGTAIGGGKSLENTMSLPDTSVQDMEHEPGKKLKSSEN--LSPLSLLCSPC  156

Query  332  aflcNCSDQREESSE-QTSEDGMFY  403
            A LC+C  +++ESSE QTSEDGMFY
Sbjct  157  AILCHCCSRKDESSEQQTSEDGMFY  181



>ref|XP_003529465.1| PREDICTED: probable protein S-acyltransferase 22-like [Glycine 
max]
Length=623

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 88/143 (62%), Gaps = 12/143 (8%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K++QYIV GLYS LI+ V GLYIWCAA+DPAD GVFKSKKY+++ D+ K A+ K SKLG 
Sbjct  39   KMYQYIVTGLYSQLIISVFGLYIWCAAADPADPGVFKSKKYLKIPDSKKLAELKNSKLGE  98

Query  185  D---SVQDANITF-DNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflc---  343
            +   S+ +AN +   +NS D  A   +  +T K    S + S  S+    +         
Sbjct  99   ESTSSMHEANASMVGSNSVDKEALGKI--RTSKDASNSVEKSTSSSCSSCILLVSSPCAY  156

Query  344  --NCSDQREESSE-QTSEDGMFY  403
              +CS   E+SS+ QTSEDGMFY
Sbjct  157  ICSCSSPTEKSSDKQTSEDGMFY  179



>gb|KHN42929.1| Putative S-acyltransferase [Glycine soja]
Length=623

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 88/143 (62%), Gaps = 12/143 (8%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K++QYIV GLYS LI+ V GLYIWCAA+DPAD GVFKSKKY+++ D+ K A+ K SKLG 
Sbjct  39   KMYQYIVTGLYSQLIISVFGLYIWCAAADPADPGVFKSKKYLKIPDSKKLAELKNSKLGE  98

Query  185  D---SVQDANITF-DNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflc---  343
            +   S+ +AN +   +NS D  A   +  +T K    S + S  S+    +         
Sbjct  99   ESTSSMHEANASMVGSNSVDKEALGKI--RTSKDASNSVEKSTSSSCSSCILLVSSPCAY  156

Query  344  --NCSDQREESSE-QTSEDGMFY  403
              +CS   E+SS+ QTSEDGMFY
Sbjct  157  ICSCSSPTEKSSDKQTSEDGMFY  179



>ref|XP_010470928.1| PREDICTED: probable protein S-acyltransferase 22 [Camelina sativa]
Length=595

 Score =   102 bits (253),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 64/134 (48%), Positives = 81/134 (60%), Gaps = 9/134 (7%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+ QYI MG+Y+PLI CV+GLYIWCAASDPAD GVF+SKKY+++ +N K   +K++K G 
Sbjct  39   KMHQYIAMGIYTPLITCVVGLYIWCAASDPADRGVFRSKKYLKIPENGKFPLSKDTKDGC  98

Query  185  DSVQDANITFDNNS-KDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQR  361
             S      T D    +DP   T+   ++ KK                 PCA LCNC    
Sbjct  99   GSATGGAKTRDGMCVQDPENETNKKLESSKKSSVLRW--------LCSPCALLCNCCGGG  150

Query  362  EESSEQTSEDGMFY  403
            +ESSEQ SEDGMFY
Sbjct  151  DESSEQMSEDGMFY  164



>ref|XP_002522494.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF39986.1| zinc finger protein, putative [Ricinus communis]
Length=618

 Score =   102 bits (253),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 8/86 (9%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            KLFQYI MG+Y+PLI CV GLYIWCAASDPAD GVF+SKKY+ +  + K A  K+SKLGG
Sbjct  39   KLFQYIAMGIYTPLITCVFGLYIWCAASDPADPGVFRSKKYLNIPPDRKQALQKDSKLGG  98

Query  185  D---SVQDANITFD-----NNSKDPH  238
            +   S+ DAN +       +N KDP+
Sbjct  99   ESTSSMHDANASIVGGKSLDNLKDPN  124



>ref|XP_010683094.1| PREDICTED: probable protein S-acyltransferase 22 [Beta vulgaris 
subsp. vulgaris]
Length=620

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 83/144 (58%), Gaps = 12/144 (8%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            KL+QYI+MGLY+PLIV V GLYIWC ASDPAD GVF+SKKY++ +   +   AK+SKL G
Sbjct  39   KLYQYIIMGLYTPLIVGVFGLYIWCTASDPADPGVFRSKKYLKTSGKGEHTGAKDSKLCG  98

Query  185  DSVQDAN-ITFDNNSKDPH---------AATHLAAQTKKKIETSHQascfsallpllpca  334
            +S      +        PH               A  +  +E+SH  S     +   PC 
Sbjct  99   ESASSKQFVNAAGKGGKPHDEDDKSTDINMEKFKADHEHGVESSH-CSSCVVGILFYPCT  157

Query  335  flcNCSDQREESSE-QTSEDGMFY  403
            FLCNC    EESSE QTSE+GMFY
Sbjct  158  FLCNCMSPSEESSERQTSEEGMFY  181



>gb|KHN37442.1| Putative S-acyltransferase [Glycine soja]
Length=623

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K++QY+VMGLY+PLI CV GLYIWCAASDPAD GVFKSKKY+++ D+ K    K SKLGG
Sbjct  39   KMYQYVVMGLYTPLITCVFGLYIWCAASDPADPGVFKSKKYLKIPDSKKLDGLKNSKLGG  98

Query  185  DS  190
            +S
Sbjct  99   ES  100



>ref|XP_003516296.1| PREDICTED: probable protein S-acyltransferase 22-like [Glycine 
max]
Length=623

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K++QY+VMGLY+PLI CV GLYIWCAASDPAD GVFKSKKY+++ D+ K    K SKLGG
Sbjct  39   KMYQYVVMGLYTPLITCVFGLYIWCAASDPADPGVFKSKKYLKIPDSKKLDGLKNSKLGG  98

Query  185  DS  190
            +S
Sbjct  99   ES  100



>ref|XP_003518747.1| PREDICTED: probable protein S-acyltransferase 22-like [Glycine 
max]
Length=625

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K++QY+VMGLY+PLI CV GLYIWCAASDPAD GVFKSKKY+++ D+ K    K SKLGG
Sbjct  39   KMYQYVVMGLYTPLITCVFGLYIWCAASDPADPGVFKSKKYLKIPDSKKLDGLKNSKLGG  98

Query  185  DS  190
            +S
Sbjct  99   ES  100



>gb|KHN01993.1| Putative S-acyltransferase [Glycine soja]
Length=625

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K++QY+VMGLY+PLI CV GLYIWCAASDPAD GVFKSKKY+++ D+ K    K SKLGG
Sbjct  39   KMYQYVVMGLYTPLITCVFGLYIWCAASDPADPGVFKSKKYLKIPDSKKLDGLKNSKLGG  98

Query  185  DS  190
            +S
Sbjct  99   ES  100



>ref|XP_010551408.1| PREDICTED: probable protein S-acyltransferase 22 isoform X1 [Tarenaya 
hassleriana]
Length=602

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 58/143 (41%), Positives = 75/143 (52%), Gaps = 10/143 (7%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLG-  181
            K++QYI MG+Y+PLI CV  LYIWCAA+DPAD GVF SKKY++V +N K  +AKE K G 
Sbjct  39   KMYQYIAMGIYTPLIACVFSLYIWCAAADPADPGVFLSKKYLKVLENGKFPRAKEMKNGY  98

Query  182  ---------GDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpca  334
                     G +      + +N    P  +         K   S +     +LL      
Sbjct  99   GSTSSRMHNGGTAIGGGKSLENTMSLPDTSVQDMEHEPGKKLKSSENLSPLSLLCSPCAI  158

Query  335  flcNCSDQREESSEQTSEDGMFY  403
                CS + E S +QTSEDGMFY
Sbjct  159  LCHCCSRKDESSEQQTSEDGMFY  181



>gb|AAG52492.1|AC018364_10 hypothetical protein; 3218-172 [Arabidopsis thaliana]
 gb|AAG60091.1|AC073178_2 DHHC-type zinc finger protein, putative [Arabidopsis thaliana]
Length=519

