BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19790_g1_i1 len=1262 path=[1:0-51 53:52-74 76:75-669
@798@!:670-1097 1226:1098-1261]

Length=1262
                                                                      Score     E

ref|XP_010105072.1|  putative glutamate carboxypeptidase 2              226   1e-62   
ref|XP_009764874.1|  PREDICTED: probable glutamate carboxypeptida...    223   7e-62   
ref|XP_004250770.1|  PREDICTED: probable glutamate carboxypeptida...    219   2e-60   
ref|XP_009376393.1|  PREDICTED: probable glutamate carboxypeptida...    211   3e-59   
ref|XP_008350228.1|  PREDICTED: probable glutamate carboxypeptida...    202   6e-59   
ref|XP_008350226.1|  PREDICTED: probable glutamate carboxypeptida...    203   1e-58   
ref|XP_006356945.1|  PREDICTED: probable glutamate carboxypeptida...    213   2e-58   
ref|XP_009351318.1|  PREDICTED: probable glutamate carboxypeptida...    207   1e-57   
gb|EYU38716.1|  hypothetical protein MIMGU_mgv1a002286mg                209   7e-57   
ref|XP_008241129.1|  PREDICTED: probable glutamate carboxypeptida...    209   7e-57   
emb|CBI39092.3|  unnamed protein product                                207   1e-56   
ref|XP_010653230.1|  PREDICTED: probable glutamate carboxypeptida...    208   2e-56   
ref|XP_010653229.1|  PREDICTED: probable glutamate carboxypeptida...    208   3e-56   
ref|XP_009379681.1|  PREDICTED: probable glutamate carboxypeptida...    207   4e-56   
ref|XP_002323358.2|  hypothetical protein POPTR_0016s06430g             205   5e-56   Populus trichocarpa [western balsam poplar]
ref|XP_007204052.1|  hypothetical protein PRUPE_ppa026745mg             207   5e-56   
ref|XP_009623706.1|  PREDICTED: probable glutamate carboxypeptida...    206   1e-55   
gb|KHN24331.1|  Putative glutamate carboxypeptidase 2                   200   4e-55   
ref|XP_011042521.1|  PREDICTED: probable glutamate carboxypeptida...    204   7e-55   
ref|XP_008387163.1|  PREDICTED: probable glutamate carboxypeptida...    201   1e-53   
ref|XP_008359523.1|  PREDICTED: probable glutamate carboxypeptida...    200   1e-53   
ref|XP_004305557.1|  PREDICTED: probable glutamate carboxypeptida...    199   2e-53   
ref|XP_006481663.1|  PREDICTED: probable glutamate carboxypeptida...    194   2e-53   
ref|XP_002524116.1|  Transferrin receptor protein, putative             199   2e-53   Ricinus communis
emb|CDP10550.1|  unnamed protein product                                198   8e-53   
ref|XP_003537151.1|  PREDICTED: probable glutamate carboxypeptida...    197   2e-52   
ref|XP_008391599.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    193   2e-52   
dbj|BAM72481.1|  AMP1-like carboxypeptidase                             196   6e-52   
ref|XP_004494296.1|  PREDICTED: probable glutamate carboxypeptida...    193   3e-51   
ref|XP_006429985.1|  hypothetical protein CICLE_v10011190mg             193   4e-51   
ref|XP_006481662.1|  PREDICTED: probable glutamate carboxypeptida...    193   4e-51   
ref|XP_010672603.1|  PREDICTED: probable glutamate carboxypeptida...    194   4e-51   
ref|XP_007145752.1|  hypothetical protein PHAVU_007G264800g             192   1e-50   
gb|KEH24309.1|  glutamate carboxypeptidase, putative                    191   2e-50   
gb|KDP21928.1|  hypothetical protein JCGZ_03066                         191   4e-50   
ref|XP_007163023.1|  hypothetical protein PHAVU_001G199600g             190   7e-50   
ref|XP_011077913.1|  PREDICTED: probable glutamate carboxypeptida...    189   2e-49   
ref|XP_009139219.1|  PREDICTED: probable glutamate carboxypeptida...    187   7e-49   
emb|CDX76133.1|  BnaA04g03970D                                          183   1e-48   
emb|CDX73456.1|  BnaC08g25470D                                          185   3e-48   
ref|XP_010427181.1|  PREDICTED: probable glutamate carboxypeptida...    184   5e-48   
ref|XP_010247434.1|  PREDICTED: probable glutamate carboxypeptida...    183   1e-47   
ref|XP_010247433.1|  PREDICTED: probable glutamate carboxypeptida...    183   1e-47   
gb|KFK34711.1|  hypothetical protein AALP_AA5G181800                    182   2e-47   
ref|XP_002877996.1|  hypothetical protein ARALYDRAFT_485877             182   4e-47   
ref|XP_010504286.1|  PREDICTED: probable glutamate carboxypeptida...    181   8e-47   
ref|XP_006403544.1|  hypothetical protein EUTSA_v10010161mg             181   1e-46   
gb|AAL03993.1|AF357217_1  glutamate carboxypeptidase                    180   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516011.1|  PREDICTED: probable glutamate carboxypeptida...    180   1e-46   
emb|CAB77592.1|  Peptidase-like protein                                 180   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567007.1|  glutamate carboxypeptidase                            180   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010908058.1|  PREDICTED: probable glutamate carboxypeptida...    179   2e-46   
ref|XP_010908056.1|  PREDICTED: probable glutamate carboxypeptida...    179   4e-46   
ref|XP_006604679.1|  PREDICTED: probable glutamate carboxypeptida...    177   1e-45   
ref|XP_007029148.1|  Transferrin receptor protein, putative isofo...    177   1e-45   
emb|CDX78257.1|  BnaA09g34520D                                          177   1e-45   
gb|KHN43582.1|  Putative glutamate carboxypeptidase 2                   177   1e-45   
ref|XP_010908057.1|  PREDICTED: probable glutamate carboxypeptida...    177   2e-45   
gb|ACU21428.1|  unknown                                                 167   3e-45   Glycine max [soybeans]
gb|KHG11397.1|  putative glutamate carboxypeptidase 2                   176   4e-45   
ref|XP_009116147.1|  PREDICTED: probable glutamate carboxypeptida...    176   5e-45   
ref|XP_006290666.1|  hypothetical protein CARUB_v10016757mg             176   6e-45   
ref|XP_010555869.1|  PREDICTED: probable glutamate carboxypeptida...    175   1e-44   
ref|XP_008777140.1|  PREDICTED: probable glutamate carboxypeptida...    174   2e-44   
ref|XP_003520727.2|  PREDICTED: probable glutamate carboxypeptida...    167   3e-42   
ref|XP_008442988.1|  PREDICTED: probable glutamate carboxypeptida...    167   3e-42   
gb|KHN22574.1|  Putative glutamate carboxypeptidase 2                   166   9e-42   
ref|XP_004981489.1|  PREDICTED: probable glutamate carboxypeptida...    165   2e-41   
ref|XP_009398816.1|  PREDICTED: probable glutamate carboxypeptida...    161   2e-41   
ref|XP_006826386.1|  hypothetical protein AMTR_s00004p00142600          164   4e-41   
gb|KEH24313.1|  glutamate carboxypeptidase, putative                    163   8e-41   
gb|KCW48177.1|  hypothetical protein EUGRSUZ_K01904                     161   1e-40   
gb|KEH24312.1|  glutamate carboxypeptidase, putative                    162   2e-40   
ref|XP_010036574.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    162   3e-40   
ref|XP_004136724.1|  PREDICTED: probable glutamate carboxypeptida...    156   2e-38   
ref|XP_004165115.1|  PREDICTED: probable glutamate carboxypeptida...    156   2e-38   
gb|KGN59254.1|  hypothetical protein Csa_3G790960                       155   5e-38   
gb|KDP33786.1|  hypothetical protein JCGZ_07357                         152   8e-37   
ref|XP_011093646.1|  PREDICTED: probable glutamate carboxypeptida...    150   3e-36   
ref|XP_011093647.1|  PREDICTED: probable glutamate carboxypeptida...    150   3e-36   
ref|XP_006451321.1|  hypothetical protein CICLE_v10007621mg             149   6e-36   
gb|KDO66598.1|  hypothetical protein CISIN_1g005260mg                   149   6e-36   
ref|XP_006475591.1|  PREDICTED: probable glutamate carboxypeptida...    149   7e-36   
ref|XP_006646308.1|  PREDICTED: probable glutamate carboxypeptida...    146   2e-35   
ref|NP_001146679.1|  uncharacterized protein LOC100280279               143   5e-35   Zea mays [maize]
ref|XP_009591681.1|  PREDICTED: probable glutamate carboxypeptida...    147   5e-35   
emb|CDP03245.1|  unnamed protein product                                147   5e-35   
ref|XP_002458463.1|  hypothetical protein SORBIDRAFT_03g034150          147   6e-35   Sorghum bicolor [broomcorn]
gb|EEC71454.1|  hypothetical protein OsI_03680                          144   1e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_006644681.1|  PREDICTED: probable glutamate carboxypeptida...    145   1e-34   
ref|XP_004969898.1|  PREDICTED: probable glutamate carboxypeptida...    145   2e-34   
ref|XP_006853725.1|  hypothetical protein AMTR_s00056p00162910          145   2e-34   
ref|XP_006646309.1|  PREDICTED: probable glutamate carboxypeptida...    146   2e-34   
ref|NP_001120724.1|  viviparous8                                        145   2e-34   Zea mays [maize]
tpg|DAA51821.1|  TPA: viviparous8                                       145   2e-34   
tpg|DAA57714.1|  TPA: hypothetical protein ZEAMMB73_602143              142   7e-34   
gb|KDO66599.1|  hypothetical protein CISIN_1g005260mg                   143   8e-34   
ref|XP_008804069.1|  PREDICTED: probable glutamate carboxypeptida...    139   1e-33   
gb|EEC71453.1|  hypothetical protein OsI_03679                          142   2e-33   Oryza sativa Indica Group [Indian rice]
ref|NP_001044202.2|  Os01g0740500                                       142   3e-33   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA57713.1|  TPA: hypothetical protein ZEAMMB73_749382              140   3e-33   
ref|XP_008242478.1|  PREDICTED: probable glutamate carboxypeptida...    141   5e-33   
gb|ACL52515.1|  unknown                                                 138   5e-33   Zea mays [maize]
ref|XP_002466328.1|  hypothetical protein SORBIDRAFT_01g005710          141   7e-33   Sorghum bicolor [broomcorn]
ref|XP_008672765.1|  PREDICTED: uncharacterized protein LOC100280...    141   8e-33   
ref|XP_010249479.1|  PREDICTED: probable glutamate carboxypeptida...    141   8e-33   
ref|XP_007203613.1|  hypothetical protein PRUPE_ppa002244mg             140   1e-32   
ref|XP_002960093.1|  hypothetical protein SELMODRAFT_73556              140   1e-32   
dbj|BAK02935.1|  predicted protein                                      140   1e-32   
gb|EYU27261.1|  hypothetical protein MIMGU_mgv1a002132mg                139   2e-32   
ref|XP_002992244.1|  hypothetical protein SELMODRAFT_134963             139   2e-32   
ref|XP_003569769.2|  PREDICTED: probable glutamate carboxypeptida...    139   2e-32   
ref|XP_004304505.1|  PREDICTED: probable glutamate carboxypeptida...    139   2e-32   
ref|XP_002982216.1|  hypothetical protein SELMODRAFT_421595             139   3e-32   
ref|NP_001147292.1|  glutamate carboxypeptidase 2                       139   3e-32   Zea mays [maize]
gb|KHG30466.1|  putative glutamate carboxypeptidase 2 -like protein     139   4e-32   
ref|XP_004287483.1|  PREDICTED: probable glutamate carboxypeptida...    137   4e-32   
ref|XP_010049609.1|  PREDICTED: probable glutamate carboxypeptida...    138   5e-32   
ref|XP_006353498.1|  PREDICTED: probable glutamate carboxypeptida...    138   5e-32   
ref|XP_008776572.1|  PREDICTED: probable glutamate carboxypeptida...    138   6e-32   
ref|XP_001774966.1|  predicted protein                                  137   7e-32   
gb|KEH27221.1|  peptidase M28 family protein                            137   9e-32   
ref|XP_002309233.2|  hypothetical protein POPTR_0006s15820g             137   9e-32   Populus trichocarpa [western balsam poplar]
ref|XP_003559345.1|  PREDICTED: probable glutamate carboxypeptida...    137   1e-31   
gb|AFW85116.1|  hypothetical protein ZEAMMB73_052433                    137   1e-31   
emb|CDY42292.1|  BnaC02g08980D                                          137   1e-31   
gb|ACG29176.1|  glutamate carboxypeptidase 2                            137   1e-31   Zea mays [maize]
ref|XP_009776393.1|  PREDICTED: probable glutamate carboxypeptida...    137   1e-31   
ref|XP_008363032.1|  PREDICTED: probable glutamate carboxypeptida...    137   1e-31   
ref|XP_009776392.1|  PREDICTED: probable glutamate carboxypeptida...    137   1e-31   
emb|CBI27988.3|  unnamed protein product                                134   1e-31   
gb|ABF99278.1|  glutamate carboxypeptidase II, putative, expressed      131   1e-31   Oryza sativa Japonica Group [Japonica rice]
emb|CDM84003.1|  unnamed protein product                                137   2e-31   
ref|XP_002514209.1|  dipeptidase, putative                              135   3e-31   Ricinus communis
ref|XP_002984044.1|  hypothetical protein SELMODRAFT_119241             135   4e-31   
ref|XP_011007261.1|  PREDICTED: probable glutamate carboxypeptida...    136   4e-31   
ref|XP_001784043.1|  predicted protein                                  135   4e-31   
ref|XP_006650705.1|  PREDICTED: probable glutamate carboxypeptida...    133   5e-31   
ref|XP_002456339.1|  hypothetical protein SORBIDRAFT_03g034260          135   7e-31   Sorghum bicolor [broomcorn]
tpg|DAA51820.1|  TPA: viviparous8                                       135   1e-30   
ref|XP_009121355.1|  PREDICTED: probable glutamate carboxypeptida...    133   2e-30   
ref|XP_002283565.3|  PREDICTED: probable glutamate carboxypeptida...    134   2e-30   Vitis vinifera
gb|KFK26210.1|  peptidase m28 family protein                            134   2e-30   
ref|XP_010917281.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    134   2e-30   
gb|EMT26362.1|  Putative glutamate carboxypeptidase 2                   131   2e-30   
ref|XP_007013008.1|  Peptidase M28 family protein isoform 1             134   2e-30   
ref|XP_008344001.1|  PREDICTED: probable glutamate carboxypeptida...    132   6e-30   
ref|XP_008354418.1|  PREDICTED: probable glutamate carboxypeptida...    132   7e-30   
emb|CDX92505.1|  BnaA10g15440D                                          131   1e-29   
ref|NP_001051516.2|  Os03g0790600                                       129   1e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009416468.1|  PREDICTED: probable glutamate carboxypeptida...    131   1e-29   
dbj|BAJ99016.1|  predicted protein                                      131   2e-29   
ref|XP_004491175.1|  PREDICTED: probable glutamate carboxypeptida...    130   2e-29   
ref|XP_006289406.1|  hypothetical protein CARUB_v10002906mg             130   3e-29   
ref|XP_010420791.1|  PREDICTED: probable glutamate carboxypeptida...    130   4e-29   
ref|XP_010535936.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    128   1e-28   
emb|CDY35864.1|  BnaC09g37960D                                          127   2e-28   
gb|AAO24914.1|  putative glutamate carboxypeptidase                     128   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006572934.1|  PREDICTED: probable glutamate carboxypeptida...    127   3e-28   
ref|XP_006572935.1|  PREDICTED: probable glutamate carboxypeptida...    127   3e-28   
gb|EPS58906.1|  hypothetical protein M569_15905                         126   3e-28   
