BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19790_g1_i3 len=608 path=[782:0-15 @798@!:16-443 1226:444-607]

Length=608
                                                                      Score     E

ref|XP_009764874.1|  PREDICTED: probable glutamate carboxypeptida...    103   5e-22   
ref|XP_009623706.1|  PREDICTED: probable glutamate carboxypeptida...    102   2e-21   
ref|XP_010105072.1|  putative glutamate carboxypeptidase 2              100   7e-21   
ref|XP_002323358.2|  hypothetical protein POPTR_0016s06430g           95.5    3e-19   Populus trichocarpa [western balsam poplar]
gb|KHN24331.1|  Putative glutamate carboxypeptidase 2                 93.6    7e-19   
emb|CDP10550.1|  unnamed protein product                              94.7    8e-19   
ref|XP_011042521.1|  PREDICTED: probable glutamate carboxypeptida...  93.6    2e-18   
ref|XP_006356945.1|  PREDICTED: probable glutamate carboxypeptida...  91.7    8e-18   
ref|XP_003537151.1|  PREDICTED: probable glutamate carboxypeptida...  90.5    2e-17   
ref|XP_006481663.1|  PREDICTED: probable glutamate carboxypeptida...  88.6    3e-17   
ref|XP_002524116.1|  Transferrin receptor protein, putative           90.1    3e-17   Ricinus communis
ref|XP_006429985.1|  hypothetical protein CICLE_v10011190mg           89.4    6e-17   
gb|KDP21928.1|  hypothetical protein JCGZ_03066                       89.0    7e-17   
ref|XP_006481662.1|  PREDICTED: probable glutamate carboxypeptida...  88.6    9e-17   
ref|XP_004250770.1|  PREDICTED: probable glutamate carboxypeptida...  86.7    4e-16   
ref|XP_007145752.1|  hypothetical protein PHAVU_007G264800g           86.3    6e-16   
ref|XP_010653230.1|  PREDICTED: probable glutamate carboxypeptida...  86.3    6e-16   
ref|XP_010653229.1|  PREDICTED: probable glutamate carboxypeptida...  86.3    6e-16   
emb|CBI39092.3|  unnamed protein product                              85.9    6e-16   
gb|KEH24309.1|  glutamate carboxypeptidase, putative                  85.5    1e-15   
ref|XP_004494296.1|  PREDICTED: probable glutamate carboxypeptida...  85.5    1e-15   
ref|XP_010672603.1|  PREDICTED: probable glutamate carboxypeptida...  85.5    1e-15   
ref|XP_007163023.1|  hypothetical protein PHAVU_001G199600g           85.1    2e-15   
ref|XP_002466328.1|  hypothetical protein SORBIDRAFT_01g005710        84.7    2e-15   Sorghum bicolor [broomcorn]
dbj|BAM72481.1|  AMP1-like carboxypeptidase                           84.7    2e-15   
ref|XP_004981489.1|  PREDICTED: probable glutamate carboxypeptida...  84.7    2e-15   
ref|XP_008241129.1|  PREDICTED: probable glutamate carboxypeptida...  84.3    2e-15   
gb|KEH24313.1|  glutamate carboxypeptidase, putative                  84.0    3e-15   
tpg|DAA51820.1|  TPA: viviparous8                                     84.0    4e-15   
tpg|DAA51821.1|  TPA: viviparous8                                     84.0    4e-15   
ref|NP_001120724.1|  viviparous8                                      84.0    4e-15   Zea mays [maize]
ref|XP_010555869.1|  PREDICTED: probable glutamate carboxypeptida...  83.2    8e-15   
gb|EYU38716.1|  hypothetical protein MIMGU_mgv1a002286mg              82.4    1e-14   
gb|KFK34711.1|  hypothetical protein AALP_AA5G181800                  82.4    1e-14   
ref|XP_006650705.1|  PREDICTED: probable glutamate carboxypeptida...  80.9    2e-14   
ref|XP_007204052.1|  hypothetical protein PRUPE_ppa026745mg           81.6    2e-14   
ref|NP_567007.1|  glutamate carboxypeptidase                          80.9    3e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CAB77592.1|  Peptidase-like protein                               80.9    3e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAL03993.1|AF357217_1  glutamate carboxypeptidase                  80.9    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009376393.1|  PREDICTED: probable glutamate carboxypeptida...  80.1    4e-14   
ref|XP_008391599.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...  80.1    4e-14   
emb|CDX78257.1|  BnaA09g34520D                                        80.5    5e-14   
ref|XP_009116147.1|  PREDICTED: probable glutamate carboxypeptida...  80.5    5e-14   
ref|XP_002877996.1|  hypothetical protein ARALYDRAFT_485877           80.1    6e-14   
ref|XP_010427181.1|  PREDICTED: probable glutamate carboxypeptida...  80.1    8e-14   
emb|CDX73456.1|  BnaC08g25470D                                        79.7    9e-14   
ref|XP_010908058.1|  PREDICTED: probable glutamate carboxypeptida...  79.3    1e-13   
emb|CDX76133.1|  BnaA04g03970D                                        78.2    2e-13   
ref|XP_010908057.1|  PREDICTED: probable glutamate carboxypeptida...  79.0    2e-13   
ref|XP_010908056.1|  PREDICTED: probable glutamate carboxypeptida...  79.0    2e-13   
ref|XP_009139219.1|  PREDICTED: probable glutamate carboxypeptida...  79.0    2e-13   
gb|ABF99278.1|  glutamate carboxypeptidase II, putative, expressed    75.9    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009379681.1|  PREDICTED: probable glutamate carboxypeptida...  78.2    3e-13   
ref|XP_003559345.1|  PREDICTED: probable glutamate carboxypeptida...  78.2    3e-13   
ref|XP_006403544.1|  hypothetical protein EUTSA_v10010161mg           77.8    4e-13   
ref|XP_006290666.1|  hypothetical protein CARUB_v10016757mg           77.4    6e-13   
ref|XP_008350228.1|  PREDICTED: probable glutamate carboxypeptida...  73.9    6e-13   
ref|XP_009351318.1|  PREDICTED: probable glutamate carboxypeptida...  76.6    6e-13   
ref|XP_008350226.1|  PREDICTED: probable glutamate carboxypeptida...  73.9    7e-13   
ref|XP_008777140.1|  PREDICTED: probable glutamate carboxypeptida...  76.3    1e-12   
ref|XP_010516011.1|  PREDICTED: probable glutamate carboxypeptida...  76.3    1e-12   
ref|XP_010504286.1|  PREDICTED: probable glutamate carboxypeptida...  75.9    2e-12   
ref|NP_001051516.2|  Os03g0790600                                     74.7    2e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAO24914.1|  putative glutamate carboxypeptidase                   74.7    4e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EMT26362.1|  Putative glutamate carboxypeptidase 2                 73.9    4e-12   
ref|XP_004305557.1|  PREDICTED: probable glutamate carboxypeptida...  73.9    8e-12   
ref|XP_008387163.1|  PREDICTED: probable glutamate carboxypeptida...  72.8    2e-11   
ref|XP_008359523.1|  PREDICTED: probable glutamate carboxypeptida...  72.8    2e-11   
gb|KCW48177.1|  hypothetical protein EUGRSUZ_K01904                   71.6    3e-11   
ref|XP_006826386.1|  hypothetical protein AMTR_s00004p00142600        72.0    3e-11   
ref|XP_010036574.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...  72.0    3e-11   
ref|XP_006646308.1|  PREDICTED: probable glutamate carboxypeptida...  71.2    5e-11   
ref|XP_009398816.1|  PREDICTED: probable glutamate carboxypeptida...  70.5    5e-11   
ref|XP_006644681.1|  PREDICTED: probable glutamate carboxypeptida...  71.2    6e-11   
ref|XP_009591681.1|  PREDICTED: probable glutamate carboxypeptida...  70.5    1e-10   
ref|XP_008804069.1|  PREDICTED: probable glutamate carboxypeptida...  68.9    1e-10   
ref|XP_007013008.1|  Peptidase M28 family protein isoform 1           70.1    1e-10   
dbj|BAD86952.1|  unknown protein                                      65.1    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044203.1|  Os01g0740600                                     64.7    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010314059.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...  69.3    2e-10   
gb|KHG30466.1|  putative glutamate carboxypeptidase 2 -like protein   69.7    2e-10   
gb|KFK26210.1|  peptidase m28 family protein                          68.9    3e-10   
ref|XP_011093647.1|  PREDICTED: probable glutamate carboxypeptida...  68.9    3e-10   
ref|XP_011093646.1|  PREDICTED: probable glutamate carboxypeptida...  68.9    3e-10   
gb|EYU27261.1|  hypothetical protein MIMGU_mgv1a002132mg              68.6    5e-10   
ref|NP_001146679.1|  uncharacterized protein LOC100280279             67.4    5e-10   Zea mays [maize]
ref|XP_004136724.1|  PREDICTED: probable glutamate carboxypeptida...  68.2    6e-10   
ref|XP_004165115.1|  PREDICTED: probable glutamate carboxypeptida...  68.2    6e-10   
ref|XP_004491175.1|  PREDICTED: probable glutamate carboxypeptida...  68.2    6e-10   
tpg|DAA57714.1|  TPA: hypothetical protein ZEAMMB73_602143            67.0    8e-10   
ref|XP_010247434.1|  PREDICTED: probable glutamate carboxypeptida...  67.4    1e-09   
ref|XP_010247433.1|  PREDICTED: probable glutamate carboxypeptida...  67.4    1e-09   
emb|CDP03245.1|  unnamed protein product                              67.4    1e-09   
ref|XP_007203613.1|  hypothetical protein PRUPE_ppa002244mg           67.0    1e-09   
ref|XP_008776572.1|  PREDICTED: probable glutamate carboxypeptida...  67.0    1e-09   
gb|EEE55357.1|  hypothetical protein OsJ_03400                        66.6    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008672765.1|  PREDICTED: uncharacterized protein LOC100280...  67.0    1e-09   
gb|KGN59254.1|  hypothetical protein Csa_3G790960                     67.0    1e-09   
ref|XP_009776392.1|  PREDICTED: probable glutamate carboxypeptida...  66.6    2e-09   
ref|XP_008242478.1|  PREDICTED: probable glutamate carboxypeptida...  66.6    2e-09   
ref|XP_009776394.1|  PREDICTED: probable glutamate carboxypeptida...  66.6    2e-09   
ref|XP_008442988.1|  PREDICTED: probable glutamate carboxypeptida...  66.6    2e-09   
ref|XP_002960093.1|  hypothetical protein SELMODRAFT_73556            66.6    2e-09   
ref|XP_009776393.1|  PREDICTED: probable glutamate carboxypeptida...  66.6    2e-09   
ref|XP_006353498.1|  PREDICTED: probable glutamate carboxypeptida...  66.6    2e-09   
dbj|BAD86951.1|  putative glutamate carboxypeptidase                  66.6    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004304505.1|  PREDICTED: probable glutamate carboxypeptida...  66.2    2e-09   
ref|NP_001044202.2|  Os01g0740500                                     66.2    2e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71453.1|  hypothetical protein OsI_03679                        66.2    2e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_002458463.1|  hypothetical protein SORBIDRAFT_03g034150        66.2    2e-09   Sorghum bicolor [broomcorn]
ref|XP_006289406.1|  hypothetical protein CARUB_v10002906mg           66.2    2e-09   
ref|XP_006853725.1|  hypothetical protein AMTR_s00056p00162910        65.9    3e-09   
ref|XP_009416468.1|  PREDICTED: probable glutamate carboxypeptida...  65.9    3e-09   
ref|XP_010420791.1|  PREDICTED: probable glutamate carboxypeptida...  65.9    3e-09   
ref|XP_006400535.1|  hypothetical protein EUTSA_v10012881mg           65.5    3e-09   
gb|ACL52515.1|  unknown                                               65.1    4e-09   Zea mays [maize]
gb|ACG29176.1|  glutamate carboxypeptidase 2                          65.5    4e-09   Zea mays [maize]
ref|XP_008363033.1|  PREDICTED: probable glutamate carboxypeptida...  65.1    4e-09   
ref|XP_006451321.1|  hypothetical protein CICLE_v10007621mg           65.5    4e-09   
gb|KDO66598.1|  hypothetical protein CISIN_1g005260mg                 65.5    4e-09   
gb|KDO66599.1|  hypothetical protein CISIN_1g005260mg                 65.5    4e-09   
ref|XP_006475591.1|  PREDICTED: probable glutamate carboxypeptida...  65.5    4e-09   
ref|XP_002984044.1|  hypothetical protein SELMODRAFT_119241           65.5    4e-09   
ref|NP_197475.2|  peptidase M28 family protein                        65.1    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007029148.1|  Transferrin receptor protein, putative isofo...  65.1    5e-09   
emb|CDY42292.1|  BnaC02g08980D                                        65.1    5e-09   
gb|KEH27221.1|  peptidase M28 family protein                          65.1    5e-09   
gb|AFW85116.1|  hypothetical protein ZEAMMB73_052433                  65.1    5e-09   
ref|XP_008354418.1|  PREDICTED: probable glutamate carboxypeptida...  65.1    6e-09   
ref|XP_008344001.1|  PREDICTED: probable glutamate carboxypeptida...  65.1    6e-09   
ref|XP_010049609.1|  PREDICTED: probable glutamate carboxypeptida...  65.1    6e-09   
ref|XP_002992244.1|  hypothetical protein SELMODRAFT_134963           64.7    7e-09   
ref|XP_002982216.1|  hypothetical protein SELMODRAFT_421595           64.7    7e-09   
gb|EEE55358.1|  hypothetical protein OsJ_03401                        64.3    8e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71454.1|  hypothetical protein OsI_03680                        64.3    8e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_003569769.2|  PREDICTED: probable glutamate carboxypeptida...  64.7    8e-09   
ref|XP_002456339.1|  hypothetical protein SORBIDRAFT_03g034260        64.3    1e-08   Sorghum bicolor [broomcorn]
ref|XP_009121355.1|  PREDICTED: probable glutamate carboxypeptida...  64.3    1e-08   
ref|XP_002871904.1|  peptidase M28 family protein                     64.3    1e-08   
ref|XP_010249479.1|  PREDICTED: probable glutamate carboxypeptida...  64.3    1e-08   
ref|XP_010917281.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...  64.3    1e-08   
ref|XP_010535936.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...  63.9    1e-08   
ref|XP_008363032.1|  PREDICTED: probable glutamate carboxypeptida...  63.9    1e-08   
ref|XP_010493052.1|  PREDICTED: probable glutamate carboxypeptida...  63.5    1e-08   
ref|XP_010493051.1|  PREDICTED: probable glutamate carboxypeptida...  63.9    1e-08   
dbj|BAK02935.1|  predicted protein                                    63.5    2e-08   
emb|CDX92505.1|  BnaA10g15440D                                        63.5    2e-08   
ref|XP_006646309.1|  PREDICTED: probable glutamate carboxypeptida...  63.5    2e-08   
emb|CDY35864.1|  BnaC09g37960D                                        63.2    2e-08   
gb|KHG11397.1|  putative glutamate carboxypeptidase 2                 63.2    2e-08   
ref|XP_004287483.1|  PREDICTED: probable glutamate carboxypeptida...  63.2    2e-08   
emb|CDM84003.1|  unnamed protein product                              63.2    2e-08   
emb|CDY44939.1|  BnaA02g04440D                                        62.8    2e-08   
ref|XP_006572934.1|  PREDICTED: probable glutamate carboxypeptida...  63.2    3e-08   
ref|XP_006572935.1|  PREDICTED: probable glutamate carboxypeptida...  62.8    3e-08   
ref|XP_004969898.1|  PREDICTED: probable glutamate carboxypeptida...  62.8    3e-08   
tpg|DAA57713.1|  TPA: hypothetical protein ZEAMMB73_749382            62.4    3e-08   
gb|KDP33786.1|  hypothetical protein JCGZ_07357                       62.8    3e-08   
ref|XP_002309233.2|  hypothetical protein POPTR_0006s15820g           62.4    4e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011077913.1|  PREDICTED: probable glutamate carboxypeptida...  62.0    5e-08   
emb|CBI27988.3|  unnamed protein product                              62.0    5e-08   
ref|NP_001147292.1|  glutamate carboxypeptidase 2                     62.4    5e-08   Zea mays [maize]
ref|XP_002283565.3|  PREDICTED: probable glutamate carboxypeptida...  62.0    6e-08   Vitis vinifera
ref|XP_006604679.1|  PREDICTED: probable glutamate carboxypeptida...  61.6    7e-08   
gb|KEH27224.1|  peptidase M28 family protein                          57.0    8e-08   
ref|XP_006644691.1|  PREDICTED: probable glutamate carboxypeptida...  61.6    8e-08   
gb|KHN43582.1|  Putative glutamate carboxypeptidase 2                 61.2    8e-08   
dbj|BAJ99016.1|  predicted protein                                    61.2    9e-08   
gb|EAY75780.1|  hypothetical protein OsI_03696                        60.8    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_011007261.1|  PREDICTED: probable glutamate carboxypeptida...  60.8    1e-07   
ref|NP_001044217.1|  Os01g0743300                                     60.8    1e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55364.1|  hypothetical protein OsJ_03414                        60.8    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002514209.1|  dipeptidase, putative                            60.5    2e-07   Ricinus communis
ref|XP_006853724.1|  hypothetical protein AMTR_s00056p00161720        60.5    2e-07   
gb|EMT32222.1|  Putative glutamate carboxypeptidase 2                 59.7    3e-07   
ref|XP_004969919.1|  PREDICTED: probable glutamate carboxypeptida...  58.9    5e-07   
ref|XP_010232288.1|  PREDICTED: probable glutamate carboxypeptida...  58.5    6e-07   
ref|XP_010232289.1|  PREDICTED: probable glutamate carboxypeptida...  58.5    7e-07   
ref|XP_002966822.1|  hypothetical protein SELMODRAFT_87649            58.2    9e-07   
ref|XP_004969900.1|  PREDICTED: probable glutamate carboxypeptida...  58.2    1e-06   
ref|XP_002961183.1|  hypothetical protein SELMODRAFT_61589            57.8    1e-06   
ref|XP_002966823.1|  hypothetical protein SELMODRAFT_61588            57.8    1e-06   
ref|XP_003569777.1|  PREDICTED: probable glutamate carboxypeptida...  57.8    1e-06   
ref|XP_003520727.2|  PREDICTED: probable glutamate carboxypeptida...  55.1    1e-05   
gb|KHN22574.1|  Putative glutamate carboxypeptidase 2                 54.7    1e-05   
gb|ACU21428.1|  unknown                                               53.1    2e-05   Glycine max [soybeans]
ref|XP_001774966.1|  predicted protein                                54.3    2e-05   
ref|XP_001781848.1|  predicted protein                                52.4    4e-05   
ref|XP_001781873.1|  predicted protein                                52.4    5e-05   
gb|EMT11464.1|  hypothetical protein F775_07896                       50.1    5e-05   
ref|XP_003616565.1|  hypothetical protein MTR_5g081820                50.1    3e-04   
ref|XP_002967665.1|  hypothetical protein SELMODRAFT_88219            50.1    4e-04   
ref|XP_002964367.1|  hypothetical protein SELMODRAFT_81471            50.1    4e-04   
ref|XP_003635765.1|  hypothetical protein MTR_006s0019                46.6    5e-04   