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 66/133 (50%), Gaps = 41/133 (31%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+ QYI MG+Y+PLI CV+GLYIWCAASDPAD GVF+SKKY+++ +N K   AK+ K G 
Sbjct  39   KIHQYIAMGIYTPLITCVVGLYIWCAASDPADRGVFRSKKYLKIPENGKFPLAKDIKDGC  98

Query  185  DSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQRE  364
             S      + D                                           C   ++
Sbjct  99   GSATGGAKSHDG-----------------------------------------TCCSGKD  117

Query  365  ESSEQTSEDGMFY  403
            ESSEQ SEDGMFY
Sbjct  118  ESSEQMSEDGMFY  130



>gb|EYU28813.1| hypothetical protein MIMGU_mgv1a003797mg [Erythranthe guttata]
Length=563

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 81/152 (53%), Gaps = 28/152 (18%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            +LFQYI++G+Y+PL++C  GLYIWCA +DPADSGVF+SKKY  + D+ K  ++ E K GG
Sbjct  39   QLFQYIIIGIYTPLLICAFGLYIWCAGADPADSGVFRSKKYRNIQDSKKHLKSSECKHGG  98

Query  185  -----DSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNC  349
                  S++DAN           AAT   +  + K +    A C +        +   NC
Sbjct  99   GESISSSIRDANCA---------AATPEESNDRGKTDIESAADCNTEHEDKNSSSRKHNC  149

Query  350  --------------SDQREESSEQTSEDGMFY  403
                           +  E+SS+Q SEDGMFY
Sbjct  150  FLTGILVLLPCALLCNSNEDSSDQQSEDGMFY  181



>ref|XP_009356348.1| PREDICTED: probable protein S-acyltransferase 22 [Pyrus x bretschneideri]
Length=624

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 74/141 (52%), Gaps = 11/141 (8%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLG  181
             KLFQYIVMGLY+PLI C   LYIWCAA+DPAD  VF+SKKY+ +  + K  + K+SKL 
Sbjct  38   RKLFQYIVMGLYAPLITCAFSLYIWCAAADPADPRVFRSKKYLNIPADEKHKRTKDSKLC  97

Query  182  GDSVQDANITFDNNSK--DPHAATHLAAQTKKKIETSHQascfsallpllpcaflc----  343
            G+S    N   D N+    P     L      K+ TS      S        A       
Sbjct  98   GESTSSMN---DANAAGGKPLDKDVLGKDGTSKMSTSDGGKSPSENSSCFLLACSPCAYV  154

Query  344  -NCSDQREESSEQTSEDGMFY  403
             NCS   EES +Q  EDGMFY
Sbjct  155  CNCSGSSEESLQQ-GEDGMFY  174



>ref|XP_008389437.1| PREDICTED: probable protein S-acyltransferase 22 [Malus domestica]
Length=624

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 82/141 (58%), Gaps = 11/141 (8%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLG  181
             KLFQY+VMGLY+PLI C   LYIWCAA+DPAD  VF+SKKY+ +  + K  + K+SKL 
Sbjct  38   RKLFQYVVMGLYTPLITCAFSLYIWCAAADPADPRVFRSKKYLNIPADEKHKRTKDSKLC  97

Query  182  GD---SVQDANIT----FDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcafl  340
            G+   S+ DAN       D +       + ++     K  + H       LL   PCA++
Sbjct  98   GESTSSMNDANAAGGKPLDKDVLGKDGTSKMSTSDGGKSPSEHS---SCFLLACSPCAYV  154

Query  341  cNCSDQREESSEQTSEDGMFY  403
            CNCS   EES +Q  EDGMFY
Sbjct  155  CNCSGSSEESLQQ-GEDGMFY  174



>ref|XP_010551410.1| PREDICTED: probable protein S-acyltransferase 22 [Tarenaya hassleriana]
Length=603

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 57/143 (40%), Positives = 74/143 (52%), Gaps = 10/143 (7%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLG-  181
            K++QYI MG+Y+PLI CV  LYIWCAA+DPAD GVF SKKY++V +N K  +AKE K G 
Sbjct  39   KMYQYIAMGIYTPLIACVFSLYIWCAAADPADPGVFLSKKYLKVLENGKFPRAKEMKDGY  98

Query  182  ---------GDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpca  334
                     G +      + +N    P  +         K   S +     +LL      
Sbjct  99   GSTSSRMHNGGTAIGGGKSLENAMSLPDTSVQDMEHEPGKKLKSSENLSPLSLLCSPCAI  158

Query  335  flcNCSDQREESSEQTSEDGMFY  403
                CS + E S +Q SEDGMFY
Sbjct  159  LCHCCSRKDESSEQQMSEDGMFY  181



>ref|XP_010552564.1| PREDICTED: probable protein S-acyltransferase 22 [Tarenaya hassleriana]
Length=553

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 57/134 (43%), Positives = 74/134 (55%), Gaps = 32/134 (24%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            +++QYIVMG+Y+ LI CV GLYIWCAASDPAD GVF+SKKY++V +N K A+A E K G 
Sbjct  39   RMYQYIVMGVYTLLITCVFGLYIWCAASDPADPGVFRSKKYVKVPENGKFARADEMKDGN  98

Query  185  DSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQRE  364
             +  D N +  +    P A                                 C+  ++R+
Sbjct  99   AATGDGNSSPISLLCSPFALL-------------------------------CHSCNRRD  127

Query  365  ESSEQ-TSEDGMFY  403
            ESSEQ  SEDGMFY
Sbjct  128  ESSEQKMSEDGMFY  141



>ref|XP_008221561.1| PREDICTED: probable protein S-acyltransferase 22 [Prunus mume]
Length=623

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 58/144 (40%), Positives = 78/144 (54%), Gaps = 14/144 (10%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            ++FQY+VMGLY+PLI CV GLYIWCAA+DPAD GVF+SKKY+ +  + K  + K+SKL G
Sbjct  39   RIFQYVVMGLYTPLITCVFGLYIWCAAADPADPGVFRSKKYLNIPADEKHNRTKDSKLCG  98

Query  185  D---SVQDAN-ITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCS  352
            +   S+ DAN +T      D      L      K+ TS   +   +            C+
Sbjct  99   ESTSSMHDANAVTVGGKPLDKDV---LGKDATSKMSTSEGGTKNESEHSSCFLLACSPCA  155

Query  353  -------DQREESSEQTSEDGMFY  403
                      E S +Q SE+GMFY
Sbjct  156  YIYNCSSSSEESSVQQMSEEGMFY  179



>ref|XP_003556715.1| PREDICTED: probable protein S-acyltransferase 22-like [Glycine 
max]
Length=622

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K++QYIV+GLYSPLI+ V GLYIWCAA+DP D GVFKSKKY+++ D+ K A+ K SKLG 
Sbjct  39   KMYQYIVIGLYSPLIISVFGLYIWCAAADPGDPGVFKSKKYLKIPDSKKLAELKNSKLGE  98

Query  185  DS  190
            +S
Sbjct  99   ES  100



>ref|XP_010938763.1| PREDICTED: LOW QUALITY PROTEIN: probable protein S-acyltransferase 
22 [Elaeis guineensis]
Length=630

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 78/144 (54%), Gaps = 11/144 (8%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            KLF+Y+++GLY+PL+ CV  LYIWCAA DP D G FKSKKY+ + DN K    K S+ G 
Sbjct  39   KLFEYVIIGLYTPLVTCVFALYIWCAAIDPGDPGYFKSKKYLNIEDNGKQIHPKISREGA  98

Query  185  D---SVQDANITFDNNSKDPHAATH-------LAAQTKKKIETSHQascfsallpllpca  334
            +   S+ +A+ T     K     TH       L+ + +KK  +         L      +
Sbjct  99   ELISSINEAHPTTVTGVKPLDKDTHADDTGGKLSDRLEKKKPSCFSMHFSMVLFSRCRLS  158

Query  335  flcN-CSDQREESSEQTSEDGMFY  403
            F+CN C      S +QTSEDGMFY
Sbjct  159  FVCNQCHSHDHSSVQQTSEDGMFY  182



>ref|XP_007222005.1| hypothetical protein PRUPE_ppa002901mg [Prunus persica]
 gb|EMJ23204.1| hypothetical protein PRUPE_ppa002901mg [Prunus persica]
Length=623