ref|XP_010493052.1|  PREDICTED: probable glutamate carboxypeptida...    125   4e-28   
ref|XP_010493051.1|  PREDICTED: probable glutamate carboxypeptida...    126   5e-28   
ref|XP_006400535.1|  hypothetical protein EUTSA_v10012881mg             126   6e-28   
ref|XP_002871904.1|  peptidase M28 family protein                       126   7e-28   
ref|NP_197475.2|  peptidase M28 family protein                          125   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006644691.1|  PREDICTED: probable glutamate carboxypeptida...    123   6e-27   
ref|XP_004969900.1|  PREDICTED: probable glutamate carboxypeptida...    123   7e-27   
gb|EMT32222.1|  Putative glutamate carboxypeptidase 2                   122   1e-26   
gb|EEE55358.1|  hypothetical protein OsJ_03401                          120   1e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EAY75780.1|  hypothetical protein OsI_03696                          121   2e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_010915061.1|  PREDICTED: probable glutamate carboxypeptida...    120   5e-26   
gb|EMT08802.1|  Putative glutamate carboxypeptidase 2                   120   5e-26   
ref|XP_004969919.1|  PREDICTED: probable glutamate carboxypeptida...    120   6e-26   
ref|NP_001044217.1|  Os01g0743300                                       120   7e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55364.1|  hypothetical protein OsJ_03414                          120   8e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004969899.1|  PREDICTED: probable glutamate carboxypeptida...    119   1e-25   
ref|XP_010232288.1|  PREDICTED: probable glutamate carboxypeptida...    118   3e-25   
ref|XP_010232289.1|  PREDICTED: probable glutamate carboxypeptida...    118   3e-25   
ref|XP_006381925.1|  hypothetical protein POPTR_0006s21270g             108   5e-25   
ref|XP_010915053.1|  PREDICTED: probable glutamate carboxypeptida...    117   8e-25   
ref|XP_002964367.1|  hypothetical protein SELMODRAFT_81471              114   6e-24   
ref|XP_006853724.1|  hypothetical protein AMTR_s00056p00161720          113   1e-23   
ref|XP_002961183.1|  hypothetical protein SELMODRAFT_61589              113   1e-23   
ref|XP_002967665.1|  hypothetical protein SELMODRAFT_88219              113   1e-23   
gb|ABF99279.1|  glutamate carboxypeptidase II, putative, expressed      110   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|KEH24310.1|  glutamate carboxypeptidase, putative                    112   2e-23   
ref|XP_002966822.1|  hypothetical protein SELMODRAFT_87649              110   6e-23   
ref|XP_009776394.1|  PREDICTED: probable glutamate carboxypeptida...    110   9e-23   
ref|XP_002966823.1|  hypothetical protein SELMODRAFT_61588              110   1e-22   
gb|KCW82315.1|  hypothetical protein EUGRSUZ_C03720                     108   4e-22   
gb|EEE55357.1|  hypothetical protein OsJ_03400                          107   5e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003569777.1|  PREDICTED: probable glutamate carboxypeptida...    107   1e-21   
emb|CBI25817.3|  unnamed protein product                                101   1e-20   
ref|XP_008363033.1|  PREDICTED: probable glutamate carboxypeptida...    102   1e-20   
ref|XP_010646810.1|  PREDICTED: probable glutamate carboxypeptida...    100   2e-20   
ref|XP_010915036.1|  PREDICTED: probable glutamate carboxypeptida...    103   2e-20   
ref|XP_010915044.1|  PREDICTED: probable glutamate carboxypeptida...    103   3e-20   
ref|XP_010646825.1|  PREDICTED: probable glutamate carboxypeptida...  94.0    4e-19   
ref|XP_007029149.1|  Transferrin receptor protein, putative isofo...  99.4    4e-19   
gb|KEH24311.1|  glutamate carboxypeptidase, putative                  99.0    5e-19   
ref|XP_002966820.1|  hypothetical protein SELMODRAFT_86742            98.6    8e-19   
emb|CBI23457.3|  unnamed protein product                              94.4    2e-18   
ref|XP_010646875.1|  PREDICTED: probable glutamate carboxypeptida...  94.0    2e-18   
ref|XP_010646874.1|  PREDICTED: probable glutamate carboxypeptida...  94.4    3e-18   
emb|CBI29491.3|  unnamed protein product                              94.4    4e-18   
ref|XP_009591682.1|  PREDICTED: probable glutamate carboxypeptida...  95.1    1e-17   
ref|XP_009591683.1|  PREDICTED: probable glutamate carboxypeptida...  94.7    1e-17   
ref|XP_010314059.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...  94.0    2e-17   
emb|CEG79716.1|  hypothetical protein RMATCC62417_14148               93.6    4e-17   
emb|CEG79717.1|  hypothetical protein RMATCC62417_14148               93.6    4e-17   
gb|EIE82054.1|  hypothetical protein RO3G_06759                       93.2    5e-17   
gb|KEH27223.1|  peptidase M28 family protein                          92.8    6e-17   
emb|CEG71914.1|  hypothetical protein RMATCC62417_07563               92.4    1e-16   
emb|CEI91111.1|  hypothetical protein RMCBS344292_05411               92.4    1e-16   
emb|CEI91110.1|  hypothetical protein RMCBS344292_05411               92.0    1e-16   
gb|EPB82894.1|  hypothetical protein HMPREF1544_10365                 91.3    2e-16   
ref|XP_005379781.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  90.9    3e-16   
ref|XP_007666301.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  90.1    5e-16   
emb|CDH55564.1|  glutamate                                            90.1    6e-16   
emb|CDH52307.1|  glutamate carboxypeptidase                           89.4    9e-16   
emb|CEI90498.1|  hypothetical protein RMCBS344292_04823               89.0    1e-15   
ref|XP_004661942.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  89.0    1e-15   
emb|CDS05363.1|  hypothetical protein LRAMOSA07892                    89.0    2e-15   
gb|KCW82316.1|  hypothetical protein EUGRSUZ_C03720                   88.2    2e-15   
dbj|BAD86951.1|  putative glutamate carboxypeptidase                  88.2    2e-15   Oryza sativa Japonica Group [Japonica rice]
emb|CDM84002.1|  unnamed protein product                              88.2    2e-15   
emb|CDS09725.1|  hypothetical protein LRAMOSA02402                    87.4    4e-15   
ref|XP_008442989.1|  PREDICTED: probable glutamate carboxypeptida...  87.0    4e-15   
gb|EIE85140.1|  hypothetical protein RO3G_09850                       87.4    4e-15   
ref|XP_006260455.1|  PREDICTED: putative N-acetylated-alpha-linke...  86.7    5e-15   
gb|EIE80119.1|  hypothetical protein RO3G_04824                       86.3    1e-14   
gb|EMS58125.1|  putative glutamate carboxypeptidase 2                 85.1    1e-14   
ref|XP_006021112.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  85.5    1e-14   
dbj|BAB28132.1|  unnamed protein product                              82.8    1e-14   Mus musculus [mouse]
emb|CDH55560.1|  glutamate carboxypeptidase                           85.5    2e-14   
gb|KEQ88865.1|  putative glutamate carboxypeptidase                   85.5    2e-14   
ref|XP_006021115.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  84.7    2e-14   
ref|NP_001025553.1|  N-acetylated-alpha-linked acidic dipeptidase 2   85.1    2e-14   Xenopus tropicalis [western clawed frog]
gb|KDE07172.1|  hypothetical protein MVLG_02573                       85.5    2e-14   
ref|XP_006021114.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  84.7    2e-14   
emb|CBI23439.3|  unnamed protein product                              84.0    3e-14   
ref|XP_010646730.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...  84.7    3e-14   
ref|XP_004868251.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  84.7    3e-14   
ref|XP_004868248.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  84.3    4e-14   
ref|XP_004893553.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  84.3    4e-14   
ref|XP_005307958.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  84.3    4e-14   
gb|KEH27222.1|  peptidase M28 family protein                          84.0    4e-14   
gb|AFW85117.1|  hypothetical protein ZEAMMB73_052433                  84.0    5e-14   
ref|XP_004893556.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  84.0    5e-14   
ref|XP_004893551.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  84.0    5e-14   
ref|XP_003219416.2|  PREDICTED: putative N-acetylated-alpha-linke...  84.0    5e-14   
ref|XP_006021110.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  84.0    5e-14   
ref|XP_004618723.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  84.0    5e-14   
ref|XP_006274653.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  84.0    6e-14   
dbj|GAM35464.1|  hypothetical protein TCE0_017f03820                  84.0    6e-14   
ref|NP_001089576.1|  N-acetylated alpha-linked acidic dipeptidase 2   84.0    6e-14   Xenopus laevis [clawed frog]
ref|XP_009564685.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  83.6    7e-14   
gb|KEQ65968.1|  glutamate carboxypeptidase 2                          83.6    7e-14   
ref|XP_008590502.1|  PREDICTED: putative N-acetylated-alpha-linke...  80.5    8e-14   
gb|KEQ69877.1|  peptidase M28                                         83.6    8e-14   
ref|XP_005357668.1|  PREDICTED: glutamate carboxypeptidase 2 isof...  83.2    9e-14   
ref|XP_008588136.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  83.2    1e-13   
ref|XP_006055382.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  83.2    1e-13   
ref|XP_006118446.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.4    1e-13   
ref|XP_004411983.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  83.2    1e-13   
ref|XP_007936242.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  83.2    1e-13   
ref|XP_006160401.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  83.2    1e-13   
emb|CDS09726.1|  hypothetical protein LRAMOSA02403                    83.2    1e-13   
ref|XP_006055379.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.8    1e-13   
ref|XP_006160400.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.8    1e-13   
gb|EMP32663.1|  N-acetylated-alpha-linked acidic dipeptidase 2        82.8    1e-13   
ref|XP_008529907.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.8    1e-13   
ref|XP_004796095.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.4    1e-13   
ref|XP_010632018.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.4    1e-13   
ref|XP_005970133.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.8    1e-13   
ref|XP_010632016.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.8    1e-13   
gb|KFO29233.1|  N-acetylated-alpha-linked acidic dipeptidase 2        82.8    1e-13   
ref|XP_010632013.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.8    1e-13   
ref|XP_001488735.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.8    2e-13   
ref|XP_005699472.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.4    2e-13   
ref|XP_004585238.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.4    2e-13   
ref|XP_004427510.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.4    2e-13   
ref|XP_006118445.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.4    2e-13   
ref|XP_004019433.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.4    2e-13   
ref|XP_003766564.1|  PREDICTED: glutamate carboxypeptidase 2-like     82.4    2e-13   
ref|XP_007063186.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.4    2e-13   
ref|XP_007495111.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.6    2e-13   
ref|XP_010892019.1|  PREDICTED: putative N-acetylated-alpha-linke...  82.0    2e-13   
gb|EPB82892.1|  hypothetical protein HMPREF1544_10363                 82.0    2e-13   
ref|XP_008170063.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.0    2e-13   
ref|XP_004658314.1|  PREDICTED: glutamate carboxypeptidase 2-like...  81.3    3e-13   
ref|XP_004796094.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.0    3e-13   
ref|XP_004763660.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.0    3e-13   
ref|XP_004364466.1|  prostate-specific membrane antigen               82.0    3e-13   
gb|EFW43554.2|  prostate-specific membrane antigen                    81.6    3e-13   
ref|XP_008686565.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  82.0    3e-13   
gb|KCW48178.1|  hypothetical protein EUGRSUZ_K01904                   80.5    3e-13   
ref|XP_008308030.1|  PREDICTED: putative N-acetylated-alpha-linke...  81.6    3e-13   
ref|XP_006510685.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.6    3e-13   
ref|XP_003764377.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.6    3e-13   
ref|XP_008261085.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.6    3e-13   
ref|XP_005304119.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.3    3e-13   
ref|XP_002708686.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.6    3e-13   
gb|EMS19580.1|  glutamate carboxypeptidase II                         81.6    3e-13   
ref|XP_005304118.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.6    3e-13   
ref|XP_007588310.1|  putative glutamate carboxypeptidase protein      82.0    3e-13   
ref|XP_005908096.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.6    3e-13   
ref|XP_006510686.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.6    3e-13   
ref|XP_001364045.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.6    3e-13   
ref|XP_008686564.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.6    4e-13   
gb|ELK00442.1|  N-acetylated-alpha-linked acidic dipeptidase 2        81.6    4e-13   
ref|XP_007495110.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.3    4e-13   
ref|XP_007495106.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.6    4e-13   
ref|XP_004647498.1|  PREDICTED: glutamate carboxypeptidase 2-like     81.6    4e-13   
ref|XP_006926770.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.3    4e-13   
gb|ELR47393.1|  N-acetylated-alpha-linked acidic dipeptidase 2        81.3    4e-13   
ref|XP_006510688.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.3    4e-13   
ref|XP_003764376.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.3    4e-13   
ref|XP_005038424.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.3    4e-13   
ref|XP_004475849.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.3    4e-13   
ref|XP_006510687.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  81.3    4e-13   
ref|XP_006776332.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.9    4e-13   
gb|AAI08996.1|  N-acetylated alpha-linked acidic dipeptidase 2        81.3    4e-13   
gb|EPQ07184.1|  N-acetylated-alpha-linked acidic dipeptidase 2        81.3    4e-13   
ref|NP_082555.2|  N-acetylated-alpha-linked acidic dipeptidase 2      81.3    4e-13   
dbj|BAE36408.1|  unnamed protein product                              81.3    5e-13   
ref|WP_022813467.1|  glutamate carboxypeptidase                       81.3    5e-13   