>ref|XP_009764874.1| PREDICTED: probable glutamate carboxypeptidase 2 [Nicotiana sylvestris]
Length=707

 Score =   103 bits (258),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKH+VYGP   GE+ELDFFPGI +A+SRS+ LN+ E    IQHEIWR ARAIQRAA+AL
Sbjct  643  WFKHMVYGPRNDGESELDFFPGIANAISRSSGLNSEEHNEAIQHEIWRTARAIQRAAHAL  702

Query  182  KGNLT  196
            KG LT
Sbjct  703  KGELT  707



>ref|XP_009623706.1| PREDICTED: probable glutamate carboxypeptidase 2 [Nicotiana tomentosiformis]
Length=705

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKH+VYGP   GE+ELDFFPGI +A+SRS+ L + E  A IQHEIWR ARAIQRAA+AL
Sbjct  641  WFKHMVYGPRNDGESELDFFPGIANAISRSSGLISEEHNASIQHEIWRTARAIQRAAHAL  700

Query  182  KGNLT  196
            KG LT
Sbjct  701  KGELT  705



>ref|XP_010105072.1| putative glutamate carboxypeptidase 2 [Morus notabilis]
 gb|EXC03810.1| putative glutamate carboxypeptidase 2 [Morus notabilis]
Length=720

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+YGPS+  E++LDFFPGI DA+SR+T ++ +++ AIIQHE+WRVARAIQRA  AL
Sbjct  656  WFKHLIYGPSSDPESKLDFFPGIADAISRTTRMSLSQKKAIIQHEVWRVARAIQRATSAL  715

Query  182  KGNLT  196
            +G LT
Sbjct  716  RGELT  720



>ref|XP_002323358.2| hypothetical protein POPTR_0016s06430g [Populus trichocarpa]
 gb|EEF05119.2| hypothetical protein POPTR_0016s06430g [Populus trichocarpa]
Length=582

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+YGP +  E++LDFFPGI DA+S+ST  +   R A +QHEIWRV RAI+RAA AL
Sbjct  518  WFKHLIYGPPSNYESKLDFFPGIADALSQSTSKSQQNRQAAVQHEIWRVGRAIERAASAL  577

Query  182  KGNLT  196
            KGNLT
Sbjct  578  KGNLT  582



>gb|KHN24331.1| Putative glutamate carboxypeptidase 2 [Glycine soja]
Length=471

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLV+GP +  E++LDFFPGI D++SR   ++  ER A IQHEIWRVARAIQRAA AL
Sbjct  407  WFKHLVFGPPSDHESKLDFFPGIADSLSRMDKMSEKERLAAIQHEIWRVARAIQRAASAL  466

Query  182  KGNL  193
            +G+L
Sbjct  467  RGDL  470



>emb|CDP10550.1| unnamed protein product [Coffea canephora]
Length=696

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+YGP   G +EL+F PG+V A+SR+T +N  ER   IQHE+WRVARAI+RAA AL
Sbjct  632  WFKHLIYGPQIDGGSELNFLPGVVGAISRNTGMNKGERQEAIQHEVWRVARAIERAACAL  691

Query  182  KGNLT  196
            KG+LT
Sbjct  692  KGSLT  696



>ref|XP_011042521.1| PREDICTED: probable glutamate carboxypeptidase 2 [Populus euphratica]
Length=704

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+YGP +  E++LDFFPGI +A+S+ST  +   R A +QHEIWRV RAI+RAA AL
Sbjct  640  WFKHLIYGPPSDYESKLDFFPGIANALSQSTSKSQQNRQAAVQHEIWRVGRAIERAASAL  699

Query  182  KGNLT  196
            KGNLT
Sbjct  700  KGNLT  704



>ref|XP_006356945.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Solanum 
tuberosum]
Length=689

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKH+VYGP   GE+ELDFFPGI +A+S+S+     E+ A IQHEIWR ARAIQRAA+AL
Sbjct  626  WFKHMVYGPRNDGESELDFFPGIANAISKSS--GGGEQNAAIQHEIWRTARAIQRAAHAL  683

Query  182  KGNL  193
            KG L
Sbjct  684  KGEL  687



>ref|XP_003537151.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Glycine 
max]
Length=695

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLV+GP +  E++LDFFPGI D++S    ++  ER A IQHEIWRVARAIQRAA AL
Sbjct  631  WFKHLVFGPPSDHESKLDFFPGIADSLSGMDKMSEKERLAAIQHEIWRVARAIQRAASAL  690

Query  182  KGNL  193
            +G+L
Sbjct  691  RGDL  694



>ref|XP_006481663.1| PREDICTED: probable glutamate carboxypeptidase 2-like isoform 
X2 [Citrus sinensis]
Length=414

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+YGP    E++L  FPGI DA+S+ST ++  +  A+IQHE+WRVARAIQRAA AL
Sbjct  350  WFKHLIYGPHGEYESKLSCFPGIADAISQSTSMSKKDGEALIQHEVWRVARAIQRAASAL  409

Query  182  KGNLT  196
            +G LT
Sbjct  410  RGELT  414



>ref|XP_002524116.1| Transferrin receptor protein, putative [Ricinus communis]
 gb|EEF38326.1| Transferrin receptor protein, putative [Ricinus communis]
Length=709

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+YGPS   E++LDFFPGI DA+S+S  +N  +  A IQHEIWRVARAI +AA AL
Sbjct  645  WFKHLIYGPSGDYESKLDFFPGIADAISKSRSMNKEDGQAAIQHEIWRVARAIDKAASAL  704

Query  182  KGNL  193
            +G L
Sbjct  705  EGRL  708



>ref|XP_006429985.1| hypothetical protein CICLE_v10011190mg [Citrus clementina]
 gb|ESR43225.1| hypothetical protein CICLE_v10011190mg [Citrus clementina]
Length=708

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+YGP    E++L  FPGI DA+S+ST ++  +  A+IQHE+WRVARAIQRAA AL
Sbjct  644  WFKHLIYGPHDEYESKLSCFPGIADAISQSTSMSKKDGEALIQHEVWRVARAIQRAASAL  703

Query  182  KGNLT  196
            +G LT
Sbjct  704  RGELT  708



>gb|KDP21928.1| hypothetical protein JCGZ_03066 [Jatropha curcas]
Length=702

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+YGP    E++L+FFP I DA+SRS ++   +  A IQHEIWRVARAI+RAA AL
Sbjct  638  WFKHLIYGPPGDYESKLEFFPSIADAISRSKNIGRQDGQAAIQHEIWRVARAIERAAGAL  697

Query  182  KGNLT  196
            KG LT
Sbjct  698  KGQLT  702



>ref|XP_006481662.1| PREDICTED: probable glutamate carboxypeptidase 2-like isoform 
X1 [Citrus sinensis]
Length=708

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+YGP    E++L  FPGI DA+S+ST ++  +  A+IQHE+WRVARAIQRAA AL
Sbjct  644  WFKHLIYGPHGEYESKLSCFPGIADAISQSTSMSKKDGEALIQHEVWRVARAIQRAASAL  703

Query  182  KGNLT  196
            +G LT
Sbjct  704  RGELT  708



>ref|XP_004250770.1| PREDICTED: probable glutamate carboxypeptidase 2 [Solanum lycopersicum]
Length=689

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKH+VYGP   GE+EL FFPGI +A+S+S+     E+ A IQHEIWR ARAI+RAA+AL
Sbjct  626  WFKHMVYGPRNDGESELYFFPGIANAISKSS--GGEEQNAAIQHEIWRSARAIERAAHAL  683

Query  182  KGNL  193
            KG L
Sbjct  684  KGEL  687



>ref|XP_007145752.1| hypothetical protein PHAVU_007G264800g [Phaseolus vulgaris]
 gb|ESW17746.1| hypothetical protein PHAVU_007G264800g [Phaseolus vulgaris]
Length=687

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WF+HLV+GP    E++LDFFPGI D++S    ++  ER A IQHE+WRV RAIQRAA AL
Sbjct  623  WFRHLVFGPHRDHESKLDFFPGIADSMSELFKMSEKERVAAIQHEVWRVVRAIQRAASAL  682

Query  182  KGNLT  196
            +G+ T
Sbjct  683  RGDFT  687



>ref|XP_010653230.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Vitis 
vinifera]
Length=705

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP    E++L FFPGI DA+S ST +   E  A IQHEIWRVARAI+RA+ AL
Sbjct  638  WFKHLVYGPRGDSESKLIFFPGIADAISASTRMKRKEGEAAIQHEIWRVARAIERASSAL  697

Query  182  KGNL  193
            +G +
Sbjct  698  RGGI  701



>ref|XP_010653229.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Vitis 
vinifera]
Length=705

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP    E++L FFPGI DA+S ST +   E  A IQHEIWRVARAI+RA+ AL
Sbjct  638  WFKHLVYGPRGDSESKLIFFPGIADAISASTRMKRKEGEAAIQHEIWRVARAIERASSAL  697

Query  182  KGNL  193
            +G +
Sbjct  698  RGGI  701



>emb|CBI39092.3| unnamed protein product [Vitis vinifera]
Length=624

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP    E++L FFPGI DA+S ST +   E  A IQHEIWRVARAI+RA+ AL
Sbjct  557  WFKHLVYGPRGDSESKLIFFPGIADAISASTRMKRKEGEAAIQHEIWRVARAIERASSAL  616