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            ++FQY+VMGLY+PLI CV GLYIWCAA+DPAD GVF+SKKY+ +  + K  + K+SKL G
Sbjct  39   RIFQYVVMGLYTPLITCVFGLYIWCAAADPADPGVFRSKKYLNIPADEKHNRTKDSKLCG  98

Query  185  D---SVQDAN  205
            +   S+ DAN
Sbjct  99   ESTSSMHDAN  108



>ref|XP_007157852.1| hypothetical protein PHAVU_002G103600g [Phaseolus vulgaris]
 gb|ESW29846.1| hypothetical protein PHAVU_002G103600g [Phaseolus vulgaris]
Length=617

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 84/141 (60%), Gaps = 7/141 (5%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLG  181
            NK  QYIV+GLYS LI  V GLYIWC ASDPAD GV KSKKYI++ ++ K A+ K SKLG
Sbjct  38   NKTCQYIVVGLYSALITSVFGLYIWCTASDPADPGVLKSKKYIKIPESKKLAEVKNSKLG  97

Query  182  GDSVQDANITFDNNS------KDPHAATHLAAQTKKKIETSHQascfsallpllpcaflc  343
             +S    +  + + +      K+      ++      +E S  +     LL   PCA++C
Sbjct  98   EESTSPMHEVYASTAGASCVDKEGLGTKGISKSASNSVEKSTSSCSSCVLLVSSPCAYIC  157

Query  344  NCSDQREESSE-QTSEDGMFY  403
            +CS   ++S++ Q SEDGMF+
Sbjct  158  SCSSLTDKSTDKQISEDGMFF  178



>gb|AES89967.2| DHHC-type zinc finger protein [Medicago truncatula]
Length=621

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 85/144 (59%), Gaps = 13/144 (9%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K++QYIV+ LY+PLI  V GLYIWCAASDP+D GVF SKKY+++ D+      K SKLG 
Sbjct  39   KMYQYIVVALYTPLITAVFGLYIWCAASDPSDPGVFNSKKYLKIPDSKMGFGLKSSKLGE  98

Query  185  DS---VQDANI-TFDNNSKDPHA------ATHLAAQTKKKIETSHQascfsallpllpca  334
            +S   + DA   T   NS D  A          +   +K I +S        LL   PCA
Sbjct  99   ESTPSMHDAKASTVGGNSMDNEAFGTGGNMKDNSHSVEKAISSS--PCLSRFLLVCSPCA  156

Query  335  flcNCSDQREESSE-QTSEDGMFY  403
            ++C CS   +ESS+ QTSEDGMFY
Sbjct  157  YICRCSGSSKESSDKQTSEDGMFY  180



>ref|XP_010923563.1| PREDICTED: probable protein S-acyltransferase 22 [Elaeis guineensis]
Length=629

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 72/155 (46%), Gaps = 32/155 (21%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLG  181
             KLF+Y+++GLY+PL+ CV  LY WCAA+DP D G+FKSKKY+ + DN K    K S+ G
Sbjct  38   RKLFEYVIIGLYTPLVTCVFCLYAWCAAADPGDPGIFKSKKYLNIEDNGKQTHPKISRQG  97

Query  182  GDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCS---  352
             + +   N        + HAAT   A   K ++  H                  +C    
Sbjct  98   AELISSIN--------EAHAAT---ATGVKPLDMDHTDDTGGKSSDRPEKKKTSSCRMHV  146

Query  353  -----------------DQREESSE-QTSEDGMFY  403
                                E SSE QTSEDGMFY
Sbjct  147  LMVLFSWCPLSFVCGQHHSHEHSSEWQTSEDGMFY  181



>ref|XP_009403762.1| PREDICTED: probable protein S-acyltransferase 22 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403763.1| PREDICTED: probable protein S-acyltransferase 22 [Musa acuminata 
subsp. malaccensis]
Length=624

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 71/144 (49%), Gaps = 16/144 (11%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            KLFQY+VMGLY+PLI CV  LY+WCAA+DP D G+FKSKKY++V D  +   +KE K  G
Sbjct  39   KLFQYVVMGLYTPLIACVFFLYVWCAATDPGDPGIFKSKKYLKVEDYKERFVSKECKQEG  98

Query  185  DSVQ-----------DANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpc  331
             + +           D +I  D    + H+         +++  S               
Sbjct  99   LTKELNVETTAEKQLDGSIDSDAARDELHSRVE-----SERLPGSTITWLVVLFSWCGLS  153

Query  332  aflcNCSDQREESSEQTSEDGMFY  403
                 C    + S EQ SE+GMFY
Sbjct  154  FMCNWCQSHEQSSEEQMSEEGMFY  177



>tpg|DAA41304.1| TPA: hypothetical protein ZEAMMB73_825108 [Zea mays]
Length=314

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = +2

Query  8    LFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGGD  187
            +FQY+V+GLY+PL++CV  LYIWCAA++PAD GVFKSKKY+ +  + K    KE + G  
Sbjct  105  VFQYVVIGLYTPLVLCVFFLYIWCAAANPADPGVFKSKKYLSLYGSGKHRHLKECRKGSS  164

Query  188  SVQ-DANITFDNNSKDPHAATHLA-AQTKKKIETSHQascfsallpllpcaflcNCSDQR  361
             V+     T +    +  A++ ++  Q K  I +   ++  + LL   P +F+ +C    
Sbjct  165  DVRLQLEGTGEKQEHEVAASSEMSMTQYKDNIPSCMSSTFSAFLLLFYPLSFVLSCCQSH  224

Query  362  EESSE-QTSEDGMFY  403
            E SSE Q +E+GMF+
Sbjct  225  EWSSEQQATEEGMFF  239



>ref|XP_010936509.1| PREDICTED: probable protein S-acyltransferase 22 [Elaeis guineensis]
Length=625

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 54/136 (40%), Positives = 83/136 (61%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+F+Y+VMG+Y+PL+ CV  LY+WCAA++PAD G+FKSKK +++  N K  Q KE + GG
Sbjct  39   KIFEYVVMGIYTPLVTCVFFLYVWCAATNPADPGLFKSKKCLQLEGNAKQTQPKEFRGGG  98

Query  185  -DSVQDANITFDNNSKDPHAATHLAAQTKKKIET-SHQascfsallpllpcaflcNCSDQ  358
             ++  +A  T D  + +      +  ++  +++  S         + L  C  LC+ S  
Sbjct  99   PENEANAATTGDKRADETINKEAIDGKSSDRLQKESLSCCNPFLAVFLSWCPLLCDQSHS  158

Query  359  REESSE-QTSEDGMFY  403
            RE+SSE Q SE+GMFY
Sbjct  159  REQSSEQQMSEEGMFY  174



>ref|XP_008785932.1| PREDICTED: probable protein S-acyltransferase 22 isoform X2 [Phoenix 
dactylifera]
Length=628

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 71/155 (46%), Gaps = 32/155 (21%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLG  181
             KLF+Y+++GLY+PL+ CV  LY WCAA+DP D G+FKSKKY+ + DN K    K S+ G
Sbjct  38   RKLFEYVIIGLYTPLVTCVFCLYAWCAATDPGDPGIFKSKKYLNIEDNGKQTHPKISRQG  97

Query  182  GDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCS---  352
             + +   N        + HA T       K ++  H                  +C    
Sbjct  98   AELISSIN--------EAHAVTTTGV---KPLDRDHADDTGGKSSDKPEKEKPSSCGMHI  146

Query  353  --------------DQR---EESSE-QTSEDGMFY  403
                           QR   E SSE Q SEDGMFY
Sbjct  147  LMVLFSWRPLSFVCSQRHSHEHSSERQPSEDGMFY  181



>ref|XP_008785930.1| PREDICTED: probable protein S-acyltransferase 22 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008785931.1| PREDICTED: probable protein S-acyltransferase 22 isoform X1 [Phoenix 
dactylifera]
Length=629

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 71/155 (46%), Gaps = 32/155 (21%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLG  181
             KLF+Y+++GLY+PL+ CV  LY WCAA+DP D G+FKSKKY+ + DN K    K S+ G
Sbjct  38   RKLFEYVIIGLYTPLVTCVFCLYAWCAATDPGDPGIFKSKKYLNIEDNGKQTHPKISRQG  97