ref|XP_005226725.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.9    5e-13   
ref|NP_001153178.1|  glutamate carboxypeptidase 2 isoform 2           80.9    5e-13   
ref|XP_006727430.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.9    5e-13   
ref|XP_007079070.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.9    5e-13   
ref|XP_004658312.1|  PREDICTED: glutamate carboxypeptidase 2-like...  80.9    5e-13   
ref|XP_005149848.1|  PREDICTED: glutamate carboxypeptidase 2-like     80.9    5e-13   
ref|XP_007174338.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.9    6e-13   
ref|XP_007079069.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.9    6e-13   
ref|XP_003992685.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.9    6e-13   
gb|EMD88450.1|  hypothetical protein COCHEDRAFT_1226672               80.9    6e-13   
ref|XP_008764149.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.1    6e-13   
ref|XP_003780877.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.9    7e-13   
ref|NP_058050.3|  glutamate carboxypeptidase 2 isoform 1              80.9    7e-13   
ref|XP_006194619.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.5    7e-13   
ref|NP_001179809.1|  N-acetylated-alpha-linked acidic dipeptidase 2   80.5    7e-13   
ref|XP_010977772.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.5    7e-13   
dbj|BAB22457.1|  unnamed protein product                              80.5    7e-13   
ref|XP_010971672.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.5    7e-13   
ref|XP_005865351.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.5    7e-13   
ref|XP_006092931.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.5    7e-13   
ref|XP_008764145.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.5    7e-13   
ref|XP_005865350.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.5    7e-13   
gb|EGC46043.1|  membrane transporter                                  80.5    7e-13   
ref|XP_006508086.1|  PREDICTED: glutamate carboxypeptidase 2 isof...  80.5    7e-13   
gb|EWM27242.1|  glutamate carboxypeptidase                            80.5    7e-13   
ref|XP_007538607.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.5    7e-13   
ref|XP_005942852.1|  PREDICTED: glutamate carboxypeptidase 2-like     80.5    7e-13   
gb|EEH11071.1|  membrane protein                                      80.5    7e-13   
ref|XP_006980744.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.5    8e-13   
emb|CDR19143.1|  unnamed protein product                              78.2    8e-13   
ref|XP_004390540.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.5    8e-13   
ref|XP_006936919.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.5    8e-13   
ref|NP_001287859.1|  N-acetylated-alpha-linked acidic dipeptidase...  80.5    8e-13   
ref|XP_009991415.1|  PREDICTED: putative N-acetylated-alpha-linke...  77.8    8e-13   
gb|EER43110.1|  membrane protein                                      80.5    8e-13   
ref|XP_004543944.1|  PREDICTED: glutamate carboxypeptidase 2-like...  80.5    9e-13   
ref|XP_003910578.1|  PREDICTED: putative N-acetylated-alpha-linke...  77.0    9e-13   
ref|XP_005720764.1|  PREDICTED: glutamate carboxypeptidase 2-like...  80.1    9e-13   
ref|NP_001100272.1|  N-acetylated-alpha-linked acidic dipeptidase 2   80.5    9e-13   
ref|XP_005273758.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.1    9e-13   
ref|XP_003441699.1|  PREDICTED: glutamate carboxypeptidase 2-like...  80.1    9e-13   
ref|XP_009422240.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.1    1e-12   
ref|XP_008764144.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.1    1e-12   
ref|XP_006219410.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.1    1e-12   
ref|XP_006136627.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.1    1e-12   
ref|XP_008964629.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.1    1e-12   
ref|XP_006242630.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.1    1e-12   
ref|XP_009422239.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.1    1e-12   
ref|XP_006776331.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.1    1e-12   
ref|NP_005458.1|  N-acetylated-alpha-linked acidic dipeptidase 2 ...  80.1    1e-12   
gb|AAH96317.1|  N-acetylated alpha-linked acidic dipeptidase 2        80.1    1e-12   
ref|XP_008067072.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.1    1e-12   
pdb|3FEC|A  Chain A, Crystal Structure Of Human Glutamate Carboxy...  80.1    1e-12   
ref|XP_008835966.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.1    1e-12   
ref|XP_006136628.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  80.1    1e-12   
ref|WP_011523625.1|  glutamate carboxypeptidase II                    80.1    1e-12   
emb|CDP31627.1|  Putative Glutamate carboxypeptidase 2                80.1    1e-12   
gb|EGW12255.1|  N-acetylated-alpha-linked acidic dipeptidase-like...  79.7    1e-12   
ref|XP_003514643.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.7    1e-12   
gb|KFZ51271.1|  N-acetylated-alpha-linked acidic dipeptidase 2        79.3    1e-12   
ref|XP_508692.2|  PREDICTED: N-acetylated-alpha-linked acidic dip...  79.7    1e-12   
ref|XP_007490999.1|  PREDICTED: glutamate carboxypeptidase 2-like     79.7    1e-12   
ref|XP_004708951.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.7    1e-12   
ref|XP_006901520.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.7    1e-12   
ref|XP_009422238.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.7    1e-12   
ref|XP_007713997.1|  hypothetical protein COCCADRAFT_6467             79.7    1e-12   
ref|XP_002916700.1|  PREDICTED: n-acetylated-alpha-linked acidic ...  79.7    1e-12   
ref|XP_008578202.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.7    1e-12   
ref|XP_002916921.1|  PREDICTED: n-acetylated-alpha-linked acidic ...  79.7    2e-12   
ref|XP_002822393.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.7    2e-12   
ref|XP_004912224.1|  PREDICTED: glutamate carboxypeptidase 2-like...  79.7    2e-12   
ref|XP_008018680.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.7    2e-12   
ref|XP_001082880.1|  PREDICTED: n-acetylated-alpha-linked acidic ...  79.3    2e-12   
gb|EFB26228.1|  hypothetical protein PANDA_004820                     79.7    2e-12   
ref|XP_009639980.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.3    2e-12   
gb|EFB12923.1|  hypothetical protein PANDA_005064                     79.3    2e-12   
ref|XP_007462087.1|  PREDICTED: LOW QUALITY PROTEIN: N-acetylated...  79.3    2e-12   
ref|XP_005579396.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.3    2e-12   
ref|XP_005633430.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.0    2e-12   
ref|XP_007650065.1|  PREDICTED: LOW QUALITY PROTEIN: N-acetylated...  79.3    2e-12   
ref|XP_007617930.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.3    2e-12   
ref|XP_001540754.1|  conserved hypothetical protein                   79.3    2e-12   
ref|XP_008723328.1|  hypothetical protein G647_01707                  79.3    2e-12   
gb|EHH23316.1|  hypothetical protein EGK_06762                        79.3    2e-12   
ref|XP_003253505.2|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.3    2e-12   
ref|XP_006056564.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.3    2e-12   
gb|KEY73638.1|  hypothetical protein S7711_09679                      79.3    2e-12   
ref|XP_004329784.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.0    2e-12   
ref|XP_005063363.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.0    2e-12   
gb|EPB81132.1|  hypothetical protein HMPREF1544_12171                 79.3    2e-12   
gb|KEQ92932.1|  hypothetical protein AUEXF2481DRAFT_7294              79.3    2e-12   
ref|XP_004264380.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.3    2e-12   
ref|XP_008707351.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.3    2e-12   
ref|XP_005434744.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.3    2e-12   
ref|XP_005232254.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.0    2e-12   
gb|EDM12570.1|  rCG47528, isoform CRA_a                               79.0    2e-12   
ref|XP_004641970.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.0    2e-12   
ref|XP_005633429.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.0    2e-12   
ref|XP_004656705.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.0    2e-12   
gb|EEQ86559.1|  glutamate carboxypeptidase                            79.0    2e-12   
ref|XP_005084099.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.0    2e-12   
gb|KFP35527.1|  Glutamate carboxypeptidase 2                          79.0    2e-12   
gb|KFQ44559.1|  Glutamate carboxypeptidase 2                          79.0    2e-12   
gb|EQL37161.1|  glutamate carboxypeptidase II                         79.0    2e-12   
ref|NP_001093778.1|  N-acetylated-alpha-linked acidic dipeptidase...  79.0    2e-12   
ref|XP_007688358.1|  hypothetical protein COCMIDRAFT_96373            79.0    2e-12   
ref|XP_010016962.1|  PREDICTED: putative N-acetylated-alpha-linke...  79.0    3e-12   
ref|XP_005516791.1|  PREDICTED: LOW QUALITY PROTEIN: N-acetylated...  79.0    3e-12   
ref|XP_010115223.1|  PREDICTED: putative N-acetylated-alpha-linke...  79.0    3e-12   
ref|XP_005149756.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.0    3e-12   
gb|AAI51636.1|  NAALADL1 protein                                      79.0    3e-12   
ref|XP_010399389.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  78.2    3e-12   
ref|XP_005894135.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  79.0    3e-12   
ref|XP_006679350.1|  hypothetical protein BATDEDRAFT_11902            78.6    3e-12   
ref|XP_005304120.1|  PREDICTED: putative N-acetylated-alpha-linke...  78.6    3e-12   
ref|XP_542257.3|  PREDICTED: N-acetylated-alpha-linked acidic dip...  78.6    3e-12   
gb|AAB96759.1|  glutamate carboxypeptidase II                         78.2    3e-12   
ref|XP_008942433.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  78.6    3e-12   
ref|XP_010399390.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  78.2    3e-12   
ref|XP_010149173.1|  PREDICTED: putative N-acetylated-alpha-linke...  76.3    3e-12   
ref|XP_006995784.1|  PREDICTED: glutamate carboxypeptidase 2-like...  78.6    3e-12   
ref|XP_009899819.1|  PREDICTED: glutamate carboxypeptidase 2-like     78.6    3e-12   
gb|KFV68137.1|  Glutamate carboxypeptidase 2                          78.6    3e-12   
ref|XP_007518649.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  78.6    3e-12   
gb|KFR02873.1|  N-acetylated-alpha-linked acidic dipeptidase 2        78.6    3e-12   
ref|XP_010350579.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  78.6    4e-12   
gb|KFW79789.1|  N-acetylated-alpha-linked acidic dipeptidase 2        77.8    4e-12   
ref|XP_005988971.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  78.6    4e-12   
ref|XP_009468650.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  78.6    4e-12   
ref|XP_009687395.1|  PREDICTED: putative N-acetylated-alpha-linke...  77.8    4e-12   
gb|EPB92272.1|  hypothetical protein HMPREF1544_00841                 78.2    4e-12   
gb|KFA67353.1|  hypothetical protein S40285_07030                     78.2    4e-12   
ref|XP_005434766.1|  PREDICTED: glutamate carboxypeptidase 2          78.2    4e-12   
ref|XP_005232275.1|  PREDICTED: glutamate carboxypeptidase 2-like     78.2    4e-12   
ref|XP_006802159.1|  PREDICTED: glutamate carboxypeptidase 2-like     78.2    4e-12   
ref|XP_005341785.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  78.2    4e-12   
ref|XP_010374966.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  78.2    4e-12   
gb|ABQ22898.1|  glutamate carboxypeptidase 2-like protein             74.7    4e-12   
ref|XP_009511887.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  77.4    4e-12   
ref|NP_113947.1|  N-acetylated-alpha-linked acidic dipeptidase-li...  78.2    4e-12   
gb|KFV19938.1|  N-acetylated-alpha-linked acidic dipeptidase 2        78.2    4e-12   
ref|XP_009987860.1|  PREDICTED: putative N-acetylated-alpha-linke...  78.2    4e-12   
ref|XP_010632083.1|  PREDICTED: putative N-acetylated-alpha-linke...  78.2    4e-12   
ref|XP_006995783.1|  PREDICTED: glutamate carboxypeptidase 2-like...  78.2    4e-12   
ref|XP_005959374.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  78.2    4e-12   
ref|XP_006628182.1|  PREDICTED: glutamate carboxypeptidase 2-like     78.2    4e-12   
ref|XP_006926768.1|  PREDICTED: glutamate carboxypeptidase 2          78.2    4e-12   
ref|XP_002754764.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  78.2    4e-12   
ref|XP_009707780.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  78.2    5e-12   
ref|XP_009005516.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  78.2    5e-12   
gb|KFO29237.1|  Glutamate carboxypeptidase 2                          78.2    5e-12   
ref|XP_008851841.1|  PREDICTED: glutamate carboxypeptidase 2          78.2    5e-12   
ref|XP_007070410.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  78.2    5e-12   
gb|KFP61704.1|  N-acetylated-alpha-linked acidic dipeptidase 2        77.8    5e-12   
ref|XP_009100992.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  77.8    5e-12   
ref|XP_009879486.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  77.8    5e-12   
ref|XP_002124485.1|  PREDICTED: putative N-acetylated-alpha-linke...  77.8    5e-12   
ref|XP_003468650.1|  PREDICTED: glutamate carboxypeptidase 2-like...  77.8    5e-12   
ref|XP_005333519.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  77.8    5e-12   
ref|XP_008147380.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  77.8    5e-12   
ref|XP_010374965.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  77.8    5e-12   
gb|KGL90185.1|  N-acetylated-alpha-linked acidic dipeptidase 2        77.8    5e-12   
ref|XP_003514884.1|  PREDICTED: glutamate carboxypeptidase 2 isof...  77.8    5e-12   
gb|EDM18599.1|  folate hydrolase                                      77.8    5e-12   
ref|XP_004019709.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  77.8    5e-12   
ref|XP_005996306.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  77.8    5e-12   
ref|NP_476533.1|  glutamate carboxypeptidase 2                        77.8    5e-12   
ref|XP_010399385.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  77.8    5e-12   
ref|XP_010399387.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  77.4    6e-12   
ref|XP_010399383.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  77.8    6e-12   
ref|XP_008299727.1|  PREDICTED: putative N-acetylated-alpha-linke...  77.8    6e-12   
ref|XP_009819703.1|  PREDICTED: N-acetylated-alpha-linked acidic ...  77.8    6e-12   