Query  182  KGNL  193
            +G +
Sbjct  617  RGGI  620



>gb|KEH24309.1| glutamate carboxypeptidase, putative [Medicago truncatula]
Length=692

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLV+GP    E +LDFFPGI D+++RST  +  ER A IQ EIWRV RAIQRA +AL
Sbjct  629  WFKHLVFGPPNDAE-KLDFFPGIADSMTRSTGTSERERLAEIQREIWRVTRAIQRATFAL  687

Query  182  KGNLT  196
            +G  T
Sbjct  688  RGEFT  692



>ref|XP_004494296.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Cicer 
arietinum]
Length=689

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLV+GP    E +LDFFPGI D+++RS      ER A IQHEIWRVARAIQRA  AL
Sbjct  626  WFKHLVFGPPNDPE-KLDFFPGIADSITRSASTGERERLAEIQHEIWRVARAIQRATSAL  684

Query  182  KGNLT  196
            +G  T
Sbjct  685  RGEFT  689



>ref|XP_010672603.1| PREDICTED: probable glutamate carboxypeptidase 2 [Beta vulgaris 
subsp. vulgaris]
Length=783

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERG--AIIQHEIWRVARAIQRAAY  175
            WFKHLVYGPS+  E++L FFP + DA+S ST    T+RG    IQHEIWRVARAIQRAA 
Sbjct  720  WFKHLVYGPSSNYESKLGFFPSLADAMSHSTQ---TKRGNQPTIQHEIWRVARAIQRAAD  776

Query  176  ALKGNL  193
            ALKG+L
Sbjct  777  ALKGDL  782



>ref|XP_007163023.1| hypothetical protein PHAVU_001G199600g [Phaseolus vulgaris]
 gb|ESW35017.1| hypothetical protein PHAVU_001G199600g [Phaseolus vulgaris]
Length=696

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGPS+  E  L+FFPGI D+++ ST +   ER A IQHEIWRVARAI RAA AL
Sbjct  633  WFKHLVYGPSSDHE-RLNFFPGISDSITSSTGVTERERLASIQHEIWRVARAIHRAASAL  691

Query  182  KGNLT  196
            +G  T
Sbjct  692  RGEFT  696



>ref|XP_002466328.1| hypothetical protein SORBIDRAFT_01g005710 [Sorghum bicolor]
 gb|EER93326.1| hypothetical protein SORBIDRAFT_01g005710 [Sorghum bicolor]
Length=711

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+Y P    E++  FFPGI DA+SRS +L++ ER   +QHE+W+V RAIQRAA  L
Sbjct  634  WFKHLLYSPPEDYESKFSFFPGIADAISRSANLSDKEREVAVQHEVWKVCRAIQRAASVL  693

Query  182  KGNLT*VPDRQPCS  223
            +G  +   +R+P +
Sbjct  694  RGEFS---ERKPIN  704



>dbj|BAM72481.1| AMP1-like carboxypeptidase [Lotus japonicus]
Length=695

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLV+GPS+  E  L+FFPGI D+ +RST ++  ER A IQHE+WRV+RAI RAA AL
Sbjct  632  WFKHLVFGPSSDHE-RLNFFPGISDSFTRSTSISEGERVAAIQHEVWRVSRAIHRAASAL  690

Query  182  KGNLT  196
            +G  T
Sbjct  691  RGEFT  695



>ref|XP_004981489.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Setaria 
italica]
Length=715

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+Y P    E++L FFPGI DA+SRS +L+  ER   IQHE+W+V+RAIQRAA  L
Sbjct  637  WFKHLLYSPPEDYESKLSFFPGIADAISRSGNLSAEEREVSIQHEVWKVSRAIQRAASVL  696

Query  182  KGNLT  196
            +G  +
Sbjct  697  RGEFS  701



>ref|XP_008241129.1| PREDICTED: probable glutamate carboxypeptidase 2 [Prunus mume]
Length=702

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVY PS+  E+EL FFPG+ DA+ ++  ++  E  A IQHEIWRVARAIQRAA +L
Sbjct  638  WFKHLVYAPSSDHESELFFFPGVADALFQAKRMSGREGQAKIQHEIWRVARAIQRAASSL  697

Query  182  KGNL  193
            KG +
Sbjct  698  KGEI  701



>gb|KEH24313.1| glutamate carboxypeptidase, putative [Medicago truncatula]
Length=654

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLV+GP    E +LDFFPGI D+++RST  +  ER A IQ EIWRV RAIQRA +AL
Sbjct  591  WFKHLVFGPPNDAE-KLDFFPGIADSMTRSTGTSERERLAEIQREIWRVTRAIQRATFAL  649

Query  182  KGNLT  196
            +G  T
Sbjct  650  RGEFT  654



>tpg|DAA51820.1| TPA: viviparous8 [Zea mays]
Length=739

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+Y P    E++L FFPGI DA+SRS +L++ E+   +QHE+W+V RAIQRAA  L
Sbjct  662  WFKHLLYSPPEDYESKLSFFPGIADAISRSANLSDKEQEVAMQHEVWKVCRAIQRAASVL  721

Query  182  KGNLT  196
            +G  +
Sbjct  722  RGEFS  726



>tpg|DAA51821.1| TPA: viviparous8 [Zea mays]
Length=713

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+Y P    E++L FFPGI DA+SRS +L++ E+   +QHE+W+V RAIQRAA  L
Sbjct  636  WFKHLLYSPPEDYESKLSFFPGIADAISRSANLSDKEQEVAMQHEVWKVCRAIQRAASVL  695

Query  182  KGNLT  196
            +G  +
Sbjct  696  RGEFS  700



>ref|NP_001120724.1| viviparous8 [Zea mays]
 gb|ACA62934.1| putative membrane localized peptidase [Zea mays]
Length=713

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+Y P    E++L FFPGI DA+SRS +L++ E+   +QHE+W+V RAIQRAA  L
Sbjct  636  WFKHLLYSPPEDYESKLSFFPGIADAISRSANLSDKEQEVAMQHEVWKVCRAIQRAASVL  695

Query  182  KGNLT  196
            +G  +
Sbjct  696  RGEFS  700



>ref|XP_010555869.1| PREDICTED: probable glutamate carboxypeptidase 2 [Tarenaya hassleriana]
Length=718

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHL--NNTERGAIIQHEIWRVARAIQRAAY  175
            WFKHLVYGPS+  E++L FFPGI DA++ ++     +TE  A IQHEIWRVARAIQR+A 
Sbjct  653  WFKHLVYGPSSDPESKLGFFPGIADAIAMASRQRDRDTETEA-IQHEIWRVARAIQRSAK  711

Query  176  ALKGNLT  196
            ALKG  T
Sbjct  712  ALKGGFT  718



>gb|EYU38716.1| hypothetical protein MIMGU_mgv1a002286mg [Erythranthe guttata]
Length=691

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+YGP    E+++DFFPGI DA+S        ER A+I HE+WRVARAIQRAA AL
Sbjct  629  WFKHLIYGPRGDSESKIDFFPGIGDAMSERR--GEKERKAMITHEMWRVARAIQRAATAL  686

Query  182  KGNLT  196
            +G  T
Sbjct  687  RGEFT  691



>gb|KFK34711.1| hypothetical protein AALP_AA5G181800 [Arabis alpina]
Length=700

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP+   E++L FFPGI DA++R    N++E   II+HEIWRVARAIQRA+ AL
Sbjct  642  WFKHLVYGPAAEPESKLGFFPGIADALAR----NSSE--GIIEHEIWRVARAIQRASKAL  695

Query  182  KGNLT  196
            KG  T
Sbjct  696  KGGFT  700



>ref|XP_006650705.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Oryza 
brachyantha]
Length=448

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+Y P    E+ L FFPG+ DA+SRS++ +  ER A++QHEIW+++RAI RAA  L
Sbjct  370  WFKHLLYSPPEDYESRLSFFPGVADAMSRSSNRSAKERRALVQHEIWKISRAIGRAANVL  429

Query  182  KGNLT  196
            +G  +
Sbjct  430  RGEFS  434



>ref|XP_007204052.1| hypothetical protein PRUPE_ppa026745mg, partial [Prunus persica]
 gb|EMJ05251.1| hypothetical protein PRUPE_ppa026745mg, partial [Prunus persica]
Length=687

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLV+ PS+  E+EL FFPG+ DA+ ++   +  E  A IQHEIWRVARAIQRAA +L
Sbjct  623  WFKHLVFAPSSDHESELLFFPGVADAIFQAKRTSGMEGQAKIQHEIWRVARAIQRAASSL  682

Query  182  KGNL  193
            +G +
Sbjct  683  RGEI  686



>ref|NP_567007.1| glutamate carboxypeptidase [Arabidopsis thaliana]
 sp|Q9M1S8.3|GCP2_ARATH RecName: Full=Probable glutamate carboxypeptidase 2; AltName: 
Full=Probable glutamate carboxypeptidase II [Arabidopsis thaliana]
 gb|ACI49799.1| At3g54720 [Arabidopsis thaliana]
 gb|AEE79270.1| glutamate carboxypeptidase [Arabidopsis thaliana]
Length=705

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP+   E++L FFPGI DA++    +N +E   II+HEIWRVARAIQRA+ AL
Sbjct  647  WFKHLVYGPAAEPESKLGFFPGIADAIA----MNASE--GIIEHEIWRVARAIQRASKAL  700

Query  182  KGNLT  196
            KG  T
Sbjct  701  KGGFT  705



>emb|CAB77592.1| Peptidase-like protein [Arabidopsis thaliana]
Length=703

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP+   E++L FFPGI DA++    +N +E   II+HEIWRVARAIQRA+ AL
Sbjct  645  WFKHLVYGPAAEPESKLGFFPGIADAIA----MNASE--GIIEHEIWRVARAIQRASKAL  698

Query  182  KGNLT  196
            KG  T
Sbjct  699  KGGFT  703



>gb|AAL03993.1|AF357217_1 glutamate carboxypeptidase [Arabidopsis thaliana]
Length=705

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP+   E++L FFPGI DA++    +N +E   II+HEIWRVARAIQRA+ AL
Sbjct  647  WFKHLVYGPAAEPESKLGFFPGIADAIA----MNASE--GIIEHEIWRVARAIQRASKAL  700

Query  182  KGNLT  196
            KG  T
Sbjct  701  KGGFT  705



>ref|XP_009376393.1| PREDICTED: probable glutamate carboxypeptidase 2 [Pyrus x bretschneideri]
Length=440

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP     ++L FFPG+ DA+ R+  +++ E  A IQHEIWRVARAIQRAA +L
Sbjct  376  WFKHLVYGPPGEHGSKLSFFPGVGDAMLRAKRMSSREGQAKIQHEIWRVARAIQRAANSL  435

Query  182  KGNL  193
            +G++
Sbjct  436  RGDV  439



>ref|XP_008391599.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamate carboxypeptidase 
2 [Malus domestica]
Length=457

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP     ++L FFPG+ DA+ R+  ++ TE  A +QHEIWRVARAIQRA  +L
Sbjct  393  WFKHLVYGPPGEHGSKLSFFPGVGDAMLRAKRMSRTEGEAKVQHEIWRVARAIQRAEKSL  452

Query  182  KGNL  193
            +G++
Sbjct  453  RGDV  456



>emb|CDX78257.1| BnaA09g34520D [Brassica napus]
Length=705

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP+   E++L FFPGI DA++    +N++E   +IQHEIWRVARAIQ+A+ AL
Sbjct  647  WFKHLVYGPAAEPESKLGFFPGIADAIA----VNSSE--GMIQHEIWRVARAIQKASRAL  700

Query  182  KGNLT  196
            KG  T
Sbjct  701  KGGFT  705



>ref|XP_009116147.1| PREDICTED: probable glutamate carboxypeptidase 2 [Brassica rapa]
Length=705

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP+   E++L FFPGI DA++    +N++E   +IQHEIWRVARAIQ+A+ AL
Sbjct  647  WFKHLVYGPAAEPESKLGFFPGIADAIA----VNSSE--GMIQHEIWRVARAIQKASRAL  700

Query  182  KGNLT  196
            KG  T
Sbjct  701  KGGFT  705



>ref|XP_002877996.1| hypothetical protein ARALYDRAFT_485877 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54255.1| hypothetical protein ARALYDRAFT_485877 [Arabidopsis lyrata subsp. 
lyrata]
Length=705

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP+   E++L FFPGI DA++    +N +E   +I+HEIWRVARAIQRA+ AL
Sbjct  647  WFKHLVYGPAAEPESKLGFFPGIADAIA----INASE--GVIEHEIWRVARAIQRASKAL  700

Query  182  KGNLT  196
            KG  T
Sbjct  701  KGGFT  705



>ref|XP_010427181.1| PREDICTED: probable glutamate carboxypeptidase 2 [Camelina sativa]
Length=714

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP+   E++L FFPGI DA++    +N +E   +I+HEIWRVARAIQRA+ AL
Sbjct  656  WFKHLVYGPAAEPESKLGFFPGIADAIA----INASE--GVIEHEIWRVARAIQRASKAL  709

Query  182  KGNLT  196
            KG  T
Sbjct  710  KGGFT  714



>emb|CDX73456.1| BnaC08g25470D [Brassica napus]
Length=702

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP+   E++L FFPGI DA++      N+  G +I+HEIWRVARAIQRA+ AL
Sbjct  644  WFKHLVYGPAAEPESKLGFFPGIADAIA-----TNSSEG-MIEHEIWRVARAIQRASRAL  697

Query  182  KGNLT  196
            KG  T
Sbjct  698  KGGFT  702



>ref|XP_010908058.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X3 [Elaeis 
guineensis]
Length=626

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+Y P    E+ + FFPGIVDA++++      E    IQHEIWRVARAIQRAA  L
Sbjct  562  WFKHLLYSPPEDYESNVSFFPGIVDAIAQARKFAEGEGQLGIQHEIWRVARAIQRAASVL  621

Query  182  KGNLT  196
            +G LT
Sbjct  622  RGELT  626



>emb|CDX76133.1| BnaA04g03970D [Brassica napus]
Length=463

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 6/65 (9%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP+   E++L FFPGI DA+       N+  G II+HEIWRV RAIQRA+ AL
Sbjct  405  WFKHLVYGPAAEPESKLGFFPGIADAIE-----TNSSEG-IIKHEIWRVTRAIQRASKAL  458