Query  182  GDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCS---  352
             + +   N        + HA T       K ++  H                  +C    
Sbjct  98   AELISSIN--------EAHAVTTTGV---KPLDRDHADDTGGKSSDKPEKEKPSSCGMHI  146

Query  353  --------------DQR---EESSE-QTSEDGMFY  403
                           QR   E SSE Q SEDGMFY
Sbjct  147  LMVLFSWRPLSFVCSQRHSHEHSSERQPSEDGMFY  181



>ref|XP_008787100.1| PREDICTED: LOW QUALITY PROTEIN: probable protein S-acyltransferase 
22 [Phoenix dactylifera]
Length=625

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 52/152 (34%), Positives = 75/152 (49%), Gaps = 35/152 (23%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            KLF+Y+V+G+Y+PL+ CV  LY+WCAA++PAD G+F+SKK +++  N K  Q KE +  G
Sbjct  39   KLFEYVVIGIYTPLVTCVFFLYVWCAATNPADPGLFRSKKCLQLEGNAKQTQPKEFR--G  96

Query  185  DSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNC-----  349
            DS+++                H AA   K ++ +                   +C     
Sbjct  97   DSLKN--------------EAHAAATGDKCLDETINKEAIDGKSSDRLPRESLSCCNAFL  142

Query  350  -------------SDQREESSE-QTSEDGMFY  403
                         S  RE+SSE Q SEDGMFY
Sbjct  143  AVFLRWCPLLCNQSHSREQSSEQQMSEDGMFY  174



>ref|XP_008650952.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA63446.1| TPA: hypothetical protein ZEAMMB73_520080 [Zea mays]
Length=613

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 84/143 (59%), Gaps = 15/143 (10%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLG  181
             K+FQY+VMGLY+PL++CV  LYIWCAA++PAD GVFKSKKY+ +  + K    KES+  
Sbjct  38   RKVFQYVVMGLYTPLVLCVFFLYIWCAAANPADPGVFKSKKYLSLYGSGKHKHLKESR--  95

Query  182  GDSVQDANITFD-NNSKDPHAATHLAAQTKKKI-------ETSHQascfsallpllpcaf  337
              +  DA +  +    K  H    +AA +++ I        +   ++   +LL   P +F
Sbjct  96   -KTSSDARLQIEGTREKQEH---EVAASSERSITQYKDNNPSCLSSTLSPSLLLFYPLSF  151

Query  338  lcNCSDQREESSE-QTSEDGMFY  403
            + +C    E SSE Q +E+GMF+
Sbjct  152  VFSCCQPHESSSEQQATEEGMFF  174



>ref|XP_002463125.1| hypothetical protein SORBIDRAFT_02g038270 [Sorghum bicolor]
 gb|EER99646.1| hypothetical protein SORBIDRAFT_02g038270 [Sorghum bicolor]
Length=617

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 56/142 (39%), Positives = 77/142 (54%), Gaps = 15/142 (11%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQY+VMGLY+PL++CV  LYIWCAA++PAD GVFKSKKY+ +  + K     ES+ G 
Sbjct  39   KVFQYVVMGLYTPLVLCVFFLYIWCAAANPADPGVFKSKKYLSLYGSGKHRHLNESRKGS  98

Query  185  DSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpc--------afl  340
                DA +      +      H  A + +K  T H+    S L              +F+
Sbjct  99   ---SDARLQLVGTGEKQE---HEVAPSGEKSMTQHKDKNSSCLSSTFSAFLLLFYPLSFV  152

Query  341  cNCSDQREESSEQT-SEDGMFY  403
             +C    E SSEQ  SE+GMF+
Sbjct  153  FSCCQSHEWSSEQQGSEEGMFF  174



>ref|XP_011075549.1| PREDICTED: probable protein S-acyltransferase 22 isoform X2 [Sesamum 
indicum]
Length=576

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 74/128 (58%), Gaps = 10/128 (8%)
 Frame = +2

Query  44   LIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGGD---SVQDANITF  214
            +++C  GLYIWCA +DPAD GVF+SKKY+ + D+ K A+ +ESK GG+   S+QDAN   
Sbjct  1    MLICAFGLYIWCAGADPADPGVFRSKKYLNILDHKKHAKFRESKHGGESTSSIQDANAA-  59

Query  215  DNNSKDPHAATHLAAQTKKKIETSHQascfsallpl--lpcaflcNCS---DQREESSEQ  379
                ++ +A   +  ++     T H+    S+      +    L  C+   +  EESS+Q
Sbjct  60   -AIGEEANAKGKIVVESAAGCNTEHEKKNSSSQKSTCFIGMLALLPCAYICNSHEESSDQ  118

Query  380  TSEDGMFY  403
             SEDGMFY
Sbjct  119  QSEDGMFY  126



>ref|XP_008667938.1| PREDICTED: LOC100281655 isoform X1 [Zea mays]
Length=711

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 53/135 (39%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = +2

Query  8    LFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGGD  187
            +FQY+V+GLY+PL++CV  LYIWCAA++PAD GVFKSKKY+ +  + K    KE + G  
Sbjct  133  VFQYVVIGLYTPLVLCVFFLYIWCAAANPADPGVFKSKKYLSLYGSGKHRHLKECRKGSS  192

Query  188  SVQ-DANITFDNNSKDPHAATHLA-AQTKKKIETSHQascfsallpllpcaflcNCSDQR  361
             V+     T +    +  A++ ++  Q K  I +   ++  + LL   P +F+ +C    
Sbjct  193  DVRLQLEGTGEKQEHEVAASSEMSMTQYKDNIPSCMSSTFSAFLLLFYPLSFVLSCCQSH  252

Query  362  EESSE-QTSEDGMFY  403
            E SSE Q +E+GMF+
Sbjct  253  EWSSEQQATEEGMFF  267



>tpg|DAA41303.1| TPA: metal ion binding protein [Zea mays]
Length=683

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 53/135 (39%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = +2

Query  8    LFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGGD  187
            +FQY+V+GLY+PL++CV  LYIWCAA++PAD GVFKSKKY+ +  + K    KE + G  
Sbjct  105  VFQYVVIGLYTPLVLCVFFLYIWCAAANPADPGVFKSKKYLSLYGSGKHRHLKECRKGSS  164

Query  188  SVQ-DANITFDNNSKDPHAATHLA-AQTKKKIETSHQascfsallpllpcaflcNCSDQR  361
             V+     T +    +  A++ ++  Q K  I +   ++  + LL   P +F+ +C    
Sbjct  165  DVRLQLEGTGEKQEHEVAASSEMSMTQYKDNIPSCMSSTFSAFLLLFYPLSFVLSCCQSH  224

Query  362  EESSE-QTSEDGMFY  403
            E SSE Q +E+GMF+
Sbjct  225  EWSSEQQATEEGMFF  239



>ref|XP_006657912.1| PREDICTED: probable protein S-acyltransferase 22-like [Oryza 
brachyantha]
Length=617

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 57/138 (41%), Positives = 80/138 (58%), Gaps = 8/138 (6%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQ + +GLY+PL+ CV  LYIWCAA+DPAD GVFKSKKY+R+  + K     E + G 
Sbjct  39   KVFQDVAVGLYTPLVSCVFFLYIWCAAADPADPGVFKSKKYMRLYGSGKHKHPNELRQG-  97

Query  185  DSVQDANITFD-NNSKDPH--AATHLAAQT--KKKIETSHQascfsallpllpcaflcNC  349
              + D  +  +    K  H  AAT   + T  + K  +S  ++    LL   P  F+ +C
Sbjct  98   --ISDVGLQIEGTGGKQEHEFAATSEKSMTHFEDKKPSSCSSTLSYFLLIFYPLYFVFSC  155

Query  350  SDQREESSEQTSEDGMFY  403
               RE S +QTSE+GMF+
Sbjct  156  CQPREWSEQQTSEEGMFF  173



>gb|EMT08286.1| Putative S-acyltransferase [Aegilops tauschii]
Length=534

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 77/139 (55%), Gaps = 9/139 (6%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQ   MGLY+PL++CV  LYIWCAA+DPAD GVFKSKKY R+    K  + KES  G 
Sbjct  39   KVFQDAAMGLYTPLVLCVFLLYIWCAATDPADPGVFKSKKYQRLYGGCKHRRLKESIQG-  97