>ref|XP_010105072.1| putative glutamate carboxypeptidase 2 [Morus notabilis]
 gb|EXC03810.1| putative glutamate carboxypeptidase 2 [Morus notabilis]
Length=720

 Score =   226 bits (575),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 165/262 (63%), Gaps = 57/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFP YHTAFDSYDWMI +GDP F+RH+AV+GVWGLL LHLAD+ +LPFNY  YA +
Sbjct  516  YYGADFPTYHTAFDSYDWMINYGDPSFKRHVAVAGVWGLLALHLADDPILPFNYISYAEQ  575

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L R+   LS +L G VSL P+  +I++  +AAK  E E +KLR+ ET +EL++L++R LN
Sbjct  576  LKRHKEVLSNLLGGLVSLSPLSTSIQDFASAAKEAEIETQKLREQETTSELVVLKKRALN  635

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRL+ AERGFL+T+G+ GR+W                 ++HL                  
Sbjct  636  DRLIFAERGFLDTDGLEGRRW-----------------FKHL------------------  660

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  +YGPS+  E++LDFFPGI DA+SR+T ++ +++ AIIQ
Sbjct  661  ----------------------IYGPSSDPESKLDFFPGIADAISRTTRMSLSQKKAIIQ  698

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HE+WRVARAIQRA  AL+G LT
Sbjct  699  HEVWRVARAIQRATSALRGELT  720



>ref|XP_009764874.1| PREDICTED: probable glutamate carboxypeptidase 2 [Nicotiana sylvestris]
Length=707

 Score =   223 bits (569),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 137/283 (48%), Positives = 167/283 (59%), Gaps = 67/283 (24%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  + S+ LY          +  DFPVYHTAFDSY WM+ FGDPFFQRH+AV+GVWGL
Sbjct  492  LHHAGVPSVDLY----------YGKDFPVYHTAFDSYSWMVNFGDPFFQRHVAVTGVWGL  541

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            L L LA++ +LPFNY  YA +L  YT  LS +LEGG+SL PI  AI+EL AAA    EEA
Sbjct  542  LALRLAEDPILPFNYLTYAVQLQDYTHILSDLLEGGISLHPITAAIQELAAAAIETLEEA  601

Query  362  kkLRKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWY  541
            KKL+ DE + E   L++RMLNDRLM AERGFL+ EG+ G+                  W+
Sbjct  602  KKLKDDEAIDEHAELKQRMLNDRLMLAERGFLDAEGLQGKP-----------------WF  644

Query  542  QHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPG  721
            +H+                                        VYGP   GE+ELDFFPG
Sbjct  645  KHM----------------------------------------VYGPRNDGESELDFFPG  664

Query  722  IVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
            I +A+SRS+ LN+ E    IQHEIWR ARAIQRAA+ALKG LT
Sbjct  665  IANAISRSSGLNSEEHNEAIQHEIWRTARAIQRAAHALKGELT  707



>ref|XP_004250770.1| PREDICTED: probable glutamate carboxypeptidase 2 [Solanum lycopersicum]
Length=689

 Score =   219 bits (558),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 134/283 (47%), Positives = 165/283 (58%), Gaps = 70/283 (25%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  + S+ LY          +  DFPVYHTAFDSY+WM+ FGDPFFQRH+AV+GVWGL
Sbjct  474  LHHAGVPSVDLY----------YGRDFPVYHTAFDSYNWMVNFGDPFFQRHVAVTGVWGL  523

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEG-GVSLDPIFDAIRELTaaakaieee  358
            L L LAD+ +LPFNY PYAAEL  YTR LS +LEG  +SL PI  A +EL A AK   +E
Sbjct  524  LALRLADDPILPFNYRPYAAELQDYTRILSKLLEGRNISLHPITAATQELAATAKETLDE  583

Query  359  akkLRKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHW  538
            AKKL+ D+   E   L+RR+LNDRLM AERGFL+ EG+ GR                  W
Sbjct  584  AKKLKVDKVTDERTALKRRILNDRLMFAERGFLDAEGLQGRP-----------------W  626

Query  539  YQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFP  718
            ++H+                                        VYGP   GE+EL FFP
Sbjct  627  FKHM----------------------------------------VYGPRNDGESELYFFP  646

Query  719  GIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNL  847
            GI +A+S+S+     E+ A IQHEIWR ARAI+RAA+ALKG L
Sbjct  647  GIANAISKSS--GGEEQNAAIQHEIWRSARAIERAAHALKGEL  687



>ref|XP_009376393.1| PREDICTED: probable glutamate carboxypeptidase 2 [Pyrus x bretschneideri]
Length=440

 Score =   211 bits (536),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 119/261 (46%), Positives = 162/261 (62%), Gaps = 57/261 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++ +DF VYHTA+D+Y+WMI FGDPFFQRH+AV+G+WGLL LHLAD++VLPFN+  YA +
Sbjct  236  YYGIDFSVYHTAYDAYEWMINFGDPFFQRHVAVAGMWGLLALHLADDSVLPFNFLSYAHQ  295

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +L+GGVSL P+  AI+E   AAK  E+EA++LR+ E  +EL+IL++R LN
Sbjct  296  LKHYEDVLSNLLDGGVSLHPLTTAIQEFADAAKEAEDEAQELREQENTSELVILKKRALN  355

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+++G+ GRQW                 ++HL                  
Sbjct  356  DRLMLAERGFLDSDGLEGRQW-----------------FKHL------------------  380

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  VYGP     ++L FFPG+ DA+ R+  +++ E  A IQ
Sbjct  381  ----------------------VYGPPGEHGSKLSFFPGVGDAMLRAKRMSSREGQAKIQ  418

Query  785  HEIWRVARAIQRAAYALKGNL  847
            HEIWRVARAIQRAA +L+G++
Sbjct  419  HEIWRVARAIQRAANSLRGDV  439



>ref|XP_008350228.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Malus 
domestica]
Length=206

 Score =   202 bits (515),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 113/261 (43%), Positives = 158/261 (61%), Gaps = 57/261 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++ +DFPVYHTAFD+Y+WM  FGDP FQRH+AV+G+WGLL LHLAD++++PF++  YA +
Sbjct  2    YYGIDFPVYHTAFDAYEWMTNFGDPLFQRHVAVAGMWGLLALHLADDSIIPFSFLSYADQ  61

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +L+GGVSL P+  AI+E   AAK  E+EA+KLR+ E  +EL++L++R LN
Sbjct  62   LKHYKDVLSNLLDGGVSLHPLTTAIQEFAYAAKEAEDEAQKLREKENTSELVVLKKRALN  121

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+++G+ GRQ                 W +HL                  
Sbjct  122  DRLMLAERGFLDSDGLEGRQ-----------------WLKHL------------------  146

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  VYGP     ++L FFPG+ DA+ R+  ++  E  A IQ
Sbjct  147  ----------------------VYGPPGEHGSKLSFFPGVGDAMLRAKRMSRREGQAKIQ  184

Query  785  HEIWRVARAIQRAAYALKGNL  847
            HE+WRVARAI+RA  +L+G++
Sbjct  185  HEVWRVARAIERATNSLRGDV  205



>ref|XP_008350226.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Malus 
domestica]
Length=238

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/261 (43%), Positives = 158/261 (61%), Gaps = 57/261 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++ +DFPVYHTAFD+Y+WM  FGDP FQRH+AV+G+WGLL LHLAD++++PF++  YA +
Sbjct  34   YYGIDFPVYHTAFDAYEWMTNFGDPLFQRHVAVAGMWGLLALHLADDSIIPFSFLSYADQ  93

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +L+GGVSL P+  AI+E   AAK  E+EA+KLR+ E  +EL++L++R LN
Sbjct  94   LKHYKDVLSNLLDGGVSLHPLTTAIQEFAYAAKEAEDEAQKLREKENTSELVVLKKRALN  153

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+++G+ GRQ                 W +HL                  
Sbjct  154  DRLMLAERGFLDSDGLEGRQ-----------------WLKHL------------------  178

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  VYGP     ++L FFPG+ DA+ R+  ++  E  A IQ
Sbjct  179  ----------------------VYGPPGEHGSKLSFFPGVGDAMLRAKRMSRREGQAKIQ  216

Query  785  HEIWRVARAIQRAAYALKGNL  847
            HE+WRVARAI+RA  +L+G++
Sbjct  217  HEVWRVARAIERATNSLRGDV  237



>ref|XP_006356945.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Solanum 
tuberosum]
Length=689

 Score =   213 bits (543),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 135/283 (48%), Positives = 167/283 (59%), Gaps = 70/283 (25%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  + S+ LY          +  DFPVYHTAFDSY+WM+ FGDPFFQRH+AV+GVWGL
Sbjct  474  LHHAGVPSVDLY----------YGRDFPVYHTAFDSYNWMVNFGDPFFQRHVAVTGVWGL  523

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEG-GVSLDPIFDAIRELTaaakaieee  358
            L   LA++ +LPFNY PYAAEL  YTR LS +LEG  +SL PI  A +EL AAAK   +E
Sbjct  524  LAFRLAEDPILPFNYLPYAAELQDYTRILSKLLEGRNISLHPITAATQELAAAAKETLDE  583

Query  359  akkLRKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHW  538
            AKKL++D+   E   L+RR+LNDRLM AERGFL+ EG+ GR                  W
Sbjct  584  AKKLKEDKATNEHTALKRRILNDRLMFAERGFLDAEGLQGRP-----------------W  626

Query  539  YQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFP  718
            ++H+                                        VYGP   GE+ELDFFP
Sbjct  627  FKHM----------------------------------------VYGPRNDGESELDFFP  646

Query  719  GIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNL  847
            GI +A+S+S+     E+ A IQHEIWR ARAIQRAA+ALKG L
Sbjct  647  GIANAISKSS--GGGEQNAAIQHEIWRTARAIQRAAHALKGEL  687



>ref|XP_009351318.1| PREDICTED: probable glutamate carboxypeptidase 2 [Pyrus x bretschneideri]
Length=463

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/258 (46%), Positives = 159/258 (62%), Gaps = 57/258 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++ +DF VYHTA+D+Y+WMI FGDPFFQRH+AV+G+WGLL LHLAD++VLPFN+  YA +
Sbjct  259  YYGIDFSVYHTAYDAYEWMINFGDPFFQRHVAVAGMWGLLALHLADDSVLPFNFLSYAHQ  318

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +L+GGVSL P+  AI+E   AAK  E+EA++LR+ E  +EL+IL++R LN
Sbjct  319  LKHYEDVLSNLLDGGVSLHPLTTAIQEFADAAKEAEDEAQELREQENTSELVILKKRALN  378

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+++G+ GRQW                 ++HL                  
Sbjct  379  DRLMLAERGFLDSDGLEGRQW-----------------FKHL------------------  403

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  VYGP     ++L FFPG+ DA+ R+  +++ E  A IQ
Sbjct  404  ----------------------VYGPPGEHGSKLSFFPGVGDAMLRAKRMSSREGQAKIQ  441

Query  785  HEIWRVARAIQRAAYALK  838
            HEIWRVARAIQRAA +L+
Sbjct  442  HEIWRVARAIQRAANSLR  459



>gb|EYU38716.1| hypothetical protein MIMGU_mgv1a002286mg [Erythranthe guttata]
Length=691