Query  182  KGNLT  196
            KG  T
Sbjct  459  KGGFT  463



>ref|XP_010908057.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Elaeis 
guineensis]
Length=704

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+Y P    E+ + FFPGIVDA++++      E    IQHEIWRVARAIQRAA  L
Sbjct  640  WFKHLLYSPPEDYESNVSFFPGIVDAIAQARKFAEGEGQLGIQHEIWRVARAIQRAASVL  699

Query  182  KGNLT  196
            +G LT
Sbjct  700  RGELT  704



>ref|XP_010908056.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Elaeis 
guineensis]
Length=707

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+Y P    E+ + FFPGIVDA++++      E    IQHEIWRVARAIQRAA  L
Sbjct  643  WFKHLLYSPPEDYESNVSFFPGIVDAIAQARKFAEGEGQLGIQHEIWRVARAIQRAASVL  702

Query  182  KGNLT  196
            +G LT
Sbjct  703  RGELT  707



>ref|XP_009139219.1| PREDICTED: probable glutamate carboxypeptidase 2 [Brassica rapa]
Length=699

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 6/65 (9%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP+   E++L FFPGI DA++      N+  G  I+HEIWRVARAIQRA+ AL
Sbjct  641  WFKHLVYGPAAEPESKLGFFPGITDAIA-----TNSSEGT-IKHEIWRVARAIQRASKAL  694

Query  182  KGNLT  196
            KG  T
Sbjct  695  KGGFT  699



>gb|ABF99278.1| glutamate carboxypeptidase II, putative, expressed [Oryza sativa 
Japonica Group]
Length=248

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+Y P    E++L FFPG+ DA+SRS++ +  E+ A ++HE+ +++RAIQRAA  L
Sbjct  170  WFKHLMYSPPEDYESKLSFFPGVADAISRSSNRSAKEQQAAVRHEVRKISRAIQRAADVL  229

Query  182  KGNLT  196
            +G  +
Sbjct  230  RGEFS  234



>ref|XP_009379681.1| PREDICTED: probable glutamate carboxypeptidase 2 [Pyrus x bretschneideri]
Length=707

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP     ++L FFPG+ DA+ R+   +  E  A IQHEIWRVARAIQRAA +L
Sbjct  643  WFKHLVYGPPGEHGSKLSFFPGVGDAMLRAKRTSRREGQAKIQHEIWRVARAIQRAANSL  702

Query  182  KGNL  193
            +G++
Sbjct  703  RGDV  706



>ref|XP_003559345.1| PREDICTED: probable glutamate carboxypeptidase 2 [Brachypodium 
distachyon]
Length=717

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+Y P    E+EL FFPGI DA+SRS + +  ++ A ++HE+WRV+ AIQRAA  L
Sbjct  639  WFKHLLYSPPEDYESELSFFPGIADAISRSRNQSAKQQQAAVRHEMWRVSMAIQRAAGVL  698

Query  182  KGNLT  196
            +G  +
Sbjct  699  RGGFS  703



>ref|XP_006403544.1| hypothetical protein EUTSA_v10010161mg [Eutrema salsugineum]
 gb|ESQ44997.1| hypothetical protein EUTSA_v10010161mg [Eutrema salsugineum]
Length=713

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP+   +++L FFPGI DA++    +N +E   +I+HE+WRVARAIQRA+ AL
Sbjct  655  WFKHLVYGPAAEPDSKLGFFPGIADAIA----MNASE--GMIEHEMWRVARAIQRASKAL  708

Query  182  KGNLT  196
            KG  T
Sbjct  709  KGGFT  713



>ref|XP_006290666.1| hypothetical protein CARUB_v10016757mg [Capsella rubella]
 gb|EOA23564.1| hypothetical protein CARUB_v10016757mg [Capsella rubella]
Length=712

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP+   E++L FFPGI DA++    ++ +E   +I+HEIWRV+RAIQRA+ AL
Sbjct  654  WFKHLVYGPAAEPESKLGFFPGIADAIA----IDASE--GVIEHEIWRVSRAIQRASKAL  707

Query  182  KGNLT  196
            KG  T
Sbjct  708  KGGFT  712



>ref|XP_008350228.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Malus 
domestica]
Length=206

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W KHLVYGP     ++L FFPG+ DA+ R+  ++  E  A IQHE+WRVARAI+RA  +L
Sbjct  142  WLKHLVYGPPGEHGSKLSFFPGVGDAMLRAKRMSRREGQAKIQHEVWRVARAIERATNSL  201

Query  182  KGNL  193
            +G++
Sbjct  202  RGDV  205



>ref|XP_009351318.1| PREDICTED: probable glutamate carboxypeptidase 2 [Pyrus x bretschneideri]
Length=463

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP     ++L FFPG+ DA+ R+  +++ E  A IQHEIWRVARAIQRAA +L
Sbjct  399  WFKHLVYGPPGEHGSKLSFFPGVGDAMLRAKRMSSREGQAKIQHEIWRVARAIQRAANSL  458

Query  182  K  184
            +
Sbjct  459  R  459



>ref|XP_008350226.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Malus 
domestica]
Length=238

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W KHLVYGP     ++L FFPG+ DA+ R+  ++  E  A IQHE+WRVARAI+RA  +L
Sbjct  174  WLKHLVYGPPGEHGSKLSFFPGVGDAMLRAKRMSRREGQAKIQHEVWRVARAIERATNSL  233

Query  182  KGNL  193
            +G++
Sbjct  234  RGDV  237



>ref|XP_008777140.1| PREDICTED: probable glutamate carboxypeptidase 2 [Phoenix dactylifera]
Length=706

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAI-IQHEIWRVARAIQRAAYA  178
            WFKHL+Y P    E+ + FFPGIVDA++++      E G + IQHEIWRVARAIQRAA  
Sbjct  643  WFKHLLYSPPEDYESNITFFPGIVDAIAQAR--KAAEEGQMGIQHEIWRVARAIQRAASV  700

Query  179  LKGNLT  196
            L+G LT
Sbjct  701  LRGELT  706



>ref|XP_010516011.1| PREDICTED: probable glutamate carboxypeptidase 2 [Camelina sativa]
Length=709

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 47/65 (72%), Gaps = 6/65 (9%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP+   E++L FFPGI DA++    ++  E   +I+HEIWRV RAIQRA+ AL
Sbjct  651  WFKHLVYGPAAEPESKLGFFPGIADAIA----IDAPE--GVIEHEIWRVTRAIQRASKAL  704

Query  182  KGNLT  196
            KG  T
Sbjct  705  KGGFT  709



>ref|XP_010504286.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Camelina 
sativa]
 ref|XP_010504287.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Camelina 
sativa]
Length=714

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 47/65 (72%), Gaps = 6/65 (9%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP+   E++L FFPGI DA++    ++  E   +I+HEIWRV RAIQRA+ AL
Sbjct  656  WFKHLVYGPAAEPESKLGFFPGIADAIA----IDAPE--GVIEHEIWRVTRAIQRASKAL  709

Query  182  KGNLT  196
            KG  T
Sbjct  710  KGGFT  714



>ref|NP_001051516.2| Os03g0790600 [Oryza sativa Japonica Group]
 gb|ABF99277.1| glutamate carboxypeptidase II, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EEC76310.1| hypothetical protein OsI_13841 [Oryza sativa Indica Group]
 dbj|BAF13430.2| Os03g0790600 [Oryza sativa Japonica Group]
Length=448

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+Y P    E++L FFPG+ DA+SRS++ +  E+ A ++HE+ +++RAIQRAA  L
Sbjct  370  WFKHLMYSPPEDYESKLSFFPGVADAISRSSNRSAKEQQAAVRHEVRKISRAIQRAADVL  429

Query  182  KGNLT  196
            +G  +
Sbjct  430  RGEFS  434



>gb|AAO24914.1| putative glutamate carboxypeptidase [Oryza sativa Japonica Group]
 dbj|BAH22722.1| plastochron3 [Oryza sativa Japonica Group]
Length=772

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+Y P    E++L FFPG+ DA+SRS++ +  E+ A ++HE+ +++RAIQRAA  L
Sbjct  694  WFKHLMYSPPEDYESKLSFFPGVADAISRSSNRSAKEQQAAVRHEVRKISRAIQRAADVL  753

Query  182  KGNLT  196
            +G  +
Sbjct  754  RGEFS  758



>gb|EMT26362.1| Putative glutamate carboxypeptidase 2 [Aegilops tauschii]
Length=487

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y P    E+EL FFPGI DA+SR  + +  +R A ++ E+WRVA AIQRAA  L
Sbjct  330  WYKHLMYSPPEDYESELSFFPGIADAISRRGNQSTRQRQAAVRQELWRVAMAIQRAANVL  389

Query  182  KGN  190
            + N
Sbjct  390  RVN  392



>ref|XP_004305557.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Fragaria 
vesca subsp. vesca]
Length=694

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP T   ++L  FPG+ DA++++  +      A ++HEIWRVARAIQRAA +L
Sbjct  630  WFKHLVYGPPTDHGSKLFVFPGVADAMNQAKSMKAGRGQAKLRHEIWRVARAIQRAARSL  689

Query  182  KGNL  193
            KG +
Sbjct  690  KGEI  693



>ref|XP_008387163.1| PREDICTED: probable glutamate carboxypeptidase 2 [Malus domestica]
Length=708

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W KHLVYGP     ++L FFPG+ DA+ R+  ++  E  A IQHE WRVARAI+RA  +L
Sbjct  644  WLKHLVYGPPGEHGSKLSFFPGVGDAMLRAKRMSRREGQAKIQHEXWRVARAIZRAXNSL  703

Query  182  KGNL  193
            +G++
Sbjct  704  RGDV  707



>ref|XP_008359523.1| PREDICTED: probable glutamate carboxypeptidase 2 [Malus domestica]
Length=708

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W KHLVYGP     ++L FFPG+ DA+ R+  ++  E  A IQHE WRVARAI+RA  +L
Sbjct  644  WLKHLVYGPPGEHGSKLSFFPGVGDAMLRAKRMSRREGQAKIQHEXWRVARAIZRAXNSL  703

Query  182  KGNL  193
            +G++
Sbjct  704  RGDV  707



>gb|KCW48177.1| hypothetical protein EUGRSUZ_K01904 [Eucalyptus grandis]
Length=491

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGPS    +   FFPGI +A+ RS  + + E  A IQHEIWRVARAIQR A  L
Sbjct  428  WFKHLVYGPSDY-RSRTSFFPGIAEAIWRSARMRSGEGQASIQHEIWRVARAIQRVADVL  486

Query  182  KG  187
             G
Sbjct  487  GG  488



>ref|XP_006826386.1| hypothetical protein AMTR_s00004p00142600 [Amborella trichopoda]
 gb|ERM93623.1| hypothetical protein AMTR_s00004p00142600 [Amborella trichopoda]
Length=744

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERG-AIIQHEIWRVARAIQRAAYA  178
            WFKHL+YGPS   E++L FFPGIVDA+ ++   +N E G A+IQHEIWRVARAI RAA A
Sbjct  679  WFKHLIYGPSKYSESKLGFFPGIVDAIYKAKERDNGEEGKALIQHEIWRVARAISRAAAA  738

Query  179  LKGNL  193
            LKGNL
Sbjct  739  LKGNL  743



>ref|XP_010036574.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamate carboxypeptidase 
2 [Eucalyptus grandis]
Length=701

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGPS    +   FFPGI +A+ RS  + + E  A IQHEIWRVARAIQR A  L
Sbjct  638  WFKHLVYGPSDY-RSRTSFFPGIAEAIWRSARMRSGEGQASIQHEIWRVARAIQRVADVL  696

Query  182  KG  187
             G
Sbjct  697  GG  698



>ref|XP_006646308.1| PREDICTED: probable glutamate carboxypeptidase 2-like, partial 
[Oryza brachyantha]
Length=500

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGPS   + E   FPG+ +A++ +   N TE    +QHEI+RVARAI +A+  L
Sbjct  436  WFKHLVYGPSEQNDWESASFPGVGNAIASARRDNTTESWKFVQHEIYRVARAITQASVVL  495

Query  182  KGNLT  196
             GNLT
Sbjct  496  TGNLT  500



>ref|XP_009398816.1| PREDICTED: probable glutamate carboxypeptidase 2 [Musa acuminata 
subsp. malaccensis]
Length=390

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 4/66 (6%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVS--RSTHLNNTERGAIIQHEIWRVARAIQRAAY  175
            WFKH+VY P    E+++ FFPGI DA+S  R      T+ G  +QHEIWRVARAI+R A 
Sbjct  326  WFKHMVYSPPEDSESKMPFFPGIADAISPARKHAGKGTQLG--VQHEIWRVARAIRRVAA  383

Query  176  ALKGNL  193
             L+G L
Sbjct  384  TLRGEL  389



>ref|XP_006644681.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Oryza 
brachyantha]
Length=716

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGPS   + E   FPG+ +A++ +   N TE    +QHEI+RVARAI +A+  L
Sbjct  652  WFKHLVYGPSEQNDWESASFPGVGNAIASARRDNTTESWKFVQHEIYRVARAITQASVVL  711

Query  182  KGNLT  196
             GNLT
Sbjct  712  TGNLT  716



>ref|XP_009591681.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Nicotiana 
tomentosiformis]
Length=695

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +   + FPGI DA+ R+  L++T+    +QHE+WRVARAI +A+  L
Sbjct  631  WYKHLIYAPSRHDDYGSNSFPGISDAIERAKSLDSTDSWRSVQHEVWRVARAITQASLVL  690

Query  182  KGNLT  196
             G LT
Sbjct  691  SGRLT  695



>ref|XP_008804069.1| PREDICTED: probable glutamate carboxypeptidase 2 [Phoenix dactylifera]
Length=342

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   +     +PGI DA+ ++   N +E  + +QHE+WR ARA+ +AA  L
Sbjct  278  WYKHLIYGPSMQDDYGSKSYPGIDDAIEKAKSSNTSESCSFVQHEVWRAARAVTQAALVL  337

Query  182  KGNLT  196
             G  T
Sbjct  338  NGKFT  342



>ref|XP_007013008.1| Peptidase M28 family protein isoform 1 [Theobroma cacao]
 gb|EOY30627.1| Peptidase M28 family protein isoform 1 [Theobroma cacao]
Length=717