Query  185  DSVQDANITFDNNSKD-----PHAATHLAAQTKKKIETSHQascfsallpllpcaflcNC  349
              V D  +  +   +        A      + K K  +   A+  + LL   P +F+ +C
Sbjct  98   --VSDVGLQLEGTGEKRGHEVADANEKSMTELKNKSSSCCSATFSAFLLIFSPLSFVFSC  155

Query  350  SDQREESSEQ-TSEDGMFY  403
               RE SSEQ  SEDGMF+
Sbjct  156  CQSREWSSEQHDSEDGMFF  174



>ref|NP_001148046.1| LOC100281655 [Zea mays]
 gb|ACG29576.1| metal ion binding protein [Zea mays]
Length=618

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 53/135 (39%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = +2

Query  8    LFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGGD  187
            +FQY+V+GLY+PL++CV  LYIWCAA++PAD GVFKSKKY+ +  + K    KE + G  
Sbjct  40   VFQYVVIGLYTPLVLCVFFLYIWCAAANPADPGVFKSKKYLSLYGSGKHRHLKECRKGSS  99

Query  188  SVQ-DANITFDNNSKDPHAATHLA-AQTKKKIETSHQascfsallpllpcaflcNCSDQR  361
             V+     T +    +  A++ ++  Q K  I +   ++  + LL   P +F+ +C    
Sbjct  100  DVRLQLEGTGEKQEHEVAASSEMSMTQYKDNIPSCMSSTFSAFLLLFYPLSFVLSCCQSH  159

Query  362  EESSE-QTSEDGMFY  403
            E SSE Q +E+GMF+
Sbjct  160  EWSSEQQATEEGMFF  174



>ref|NP_001167661.1| metal ion binding protein [Zea mays]
 gb|ACG25563.1| metal ion binding protein [Zea mays]
Length=618

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 53/135 (39%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = +2

Query  8    LFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGGD  187
            +FQY+V+GLY+PL++CV  LYIWCAA++PAD GVFKSKKY+ +  + K    KE + G  
Sbjct  40   VFQYVVIGLYTPLVLCVFFLYIWCAAANPADPGVFKSKKYLSLYGSGKHRHLKECRKGSS  99

Query  188  SVQ-DANITFDNNSKDPHAATHLA-AQTKKKIETSHQascfsallpllpcaflcNCSDQR  361
             V+     T +    +  A++ ++  Q K  I +   ++  + LL   P +F+ +C    
Sbjct  100  DVRLQLEGTGEKQEHEVAASSEMSMTQYKDNIPSCMSSTFSAFLLLFYPLSFVLSCCQSH  159

Query  362  EESSE-QTSEDGMFY  403
            E SSE Q +E+GMF+
Sbjct  160  EWSSEQQATEEGMFF  174



>ref|XP_009421083.1| PREDICTED: probable protein S-acyltransferase 22 [Musa acuminata 
subsp. malaccensis]
Length=632

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 47/142 (33%), Positives = 73/142 (51%), Gaps = 12/142 (8%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K FQY+VMGLY+PL+ CV  LY+WCAA+DP D G+F+ KK ++V    +   +KESK  G
Sbjct  39   KPFQYVVMGLYTPLVTCVFCLYVWCAATDPGDPGIFRCKKNLKVEGCREQILSKESKQEG  98

Query  185  DSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCS----  352
             + Q   +  +  ++     +  +  T+ ++ + H++              L  C     
Sbjct  99   STKQ---LNVETTAQKQFEGSKDSVYTRGELHSKHESERLPCNSVPCLAVLLSWCGMSCM  155

Query  353  ----DQREESSE-QTSEDGMFY  403
                   E+SSE Q  E+GMFY
Sbjct  156  CNWCQSHEQSSEQQMDEEGMFY  177



>ref|NP_001175284.1| Os07g0596000 [Oryza sativa Japonica Group]
 dbj|BAH94012.1| Os07g0596000 [Oryza sativa Japonica Group]
Length=248

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 75/141 (53%), Gaps = 14/141 (10%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQ + +GLY+PL+  V  +YIWCAA+DPAD GV KSKKY+R+  + K    KE + G 
Sbjct  39   KVFQDVAVGLYTPLVSFVFFMYIWCAATDPADPGVLKSKKYLRLYGSGKHKHPKEFRHG-  97

Query  185  DSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQ--------ascfsallpllpcafl  340
              + D+ +  +   +      H  A   +K  T ++        ++    L+   P   +
Sbjct  98   --ISDSGLQVEGTGEK---QEHEFAAASEKSTTRYKDNNPSCCSSTSSVFLIIFYPLYLV  152

Query  341  cNCSDQREESSEQTSEDGMFY  403
             +C   RE S +Q SE+GMF+
Sbjct  153  FSCCQPREWSEQQASEEGMFF  173



>ref|XP_006661701.1| PREDICTED: probable protein S-acyltransferase 22-like [Oryza 
brachyantha]
Length=602

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 49/136 (36%), Positives = 75/136 (55%), Gaps = 12/136 (9%)
 Frame = +2

Query  11   FQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAK---ESKLG  181
             QY++MGLY+PLI CV+ LYIWCAA++P D G+FK+KK+ R+  + K  Q     E   G
Sbjct  41   LQYVLMGLYTPLITCVVMLYIWCAATNPGDPGIFKAKKHPRLDKDGKQTQENSEHELHHG  100

Query  182  GDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcafl-cNCSDQ  358
            G S  D     +N+ +       L+   +  + +SH   C    +   P + L   C   
Sbjct  101  GKSFSDGCSVVNNSER-------LSNMFEGNVPSSHPGLCGIPYVLCTPFSCLWKRCFHS  153

Query  359  REESSEQ-TSEDGMFY  403
             ++SS+Q +SE+GMF+
Sbjct  154  DDQSSQQHSSEEGMFF  169



>gb|EAZ40525.1| hypothetical protein OsJ_24981 [Oryza sativa Japonica Group]
Length=617

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 47/141 (33%), Positives = 72/141 (51%), Gaps = 14/141 (10%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQ + +GLY+PL+  V  +YIWCAA+DPAD GV KSKKY+R+  + K    KE + G 
Sbjct  39   KVFQDVAVGLYTPLVSFVFFMYIWCAATDPADPGVLKSKKYLRLYGSGKHKHPKEFRHG-  97

Query  185  DSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpc--------afl  340
              + D+ +  +   +      H  A   +K  T ++ +  S                  +
Sbjct  98   --ISDSGLQVEGTGEKQE---HEFAAASEKSTTRYKDNNPSCCSSTSSVFLIIFYPLYLV  152

Query  341  cNCSDQREESSEQTSEDGMFY  403
             +C   RE S +Q SE+GMF+
Sbjct  153  FSCCQPREWSEQQASEEGMFF  173



>gb|EPS59037.1| hypothetical protein M569_15773, partial [Genlisea aurea]
Length=91

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   FQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKY  127
            FQYIVMG+Y+PL+V   GLYIWCAA+DP DSGV KSKKY
Sbjct  49   FQYIVMGIYTPLLVSSFGLYIWCAAADPVDSGVLKSKKY  87



>gb|EEC66754.1| hypothetical protein OsI_33126 [Oryza sativa Indica Group]
Length=596

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +2

Query  11   FQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQ---AKESKLG  181
             QY++MGLY+PLI CV+ LYIWCAA++P D G+FK+KK+ ++  + K  Q     ES  G
Sbjct  41   LQYVLMGLYTPLITCVVTLYIWCAATNPGDPGIFKAKKHPKLGKDGKQTQEISEHESCQG  100

Query  182  GDSVQDANITFDNNSK  229
            G S  D     +N+ +
Sbjct  101  GKSFSDGCSVVNNSER  116



>ref|XP_010236066.1| PREDICTED: probable protein S-acyltransferase 22 [Brachypodium 
distachyon]
Length=612