 Score =   209 bits (533),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 123/262 (47%), Positives = 148/262 (56%), Gaps = 59/262 (23%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            +F +DFPVYHTAFDSYDWM+  GDP F+RH+  +G+WGL+ LHLAD+ +LPFNY  YA E
Sbjct  489  YFGIDFPVYHTAFDSYDWMVNVGDPLFKRHVTAAGIWGLVALHLADDPILPFNYLSYATE  548

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   L+ +L G +SLDPI DAI+E   AA   EEE KKLR D++  E  +L RRMLN
Sbjct  549  LQEYKNVLNELLGGTISLDPIADAIQEFITAANVTEEEIKKLRVDQSSDESTVLRRRMLN  608

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM  ERGFL+ EG+ GRQWFKHL+                           GP   S 
Sbjct  609  DRLMLTERGFLDPEGLPGRQWFKHLI--------------------------YGPRGDSE  642

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
             K+                               DFFPGI DA+S        ER A+I 
Sbjct  643  SKI-------------------------------DFFPGIGDAMSE--RRGEKERKAMIT  669

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HE+WRVARAIQRAA AL+G  T
Sbjct  670  HEMWRVARAIQRAATALRGEFT  691



>ref|XP_008241129.1| PREDICTED: probable glutamate carboxypeptidase 2 [Prunus mume]
Length=702

 Score =   209 bits (533),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 117/261 (45%), Positives = 159/261 (61%), Gaps = 57/261 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFD+YDWM+ FGDP FQRH+AV+G+WGLL LHLAD+++LPFN+  Y  +
Sbjct  498  YYGRDFPVYHTAFDAYDWMVNFGDPLFQRHVAVAGIWGLLALHLADDSILPFNFLSYVDQ  557

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +L+G VSL P+  AI+E   AAK +E EA++LR  ++ +EL++L++R LN
Sbjct  558  LKHYKDVLSSLLDGSVSLHPLTTAIQEFAYAAKEVEHEAQRLRDVQSTSELVLLKKRALN  617

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+++G+ GR                 HW++HL                  
Sbjct  618  DRLMLAERGFLDSDGLEGR-----------------HWFKHL------------------  642

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  VY PS+  E+EL FFPG+ DA+ ++  ++  E  A IQ
Sbjct  643  ----------------------VYAPSSDHESELFFFPGVADALFQAKRMSGREGQAKIQ  680

Query  785  HEIWRVARAIQRAAYALKGNL  847
            HEIWRVARAIQRAA +LKG +
Sbjct  681  HEIWRVARAIQRAASSLKGEI  701



>emb|CBI39092.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   207 bits (528),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 154/261 (59%), Gaps = 57/261 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSYDWM   GDP FQRH+AV+GVWGLL LHLAD+ +LPFNY  Y  +
Sbjct  417  YYGRDFPVYHTAFDSYDWMTNHGDPLFQRHVAVAGVWGLLALHLADDPILPFNYVSYTEQ  476

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  YT  L  +++G VSL PI  +I+EL +AA+  E EAKKLR++E  +E L+L++R LN
Sbjct  477  LWNYTNLLRNLVKGNVSLHPITASIQELASAAEEAEGEAKKLREEERNSEFLVLKKRALN  536

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+ +G+ GRQWFKHLV                           GP   S 
Sbjct  537  DRLMLAERGFLDADGLQGRQWFKHLV--------------------------YGPRGDSE  570

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
             K+I                               FFPGI DA+S ST +   E  A IQ
Sbjct  571  SKLI-------------------------------FFPGIADAISASTRMKRKEGEAAIQ  599

Query  785  HEIWRVARAIQRAAYALKGNL  847
            HEIWRVARAI+RA+ AL+G +
Sbjct  600  HEIWRVARAIERASSALRGGI  620



>ref|XP_010653230.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Vitis 
vinifera]
Length=705

 Score =   208 bits (530),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 154/261 (59%), Gaps = 57/261 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSYDWM   GDP FQRH+AV+GVWGLL LHLAD+ +LPFNY  Y  +
Sbjct  498  YYGRDFPVYHTAFDSYDWMTNHGDPLFQRHVAVAGVWGLLALHLADDPILPFNYVSYTEQ  557

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  YT  L  +++G VSL PI  +I+EL +AA+  E EAKKLR++E  +E L+L++R LN
Sbjct  558  LQNYTNLLRNLVKGNVSLHPITASIQELASAAEEAEGEAKKLREEERNSEFLVLKKRALN  617

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+ +G+ GRQWFKHLV                           GP   S 
Sbjct  618  DRLMLAERGFLDADGLQGRQWFKHLV--------------------------YGPRGDSE  651

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
             K+I                               FFPGI DA+S ST +   E  A IQ
Sbjct  652  SKLI-------------------------------FFPGIADAISASTRMKRKEGEAAIQ  680

Query  785  HEIWRVARAIQRAAYALKGNL  847
            HEIWRVARAI+RA+ AL+G +
Sbjct  681  HEIWRVARAIERASSALRGGI  701



>ref|XP_010653229.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Vitis 
vinifera]
Length=705

 Score =   208 bits (529),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 154/261 (59%), Gaps = 57/261 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSYDWM   GDP FQRH+AV+GVWGLL LHLAD+ +LPFNY  Y  +
Sbjct  498  YYGRDFPVYHTAFDSYDWMTNHGDPLFQRHVAVAGVWGLLALHLADDPILPFNYVSYTEQ  557

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  YT  L  +++G VSL PI  +I+EL +AA+  E EAKKLR++E  +E L+L++R LN
Sbjct  558  LWNYTNLLRNLVKGNVSLHPITASIQELASAAEEAEGEAKKLREEERNSEFLVLKKRALN  617

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+ +G+ GRQWFKHLV                           GP   S 
Sbjct  618  DRLMLAERGFLDADGLQGRQWFKHLV--------------------------YGPRGDSE  651

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
             K+I                               FFPGI DA+S ST +   E  A IQ
Sbjct  652  SKLI-------------------------------FFPGIADAISASTRMKRKEGEAAIQ  680

Query  785  HEIWRVARAIQRAAYALKGNL  847
            HEIWRVARAI+RA+ AL+G +
Sbjct  681  HEIWRVARAIERASSALRGGI  701



>ref|XP_009379681.1| PREDICTED: probable glutamate carboxypeptidase 2 [Pyrus x bretschneideri]
Length=707

 Score =   207 bits (528),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/261 (45%), Positives = 158/261 (61%), Gaps = 57/261 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++ +DFPVYHTAFD+Y+WM  FGDP FQRH+AV+G+WGL+ LHLAD++++PFN+  YA +
Sbjct  503  YYGIDFPVYHTAFDAYEWMTNFGDPLFQRHVAVAGIWGLVALHLADDSIIPFNFLSYADQ  562

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +L+GGVSL P+  AI+E   AAK  E+EA+KLR+ E  +EL+IL++R LN
Sbjct  563  LKHYKDVLSNLLDGGVSLHPLTTAIQEFAYAAKEAEDEAQKLREQENTSELVILKKRALN  622

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL++ G+ GRQW                 ++HL                  
Sbjct  623  DRLMLAERGFLDSGGLQGRQW-----------------FKHL------------------  647

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  VYGP     ++L FFPG+ DA+ R+   +  E  A IQ
Sbjct  648  ----------------------VYGPPGEHGSKLSFFPGVGDAMLRAKRTSRREGQAKIQ  685

Query  785  HEIWRVARAIQRAAYALKGNL  847
            HEIWRVARAIQRAA +L+G++
Sbjct  686  HEIWRVARAIQRAANSLRGDV  706



>ref|XP_002323358.2| hypothetical protein POPTR_0016s06430g [Populus trichocarpa]
 gb|EEF05119.2| hypothetical protein POPTR_0016s06430g [Populus trichocarpa]
Length=582

 Score =   205 bits (522),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 154/262 (59%), Gaps = 57/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSY WM K+ DP F RH+AV+G+WGLL LHLADE++LPF+Y  Y  +
Sbjct  378  YYGRDFPVYHTAFDSYGWMKKYADPLFHRHVAVAGIWGLLALHLADESILPFDYISYVEQ  437

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  +T  L  +L+  VSL P+  +I+EL +AAK +E E K+LR+ E   + + L+ R LN
Sbjct  438  LQGHTGVLGKLLDRNVSLHPLVTSIQELASAAKEVEYEVKQLREQERRGDFIDLKLRALN  497

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+ EG+ GRQW                 ++HL                  
Sbjct  498  DRLMLAERGFLDVEGLQGRQW-----------------FKHL------------------  522

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  +YGP +  E++LDFFPGI DA+S+ST  +   R A +Q
Sbjct  523  ----------------------IYGPPSNYESKLDFFPGIADALSQSTSKSQQNRQAAVQ  560

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HEIWRV RAI+RAA ALKGNLT
Sbjct  561  HEIWRVGRAIERAASALKGNLT  582



>ref|XP_007204052.1| hypothetical protein PRUPE_ppa026745mg, partial [Prunus persica]
 gb|EMJ05251.1| hypothetical protein PRUPE_ppa026745mg, partial [Prunus persica]
Length=687

 Score =   207 bits (526),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 115/261 (44%), Positives = 158/261 (61%), Gaps = 57/261 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFD+YDWM+ FGDP FQRH+AV+G+WGLL LHLAD+++LPFN+  Y  +
Sbjct  483  YYGRDFPVYHTAFDAYDWMVNFGDPLFQRHVAVAGIWGLLALHLADDSILPFNFLSYVDQ  542

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +L+G VSL P+  AI+E   AAK +E EA++LR  ++ +EL++L++R LN
Sbjct  543  LKHYKDVLSSLLDGSVSLHPLTTAIQEFAYAAKEVEHEAQRLRDVQSTSELVLLKKRALN  602

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+++G+ GR                 HW++HL                  
Sbjct  603  DRLMLAERGFLDSDGLEGR-----------------HWFKHL------------------  627

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  V+ PS+  E+EL FFPG+ DA+ ++   +  E  A IQ
Sbjct  628  ----------------------VFAPSSDHESELLFFPGVADAIFQAKRTSGMEGQAKIQ  665

Query  785  HEIWRVARAIQRAAYALKGNL  847
            HEIWRVARAIQRAA +L+G +
Sbjct  666  HEIWRVARAIQRAASSLRGEI  686



>ref|XP_009623706.1| PREDICTED: probable glutamate carboxypeptidase 2 [Nicotiana tomentosiformis]
Length=705

 Score =   206 bits (524),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 137/283 (48%), Positives = 167/283 (59%), Gaps = 67/283 (24%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  + S+ LY          +  DFPVYHTAFDSY+WM+  GDPFFQRH+AV+GVWGL
Sbjct  490  LHHAGVPSVDLY----------YGKDFPVYHTAFDSYNWMVNCGDPFFQRHVAVTGVWGL  539

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            L L LAD+ +LPFNY  YAA+L  YT  LS +LEGG+SL PI  AI+EL AAA    EEA
Sbjct  540  LALRLADDLILPFNYFTYAAQLQDYTHILSDLLEGGISLHPITAAIQELAAAAVETLEEA  599

Query  362  kkLRKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWY  541
            KKL+ +E   E   L++RMLNDRLM AERGFL+ EG+ G+                  W+
Sbjct  600  KKLKDEEATDEHAELKQRMLNDRLMLAERGFLDAEGLQGKP-----------------WF  642

Query  542  QHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPG  721
            +H+                                        VYGP   GE+ELDFFPG
Sbjct  643  KHM----------------------------------------VYGPRNDGESELDFFPG  662

Query  722  IVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
            I +A+SRS+ L + E  A IQHEIWR ARAIQRAA+ALKG LT
Sbjct  663  IANAISRSSGLISEEHNASIQHEIWRTARAIQRAAHALKGELT  705



>gb|KHN24331.1| Putative glutamate carboxypeptidase 2 [Glycine soja]
Length=471

 Score =   200 bits (509),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 114/263 (43%), Positives = 154/263 (59%), Gaps = 57/263 (22%)
 Frame = +2

Query  62   TFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAA  241
             ++  D+PVYHTAFDSY+WM KFGDPFFQRH AV+G+WGLL L LAD++++PFNY  YA 
Sbjct  266  VYYGKDYPVYHTAFDSYNWMTKFGDPFFQRHEAVTGIWGLLALRLADDSIIPFNYLSYAN  325

Query  242  ELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRML  421
            +L  Y   LS +L+  ++L P+  +I+E  +AAK   +E+KKL+  E     + ++ R L
Sbjct  326  QLQVYNNILSNLLDKQITLHPLNTSIQEFASAAKEANDESKKLKWQEASDRSIDMKMRAL  385

Query  422  NDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGS  601
            NDRLM AERGFL+ +G+ GRQW                 ++HL                 
Sbjct  386  NDRLMLAERGFLDVDGLQGRQW-----------------FKHL-----------------  411

Query  602  SVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAII  781
                                   V+GP +  E++LDFFPGI D++SR   ++  ER A I
Sbjct  412  -----------------------VFGPPSDHESKLDFFPGIADSLSRMDKMSEKERLAAI  448

Query  782  QHEIWRVARAIQRAAYALKGNLT  850
            QHEIWRVARAIQRAA AL+G+L 
Sbjct  449  QHEIWRVARAIQRAASALRGDLA  471



>ref|XP_011042521.1| PREDICTED: probable glutamate carboxypeptidase 2 [Populus euphratica]
Length=704

 Score =   204 bits (518),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 154/262 (59%), Gaps = 57/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSY WM K+ DP F RH+AV+G+WGLL LHLADE++LPF+Y  Y  +
Sbjct  500  YYGRDFPVYHTAFDSYGWMKKYADPLFHRHVAVAGIWGLLALHLADESILPFDYISYVEQ  559