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +     FPGI DA+ ++ +LN  E   ++QHE+WRV+RA+  A+  L
Sbjct  653  WYKHLIYAPSRHNDYGSTSFPGINDAIEKAKNLNTVESWDLVQHEVWRVSRAVGHASLVL  712

Query  182  KGNLT  196
            KG LT
Sbjct  713  KGELT  717



>dbj|BAD86952.1| unknown protein [Oryza sativa Japonica Group]
Length=82

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KH++Y  S   +     FPGIV A+ ++  LN TE   ++QHEI+R ARA+ +A+  L
Sbjct  18   WYKHMIYASSDQDDWGTKAFPGIVSAIDKANKLNTTESWQLLQHEIYRAARAVSKASAVL  77

Query  182  KGNLT  196
             G LT
Sbjct  78   DGRLT  82



>ref|NP_001044203.1| Os01g0740600 [Oryza sativa Japonica Group]
 dbj|BAF06117.1| Os01g0740600, partial [Oryza sativa Japonica Group]
Length=87

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KH++Y  S   +     FPGIV A+ ++  LN TE   ++QHEI+R ARA+ +A+  L
Sbjct  23   WYKHMIYASSDQDDWGTKAFPGIVSAIDKANKLNTTESWQLLQHEIYRAARAVSKASAVL  82

Query  182  KGNLT  196
             G LT
Sbjct  83   DGRLT  87



>ref|XP_010314059.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamate carboxypeptidase 
2 [Solanum lycopersicum]
Length=524

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y P+   +   + FPGI DA+  +  LN+++    +QHE+WRVARAI +A+  L
Sbjct  460  WYKHLIYAPAKHNDYGFNSFPGISDAIENAKSLNSSDSWYSVQHEVWRVARAITQASLVL  519

Query  182  KGNLT  196
             G LT
Sbjct  520  SGRLT  524



>gb|KHG30466.1| putative glutamate carboxypeptidase 2 -like protein [Gossypium 
arboreum]
Length=705

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +     FPGI DA+  + +LN  E   ++QHE+WRVARA++ A+  L
Sbjct  641  WYKHLIYAPSRHNDYGSTSFPGIDDAIENAKNLNTAESWHVVQHEVWRVARAVKHASLVL  700

Query  182  KGNLT  196
             G LT
Sbjct  701  DGKLT  705



>gb|KFK26210.1| peptidase m28 family protein [Arabis alpina]
Length=673

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   +     FPG+ DA+  +  LN       +QH+IWRV+RAI+ A+  L
Sbjct  609  WYKHLIYGPSKYNDYGTKSFPGVDDAIDNAKKLNTKASWENVQHQIWRVSRAIKHASLVL  668

Query  182  KGNLT  196
            KG+LT
Sbjct  669  KGDLT  673



>ref|XP_011093647.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Sesamum 
indicum]
Length=704

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +     FPGI DA+ ++ +LN  +    +QHEIWRVAR I +A+  L
Sbjct  640  WYKHLIYAPSKHNDYGSTSFPGIDDALEKAKNLNTADSWHSVQHEIWRVARVITQASLCL  699

Query  182  KGNLT  196
            KG LT
Sbjct  700  KGKLT  704



>ref|XP_011093646.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Sesamum 
indicum]
Length=705

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +     FPGI DA+ ++ +LN  +    +QHEIWRVAR I +A+  L
Sbjct  641  WYKHLIYAPSKHNDYGSTSFPGIDDALEKAKNLNTADSWHSVQHEIWRVARVITQASLCL  700

Query  182  KGNLT  196
            KG LT
Sbjct  701  KGKLT  705



>gb|EYU27261.1| hypothetical protein MIMGU_mgv1a002132mg [Erythranthe guttata]
Length=709

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +     FPGI DA+ ++  +N TE    +QHEIWRVAR I +A+  L
Sbjct  645  WYKHLIYAPSKHDDYGSKSFPGIDDAIEKAKSINTTESWRSVQHEIWRVARVITQASLCL  704

Query  182  KGNLT  196
             G LT
Sbjct  705  VGKLT  709



>ref|NP_001146679.1| uncharacterized protein LOC100280279 [Zea mays]
 gb|ACL54512.1| unknown [Zea mays]
 tpg|DAA57716.1| TPA: hypothetical protein ZEAMMB73_602143 [Zea mays]
Length=343

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGPS   + +   +PGI +A++ +   N +E    +QHEI+RVARA+ +A+  L
Sbjct  279  WFKHLVYGPSDQNDWDTAVYPGIANAIASARSSNTSESWKFVQHEIYRVARAVTQASAIL  338

Query  182  KGNLT  196
             G LT
Sbjct  339  SGRLT  343



>ref|XP_004136724.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Cucumis 
sativus]
Length=701

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP +  E+ L +FPGI DAVS S  +N  E   +IQHEIWRVARAI+RAA AL
Sbjct  637  WFKHLVYGPLSNYESALVYFPGIADAVSESKEINKRELEELIQHEIWRVARAIRRAAAAL  696

Query  182  KGNLT  196
            KG L+
Sbjct  697  KGELS  701



>ref|XP_004165115.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Cucumis 
sativus]
Length=701

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP +  E+ L +FPGI DAVS S  +N  E   +IQHEIWRVARAI+RAA AL
Sbjct  637  WFKHLVYGPLSNYESALVYFPGIADAVSESKEINKRELEELIQHEIWRVARAIRRAAAAL  696

Query  182  KGNLT  196
            KG L+
Sbjct  697  KGELS  701



>ref|XP_004491175.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Cicer 
arietinum]
Length=706

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   +     FPGIVDA++ + ++  TE    +QH++WRV+R I+ A+  L
Sbjct  642  WYKHLIYGPSKHNDYGSQSFPGIVDALTIAKNVQTTESWHHVQHQVWRVSRVIRHASLVL  701

Query  182  KGNLT  196
             G LT
Sbjct  702  SGQLT  706



>tpg|DAA57714.1| TPA: hypothetical protein ZEAMMB73_602143 [Zea mays]
Length=464

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGPS   + +   +PGI +A++ +   N +E    +QHEI+RVARA+ +A+  L
Sbjct  400  WFKHLVYGPSDQNDWDTAVYPGIANAIASARSSNTSESWKFVQHEIYRVARAVTQASAIL  459

Query  182  KGNLT  196
             G LT
Sbjct  460  SGRLT  464



>ref|XP_010247434.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Nelumbo 
nucifera]
Length=651

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGPS   +++LDFFP I +A S +  L   E  + IQHEIWRVARA++RAA AL
Sbjct  587  WFKHLVYGPSNDYQSKLDFFPSIANAFSDAARLPREEAKSAIQHEIWRVARAVRRAASAL  646

Query  182  KGNLT  196
            KG LT
Sbjct  647  KGELT  651



>ref|XP_010247433.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Nelumbo 
nucifera]
Length=702

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGPS   +++LDFFP I +A S +  L   E  + IQHEIWRVARA++RAA AL
Sbjct  638  WFKHLVYGPSNDYQSKLDFFPSIANAFSDAARLPREEAKSAIQHEIWRVARAVRRAASAL  697

Query  182  KGNLT  196
            KG LT
Sbjct  698  KGELT  702



>emb|CDP03245.1| unnamed protein product [Coffea canephora]
Length=704

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL++ PS   +    +FPGI DA+ ++  +N T+    +QHE+WRV+R I+ A+  L
Sbjct  640  WYKHLIFAPSKHNDYGSKYFPGIDDAIEKAKSINTTDLWLAVQHEVWRVSRVIKHASLVL  699

Query  182  KGNLT  196
             G LT
Sbjct  700  SGQLT  704



>ref|XP_007203613.1| hypothetical protein PRUPE_ppa002244mg [Prunus persica]
 gb|EMJ04812.1| hypothetical protein PRUPE_ppa002244mg [Prunus persica]
Length=696

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   +     FPGI +A+ ++  L   E   ++QHE+WRVARA++ A+  +
Sbjct  632  WYKHLIYGPSKHDDYGSKSFPGIDEAIEKAKSLKTAESRKLVQHEVWRVARAVRHASQII  691

Query  182  KGNLT  196
             G LT
Sbjct  692  NGELT  696



>ref|XP_008776572.1| PREDICTED: probable glutamate carboxypeptidase 2, partial [Phoenix 
dactylifera]
Length=668

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPST        +PGI DA+ ++   N ++  + +QHE+WR ARA+ +AA  L
Sbjct  604  WYKHLIYGPSTHDSYGSKSYPGIDDAIEKAKSSNTSDSWSFVQHEVWRAARAVTQAALVL  663

Query  182  KGNLT  196
             G  T
Sbjct  664  NGKFT  668



>gb|EEE55357.1| hypothetical protein OsJ_03400 [Oryza sativa Japonica Group]
Length=556

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGPS   + E   +PG+ +A++ +   N TE    +QHEI RVARAI +A+  L
Sbjct  492  WFKHLVYGPSEQNDWESASYPGVENAIASARKENTTESWKFVQHEIHRVARAITQASVVL  551

Query  182  KGNLT  196
             G+LT
Sbjct  552  AGSLT  556



>ref|XP_008672765.1| PREDICTED: uncharacterized protein LOC100280279 isoform X1 [Zea 
mays]
Length=732

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGPS   + +   +PGI +A++ +   N +E    +QHEI+RVARA+ +A+  L
Sbjct  668  WFKHLVYGPSDQNDWDTAVYPGIANAIASARSSNTSESWKFVQHEIYRVARAVTQASAIL  727

Query  182  KGNLT  196
             G LT
Sbjct  728  SGRLT  732



>gb|KGN59254.1| hypothetical protein Csa_3G790960 [Cucumis sativus]
Length=701

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP +  E+ L +FPGI DAVS S  +N  E   +IQHEIWRVARAI+RAA AL
Sbjct  637  WFKHLVYGPLSNYESALVYFPGIADAVSESKVINKRELEELIQHEIWRVARAIRRAAAAL  696

Query  182  KGNLT  196
            KG L+
Sbjct  697  KGELS  701



>ref|XP_009776392.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Nicotiana 
sylvestris]
Length=698

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y P+   +   + FPG+ DA+ ++  L +T+    +QHE+WRVARAI +A+  L
Sbjct  634  WYKHLIYAPARHDDYGSNSFPGVSDAIEKAKSLKSTDSWRSVQHEVWRVARAITQASLVL  693

Query  182  KGNLT  196
             G LT
Sbjct  694  SGRLT  698



>ref|XP_008242478.1| PREDICTED: probable glutamate carboxypeptidase 2 [Prunus mume]
Length=708

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   +     FPGI +A+ ++  L   E   ++QHE+WRVARA++ A+  +
Sbjct  644  WYKHLIYGPSKHDDYGSKSFPGIDEAIEKAKSLKTAESWKLVQHEVWRVARAVRHASQII  703

Query  182  KGNLT  196
             G LT
Sbjct  704  NGELT  708



>ref|XP_009776394.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X3 [Nicotiana 
sylvestris]
Length=685

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y P+   +   + FPG+ DA+ ++  L +T+    +QHE+WRVARAI +A+  L
Sbjct  621  WYKHLIYAPARHDDYGSNSFPGVSDAIEKAKSLKSTDSWRSVQHEVWRVARAITQASLVL  680

Query  182  KGNLT  196
             G LT
Sbjct  681  SGRLT  685



>ref|XP_008442988.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Cucumis 
melo]
Length=701

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGP +  E+ L +FPGI DAVS S  +N      +IQHEIWRVARAI RAA AL
Sbjct  637  WFKHLVYGPPSDYESALVYFPGIADAVSESKEMNKMGLEELIQHEIWRVARAIGRAAAAL  696

Query  182  KGNLT  196
            KG L+
Sbjct  697  KGELS  701



>ref|XP_002960093.1| hypothetical protein SELMODRAFT_73556 [Selaginella moellendorffii]
 gb|EFJ37632.1| hypothetical protein SELMODRAFT_73556 [Selaginella moellendorffii]
Length=690

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS         FPG+ DA++ +  +NN      +QHEIW+VARAI   A+ L
Sbjct  626  WYKHLIYGPSGKNHYNSQLFPGVCDALAAAMSINNKASWNALQHEIWKVARAITNVAHFL  685

Query  182  KGNL  193
             G L
Sbjct  686  SGEL  689



>ref|XP_009776393.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Nicotiana 
sylvestris]
Length=695

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y P+   +   + FPG+ DA+ ++  L +T+    +QHE+WRVARAI +A+  L
Sbjct  631  WYKHLIYAPARHDDYGSNSFPGVSDAIEKAKSLKSTDSWRSVQHEVWRVARAITQASLVL  690

Query  182  KGNLT  196
             G LT
Sbjct  691  SGRLT  695



>ref|XP_006353498.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Solanum 
tuberosum]
Length=693

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y P+   +     FPGI DA+  +  LN+++    +QHE+WRVARAI +A+  L
Sbjct  629  WYKHLIYAPAKHDDYGSKSFPGISDAIENAKSLNSSDSWHSVQHEVWRVARAITQASLVL  688

Query  182  KGNLT  196
             G LT
Sbjct  689  SGRLT  693



>dbj|BAD86951.1| putative glutamate carboxypeptidase [Oryza sativa Japonica Group]
Length=661

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGPS   + E   +PG+ +A++ +   N TE    +QHEI RVARAI +A+  L
Sbjct  597  WFKHLVYGPSEQNDWESASYPGVENAIASARKENTTESWKFVQHEIHRVARAITQASVVL  656

Query  182  KGNLT  196
             G+LT
Sbjct  657  AGSLT  661



>ref|XP_004304505.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Fragaria 
vesca subsp. vesca]
Length=695

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS       + FPGI +A+ ++  L   E    +QHE+WRVARA++ AA  +
Sbjct  631  WYKHLIYGPSRNDVYGSESFPGIDEAIVKAKRLKTAESWKFVQHEVWRVARAVRHAAKVI  690

Query  182  KGNLT  196
             G LT
Sbjct  691  NGELT  695



>ref|NP_001044202.2| Os01g0740500 [Oryza sativa Japonica Group]
 dbj|BAF06116.2| Os01g0740500 [Oryza sativa Japonica Group]
Length=713