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 55/139 (40%), Positives = 74/139 (53%), Gaps = 15/139 (11%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQ   +GLY+PL+ CV  LYIWCAA+DPAD GV KSKKY+R+  + K  Q        
Sbjct  39   KVFQDAAVGLYTPLVFCVFFLYIWCAATDPADPGVLKSKKYLRLYGSCKHRQG-------  91

Query  185  DSVQDANITFD-NNSKDPH----AATHLAAQTKKKIETSHQascfsallpllpcaflcNC  349
              V D  +  +    K  H    A+     Q K K  +   A+  + LL   P +F  +C
Sbjct  92   --VSDVGLQLEGTGEKKEHEVADASETSMTQHKSKSTSCCSAASSALLLIFYPLSFAFSC  149

Query  350  SDQREESSE-QTSEDGMFY  403
               R+ SSE Q SE+GMF+
Sbjct  150  CQSRDWSSEQQASEEGMFF  168



>gb|EAZ04575.1| hypothetical protein OsI_26727 [Oryza sativa Indica Group]
Length=617

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 46/141 (33%), Positives = 71/141 (50%), Gaps = 14/141 (10%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQ + +GLY+PL+  V  +YIWCAA+DPAD GV KSKKY+R+  + K    KE + G 
Sbjct  39   KVFQDVAVGLYTPLVSFVFFMYIWCAATDPADPGVLKSKKYLRLYGSGKHKHPKEFRHG-  97

Query  185  DSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpc--------afl  340
              + D+ +  +   +      H  A   +K  T ++ +                     +
Sbjct  98   --ISDSGLQVEGTGEKQE---HEFAAASEKSTTRYKDNNPFCCSSTSSVFLIIFYPLYLV  152

Query  341  cNCSDQREESSEQTSEDGMFY  403
             +C   RE S +Q SE+GMF+
Sbjct  153  FSCCQPREWSEQQASEEGMFF  173



>ref|NP_001064375.1| Os10g0337500 [Oryza sativa Japonica Group]
 gb|ABB47214.1| zinc finger family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26289.1| Os10g0337500 [Oryza sativa Japonica Group]
 gb|EEE50766.1| hypothetical protein OsJ_31120 [Oryza sativa Japonica Group]
Length=596

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +2

Query  11   FQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQ---AKESKLG  181
             QY++MGLY+PLI CV+ LYIWCAA++P D G+FK+KK+ ++  + K  Q     ES  G
Sbjct  41   LQYVLMGLYTPLITCVVTLYIWCAATNPGDPGIFKAKKHPKLGKDGKQIQEISEHESCQG  100

Query  182  GDSVQDANITFDNNSK  229
            G S  D     +N+ +
Sbjct  101  GKSFSDGCSIVNNSER  116



>ref|XP_006844837.1| hypothetical protein AMTR_s00058p00078640 [Amborella trichopoda]
 gb|ERN06512.1| hypothetical protein AMTR_s00058p00078640 [Amborella trichopoda]
Length=655

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 52/140 (37%), Positives = 76/140 (54%), Gaps = 7/140 (5%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGG  184
            K+FQ++V+G+Y+PL+  V  LYIWCAA+DP D GVFKSKKY  ++++ K +  K S+  G
Sbjct  39   KVFQFVVIGVYTPLVASVFALYIWCAATDPGDPGVFKSKKYQHISNDKKHSHLKGSESVG  98

Query  185  DSVQDANITFDNNSKDPHAA-----THLAAQTKKKIETSHQ-ascfsallpllpcaflcN  346
             +    N     +  +   A       +  ++  K+E           L+   P A L N
Sbjct  99   ATTSPLNDVSVASVGEKGLAEGMDVAPMEGESAGKVEPKRICTIIPMILVGCCPFACLQN  158

Query  347  CSDQREESSE-QTSEDGMFY  403
                 ++SSE QTSEDGMFY
Sbjct  159  LLGSHDQSSEAQTSEDGMFY  178



>ref|XP_008228407.1| PREDICTED: probable protein S-acyltransferase 22 isoform X1 [Prunus 
mume]
Length=134

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 4/64 (6%)
 Frame = +2

Query  26   MGLYSPLIVCVI-GLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGGD---SV  193
            MGL +PLI  V   LYIWCAA+DPAD GVF+SKKY+++  + K  + K+SKL G+   S+
Sbjct  1    MGLDAPLITSVFFSLYIWCAAADPADPGVFRSKKYLKIPADEKHTRRKDSKLCGESTSSM  60

Query  194  QDAN  205
            QDAN
Sbjct  61   QDAN  64



>ref|XP_008228408.1| PREDICTED: probable protein S-acyltransferase 22 isoform X2 [Prunus 
mume]
Length=117

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 4/64 (6%)
 Frame = +2

Query  26   MGLYSPLIVCVI-GLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGGD---SV  193
            MGL +PLI  V   LYIWCAA+DPAD GVF+SKKY+++  + K  + K+SKL G+   S+
Sbjct  1    MGLDAPLITSVFFSLYIWCAAADPADPGVFRSKKYLKIPADEKHTRRKDSKLCGESTSSM  60

Query  194  QDAN  205
            QDAN
Sbjct  61   QDAN  64



>gb|EEC74735.1| hypothetical protein OsI_10473 [Oryza sativa Indica Group]
Length=598

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 50/136 (37%), Positives = 72/136 (53%), Gaps = 12/136 (9%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKL--  178
            K FQY+ M LY+PLI  V+ LYIWCAA++P D G+FKS ++ ++ D  +S +  +  L  
Sbjct  39   KAFQYVAMVLYTPLITSVVVLYIWCAATNPGDPGIFKSAEHPKLKDGRRSQKNSDHGLSQ  98

Query  179  GGDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQ  358
            GG    D     DN+ K       L++  ++K   SH    FS +L          C   
Sbjct  99   GGKMSSDGFNAVDNSEK-------LSSMLEQK--DSHSWPTFSEILCFPFSCLCKRCFHA  149

Query  359  REESSEQ-TSEDGMFY  403
              +SSEQ  SE+GMF+
Sbjct  150  DNQSSEQHMSEEGMFF  165



>ref|NP_001049335.1| Os03g0209500 [Oryza sativa Japonica Group]
 gb|ABF94578.1| zinc finger family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11249.1| Os03g0209500 [Oryza sativa Japonica Group]
 dbj|BAH00714.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58560.1| hypothetical protein OsJ_09865 [Oryza sativa Japonica Group]
Length=598

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 49/136 (36%), Positives = 71/136 (52%), Gaps = 12/136 (9%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKL--  178
            K FQY+ M LY+PLI  V+ LYIWCAA++P D G+FKS ++ ++ D  +S +  +  L  
Sbjct  39   KAFQYVAMVLYTPLITSVVVLYIWCAATNPGDPGIFKSAEHPKLKDGRRSQKNSDHGLSQ  98

Query  179  GGDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQ  358
            GG    D     DN+ K       L++  ++    SH    FS +L          C   
Sbjct  99   GGKMSSDGFNAVDNSEK-------LSSMLEQN--DSHSWPTFSEILCFPFSCLCKRCFHA  149

Query  359  REESSEQ-TSEDGMFY  403
              +SSEQ  SE+GMF+
Sbjct  150  DNQSSEQHMSEEGMFF  165



>gb|AAN77310.1| Putative DHHC-type zinc finger protein [Oryza sativa Japonica 
Group]
Length=586

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 49/136 (36%), Positives = 71/136 (52%), Gaps = 12/136 (9%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKL--  178
            K FQY+ M LY+PLI  V+ LYIWCAA++P D G+FKS ++ ++ D  +S +  +  L  
Sbjct  39   KAFQYVAMVLYTPLITSVVVLYIWCAATNPGDPGIFKSAEHPKLKDGRRSQKNSDHGLSQ  98

Query  179  GGDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQ  358
            GG    D     DN+ K       L++  ++    SH    FS +L          C   
Sbjct  99   GGKMSSDGFNAVDNSEK-------LSSMLEQN--DSHSWPTFSEILCFPFSCLCKRCFHA  149

Query  359  REESSEQ-TSEDGMFY  403
              +SSEQ  SE+GMF+
Sbjct  150  DNQSSEQHMSEEGMFF  165



>ref|XP_003607770.1| CG17075 [Medicago truncatula]
Length=695

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 72/130 (55%), Gaps = 13/130 (10%)
 Frame = +2