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  +T  L  +L+  VSL P+  +I+EL +AAK +E E K+LR+ E   + + L+ R LN
Sbjct  560  LQGHTVVLGKLLDRNVSLHPLVTSIQELASAAKEVEYEVKQLREQERRGDFIDLKLRALN  619

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+ EG+ GRQW                 ++HL                  
Sbjct  620  DRLMLAERGFLDVEGLQGRQW-----------------FKHL------------------  644

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  +YGP +  E++LDFFPGI +A+S+ST  +   R A +Q
Sbjct  645  ----------------------IYGPPSDYESKLDFFPGIANALSQSTSKSQQNRQAAVQ  682

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HEIWRV RAI+RAA ALKGNLT
Sbjct  683  HEIWRVGRAIERAASALKGNLT  704



>ref|XP_008387163.1| PREDICTED: probable glutamate carboxypeptidase 2 [Malus domestica]
Length=708

 Score =   201 bits (510),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/261 (43%), Positives = 157/261 (60%), Gaps = 57/261 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++ +DFPVYHTAFD+Y+WM  FGDP FQRH+AV+G+WGLL LHLAD++++PF++  YA +
Sbjct  504  YYGIDFPVYHTAFDAYEWMTNFGDPLFQRHVAVAGMWGLLALHLADDSIIPFSFLSYADQ  563

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +L+GGVSL P+  AI+E   AAK  E+EA+KLR+ E  +EL++L++R LN
Sbjct  564  LKHYKDVLSNLLDGGVSLHPLTTAIQEFAYAAKEAEDEAQKLREKENTSELVVLKKRALN  623

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+++G+ GRQ                 W +HL                  
Sbjct  624  DRLMLAERGFLDSDGLEGRQ-----------------WLKHL------------------  648

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  VYGP     ++L FFPG+ DA+ R+  ++  E  A IQ
Sbjct  649  ----------------------VYGPPGEHGSKLSFFPGVGDAMLRAKRMSRREGQAKIQ  686

Query  785  HEIWRVARAIQRAAYALKGNL  847
            HE WRVARAI+RA  +L+G++
Sbjct  687  HEXWRVARAIZRAXNSLRGDV  707



>ref|XP_008359523.1| PREDICTED: probable glutamate carboxypeptidase 2 [Malus domestica]
Length=708

 Score =   200 bits (509),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/261 (43%), Positives = 157/261 (60%), Gaps = 57/261 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++ +DFPVYHTAFD+Y+WM  FGDP FQRH+AV+G+WGLL LHLAD++++PF++  YA +
Sbjct  504  YYGIDFPVYHTAFDAYEWMTNFGDPLFQRHVAVAGMWGLLALHLADDSIIPFSFLSYADQ  563

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +L+GGVSL P+  AI+E   AAK  E+EA+KLR+ E  +EL++L++R LN
Sbjct  564  LKHYKDVLSNLLDGGVSLHPLTTAIQEFAYAAKEAEDEAQKLREXENTSELVVLKKRALN  623

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+++G+ GRQ                 W +HL                  
Sbjct  624  DRLMLAERGFLDSDGLEGRQ-----------------WLKHL------------------  648

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  VYGP     ++L FFPG+ DA+ R+  ++  E  A IQ
Sbjct  649  ----------------------VYGPPGEHGSKLSFFPGVGDAMLRAKRMSRREGQAKIQ  686

Query  785  HEIWRVARAIQRAAYALKGNL  847
            HE WRVARAI+RA  +L+G++
Sbjct  687  HEXWRVARAIZRAXNSLRGDV  707



>ref|XP_004305557.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Fragaria 
vesca subsp. vesca]
Length=694

 Score =   199 bits (507),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/261 (43%), Positives = 153/261 (59%), Gaps = 57/261 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSYDWM KFGDP F RH+AV+G+WGL+ LHLAD+++LPFNY  Y  +
Sbjct  490  YYGRDFPVYHTAFDSYDWMTKFGDPLFHRHVAVAGIWGLIALHLADDSILPFNYFSYVDQ  549

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +L+G  SLDP+  AI E   AA+  E EA+KLR++E  +E ++L++R LN
Sbjct  550  LKHYKDVLSHLLDGSTSLDPLTTAIEEFANAAREAENEAQKLREEEGSSEFVMLKKRALN  609

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+++G+ GRQW                 ++HL                  
Sbjct  610  DRLMLAERGFLDSDGLEGRQW-----------------FKHL------------------  634

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  VYGP T   ++L  FPG+ DA++++  +      A ++
Sbjct  635  ----------------------VYGPPTDHGSKLFVFPGVADAMNQAKSMKAGRGQAKLR  672

Query  785  HEIWRVARAIQRAAYALKGNL  847
            HEIWRVARAIQRAA +LKG +
Sbjct  673  HEIWRVARAIQRAARSLKGEI  693



>ref|XP_006481663.1| PREDICTED: probable glutamate carboxypeptidase 2-like isoform 
X2 [Citrus sinensis]
Length=414

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 112/262 (43%), Positives = 154/262 (59%), Gaps = 57/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTA D+Y W++   DP F RH+AV+GVWGLL LHLAD+++LPFN+  Y+ +
Sbjct  210  YYGKDFPVYHTALDTYTWIVGHADPLFHRHVAVAGVWGLLALHLADDSILPFNFLSYSDQ  269

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L      LS +L+  +SLDP+  AI++LT+AAK  + EAK+LR+ E +  + IL+   LN
Sbjct  270  LQENKDILSNLLDQRISLDPLTAAIKDLTSAAKDAQNEAKRLREQEHLGGVEILKIHDLN  329

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+T+G+ GRQW                 ++HL                  
Sbjct  330  DRLMLAERGFLDTDGLQGRQW-----------------FKHL------------------  354

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  +YGP    E++L  FPGI DA+S+ST ++  +  A+IQ
Sbjct  355  ----------------------IYGPHGEYESKLSCFPGIADAISQSTSMSKKDGEALIQ  392

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HE+WRVARAIQRAA AL+G LT
Sbjct  393  HEVWRVARAIQRAASALRGELT  414



>ref|XP_002524116.1| Transferrin receptor protein, putative [Ricinus communis]
 gb|EEF38326.1| Transferrin receptor protein, putative [Ricinus communis]
Length=709

 Score =   199 bits (507),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 150/257 (58%), Gaps = 57/257 (22%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            DFPVYHTAFDS++W+ KFGDP F RH+AV+GVWGLL LHLAD+++LPF+Y  Y  EL  +
Sbjct  509  DFPVYHTAFDSFEWITKFGDPLFHRHVAVAGVWGLLALHLADDSILPFDYLSYVKELQEH  568

Query  257  TRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
               LS +L+   SL+P+  +I+ L + AK  + EAKKLR+ E+  E +  + R LNDRLM
Sbjct  569  NFVLSKLLDQSTSLNPLSTSIQRLASVAKEAKIEAKKLRQQESRGEFVAFKLRALNDRLM  628

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
             AERGFL+ +G+ GR                 HW++HL                      
Sbjct  629  LAERGFLDADGLLGR-----------------HWFKHL----------------------  649

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              +YGPS   E++LDFFPGI DA+S+S  +N  +  A IQHEIW
Sbjct  650  ------------------IYGPSGDYESKLDFFPGIADAISKSRSMNKEDGQAAIQHEIW  691

Query  797  RVARAIQRAAYALKGNL  847
            RVARAI +AA AL+G L
Sbjct  692  RVARAIDKAASALEGRL  708



>emb|CDP10550.1| unnamed protein product [Coffea canephora]
Length=696

 Score =   198 bits (503),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 150/266 (56%), Gaps = 65/266 (24%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSYDWM+ FGDP FQRH+AVSGVWGLL L LAD+ +LPFNY  Y A+
Sbjct  492  YYGRDFPVYHTAFDSYDWMVNFGDPLFQRHVAVSGVWGLLALRLADDPILPFNYLSYVAQ  551

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y  +LS  LEG +SL+PI  AI++  AAA  I E+ KKL +DE M E  +L++RMLN
Sbjct  552  LQEYRNTLSNFLEGDISLNPITLAIQDFKAAADEIAEQVKKLSEDERMDEFSVLKKRMLN  611

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVL--G  598
            DRLM AERGFL+ EG+ G +WFKHL+                           GP +  G
Sbjct  612  DRLMFAERGFLDAEGLQGLRWFKHLI--------------------------YGPQIDGG  645

Query  599  SSVKVIAAYTYCI--NFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERG  772
            S +  +      I  N G+ +G                                   ER 
Sbjct  646  SELNFLPGVVGAISRNTGMNKG-----------------------------------ERQ  670

Query  773  AIIQHEIWRVARAIQRAAYALKGNLT  850
              IQHE+WRVARAI+RAA ALKG+LT
Sbjct  671  EAIQHEVWRVARAIERAACALKGSLT  696



>ref|XP_003537151.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Glycine 
max]
Length=695

 Score =   197 bits (500),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 153/262 (58%), Gaps = 57/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  D+PVYHTAFDSY+WM KFGDPFFQRH AV+G+WGLL L LAD++++PFNY  YA +
Sbjct  491  YYGKDYPVYHTAFDSYNWMTKFGDPFFQRHEAVTGIWGLLALRLADDSIIPFNYLSYANQ  550

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +L+  ++L P+  +I+E  +AAK   +E+KKL+  E     + ++ R LN
Sbjct  551  LQVYNNILSNLLDKQITLHPLNTSIQEFASAAKEANDESKKLKWQEASDRSIDMKMRALN  610

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+ +G+ GRQW                 ++HL                  
Sbjct  611  DRLMLAERGFLDVDGLQGRQW-----------------FKHL------------------  635

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  V+GP +  E++LDFFPGI D++S    ++  ER A IQ
Sbjct  636  ----------------------VFGPPSDHESKLDFFPGIADSLSGMDKMSEKERLAAIQ  673

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HEIWRVARAIQRAA AL+G+L 
Sbjct  674  HEIWRVARAIQRAASALRGDLA  695



>ref|XP_008391599.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamate carboxypeptidase 
2 [Malus domestica]
Length=457

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 119/261 (46%), Positives = 158/261 (61%), Gaps = 57/261 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++ +DF VYHTA+D+Y+WMI FGDPFFQRH+AV+G+WGLL LHLAD+ VLPFN+  YA +
Sbjct  253  YYGIDFSVYHTAYDAYEWMINFGDPFFQRHVAVAGMWGLLALHLADDLVLPFNFLSYADQ  312

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +L+GGVSL P+  AI+E   AAK  E+EA+KLR  E  +EL+IL+ R LN
Sbjct  313  LKHYKDVLSNLLDGGVSLHPLTTAIQEFAYAAKEAEDEAQKLRDQENTSELVILKTRALN  372

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+++G+ GRQW                 ++HL                  
Sbjct  373  DRLMFAERGFLDSDGIEGRQW-----------------FKHL------------------  397

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  VYGP     ++L FFPG+ DA+ R+  ++ TE  A +Q
Sbjct  398  ----------------------VYGPPGEHGSKLSFFPGVGDAMLRAKRMSRTEGEAKVQ  435

Query  785  HEIWRVARAIQRAAYALKGNL  847
            HEIWRVARAIQRA  +L+G++
Sbjct  436  HEIWRVARAIQRAEKSLRGDV  456



>dbj|BAM72481.1| AMP1-like carboxypeptidase [Lotus japonicus]
Length=695

 Score =   196 bits (497),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 116/262 (44%), Positives = 151/262 (58%), Gaps = 58/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSY+WM + GDPFFQRH+AV+GVWGLL LHLAD+++LPFNY  YA E
Sbjct  492  YYGRDFPVYHTAFDSYNWMAEHGDPFFQRHVAVTGVWGLLALHLADDSILPFNYVSYANE  551

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +L+   SL P+  +I+E   AAK  ++E KKLR  ET    + + +R LN
Sbjct  552  LQLYNNRLSNLLDQKTSLHPLAMSIQEFAFAAKEADDELKKLRLQETADCSVDMRKRALN  611

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM  E+GFL+ +G+ GRQW                 ++HL                  
Sbjct  612  DRLMLVEKGFLDADGLQGRQW-----------------FKHL------------------  636

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  V+GPS+  E  L+FFPGI D+ +RST ++  ER A IQ
Sbjct  637  ----------------------VFGPSSDHE-RLNFFPGISDSFTRSTSISEGERVAAIQ  673

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HE+WRV+RAI RAA AL+G  T
Sbjct  674  HEVWRVSRAIHRAASALRGEFT  695



>ref|XP_004494296.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Cicer 
arietinum]
Length=689

 Score =   193 bits (491),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/262 (43%), Positives = 153/262 (58%), Gaps = 58/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSY+WM ++GDPFFQRH+AV+G+WGLL L LAD+++LPF+Y  YA E
Sbjct  486  YYGKDFPVYHTAFDSYNWMAEYGDPFFQRHVAVTGIWGLLALRLADDSILPFDYLSYANE  545

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +L+  +S+ P+  +I E  +AAK +++E K+LR  ET  + + ++RR +N
Sbjct  546  LQLYRDILSNMLDQKISVHPLTSSIEEFASAAKEVDDELKELRLLETAGQFVDMKRRAMN  605

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AE+GFL+ +G+ G+QW                 ++HL                  
Sbjct  606  DRLMLAEKGFLDGDGLEGKQW-----------------FKHL------------------  630

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  V+GP    E +LDFFPGI D+++RS      ER A IQ
Sbjct  631  ----------------------VFGPPNDPE-KLDFFPGIADSITRSASTGERERLAEIQ  667