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGPS   + E   +PG+ +A++ +   N TE    +QHEI RVARAI +A+  L
Sbjct  649  WFKHLVYGPSEQNDWESASYPGVENAIASARKENTTESWKFVQHEIHRVARAITQASVVL  708

Query  182  KGNLT  196
             G+LT
Sbjct  709  AGSLT  713



>gb|EEC71453.1| hypothetical protein OsI_03679 [Oryza sativa Indica Group]
Length=733

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGPS   + E   +PG+ +A++ +   N TE    +QHEI RVARAI +A+  L
Sbjct  669  WFKHLVYGPSEQNDWESASYPGVENAIASARKENTTESWKFVQHEIHRVARAITQASVVL  728

Query  182  KGNLT  196
             G+LT
Sbjct  729  AGSLT  733



>ref|XP_002458463.1| hypothetical protein SORBIDRAFT_03g034150 [Sorghum bicolor]
 gb|EES03583.1| hypothetical protein SORBIDRAFT_03g034150 [Sorghum bicolor]
Length=728

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLVYGPS   + +   +PGI +A++ +   N +E    +QHE++RVARA+ +A+  L
Sbjct  664  WFKHLVYGPSDQNDWDTAVYPGIANAIASARSSNTSESWKFVQHEVYRVARAVTQASAIL  723

Query  182  KGNLT  196
             G LT
Sbjct  724  SGRLT  728



>ref|XP_006289406.1| hypothetical protein CARUB_v10002906mg [Capsella rubella]
 gb|EOA22304.1| hypothetical protein CARUB_v10002906mg [Capsella rubella]
Length=679

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHLVYGPS   +     FPG+ DA+  +  LN       +QH+IWRV+RAI++A+  L
Sbjct  615  WYKHLVYGPSKYDDYGSKSFPGVDDAIENAKKLNTKASWENVQHQIWRVSRAIRQASLVL  674

Query  182  KGNL  193
            KG L
Sbjct  675  KGEL  678



>ref|XP_006853725.1| hypothetical protein AMTR_s00056p00162910 [Amborella trichopoda]
 gb|ERN15192.1| hypothetical protein AMTR_s00056p00162910 [Amborella trichopoda]
Length=704

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W KHLVYGPS   +     FPG+ DA+  +   N TE  A +QH+IWRV+R + +A+  L
Sbjct  640  WHKHLVYGPSNHDQYGSRSFPGVEDAIVEARRSNTTESWAFVQHQIWRVSRVVSQASLVL  699

Query  182  KGNLT  196
            +G+ T
Sbjct  700  RGDFT  704



>ref|XP_009416468.1| PREDICTED: probable glutamate carboxypeptidase 2 [Musa acuminata 
subsp. malaccensis]
Length=726

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   +   + FPGI DA+ ++  LN ++    +QHE+WR AR + +A+  L
Sbjct  662  WYKHLIYGPSLHDDYGSNSFPGIDDAIEKAKSLNTSDSWRFVQHEVWRAARVVTQASLVL  721

Query  182  KGNLT  196
             G  T
Sbjct  722  HGKFT  726



>ref|XP_010420791.1| PREDICTED: probable glutamate carboxypeptidase 2 [Camelina sativa]
Length=678

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHLVYGPS   +     FPG+ DA+  +  LN       +QH+IWRV+RA+++A+  L
Sbjct  614  WYKHLVYGPSKYDDYGSKSFPGVDDAIENAKKLNTKASWENVQHQIWRVSRAVRQASLVL  673

Query  182  KGNL  193
            KG L
Sbjct  674  KGEL  677



>ref|XP_006400535.1| hypothetical protein EUTSA_v10012881mg [Eutrema salsugineum]
 gb|ESQ41988.1| hypothetical protein EUTSA_v10012881mg [Eutrema salsugineum]
Length=673

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHLVYGPS   +     FPG+ DA+  +  L       ++QH+IWRVARA++ A+  L
Sbjct  609  WYKHLVYGPSKYDDYGSKSFPGVDDAIDDAKRLKTKASWELVQHQIWRVARAVRHASLVL  668

Query  182  KGNL  193
            KG L
Sbjct  669  KGEL  672



>gb|ACL52515.1| unknown [Zea mays]
 gb|AFW85114.1| hypothetical protein ZEAMMB73_052433 [Zea mays]
Length=384

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +   + +PGI DA+ R    N +E    IQHEI+RV+R I +AA  L
Sbjct  320  WYKHLIYAPSLHNDYGAEVYPGIGDAIERVKKTNTSESLQSIQHEIYRVSRVINQAALVL  379

Query  182  KGNLT  196
             G LT
Sbjct  380  SGGLT  384



>gb|ACG29176.1| glutamate carboxypeptidase 2 [Zea mays]
Length=693

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +   + +PGI DA+ R    N +E    IQHEI+RV+R I +AA  L
Sbjct  629  WYKHLIYAPSLHNDYGAEVYPGIGDAIERVKKTNTSESLQSIQHEIYRVSRVINQAALVL  688

Query  182  KGNLT  196
             G LT
Sbjct  689  SGGLT  693



>ref|XP_008363033.1| PREDICTED: probable glutamate carboxypeptidase 2 [Malus domestica]
Length=413

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   +   + FPGI DA++++   N  E    +QHE++RV+RA++ A+  +
Sbjct  349  WYKHLIYGPSKYDDYASESFPGIYDAIAKAKISNTAESWKFVQHEVYRVSRAVKHASQII  408

Query  182  KGNLT  196
             G LT
Sbjct  409  NGELT  413



>ref|XP_006451321.1| hypothetical protein CICLE_v10007621mg [Citrus clementina]
 gb|ESR64561.1| hypothetical protein CICLE_v10007621mg [Citrus clementina]
Length=705

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +    +FP I DA+  +  LN  +    +QHE+WRV+RA++ A+  L
Sbjct  641  WYKHLIYAPSKHNDYGSKYFPAIDDAIEEAMKLNTAKSWHTVQHEVWRVSRAVRHASLVL  700

Query  182  KGNLT  196
             G LT
Sbjct  701  NGKLT  705



>gb|KDO66598.1| hypothetical protein CISIN_1g005260mg [Citrus sinensis]
Length=705

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +    +FP I DA+  +  LN  +    +QHE+WRV+RA++ A+  L
Sbjct  641  WYKHLIYAPSKHNDYGSKYFPAIDDAIEEAMKLNTAKSWHTVQHEVWRVSRAVRHASLVL  700

Query  182  KGNLT  196
             G LT
Sbjct  701  NGKLT  705



>gb|KDO66599.1| hypothetical protein CISIN_1g005260mg [Citrus sinensis]
Length=701

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +    +FP I DA+  +  LN  +    +QHE+WRV+RA++ A+  L
Sbjct  637  WYKHLIYAPSKHNDYGSKYFPAIDDAIEEAMKLNTAKSWHTVQHEVWRVSRAVRHASLVL  696

Query  182  KGNLT  196
             G LT
Sbjct  697  NGKLT  701



>ref|XP_006475591.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Citrus 
sinensis]
Length=705

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +    +FP I DA+  +  LN  +    +QHE+WRV+RA++ A+  L
Sbjct  641  WYKHLIYAPSKHNDYGSKYFPAIDDAIEEAMKLNTAKSWHTVQHEVWRVSRAVRHASLVL  700

Query  182  KGNLT  196
             G LT
Sbjct  701  NGKLT  705



>ref|XP_002984044.1| hypothetical protein SELMODRAFT_119241 [Selaginella moellendorffii]
 gb|EFJ15056.1| hypothetical protein SELMODRAFT_119241 [Selaginella moellendorffii]
Length=704

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KH++YGPS         FPG+ DA++ +  +NN      +QHEIW+VARAI   A+ L
Sbjct  640  WYKHVIYGPSGKNHYNSQLFPGVCDALAAAMSINNKASWNALQHEIWKVARAITNVAHFL  699

Query  182  KGNL  193
             G L
Sbjct  700  SGEL  703



>ref|NP_197475.2| peptidase M28 family protein [Arabidopsis thaliana]
 gb|AAP37682.1| At5g19740 [Arabidopsis thaliana]
 gb|AED92744.1| peptidase M28 family protein [Arabidopsis thaliana]
Length=681

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   +     FPG+ DA+  +  LN       +QH+IWRV+RAI+ A+  L
Sbjct  617  WYKHLIYGPSKYDDYGSKSFPGVDDAIDNAKKLNTKASWENVQHQIWRVSRAIRHASLVL  676

Query  182  KGNL  193
            KG L
Sbjct  677  KGEL  680



>ref|XP_007029148.1| Transferrin receptor protein, putative isoform 1 [Theobroma cacao]
 gb|EOY09650.1| Transferrin receptor protein, putative isoform 1 [Theobroma cacao]
Length=702

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+YGP     ++L+FFPGI DA++ ST L+  +  A I+HEIWRVARAI+RAA AL
Sbjct  638  WFKHLIYGPRRNHGSKLEFFPGISDAIAESTKLSQRDGQAAIRHEIWRVARAIRRAAVAL  697

Query  182  KGNLT  196
            KG LT
Sbjct  698  KGELT  702



>emb|CDY42292.1| BnaC02g08980D [Brassica napus]
Length=676

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHLVYGP+   E   + FPGI DA+  +  +       ++QHEIWRV+RAI  A+  L
Sbjct  612  WYKHLVYGPAKYDEYGSESFPGIDDAIDNAKRVKTKNYWGLVQHEIWRVSRAITHASLVL  671

Query  182  KGNL  193
            KG L
Sbjct  672  KGVL  675



>gb|KEH27221.1| peptidase M28 family protein [Medicago truncatula]
Length=704

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS         FPGI DA   +  L++ E  + +QHE+WRV+R I+ A+  L
Sbjct  640  WYKHLIYGPSKHNNYGSQSFPGIYDAAKMARSLHSAESWSQVQHEVWRVSRVIKHASLVL  699

Query  182  KGNLT  196
             G LT
Sbjct  700  SGQLT  704



>gb|AFW85116.1| hypothetical protein ZEAMMB73_052433 [Zea mays]
Length=725

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +   + +PGI DA+ R    N +E    IQHEI+RV+R I +AA  L
Sbjct  661  WYKHLIYAPSLHNDYGAEVYPGIGDAIERVKKTNTSESLQSIQHEIYRVSRVINQAALVL  720

Query  182  KGNLT  196
             G LT
Sbjct  721  SGGLT  725



>ref|XP_008354418.1| PREDICTED: probable glutamate carboxypeptidase 2 [Malus domestica]
 ref|XP_008354419.1| PREDICTED: probable glutamate carboxypeptidase 2 [Malus domestica]
Length=706

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   +   + FPGI DA++++   N  E    +QHE++RV+RA++ A+  +
Sbjct  642  WYKHLIYGPSKYDDYASESFPGIYDAIAKAKISNTAESWKFVQHEVYRVSRAVKHASQII  701

Query  182  KGNLT  196
             G LT
Sbjct  702  NGELT  706



>ref|XP_008344001.1| PREDICTED: probable glutamate carboxypeptidase 2 [Malus domestica]
Length=706

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   +   + FPGI DA++++   N  E    +QHE++RV+RA++ A+  +
Sbjct  642  WYKHLIYGPSKYDDYASESFPGIYDAIAKAKISNTAESWKFVQHEVYRVSRAVKHASQII  701

Query  182  KGNLT  196
             G LT
Sbjct  702  NGELT  706



>ref|XP_010049609.1| PREDICTED: probable glutamate carboxypeptidase 2 [Eucalyptus 
grandis]
 gb|KCW82314.1| hypothetical protein EUGRSUZ_C03720 [Eucalyptus grandis]
Length=707

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   +     FPGI DA+  +  ++ ++    +QHEIWRV+RA++ A   L
Sbjct  643  WYKHLIYGPSKHNDYGSKSFPGIDDAIEEAKKVSTSDSWHSVQHEIWRVSRAVKHATQVL  702

Query  182  KGNLT  196
             G LT
Sbjct  703  SGKLT  707



>ref|XP_002992244.1| hypothetical protein SELMODRAFT_134963 [Selaginella moellendorffii]
 gb|EFJ06741.1| hypothetical protein SELMODRAFT_134963 [Selaginella moellendorffii]
Length=742

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W KHL+YGPS     + + FP ++DA+  ++   N ++   +QH+IWRV+R ++RA   L
Sbjct  678  WHKHLIYGPSKNNGYQSEAFPAVLDAIVEASGSTNPDKWDAVQHQIWRVSRVLERATLVL  737

Query  182  KGNLT  196
            +G LT
Sbjct  738  RGELT  742



>ref|XP_002982216.1| hypothetical protein SELMODRAFT_421595 [Selaginella moellendorffii]
 gb|EFJ16884.1| hypothetical protein SELMODRAFT_421595 [Selaginella moellendorffii]
Length=783

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W KHL+YGPS     + + FP ++DA+  ++   N ++   +QH+IWRV+R ++RA   L
Sbjct  719  WHKHLIYGPSKNNGYQSEAFPAVLDAIVEASGSTNPDKWDAVQHQIWRVSRVLERATLVL  778

Query  182  KGNLT  196
            +G LT
Sbjct  779  RGELT  783



>gb|EEE55358.1| hypothetical protein OsJ_03401 [Oryza sativa Japonica Group]
Length=504

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KH++Y  S   +     FPGIV A+ ++  LN TE   ++QHEI+R ARA+ +A+  L
Sbjct  440  WYKHMIYASSDQDDWGTKAFPGIVSAIDKANKLNTTESWQLLQHEIYRAARAVSKASAVL  499

Query  182  KGNLT  196
             G LT
Sbjct  500  DGRLT  504



>gb|EEC71454.1| hypothetical protein OsI_03680 [Oryza sativa Indica Group]
Length=543

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KH++Y  S   +     FPGIV A+ ++  LN TE   ++QHEI+R ARA+ +A+  L
Sbjct  479  WYKHMIYASSDQDDWGTKAFPGIVSAIDKANKLNTTESWQLLQHEIYRAARAVSKASAVL  538

Query  182  KGNLT  196
             G LT
Sbjct  539  DGRLT  543



>ref|XP_003569769.2| PREDICTED: probable glutamate carboxypeptidase 2 [Brachypodium 
distachyon]
Length=741