Query  47   IVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGGDS---VQDANI-TF  214
            I  V GLYIWCAASDP+D GVF SKKY+++ D+      K SKLG +S   + DA   T 
Sbjct  127  ITAVFGLYIWCAASDPSDPGVFNSKKYLKIPDSKMGFGLKSSKLGEESTPSMHDAKASTV  186

Query  215  DNNSKDPHA------ATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQREESSE  376
              NS D  A          +   +K I +S        LL   PCA++C CS   +ESS+
Sbjct  187  GGNSMDNEAFGTGGNMKDNSHSVEKAISSS--PCLSRFLLVCSPCAYICRCSGSSKESSD  244

Query  377  -QTSEDGMFY  403
             QTSEDGMFY
Sbjct  245  KQTSEDGMFY  254



>ref|XP_006649604.1| PREDICTED: probable protein S-acyltransferase 22-like [Oryza 
brachyantha]
Length=598

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 74/138 (54%), Gaps = 13/138 (9%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRV-ADNIKSAQAKESKL  178
             K  QY+VMGLY+PLI  V+ LYIWCAA++P D G+FKS ++ ++  D  +S +  +  L
Sbjct  38   RKAVQYVVMGLYTPLITSVVLLYIWCAATNPGDPGIFKSAEHPKLNKDGRQSQKNSDHGL  97

Query  179  --GGDSVQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCS  352
              GG    D     DN+ K       L++  ++K   S+  S FS +L          C 
Sbjct  98   SHGGKMSSDGFNAVDNSEK-------LSSMLEQK--DSYSWSTFSEILCFPFSCLCKRCF  148

Query  353  DQREESSEQ-TSEDGMFY  403
                +SSEQ  SE+GMF+
Sbjct  149  HAGNQSSEQHMSEEGMFF  166



>ref|XP_010939066.1| PREDICTED: probable protein S-acyltransferase 22 [Elaeis guineensis]
Length=391

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 43/64 (67%), Gaps = 7/64 (11%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVC-------VIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQA  163
            KLFQY+VMG Y+PL+         V  LY+ CAA+DPAD  VFKSKKY +V +++K  Q 
Sbjct  39   KLFQYVVMGTYTPLVSLFTDQSDNVFCLYVSCAAADPADPEVFKSKKYHQVENSVKQTQP  98

Query  164  KESK  175
            KE +
Sbjct  99   KEFR  102



>ref|XP_004983277.1| PREDICTED: probable S-acyltransferase At1g69420-like [Setaria 
italica]
Length=589

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +2

Query  11   FQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADN  145
             QY+V+GLY+PLI CV+ LY WCAA+DP D G+FK K++ ++ +N
Sbjct  41   LQYVVVGLYTPLITCVVVLYAWCAATDPGDPGIFKLKRHPKIQEN  85



>tpg|DAA43859.1| TPA: hypothetical protein ZEAMMB73_048113 [Zea mays]
Length=563

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESK--  175
             K FQ + M +Y+PLI CV+ LYIWCAA++P D G+F S K +++  N K +     +  
Sbjct  38   TKPFQIVAMAIYTPLITCVVVLYIWCAATNPGDPGIFDSTKNLKLDKNEKHSYVNSDQGI  97

Query  176  -LGGDSVQDANITFDNNSK  229
              GG  + +   T DN+ K
Sbjct  98   NHGGRPLSETFGTADNSEK  116



>ref|XP_004985257.1| PREDICTED: probable S-acyltransferase At1g69420-like [Setaria 
italica]
Length=599

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 7/81 (9%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRV-----ADNIKSAQAK  166
             K FQ + M +Y+PLI CV+ LYIWCAA++P D G+F S K +++       N+ S Q  
Sbjct  38   TKPFQIVAMAIYTPLITCVVVLYIWCAATNPGDPGIFSSTKDLKLHKHEKHSNVNSDQGI  97

Query  167  ESKLGGDSVQDANITFDNNSK  229
                GG  + +A  T DN+ K
Sbjct  98   SH--GGRPLSEAFGTADNSEK  116



>ref|NP_001168890.1| uncharacterized protein LOC100382695 [Zea mays]
 gb|ACN30946.1| unknown [Zea mays]
Length=455

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 44/137 (32%), Positives = 69/137 (50%), Gaps = 21/137 (15%)
 Frame = +2

Query  11   FQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGGDS  190
             QY++MGLY+PLI CVI LYIWCA +DP D G+F           + S +  E +     
Sbjct  41   LQYLLMGLYTPLITCVILLYIWCAGTDPGDPGIF-----------LNSKRPPEKQGSSTH  89

Query  191  VQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQR---  361
                 ++F N  +  H + +++   + K  +S+     +    L    F  +C  +R   
Sbjct  90   EYPEGVSFSNCCRVVHNSENISNNFEVKDSSSY----LTFTRVLCLIYFPFSCLCKRWFH  145

Query  362  --EESSEQ-TSEDGMFY  403
              ++SSEQ TSE+GMF+
Sbjct  146  SDDQSSEQNTSEEGMFF  162



>gb|AFW81950.1| hypothetical protein ZEAMMB73_895981 [Zea mays]
Length=299

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 46/78 (59%), Gaps = 3/78 (4%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESK---  175
            K FQ + M +Y+PLI CV+ LYIWCAA++P D G+F S K +++  N K +     +   
Sbjct  30   KPFQIVAMAIYTPLITCVVVLYIWCAATNPRDPGIFDSTKNLKLDKNEKHSYVNSDQGIN  89

Query  176  LGGDSVQDANITFDNNSK  229
             GG  + +   T DN+ K
Sbjct  90   HGGRPLSETFGTADNSEK  107



>ref|XP_008652038.1| PREDICTED: probable protein S-acyltransferase 22 isoform X1 [Zea 
mays]
 tpg|DAA43860.1| TPA: hypothetical protein ZEAMMB73_048113 [Zea mays]
Length=601

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 46/78 (59%), Gaps = 3/78 (4%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESK---  175
            K FQ + M +Y+PLI CV+ LYIWCAA++P D G+F S K +++  N K +     +   
Sbjct  39   KPFQIVAMAIYTPLITCVVVLYIWCAATNPGDPGIFDSTKNLKLDKNEKHSYVNSDQGIN  98

Query  176  LGGDSVQDANITFDNNSK  229
             GG  + +   T DN+ K
Sbjct  99   HGGRPLSETFGTADNSEK  116



>ref|XP_008652044.1| PREDICTED: probable protein S-acyltransferase 22 isoform X2 [Zea 
mays]
Length=597

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 46/78 (59%), Gaps = 3/78 (4%)
 Frame = +2

Query  5    KLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESK---  175
            K FQ + M +Y+PLI CV+ LYIWCAA++P D G+F S K +++  N K +     +   
Sbjct  39   KPFQIVAMAIYTPLITCVVVLYIWCAATNPGDPGIFDSTKNLKLDKNEKHSYVNSDQGIN  98

Query  176  LGGDSVQDANITFDNNSK  229
             GG  + +   T DN+ K
Sbjct  99   HGGRPLSETFGTADNSEK  116



>ref|XP_003558529.1| PREDICTED: probable protein S-acyltransferase 22 [Brachypodium 
distachyon]
Length=592

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKES---  172
            +K  Q + MGLY+PLI CV+ LYIWCAA++P D G+ K  K++++  + + +Q       
Sbjct  38   SKTAQNVAMGLYTPLITCVVMLYIWCAATNPGDPGISKPSKHLKLDKDGQQSQINSDHGL  97

Query  173  KLGGDSVQDANITFDNNSK  229
              GG S+ +     DN+ K
Sbjct  98   SQGGRSLSEGFNAVDNSEK  116



>dbj|BAJ99767.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 4/72 (6%)
 Frame = +2

Query  14   QYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGGDSV  193
            QY+ MGLY+PLI CV+ LYIWCAA++P D G+ +S ++ R+  + + + +      G  +
Sbjct  42   QYVAMGLYTPLITCVVTLYIWCAATNPGDPGICRSTRHSRLDKDGRQSHSHSHMDSGHGL  101