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HEIWRVARAIQRA  AL+G  T
Sbjct  668  HEIWRVARAIQRATSALRGEFT  689



>ref|XP_006429985.1| hypothetical protein CICLE_v10011190mg [Citrus clementina]
 gb|ESR43225.1| hypothetical protein CICLE_v10011190mg [Citrus clementina]
Length=708

 Score =   193 bits (491),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 112/262 (43%), Positives = 154/262 (59%), Gaps = 57/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTA D+Y W++   DP F RH+AV+GVWGLL LHLAD+++LPFN+  Y+ +
Sbjct  504  YYGKDFPVYHTALDTYTWIVGHADPLFHRHVAVAGVWGLLALHLADDSILPFNFLSYSDQ  563

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L      LS +L+  +SLDP+  AI++LT+AAK  + EAK+LR+ E +  + IL+   LN
Sbjct  564  LQENKDILSNLLDQRISLDPLTAAIKDLTSAAKDAQNEAKRLREQEHLGGVEILKIHDLN  623

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+T+G+ GRQW                 ++HL                  
Sbjct  624  DRLMLAERGFLDTDGLQGRQW-----------------FKHL------------------  648

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  +YGP    E++L  FPGI DA+S+ST ++  +  A+IQ
Sbjct  649  ----------------------IYGPHDEYESKLSCFPGIADAISQSTSMSKKDGEALIQ  686

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HE+WRVARAIQRAA AL+G LT
Sbjct  687  HEVWRVARAIQRAASALRGELT  708



>ref|XP_006481662.1| PREDICTED: probable glutamate carboxypeptidase 2-like isoform 
X1 [Citrus sinensis]
Length=708

 Score =   193 bits (491),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 112/262 (43%), Positives = 154/262 (59%), Gaps = 57/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTA D+Y W++   DP F RH+AV+GVWGLL LHLAD+++LPFN+  Y+ +
Sbjct  504  YYGKDFPVYHTALDTYTWIVGHADPLFHRHVAVAGVWGLLALHLADDSILPFNFLSYSDQ  563

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L      LS +L+  +SLDP+  AI++LT+AAK  + EAK+LR+ E +  + IL+   LN
Sbjct  564  LQENKDILSNLLDQRISLDPLTAAIKDLTSAAKDAQNEAKRLREQEHLGGVEILKIHDLN  623

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+T+G+ GRQW                 ++HL                  
Sbjct  624  DRLMLAERGFLDTDGLQGRQW-----------------FKHL------------------  648

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  +YGP    E++L  FPGI DA+S+ST ++  +  A+IQ
Sbjct  649  ----------------------IYGPHGEYESKLSCFPGIADAISQSTSMSKKDGEALIQ  686

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HE+WRVARAIQRAA AL+G LT
Sbjct  687  HEVWRVARAIQRAASALRGELT  708



>ref|XP_010672603.1| PREDICTED: probable glutamate carboxypeptidase 2 [Beta vulgaris 
subsp. vulgaris]
Length=783

 Score =   194 bits (492),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 150/264 (57%), Gaps = 62/264 (23%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYH+AFDSYDWMI  GDP F RH+AV+G+WGLL L LA++ +LPFNY  YA +
Sbjct  580  YYGKDFPVYHSAFDSYDWMITHGDPLFHRHVAVAGLWGLLALRLAEDPILPFNYRSYALQ  639

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  YT SLS +LEG  S+ PI  +I+ L A A+ + EEAKKL       +  +L RRMLN
Sbjct  640  LQEYTSSLSNMLEGRASITPIITSIKNLLAVAQEVGEEAKKLSVSGASIDTGVLMRRMLN  699

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERG L+ +G+ G +W                 ++HL                  
Sbjct  700  DRLMLAERGLLDADGLQGNRW-----------------FKHL------------------  724

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERG--AI  778
                                  VYGPS+  E++L FFP + DA+S ST    T+RG    
Sbjct  725  ----------------------VYGPSSNYESKLGFFPSLADAMSHSTQ---TKRGNQPT  759

Query  779  IQHEIWRVARAIQRAAYALKGNLT  850
            IQHEIWRVARAIQRAA ALKG+L 
Sbjct  760  IQHEIWRVARAIQRAADALKGDLN  783



>ref|XP_007145752.1| hypothetical protein PHAVU_007G264800g [Phaseolus vulgaris]
 gb|ESW17746.1| hypothetical protein PHAVU_007G264800g [Phaseolus vulgaris]
Length=687

 Score =   192 bits (487),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 112/262 (43%), Positives = 150/262 (57%), Gaps = 57/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  D+PVYHTAFDSY+WM +FGDPFF RH+AV+G+WGLL L LAD++++PFNY  YA +
Sbjct  483  YYGKDYPVYHTAFDSYNWMTEFGDPFFHRHVAVTGIWGLLALRLADDSIIPFNYLSYADQ  542

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +LE  +SL P+  +I+E  +AAK   +E+KKLR  E   + + ++ R LN
Sbjct  543  LQVYNDILSNLLEKQISLHPLNASIQEFASAAKEANDESKKLRLQENSDDFVDMKIRALN  602

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM  E+GFL+ +G+ GRQWF+HLV                                  
Sbjct  603  DRLMLTEKGFLDVDGLRGRQWFRHLV----------------------------------  628

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                        FG  R  E +           LDFFPGI D++S    ++  ER A IQ
Sbjct  629  ------------FGPHRDHESK-----------LDFFPGIADSMSELFKMSEKERVAAIQ  665

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HE+WRV RAIQRAA AL+G+ T
Sbjct  666  HEVWRVVRAIQRAASALRGDFT  687



>gb|KEH24309.1| glutamate carboxypeptidase, putative [Medicago truncatula]
Length=692

 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/262 (42%), Positives = 153/262 (58%), Gaps = 58/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSY+WM ++ DPFFQRH+AV+G+WGLL L LAD+++LPFNY  YA E
Sbjct  489  YYGKDFPVYHTAFDSYNWMAEYADPFFQRHVAVTGIWGLLALRLADDSILPFNYLSYANE  548

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +L+  +SL P+  +I+E   AAK +++E K+L+  ET  + + ++RR +N
Sbjct  549  LRLYRDKLSNMLDHKMSLHPLTTSIQEFACAAKEVDDELKELKLVETSGQFVDMKRRAMN  608

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AE+GFL+ +G+ G+QW                 ++HL                  
Sbjct  609  DRLMLAEKGFLDGDGLKGKQW-----------------FKHL------------------  633

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  V+GP    E +LDFFPGI D+++RST  +  ER A IQ
Sbjct  634  ----------------------VFGPPNDAE-KLDFFPGIADSMTRSTGTSERERLAEIQ  670

Query  785  HEIWRVARAIQRAAYALKGNLT  850
             EIWRV RAIQRA +AL+G  T
Sbjct  671  REIWRVTRAIQRATFALRGEFT  692



>gb|KDP21928.1| hypothetical protein JCGZ_03066 [Jatropha curcas]
Length=702

 Score =   191 bits (484),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 114/263 (43%), Positives = 152/263 (58%), Gaps = 58/263 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSY+WM  +GDP F RH+AV+GVWGL+ L LAD++VLPF+Y  YA +
Sbjct  497  YYGRDFPVYHTAFDSYEWMTNYGDPLFHRHVAVAGVWGLVALQLADDSVLPFDYLSYAEQ  556

Query  245  LLRYTRSLSGVLE-GGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRML  421
            L  +   LS +L+   +SL+P+  +I+ L  AAK  E EAK+LR  E+  E + L+ R L
Sbjct  557  LKGHKDVLSNLLDHQSISLNPLITSIQRLALAAKEAENEAKQLRWQESRGEFVALKLRGL  616

Query  422  NDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGS  601
            NDRLM AERGFL+ +G+ GR                 +W++HL                 
Sbjct  617  NDRLMLAERGFLDADGLQGR-----------------NWFKHL-----------------  642

Query  602  SVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAII  781
                                   +YGP    E++L+FFP I DA+SRS ++   +  A I
Sbjct  643  -----------------------IYGPPGDYESKLEFFPSIADAISRSKNIGRQDGQAAI  679

Query  782  QHEIWRVARAIQRAAYALKGNLT  850
            QHEIWRVARAI+RAA ALKG LT
Sbjct  680  QHEIWRVARAIERAAGALKGQLT  702



>ref|XP_007163023.1| hypothetical protein PHAVU_001G199600g [Phaseolus vulgaris]
 gb|ESW35017.1| hypothetical protein PHAVU_001G199600g [Phaseolus vulgaris]
Length=696

 Score =   190 bits (482),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 116/262 (44%), Positives = 148/262 (56%), Gaps = 58/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSY+WM ++ DPFF RH+AV+GVWGLL LHLA + +LPFNY  YA E
Sbjct  493  YYGRDFPVYHTAFDSYNWMAEYADPFFHRHVAVTGVWGLLALHLAGDPILPFNYVSYANE  552

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS  ++  +SL P+  +I E  +AAK ++ E KKLR  ET    + ++RR LN
Sbjct  553  LQLYKNMLSNFIDQKISLYPLTLSIEEFASAAKEVDGEVKKLRLQETEGCSVDMKRRALN  612

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AE+GFL+  G+ GRQW                 ++HL                  
Sbjct  613  DRLMLAEKGFLDAYGLQGRQW-----------------FKHL------------------  637

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  VYGPS+  E  L+FFPGI D+++ ST +   ER A IQ
Sbjct  638  ----------------------VYGPSSDHE-RLNFFPGISDSITSSTGVTERERLASIQ  674

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HEIWRVARAI RAA AL+G  T
Sbjct  675  HEIWRVARAIHRAASALRGEFT  696



>ref|XP_011077913.1| PREDICTED: probable glutamate carboxypeptidase 2 [Sesamum indicum]
Length=679

 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 129/282 (46%), Positives = 160/282 (57%), Gaps = 70/282 (25%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  + S+ LY          F  DFPVYHTAFDSYDW++ FGDP FQRH+ V+G+WGL
Sbjct  467  LHHAGVPSVDLY----------FGSDFPVYHTAFDSYDWIVNFGDPSFQRHVTVAGIWGL  516

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            + LHLAD+ +LPFNY  YA EL  Y   L+  L G VSLDPI  AI+E  AAA   EEEA
Sbjct  517  IALHLADDPILPFNYLSYATELQEYKNVLT-TLVGTVSLDPIAAAIQEFIAAANETEEEA  575

Query  362  kkLRKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWY  541
            +KLR D+ + E  +L RRMLNDRLM  ERGFL+TEG+ GRQW                 +
Sbjct  576  QKLRVDQNVDESTVLRRRMLNDRLMLTERGFLDTEGLRGRQW-----------------F  618

Query  542  QHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPG  721
            +HL                                        +YGP    E+++ FFPG
Sbjct  619  KHL----------------------------------------IYGPRGDTESKIAFFPG  638

Query  722  IVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNL  847
            I +A+S    +N  ER A I+HEIWRVARAI+RAA AL+G L
Sbjct  639  IGEAMS--GRMNEEEREATIRHEIWRVARAIERAAIALRGEL  678



>ref|XP_009139219.1| PREDICTED: probable glutamate carboxypeptidase 2 [Brassica rapa]
Length=699

 Score =   187 bits (474),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 120/288 (42%), Positives = 159/288 (55%), Gaps = 81/288 (28%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I SI +Y          +  D+PVYHTAFDSYDWMI+  DP F RH+A++G+WGL
Sbjct  488  LHHAGIPSIDMY----------YGADYPVYHTAFDSYDWMIRNADPLFHRHVAMAGIWGL  537

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            LG+ LADE VLPF+Y  YA +L  +  +LS +LEG VS+DP+  AI+E +  AK + +EA
Sbjct  538  LGIILADEPVLPFDYISYAEQLQAHRDALSKLLEGKVSIDPLSVAIQEFSLVAKEVADEA  597

Query  362  kkL-----RKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFF  526
            KKL     RK++  A      RR LNDR+M AERGFL++EG+ G++W             
Sbjct  598  KKLKEGAYRKNDVAAAA---RRRELNDRMMLAERGFLDSEGIKGKEW-------------  641

Query  527  ILHWYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETEL  706
                ++HL                                        VYGP+   E++L
Sbjct  642  ----FKHL----------------------------------------VYGPAAEPESKL  657

Query  707  DFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
             FFPGI DA++      N+  G I +HEIWRVARAIQRA+ ALKG  T
Sbjct  658  GFFPGITDAIA-----TNSSEGTI-KHEIWRVARAIQRASKALKGGFT  699



>emb|CDX76133.1| BnaA04g03970D [Brassica napus]
Length=463

 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 115/285 (40%), Positives = 157/285 (55%), Gaps = 75/285 (26%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I SI +Y          +  D+PVYHTAFDSYDWMI+  DP F RH+A++G+WGL
Sbjct  252  LHHAGIPSIDMY----------YGADYPVYHTAFDSYDWMIRNADPLFHRHVAMAGIWGL  301

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            LG+ LADE VLPF+Y  YA +L  +  ++  +LEG VS+DP+  AI+E +  AK + +EA
Sbjct  302  LGIILADEPVLPFDYISYAEQLQAHRDAVCKLLEGKVSIDPLSVAIQEFSLVAKEVTDEA  361

Query  362  kkLRKDETMAE--LLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILH  535
            KKL++         +  +RR LNDR+M AERGFL++EG+ G++W                
Sbjct  362  KKLKEQAYSKNDVAVAAKRRELNDRMMLAERGFLDSEGIKGKEW----------------  405

Query  536  WYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFF  715
             ++HL                                        VYGP+   E++L FF
Sbjct  406  -FKHL----------------------------------------VYGPAAEPESKLGFF  424