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KH++Y  S   +     FPGIV A++ + HLN TE   ++QHEI+R ARA+ +A+  L
Sbjct  677  WYKHMIYASSDQDDWGTKAFPGIVSAIANAKHLNTTESWRLLQHEIYRGARAVSKASAVL  736

Query  182  KGNLT  196
             G LT
Sbjct  737  DGRLT  741



>ref|XP_002456339.1| hypothetical protein SORBIDRAFT_03g034260 [Sorghum bicolor]
 gb|EES01459.1| hypothetical protein SORBIDRAFT_03g034260 [Sorghum bicolor]
Length=726

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +     +PG+ DA+ ++   N +E    +QHEI+RV+R I +AA  L
Sbjct  662  WYKHLIYAPSLHNDYGAQVYPGVDDAIQKAKKTNTSESWQSVQHEIYRVSRVINQAALVL  721

Query  182  KGNLT  196
             G+LT
Sbjct  722  SGDLT  726



>ref|XP_009121355.1| PREDICTED: probable glutamate carboxypeptidase 2, partial [Brassica 
rapa]
Length=652

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHLVYGPS   +     FPG+ DA+  +  +        +QHEIWRV+RAI+ AA  L
Sbjct  588  WYKHLVYGPSKYDDYGSKSFPGVDDAIDNAKRVKTKASWEHVQHEIWRVSRAIRHAALVL  647

Query  182  KGNL  193
            KG L
Sbjct  648  KGEL  651



>ref|XP_002871904.1| peptidase M28 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48163.1| peptidase M28 family protein [Arabidopsis lyrata subsp. lyrata]
Length=682

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETEL--DFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAY  175
            W+KHL+YGPST  +       FPG+ DA+  +  LN       +QH+IWRV+RAI++A+ 
Sbjct  616  WYKHLIYGPSTYDDYGYGSKSFPGVDDAIDNAKKLNTKASWEYVQHQIWRVSRAIRQASL  675

Query  176  ALKGNL  193
             LKG L
Sbjct  676  VLKGEL  681



>ref|XP_010249479.1| PREDICTED: probable glutamate carboxypeptidase 2 [Nelumbo nucifera]
Length=780

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   +     FPGI DA+ ++  LN  E    +QHE+WR +R +  A+  L
Sbjct  716  WYKHLIYGPSKHDDYGSKSFPGIDDAIEKAKSLNTLEAWRFVQHEVWRASRVVTHASLVL  775

Query  182  KGNLT  196
             G  T
Sbjct  776  SGEFT  780



>ref|XP_010917281.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamate carboxypeptidase 
2 [Elaeis guineensis]
Length=808

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 6/71 (8%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDF------FPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQ  163
            W+KHL+YGPS               FPGI DA  ++  LN ++  + +QHE+WRVARA+ 
Sbjct  738  WYKHLIYGPSMHDXXXXXXGYGSKSFPGIDDATEKAKSLNTSDSWSFVQHEVWRVARAVT  797

Query  164  RAAYALKGNLT  196
            +AA  L G  T
Sbjct  798  QAALVLNGKFT  808



>ref|XP_010535936.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamate carboxypeptidase 
2 [Tarenaya hassleriana]
Length=699

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   +     FPG+ DA+  +  LN  E    ++HEIWRV+RAI+ ++  L
Sbjct  625  WYKHLIYGPSKHDDYGSKSFPGVDDALENAKRLNTEESWQSVRHEIWRVSRAIRHSSLVL  684

Query  182  KGNLT  196
               LT
Sbjct  685  MAQLT  689



>ref|XP_008363032.1| PREDICTED: probable glutamate carboxypeptidase 2, partial [Malus 
domestica]
Length=705

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+YGPS   +     FPGI +A+ ++  L   E   I+QHE++RV+RA++ A+  +
Sbjct  641  WFKHLIYGPSXHDDYGSVSFPGIGEAIEKAKSLKTAESWKIVQHEVYRVSRAVKHASQII  700

Query  182  KGNLT  196
             G LT
Sbjct  701  NGELT  705



>ref|XP_010493052.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Camelina 
sativa]
Length=551

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHLVYGPS   +     FPG+ DA+  +  L+       +QH IWRV+RAI++A+  L
Sbjct  487  WYKHLVYGPSKYDDYGSKSFPGVDDAIENAKKLDTKASWENVQHHIWRVSRAIRQASLVL  546

Query  182  KGNL  193
            KG L
Sbjct  547  KGQL  550



>ref|XP_010493051.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Camelina 
sativa]
Length=677

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHLVYGPS   +     FPG+ DA+  +  L+       +QH IWRV+RAI++A+  L
Sbjct  613  WYKHLVYGPSKYDDYGSKSFPGVDDAIENAKKLDTKASWENVQHHIWRVSRAIRQASLVL  672

Query  182  KGNL  193
            KG L
Sbjct  673  KGQL  676



>dbj|BAK02935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=764

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   + +   +PGI DA++ +   N +    ++QHE+ RVARA+ +A+  L
Sbjct  700  WYKHLIYGPSEQNDWDTASYPGIADAIATARRSNTSASWKLVQHEVHRVARAVAKASAVL  759

Query  182  KGNLT  196
             G+LT
Sbjct  760  SGSLT  764



>emb|CDX92505.1| BnaA10g15440D [Brassica napus]
Length=669

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHLVYGPS   +     FPG+ DAV  +  +        +QHEIWRV+RAI+ A+  L
Sbjct  605  WYKHLVYGPSKYDDYGSKSFPGVDDAVDTAKRVKTKASWEHVQHEIWRVSRAIRHASLVL  664

Query  182  KGNL  193
            KG L
Sbjct  665  KGEL  668



>ref|XP_006646309.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Oryza 
brachyantha]
Length=768

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KH++Y  S   +     FPGIV A+ ++  LN  E   ++QHEI+R ARA+ +A+  L
Sbjct  704  WYKHMIYASSDQDDWGTKAFPGIVSAIDKANKLNTAESWQLLQHEIYRAARAVSKASAVL  763

Query  182  KGNLT  196
             G LT
Sbjct  764  DGRLT  768



>emb|CDY35864.1| BnaC09g37960D [Brassica napus]
Length=668

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHLVYGPS   +     FPG+ DA+  +  +        +QHEIWRV+RAI+ A+  L
Sbjct  604  WYKHLVYGPSKYDDYGSKSFPGVDDAIDNAKRVKTKASWEHVQHEIWRVSRAIRHASLVL  663

Query  182  KGNL  193
            KG L
Sbjct  664  KGEL  667



>gb|KHG11397.1| putative glutamate carboxypeptidase 2 [Gossypium arboreum]
 gb|KHG11398.1| putative glutamate carboxypeptidase 2 [Gossypium arboreum]
Length=702

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+YGP +  E+ L+FFPGI DA++ S +++  +  A I+HEIWRVARAIQRAA AL
Sbjct  638  WFKHLIYGPRSNYESGLEFFPGISDAMAESKNMSQKDGHAAIKHEIWRVARAIQRAAAAL  697

Query  182  KGNLT  196
            KG L 
Sbjct  698  KGELV  702



>ref|XP_004287483.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Fragaria 
vesca subsp. vesca]
Length=550

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 45/85 (53%), Gaps = 13/85 (15%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHLVYGP+   +     FPG+ +A  ++  LN  E    +QHE+WRVARA++ AA  +
Sbjct  477  WYKHLVYGPARNDDYGTKSFPGVDEATEKAKRLNTAESWKFVQHEVWRVARAVRHAAIVI  536

Query  182  KGNLT*VPDRQPCS*CVVRSYIFRK  256
                    +  PCS      Y F K
Sbjct  537  --------NDFPCS-----DYCFAK  548



>emb|CDM84003.1| unnamed protein product [Triticum aestivum]
Length=729

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   + +   +PGI DA++ +   N +    ++QHE+ RVARA+ +A+  L
Sbjct  665  WYKHLIYGPSEQNDWDTASYPGIADAIATARSSNTSASWKLVQHEVHRVARAVAQASAVL  724

Query  182  KGNLT  196
             G+LT
Sbjct  725  SGSLT  729



>emb|CDY44939.1| BnaA02g04440D [Brassica napus]
Length=478

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KH+VYGP+   E     FPGI DA+  +  +       ++QHEIWRV+R I+ A+  L
Sbjct  414  WYKHMVYGPAKYDEYGSKSFPGIDDAIDNAKRVKTKASWGLVQHEIWRVSRVIRHASIVL  473

Query  182  KGNL  193
            KG L
Sbjct  474  KGVL  477



>ref|XP_006572934.1| PREDICTED: probable glutamate carboxypeptidase 2-like isoform 
X1 [Glycine max]
Length=708

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   +     FPGI DAV  + +L+  E    +QHE+WRV+R I++A+  L
Sbjct  644  WYKHLIYGPSKHNDYGSQSFPGIDDAVKMAKNLHTAESWHRVQHEVWRVSRVIKQASLVL  703

Query  182  KGNLT  196
             G L+
Sbjct  704  FGLLS  708



>ref|XP_006572935.1| PREDICTED: probable glutamate carboxypeptidase 2-like isoform 
X2 [Glycine max]
 gb|KHN40372.1| Putative glutamate carboxypeptidase 2 [Glycine soja]
Length=705

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   +     FPGI DAV  + +L+  E    +QHE+WRV+R I++A+  L
Sbjct  641  WYKHLIYGPSKHNDYGSQSFPGIDDAVKMAKNLHTAESWHRVQHEVWRVSRVIKQASLVL  700

Query  182  KGNLT  196
             G L+
Sbjct  701  FGLLS  705



>ref|XP_004969898.1| PREDICTED: probable glutamate carboxypeptidase 2-like isoform 
X1 [Setaria italica]
Length=734

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W KHLVYGPS   + +   +PGI +A+  +   N +E    +QHEI+RVARA+ +A+  L
Sbjct  670  WCKHLVYGPSDQNDWDTAVYPGIANAIGSARSSNTSESWKSVQHEIYRVARAVTQASAVL  729

Query  182  KGNLT  196
             G LT
Sbjct  730  SGRLT  734



>tpg|DAA57713.1| TPA: hypothetical protein ZEAMMB73_749382 [Zea mays]
Length=442

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KH++Y  S   +     FPGIV A+ ++   N TE   ++QHEI+RVARA+ +A+  L
Sbjct  378  WYKHMIYASSDQDDWGTKAFPGIVSAMDKAKKSNTTETWRLLQHEIYRVARAVSKASAVL  437

Query  182  KGNLT  196
             G LT
Sbjct  438  DGKLT  442



>gb|KDP33786.1| hypothetical protein JCGZ_07357 [Jatropha curcas]
Length=703

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y P+       + FPGI DA+ ++  L   E    +QHE+WRV+RA+++ +  L
Sbjct  639  WYKHLIYAPAKHNVYGSNSFPGIDDAIEKAKRLKTAESWQSVQHEVWRVSRAVRQVSLVL  698

Query  182  KGNLT  196
             G LT
Sbjct  699  SGELT  703



>ref|XP_002309233.2| hypothetical protein POPTR_0006s15820g [Populus trichocarpa]
 gb|EEE92756.2| hypothetical protein POPTR_0006s15820g [Populus trichocarpa]
Length=728

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +    +FPGI DA+  +  L+  E    +QH++WRV+RA++  +  L
Sbjct  664  WYKHLIYAPSKHDDYGSSYFPGIDDAIEEARSLSTPEAWRSVQHQVWRVSRAVRHVSQVL  723

Query  182  KGNLT  196
             G LT
Sbjct  724  TGELT  728



>ref|XP_011077913.1| PREDICTED: probable glutamate carboxypeptidase 2 [Sesamum indicum]
Length=679

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+YGP    E+++ FFPGI +A+S    +N  ER A I+HEIWRVARAI+RAA AL
Sbjct  617  WFKHLIYGPRGDTESKIAFFPGIGEAMS--GRMNEEEREATIRHEIWRVARAIERAAIAL  674

Query  182  KGNL  193
            +G L
Sbjct  675  RGEL  678



>emb|CBI27988.3| unnamed protein product [Vitis vinifera]
Length=425

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGP    +     FPGI DA+ ++   +  +  +++QHE+WRV+RA+  A+  L
Sbjct  361  WYKHLIYGPLKHDDYGSKSFPGIDDAIEKAKSQSTEKSWSLVQHEVWRVSRAVIDASLVL  420

Query  182  KGNLT  196
             G LT
Sbjct  421  NGELT  425



>ref|NP_001147292.1| glutamate carboxypeptidase 2 [Zea mays]
 gb|ACG26627.1| glutamate carboxypeptidase 2 [Zea mays]
 gb|ACN33904.1| unknown [Zea mays]
 tpg|DAA57712.1| TPA: glutamate carboxypeptidase 2 [Zea mays]
Length=738

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KH++Y  S   +     FPGIV A+ ++   N TE   ++QHEI+RVARA+ +A+  L
Sbjct  674  WYKHMIYASSDQDDWGTKAFPGIVSAMDKAKKSNTTETWRLLQHEIYRVARAVSKASAVL  733

Query  182  KGNLT  196
             G LT
Sbjct  734  DGKLT  738



>ref|XP_002283565.3| PREDICTED: probable glutamate carboxypeptidase 2 [Vitis vinifera]
Length=776

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGP    +     FPGI DA+ ++   +  +  +++QHE+WRV+RA+  A+  L
Sbjct  712  WYKHLIYGPLKHDDYGSKSFPGIDDAIEKAKSQSTEKSWSLVQHEVWRVSRAVIDASLVL  771

Query  182  KGNLT  196
             G LT
Sbjct  772  NGELT  776



>ref|XP_006604679.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Glycine 
max]
Length=696

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLV+GPS+  E +L+FFPGI D+++R + ++  ER + IQHEIWRVARAI+RAA AL
Sbjct  633  WFKHLVFGPSSNHE-KLNFFPGISDSITRLSGISERERLSSIQHEIWRVARAIRRAASAL  691

Query  182  KGNLT  196
             G  T
Sbjct  692  SGEFT  696



>gb|KEH27224.1| peptidase M28 family protein [Medicago truncatula]
Length=61

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  14   LVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNL  193
            ++YGPS         FPGI DA   + +++  E  + IQHE+WRV+R I+ A+ AL G L
Sbjct  1    MIYGPSKHNNYGSQSFPGIYDAAKMAKNVHTAESWSQIQHEVWRVSRVIRHASLALSGQL  60