Query  194  QDANITFDNNSK  229
              A    DN+ K
Sbjct  102  HAA----DNSEK  109



>ref|XP_002465665.1| hypothetical protein SORBIDRAFT_01g043340 [Sorghum bicolor]
 gb|EER92663.1| hypothetical protein SORBIDRAFT_01g043340 [Sorghum bicolor]
Length=567

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESK--  175
             K FQ + M +Y+PLI CV+ LYIWCAA++P D G+F S K +++  + K +     +  
Sbjct  38   TKPFQIVAMAIYTPLITCVVVLYIWCAATNPGDPGIFDSTKNLKLDKHEKHSYVNSDQGI  97

Query  176  -LGGDSVQDANITFDNNSK  229
              GG  + +   T DN+ K
Sbjct  98   NHGGRPLSETFGTADNSEK  116



>tpg|DAA46878.1| TPA: hypothetical protein ZEAMMB73_779274 [Zea mays]
Length=581

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 44/137 (32%), Positives = 69/137 (50%), Gaps = 21/137 (15%)
 Frame = +2

Query  11   FQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGGDS  190
             QY++MGLY+PLI CVI LYIWCA +DP D G+F           + S +  E +     
Sbjct  41   LQYLLMGLYTPLITCVILLYIWCAGTDPGDPGIF-----------LNSKRPPEKQGSSTH  89

Query  191  VQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQR---  361
                 ++F N  +  H + +++   + K  +S+     +    L    F  +C  +R   
Sbjct  90   EYPEGVSFSNCCRVVHNSENISNNFEVKDSSSY----LTFTRVLCLIYFPFSCLCKRWFH  145

Query  362  --EESSEQ-TSEDGMFY  403
              ++SSEQ TSE+GMF+
Sbjct  146  SDDQSSEQNTSEEGMFF  162



>tpg|DAA46877.1| TPA: hypothetical protein ZEAMMB73_779274 [Zea mays]
Length=584

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 44/137 (32%), Positives = 69/137 (50%), Gaps = 21/137 (15%)
 Frame = +2

Query  11   FQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKESKLGGDS  190
             QY++MGLY+PLI CVI LYIWCA +DP D G+F           + S +  E +     
Sbjct  41   LQYLLMGLYTPLITCVILLYIWCAGTDPGDPGIF-----------LNSKRPPEKQGSSTH  89

Query  191  VQDANITFDNNSKDPHAATHLAAQTKKKIETSHQascfsallpllpcaflcNCSDQR---  361
                 ++F N  +  H + +++   + K  +S+     +    L    F  +C  +R   
Sbjct  90   EYPEGVSFSNCCRVVHNSENISNNFEVKDSSSY----LTFTRVLCLIYFPFSCLCKRWFH  145

Query  362  --EESSEQ-TSEDGMFY  403
              ++SSEQ TSE+GMF+
Sbjct  146  SDDQSSEQNTSEEGMFF  162



>emb|CDY07350.1| BnaA07g24290D [Brassica napus]
Length=575

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 57/163 (35%), Positives = 72/163 (44%), Gaps = 41/163 (25%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLI-----------------------------VCVIGLYIWCAASDP  94
            +KL QYI MG+YSPL+                                I  Y +    DP
Sbjct  38   SKLHQYIAMGIYSPLLKPSTLEFSYLHKMWYHYTHLTLSSYVNMESLKIVFYFFPFWMDP  97

Query  95   ADSGVFKSKKYIRVADNIKSAQAKESKLGGDSVQDANITFDNNSKDPHAATHLAAQTKKK  274
            AD GVF+SKKY++V +N K  Q+K +K G  S      + D  S+           TKKK
Sbjct  98   ADRGVFRSKKYLKVPENGKFPQSKYTKNGCGSTTVGAKSHDQESR-----------TKKK  146

Query  275  IETSHQascfsallpllpcaflcNCSDQREESSEQTSEDGMFY  403
            +E+S Q S    LL        C CS + E S  QTSED MFY
Sbjct  147  LESS-QRSSLLRLLCSPCAMLCCCCSGRGESSELQTSEDVMFY  188



>gb|AAM00987.1|AC090482_16 Putative DHHC-type zinc finger protein [Oryza sativa Japonica 
Group]
Length=589

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 34/112 (30%), Positives = 49/112 (44%), Gaps = 39/112 (35%)
 Frame = +2

Query  11   FQYIVMGLYSPLI------------------------------------VCVIGLYIWCA  82
             QY++MGLY+PLI                                     CV+ LYIWCA
Sbjct  41   LQYVLMGLYTPLIDLHLLSVWGDFFCTTPFCVLVGIICGECLGEILHYITCVVTLYIWCA  100

Query  83   ASDPADSGVFKSKKYIRVADNIKSAQ---AKESKLGGDSVQDANITFDNNSK  229
            A++P D G+FK+KK+ ++  + K  Q     ES  GG S  D     +N+ +
Sbjct  101  ATNPGDPGIFKAKKHPKLGKDGKQIQEISEHESCQGGKSFSDGCSIVNNSER  152



>ref|XP_002961604.1| hypothetical protein SELMODRAFT_164924, partial [Selaginella 
moellendorffii]
 gb|EFJ36864.1| hypothetical protein SELMODRAFT_164924, partial [Selaginella 
moellendorffii]
Length=521

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADN  145
            +K+ +Y V+ ++SPL++ V  LYI CAA++PAD G+ K K Y +   N
Sbjct  38   SKVLEYHVIAIFSPLVILVFALYIRCAAANPADPGIEKHKLYGKGGSN  85



>ref|XP_002971197.1| hypothetical protein SELMODRAFT_95335, partial [Selaginella moellendorffii]
 gb|EFJ27795.1| hypothetical protein SELMODRAFT_95335, partial [Selaginella moellendorffii]
Length=523

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADN  145
            +K+ +Y V+ ++SPL++ V  LYI CAA++PAD G+ K K Y +   N
Sbjct  38   SKVLEYHVIAIFSPLVILVFALYIRCAAANPADPGIEKHKLYGKGGSN  85



>gb|AAM76752.1| hypothetical protein [Arabidopsis thaliana]
Length=565

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 34/57 (60%), Gaps = 6/57 (11%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKES  172
            NKL++YI +G+YS L   V+ LYI C   DPAD G+F        ADN  + +++ S
Sbjct  39   NKLYEYIAIGVYSFLAFSVLVLYIRCTGIDPADPGIFVK------ADNTPAHKSQNS  89



>ref|NP_180922.2| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 sp|Q6DR03.1|ZDHC3_ARATH RecName: Full=Protein S-acyltransferase 21; AltName: Full=Probable 
palmitoyltransferase At2g33640; AltName: Full=Zinc finger 
DHHC domain-containing protein At2g33640 [Arabidopsis thaliana]
 gb|AAT69229.1| hypothetical protein At2g33640 [Arabidopsis thaliana]
 gb|AEC08865.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=565

 Score = 47.8 bits (112),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 34/57 (60%), Gaps = 6/57 (11%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKES  172
            NKL++YI +G+YS L   V+ LYI C   DPAD G+F        ADN  + +++ S
Sbjct  39   NKLYEYIAIGVYSFLAFSVLVLYIRCTGIDPADPGIFVK------ADNTPAHKSQNS  89



>ref|XP_010509854.1| PREDICTED: protein S-acyltransferase 21-like [Camelina sativa]
Length=577

 Score = 47.8 bits (112),  Expect = 0.001, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 6/57 (11%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKYIRVADNIKSAQAKES  172
            NKL++YI +G+YS L   V+ LYI C   DPAD G+F     +R ADN  + +++ S
Sbjct  39   NKLYEYIAIGVYSFLAFSVLVLYIRCTGIDPADPGIF-----VR-ADNTPAHKSQNS  89



>ref|XP_002879462.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55721.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=571

 Score = 47.8 bits (112),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    NKLFQYIVMGLYSPLIVCVIGLYIWCAASDPADSGVFKSKKY  127
            NKL++YI +G+YS L   V+ LYI C   DPAD G+F    Y
Sbjct  39   NKLYEYIAIGVYSFLAFSVLVLYIRCTGIDPADPGIFVKADY  80



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508466684456