Query  194  T  196
            T
Sbjct  61   T  61



>ref|XP_006644691.1| PREDICTED: probable glutamate carboxypeptidase 2-like, partial 
[Oryza brachyantha]
Length=683

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +     +PG+ DA+  +   N +E    +QHEI+R+AR I++A+  L
Sbjct  619  WYKHLIYAPSLHDDYGAQVYPGVDDAIQMAERTNTSESWRSVQHEIYRIARVIKQASLVL  678

Query  182  KGNLT  196
             G LT
Sbjct  679  SGGLT  683



>gb|KHN43582.1| Putative glutamate carboxypeptidase 2 [Glycine soja]
Length=678

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHLV+GPS+  E +L+FFPGI D+++R + ++  ER + IQHEIWRVARAI+RAA AL
Sbjct  615  WFKHLVFGPSSNHE-KLNFFPGISDSITRLSGISERERLSSIQHEIWRVARAIRRAASAL  673

Query  182  KGNLT  196
             G  T
Sbjct  674  SGEFT  678



>dbj|BAJ99016.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=751

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KH++YGPS   +   + +PG+ DA+  +   N ++    +QHEI R+AR I +AA  L
Sbjct  687  WYKHMIYGPSLYNDYGAEVYPGVDDAIQTAKKTNTSQSWQSVQHEIHRIARVISQAALVL  746

Query  182  KGNLT  196
             G LT
Sbjct  747  SGGLT  751



>gb|EAY75780.1| hypothetical protein OsI_03696 [Oryza sativa Indica Group]
Length=728

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +     +PG+ DA+  +   N +E    +QHEI+R+AR I +A+  L
Sbjct  664  WYKHLIYAPSLHDDYGAQVYPGVDDAIQMAERTNTSESWRSVQHEIYRIARVINQASLVL  723

Query  182  KGNLT  196
             G LT
Sbjct  724  SGGLT  728



>ref|XP_011007261.1| PREDICTED: probable glutamate carboxypeptidase 2 [Populus euphratica]
Length=733

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +     FPGI DA+  +  L+  E    +QH++WRV+RA++  +  L
Sbjct  669  WYKHLIYAPSKHDDYGSSCFPGIDDAIEEARSLSTPEAWRSVQHQVWRVSRAVRHVSQVL  728

Query  182  KGNLT  196
             G LT
Sbjct  729  TGELT  733



>ref|NP_001044217.1| Os01g0743300 [Oryza sativa Japonica Group]
 dbj|BAD87907.1| putative glutamate carboxypeptidase [Oryza sativa Japonica Group]
 dbj|BAF06131.1| Os01g0743300 [Oryza sativa Japonica Group]
Length=728

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +     +PG+ DA+  +   N +E    +QHEI+R+AR I +A+  L
Sbjct  664  WYKHLIYAPSLHDDYGAQVYPGVDDAIQMAERTNTSESWRSVQHEIYRIARVINQASLVL  723

Query  182  KGNLT  196
             G LT
Sbjct  724  SGGLT  728



>gb|EEE55364.1| hypothetical protein OsJ_03414 [Oryza sativa Japonica Group]
Length=704

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+Y PS   +     +PG+ DA+  +   N +E    +QHEI+R+AR I +A+  L
Sbjct  640  WYKHLIYAPSLHDDYGAQVYPGVDDAIQMAERTNTSESWRSVQHEIYRIARVINQASLVL  699

Query  182  KGNLT  196
             G LT
Sbjct  700  SGGLT  704



>ref|XP_002514209.1| dipeptidase, putative [Ricinus communis]
 gb|EEF48163.1| dipeptidase, putative [Ricinus communis]
Length=648

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W KHL+Y      +     FPGIVDA+ ++  L   E    +QHE+WRV+RA++ A+  L
Sbjct  584  WNKHLIYASLKHNDYRSKSFPGIVDAIEKAKSLKTAESWHYVQHEVWRVSRAVRHASLVL  643

Query  182  KGNLT  196
             G LT
Sbjct  644  SGELT  648



>ref|XP_006853724.1| hypothetical protein AMTR_s00056p00161720 [Amborella trichopoda]
 gb|ERN15191.1| hypothetical protein AMTR_s00056p00161720 [Amborella trichopoda]
Length=665

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W KHLVYGPS   +     FPGI DA+      +  E  A +QH+IWR +R + +A+  L
Sbjct  601  WHKHLVYGPSKHNDYGSRSFPGIEDAIEEGRSSSTRESWAFVQHQIWRASRVVSQASLVL  660

Query  182  KGNLT  196
            +G+ T
Sbjct  661  RGDFT  665



>gb|EMT32222.1| Putative glutamate carboxypeptidase 2 [Aegilops tauschii]
Length=620

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KH++Y  S   +     FPGIV A++ +  LN +E   ++QHEI+R ARA+ +A+  L
Sbjct  556  WYKHMIYASSDQDDWGTKAFPGIVSAMANAQKLNTSESWRLLQHEIYRGARAVSKASAVL  615

Query  182  KGNLT  196
             G LT
Sbjct  616  DGRLT  620



>ref|XP_004969919.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Setaria 
italica]
Length=724

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KHL+YGPS   +   + +PGI DA+  +   +  E    +Q+EI RVAR I +AA  L
Sbjct  660  WYKHLIYGPSLHNDYGAEIYPGIDDAIQTAKRTSTLESWQAVQNEIHRVARVINQAALVL  719

Query  182  KGNLT  196
             G LT
Sbjct  720  TGGLT  724



>ref|XP_010232288.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Brachypodium 
distachyon]
Length=733

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+YGP    + +   +PGI +A++ +   N +    +++HEI RVARA+ +A+  L
Sbjct  669  WFKHLIYGPLEQNDWDTASYPGIANAIAAARSTNTSASWKLVEHEIHRVARAVMQASAVL  728

Query  182  KGNLT  196
             G+LT
Sbjct  729  GGSLT  733



>ref|XP_010232289.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Brachypodium 
distachyon]
Length=732

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            WFKHL+YGP    + +   +PGI +A++ +   N +    +++HEI RVARA+ +A+  L
Sbjct  668  WFKHLIYGPLEQNDWDTASYPGIANAIAAARSTNTSASWKLVEHEIHRVARAVMQASAVL  727

Query  182  KGNLT  196
             G+LT
Sbjct  728  GGSLT  732



>ref|XP_002966822.1| hypothetical protein SELMODRAFT_87649, partial [Selaginella moellendorffii]
 gb|EFJ31421.1| hypothetical protein SELMODRAFT_87649, partial [Selaginella moellendorffii]
Length=616

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSR-STHLNNTERGAI---IQHEIWRVARAIQRA  169
            WFKHL+YGP+         FP I D +S+ +   +  E  A+   +QHEIWR +RA+Q A
Sbjct  547  WFKHLIYGPTQTNVYGTSTFPAIADVISKMAVGEDKEELKALKQDLQHEIWRASRAVQCA  606

Query  170  AYALKGNL  193
            A  LKG++
Sbjct  607  ANVLKGDI  614



>ref|XP_004969900.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Setaria 
italica]
Length=738

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KH++Y  S   +     FP IV A+ ++   N TE    +QHEI+RVARA+ +A+  L
Sbjct  674  WYKHMIYASSDQDDWGTKAFPDIVSAMDKAKKSNTTESWRSLQHEIYRVARAVSKASAVL  733

Query  182  KGNLT  196
             G LT
Sbjct  734  DGGLT  738



>ref|XP_002961183.1| hypothetical protein SELMODRAFT_61589, partial [Selaginella moellendorffii]
 gb|EFJ38722.1| hypothetical protein SELMODRAFT_61589, partial [Selaginella moellendorffii]
Length=641

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSR-STHLNNTERGAI---IQHEIWRVARAIQRA  169
            WFKHL+YGP+         FP I D +S+ +   +  E  A+   +QHEIWR +RAIQ A
Sbjct  573  WFKHLIYGPTQTNVYGTSTFPAIADVISKMAVGEDKEELKALKQDLQHEIWRASRAIQCA  632

Query  170  AYALKGNL  193
            A  +KG++
Sbjct  633  ANVIKGDI  640



>ref|XP_002966823.1| hypothetical protein SELMODRAFT_61588, partial [Selaginella moellendorffii]
 gb|EFJ31422.1| hypothetical protein SELMODRAFT_61588, partial [Selaginella moellendorffii]
Length=634

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSR-STHLNNTERGAI---IQHEIWRVARAIQRA  169
            WFKHL+YGP+         FP I D +S+ +   +  E  A+   +QHEIWR +RAIQ A
Sbjct  566  WFKHLIYGPTQTNVYGTSTFPAIADVISKMAVGEDKEELKALKQDLQHEIWRASRAIQCA  625

Query  170  AYALKGNL  193
            A  +KG++
Sbjct  626  ANVIKGDI  633



>ref|XP_003569777.1| PREDICTED: probable glutamate carboxypeptidase 2 [Brachypodium 
distachyon]
Length=724

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYAL  181
            W+KH++Y PS   +     +PG  DA+  +   N +E    +QHEI R+AR I +AA  L
Sbjct  660  WYKHMIYAPSRYNDYGAQVYPGADDAIQTAKRTNTSESWQSVQHEIHRIARVINQAALVL  719

Query  182  KGNLT  196
             G LT
Sbjct  720  SGGLT  724



>ref|XP_003520727.2| PREDICTED: probable glutamate carboxypeptidase 2-like [Glycine 
max]
Length=694

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  142
            WFKHLV+GPS+  E  ++FFPGI D+   S  ++  ER A IQHEIW
Sbjct  631  WFKHLVFGPSSDHE-RINFFPGISDSTITSAGVSERERLASIQHEIW  676



>gb|KHN22574.1| Putative glutamate carboxypeptidase 2 [Glycine soja]
Length=594

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  142
            WFKHLV+GPS+  E  ++FFPGI D+   S  ++  ER A IQHEIW
Sbjct  531  WFKHLVFGPSSDHE-RINFFPGISDSTITSAGVSERERLASIQHEIW  576



>gb|ACU21428.1| unknown [Glycine max]
Length=205

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  142
            WFKHLV+GPS+  E  ++FFPGI D+   S  ++  ER A I+HEIW
Sbjct  142  WFKHLVFGPSSDHE-RINFFPGISDSTITSAGVSERERLASIRHEIW  187



>ref|XP_001774966.1| predicted protein [Physcomitrella patens]
 gb|EDQ60232.1| predicted protein [Physcomitrella patens]
Length=675

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 4/69 (6%)
 Frame = +2

Query  2    WFKHLVYGPSTGGETELDFFPGIVDAVSRSTHLN----NTERGAIIQHEIWRVARAIQRA  169
            W+KHLVYG           FPGI DA  ++T  +    NT + A +QHEI+R AR I RA
Sbjct  607  WYKHLVYGRVANNNYGSLSFPGIWDAFHQATESSNDTANTAKWAAVQHEIFRCARVITRA  666

Query  170  AYALKGNLT  196
            +  L+G +T
Sbjct  667  SLVLQGKIT  675



>ref|XP_001781848.1| predicted protein [Physcomitrella patens]
 gb|EDQ53303.1| predicted protein [Physcomitrella patens]
Length=241

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  368  APVAQWIERLFPKQKVVGSTPTWRD  294
            APVAQWIERLFPKQKVVGSTP WR+
Sbjct  207  APVAQWIERLFPKQKVVGSTPIWRE  231



>ref|XP_001781873.1| predicted protein [Physcomitrella patens]
 gb|EDQ53328.1| predicted protein [Physcomitrella patens]
Length=304

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  368  APVAQWIERLFPKQKVVGSTPTWRD  294
            APVAQWIERLFPKQKVVGSTP WR+
Sbjct  207  APVAQWIERLFPKQKVVGSTPIWRE  231



>gb|EMT11464.1| hypothetical protein F775_07896 [Aegilops tauschii]
Length=112

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +2

Query  17   VYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  196
            +YGPS   +   + +PG  DA+  +   N +E    +QHEI R+AR I +AA  L G LT
Sbjct  53   IYGPSLYNDYGAEVYPGADDAIQTAKKTNTSESWQSVQHEIHRIARVISQAALVLSGGLT  112



>ref|XP_003616565.1| hypothetical protein MTR_5g081820 [Medicago truncatula]
 gb|AES99523.1| transmembrane protein, putative [Medicago truncatula]
Length=224

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -1

Query  368  APVAQWIERLFPKQKVVGSTPTWRDVF  288
            APVAQWIER FPK+KVVGSTPTWR  F
Sbjct  172  APVAQWIERPFPKRKVVGSTPTWRVSF  198



>ref|XP_002967665.1| hypothetical protein SELMODRAFT_88219 [Selaginella moellendorffii]
 gb|EFJ31012.1| hypothetical protein SELMODRAFT_88219 [Selaginella moellendorffii]
Length=703

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  8    KHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKG  187
            KHL+YG +T        FPGI  A++ +    +    +++QHEIW+VARAI  AA  L  
Sbjct  641  KHLIYGQTTSDLYGSQSFPGISLALANALAKMDKSTSSVLQHEIWKVARAITNAARVLSD  700

Query  188  NL  193
            N 
Sbjct  701  NF  702



>ref|XP_002964367.1| hypothetical protein SELMODRAFT_81471 [Selaginella moellendorffii]
 gb|EFJ34700.1| hypothetical protein SELMODRAFT_81471 [Selaginella moellendorffii]
Length=703

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  8    KHLVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKG  187
            KHL+YG +T        FPGI  A++ +    +    +++QHEIW+VARAI  AA  L  
Sbjct  641  KHLIYGQTTSDLYGSQSFPGISLALANALAKMDKSTSSVLQHEIWKVARAITNAARVLSD  700

Query  188  NL  193
            N 
Sbjct  701  NF  702



>ref|XP_003635765.1| hypothetical protein MTR_006s0019 [Medicago truncatula]
 gb|KEH39218.1| hypothetical protein MTR_2g090870 [Medicago truncatula]
Length=61

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/21 (100%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -1

Query  356  QWIERLFPKQKVVGSTPTWRD  294
            QWIERLFPKQKVVGSTPTWRD
Sbjct  4    QWIERLFPKQKVVGSTPTWRD  24



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 769335055200