Query  716  PGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
            PGI DA+      N++E   II+HEIWRV RAIQRA+ ALKG  T
Sbjct  425  PGIADAI----ETNSSE--GIIKHEIWRVTRAIQRASKALKGGFT  463



>emb|CDX73456.1| BnaC08g25470D [Brassica napus]
Length=702

 Score =   185 bits (469),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 118/288 (41%), Positives = 159/288 (55%), Gaps = 81/288 (28%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I SI +Y          +  D+PVYHTAFDSYDWMI+  DP F RH+A++GVWGL
Sbjct  491  LHHAGIASIDMY----------YGADYPVYHTAFDSYDWMIRNADPLFHRHVAMAGVWGL  540

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            LG+ LADE VLPFNY  YA +L  +  +LS +L+G  S+DP+  AI+E +  AK  ++EA
Sbjct  541  LGIILADEPVLPFNYISYAEQLQAHRDALSKLLQGKASVDPLSMAIQEFSLVAKEAQDEA  600

Query  362  kkLR-----KDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFF  526
            KKL+     K++  A     +RR LNDR+M  ERGFL++EG+ G++W             
Sbjct  601  KKLKEQAYNKNDVAAAA---KRRELNDRMMLGERGFLDSEGIKGKEW-------------  644

Query  527  ILHWYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETEL  706
                ++HL                                        VYGP+   E++L
Sbjct  645  ----FKHL----------------------------------------VYGPAAEPESKL  660

Query  707  DFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
             FFPGI DA++      N+  G +I+HEIWRVARAIQRA+ ALKG  T
Sbjct  661  GFFPGIADAIA-----TNSSEG-MIEHEIWRVARAIQRASRALKGGFT  702



>ref|XP_010427181.1| PREDICTED: probable glutamate carboxypeptidase 2 [Camelina sativa]
Length=714

 Score =   184 bits (468),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 118/288 (41%), Positives = 160/288 (56%), Gaps = 81/288 (28%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I SI +Y          +  D+PVYHTAFDSYDWMI   DP F RH+A++G+WGL
Sbjct  503  LHHAGIPSIDMY----------YGADYPVYHTAFDSYDWMIHNADPLFHRHVAMAGIWGL  552

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            LG+ LADE ++PF+Y  YA EL  +  +LS +L+G VS+DP+  AI+E +  AK + +EA
Sbjct  553  LGILLADEPLIPFDYTSYAQELHAHRDTLSKLLKGKVSVDPLSMAIQEFSLVAKEVTDEA  612

Query  362  kkLR-----KDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFF  526
            KKL+     KD+ +A     +RR LNDRLM  ERGFL+ EG+ G++W             
Sbjct  613  KKLKEKSYSKDDVVAAA---KRRELNDRLMLVERGFLDAEGIKGKEW-------------  656

Query  527  ILHWYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETEL  706
                ++HL                                        VYGP+   E++L
Sbjct  657  ----FKHL----------------------------------------VYGPAAEPESKL  672

Query  707  DFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
             FFPGI DA++    +N +E   +I+HEIWRVARAIQRA+ ALKG  T
Sbjct  673  GFFPGIADAIA----INASE--GVIEHEIWRVARAIQRASKALKGGFT  714



>ref|XP_010247434.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Nelumbo 
nucifera]
Length=651

 Score =   183 bits (465),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 154/262 (59%), Gaps = 58/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  D+P YHTAFDSYDWMI +GDPFFQRH+AVSG+WGLL L LAD+++LPFNY  YAA+
Sbjct  448  YYGKDYPAYHTAFDSYDWMINYGDPFFQRHVAVSGMWGLLALRLADDSILPFNYLSYAAQ  507

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  YT  L+  L+G VSL PI  +I EL +AAK +EE AKKLR+ ET  +L  L+RR LN
Sbjct  508  LHEYTNVLNRFLDGNVSLLPITTSIHELASAAKGVEEAAKKLREQETKDDLE-LKRRSLN  566

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM  ER F++  G+ G+QW                 ++HL                  
Sbjct  567  DRLMLTERSFIDATGLQGKQW-----------------FKHL------------------  591

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  VYGPS   +++LDFFP I +A S +  L   E  + IQ
Sbjct  592  ----------------------VYGPSNDYQSKLDFFPSIANAFSDAARLPREEAKSAIQ  629

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HEIWRVARA++RAA ALKG LT
Sbjct  630  HEIWRVARAVRRAASALKGELT  651



>ref|XP_010247433.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Nelumbo 
nucifera]
Length=702

 Score =   183 bits (465),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 154/262 (59%), Gaps = 58/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  D+P YHTAFDSYDWMI +GDPFFQRH+AVSG+WGLL L LAD+++LPFNY  YAA+
Sbjct  499  YYGKDYPAYHTAFDSYDWMINYGDPFFQRHVAVSGMWGLLALRLADDSILPFNYLSYAAQ  558

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  YT  L+  L+G VSL PI  +I EL +AAK +EE AKKLR+ ET  +L  L+RR LN
Sbjct  559  LHEYTNVLNRFLDGNVSLLPITTSIHELASAAKGVEEAAKKLREQETKDDLE-LKRRSLN  617

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM  ER F++  G+ G+QW                 ++HL                  
Sbjct  618  DRLMLTERSFIDATGLQGKQW-----------------FKHL------------------  642

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  VYGPS   +++LDFFP I +A S +  L   E  + IQ
Sbjct  643  ----------------------VYGPSNDYQSKLDFFPSIANAFSDAARLPREEAKSAIQ  680

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HEIWRVARA++RAA ALKG LT
Sbjct  681  HEIWRVARAVRRAASALKGELT  702



>gb|KFK34711.1| hypothetical protein AALP_AA5G181800 [Arabis alpina]
Length=700

 Score =   182 bits (463),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 115/285 (40%), Positives = 158/285 (55%), Gaps = 75/285 (26%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I SI +Y          +  D+PVYHTAFDSYDWMI   DP F RH+A++GVWGL
Sbjct  489  LHHAGIPSIDMY----------YGADYPVYHTAFDSYDWMIHNADPLFHRHVAMAGVWGL  538

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            LG+ LADE ++PF+Y  YA +L  +  +L+ +LEG VS++P+  AI+E +  AK   +EA
Sbjct  539  LGILLADEPLIPFDYISYAEQLEAHRDTLTKLLEGKVSVNPLSMAIQEFSMVAKEAADEA  598

Query  362  kkLRKDETMAE--LLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILH  535
            KKL++  +        ++RR LNDR+M  ERGFL+ EG+ G++W                
Sbjct  599  KKLKEQASNKSDVAAAVKRRELNDRMMLVERGFLDAEGIKGKEW----------------  642

Query  536  WYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFF  715
             ++HL                                        VYGP+   E++L FF
Sbjct  643  -FKHL----------------------------------------VYGPAAEPESKLGFF  661

Query  716  PGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
            PGI DA++R    N++E   II+HEIWRVARAIQRA+ ALKG  T
Sbjct  662  PGIADALAR----NSSE--GIIEHEIWRVARAIQRASKALKGGFT  700



>ref|XP_002877996.1| hypothetical protein ARALYDRAFT_485877 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54255.1| hypothetical protein ARALYDRAFT_485877 [Arabidopsis lyrata subsp. 
lyrata]
Length=705

 Score =   182 bits (461),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 117/288 (41%), Positives = 158/288 (55%), Gaps = 81/288 (28%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I SI +Y          +  D+PVYHTAFDSYDWMI   DP F RH+A++G+WGL
Sbjct  494  LHHAGIPSIDMY----------YGADYPVYHTAFDSYDWMIHNADPLFHRHVAMAGIWGL  543

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            LG+ LADE ++PF+Y  YA +L  +  +LS +LEG VS++P+  AI+E +  AK   +EA
Sbjct  544  LGIILADEPLIPFDYISYAEQLQVHRDTLSKLLEGKVSVNPLSMAIQEFSLVAKEAADEA  603

Query  362  kkLR-----KDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFF  526
            KKL+     KD+  A     +RR LNDRLM  ERGFL+ EG+ G++W             
Sbjct  604  KKLKEKSYSKDDVAAAA---KRRELNDRLMLVERGFLDAEGIKGKEW-------------  647

Query  527  ILHWYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETEL  706
                ++HL                                        VYGP+   E++L
Sbjct  648  ----FKHL----------------------------------------VYGPAAEPESKL  663

Query  707  DFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
             FFPGI DA++    +N +E   +I+HEIWRVARAIQRA+ ALKG  T
Sbjct  664  GFFPGIADAIA----INASE--GVIEHEIWRVARAIQRASKALKGGFT  705



>ref|XP_010504286.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Camelina 
sativa]
 ref|XP_010504287.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Camelina 
sativa]
Length=714

 Score =   181 bits (459),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 117/288 (41%), Positives = 157/288 (55%), Gaps = 81/288 (28%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I SI +Y          +  D+PVYHTAFDSYDWMI   DP F RH+A++G+WGL
Sbjct  503  LHHAGIPSIDMY----------YGADYPVYHTAFDSYDWMIHNADPLFHRHVAMAGIWGL  552

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            LG+ LADE ++PF+Y  YA EL  +  +LS +LEG VS+DP+  AI+E +  AK + +EA
Sbjct  553  LGILLADEPLIPFDYTSYAQELQAHRDTLSKLLEGKVSVDPLSMAIQEFSLVAKEVADEA  612

Query  362  kkLR-----KDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFF  526
            KKL+     KD+  A     +RR LNDRLM  ERGFL+ EG+ G++W             
Sbjct  613  KKLKEKSYSKDDVAAAR---KRRELNDRLMLVERGFLDAEGIKGKEW-------------  656

Query  527  ILHWYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETEL  706
                ++HL                                        VYGP+   E++L
Sbjct  657  ----FKHL----------------------------------------VYGPAAEPESKL  672

Query  707  DFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
             FFPGI DA++    ++  E   +I+HEIWRV RAIQRA+ ALKG  T
Sbjct  673  GFFPGIADAIA----IDAPE--GVIEHEIWRVTRAIQRASKALKGGFT  714



>ref|XP_006403544.1| hypothetical protein EUTSA_v10010161mg [Eutrema salsugineum]
 gb|ESQ44997.1| hypothetical protein EUTSA_v10010161mg [Eutrema salsugineum]
Length=713

 Score =   181 bits (458),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 113/288 (39%), Positives = 162/288 (56%), Gaps = 81/288 (28%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I SI +Y          +  D+PVYHTAFDSYDWMI+  DP F RH+A++G+WGL
Sbjct  502  LHHAGIPSIDMY----------YGADYPVYHTAFDSYDWMIRNADPMFHRHVAMAGIWGL  551

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            +G+ LADE V+PF+Y  YA +L  +  +LS +LEG VS++P+  AI+E +  A+  ++EA
Sbjct  552  IGIILADEPVIPFDYISYAEQLQAHRDTLSKLLEGKVSVNPLSMAIQEFSYVAEKAKDEA  611

Query  362  kkLR-----KDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFF  526
            KKL+     K++  A     +RR LNDR+M AERGFL++EG+ G++W             
Sbjct  612  KKLKEQAYSKNDVAAAA---KRRELNDRMMLAERGFLDSEGIKGKEW-------------  655

Query  527  ILHWYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETEL  706
                ++HL                                        VYGP+   +++L
Sbjct  656  ----FKHL----------------------------------------VYGPAAEPDSKL  671

Query  707  DFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
             FFPGI DA++    +N +E   +I+HE+WRVARAIQRA+ ALKG  T
Sbjct  672  GFFPGIADAIA----MNASE--GMIEHEMWRVARAIQRASKALKGGFT  713



>gb|AAL03993.1|AF357217_1 glutamate carboxypeptidase [Arabidopsis thaliana]
Length=705

 Score =   180 bits (457),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 117/288 (41%), Positives = 157/288 (55%), Gaps = 81/288 (28%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I SI +Y          +  D+PVYHTAFDSYDWMI   DP F RH+A++G+WGL
Sbjct  494  LHHAGIPSIDMY----------YGADYPVYHTAFDSYDWMIHNADPLFHRHVAMAGIWGL  543

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            LG+ LADE ++PF+Y  YA +L  +   LS +LEG VS++P+  AI+E +  AK   +EA
Sbjct  544  LGILLADEPLIPFDYISYAEQLQAHRDKLSKLLEGKVSVNPLSMAIQEFSLVAKEAADEA  603

Query  362  kkLR-----KDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFF  526
            KKL+     K++  A     +RR LNDRLM  ERGFL+ EG+ G++W             
Sbjct  604  KKLKGKSYSKNDVAAAA---KRRELNDRLMLVERGFLDAEGIKGKEW-------------  647

Query  527  ILHWYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETEL  706
                ++HL                                        VYGP+   E++L
Sbjct  648  ----FKHL----------------------------------------VYGPAAEPESKL  663

Query  707  DFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
             FFPGI DA++    +N +E   II+HEIWRVARAIQRA+ ALKG  T
Sbjct  664  GFFPGIADAIA----MNASE--GIIEHEIWRVARAIQRASKALKGGFT  705



>ref|XP_010516011.1| PREDICTED: probable glutamate carboxypeptidase 2 [Camelina sativa]
Length=709

 Score =   180 bits (457),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 116/288 (40%), Positives = 157/288 (55%), Gaps = 81/288 (28%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I SI +Y          +  D+PVYHTAFDSYDWMI   DP F RH+A+SG+WGL
Sbjct  498  LHHAGIPSIDMY----------YGADYPVYHTAFDSYDWMIHNADPLFHRHVAMSGIWGL  547

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            +G+ LADE ++PF+Y  YA EL  +  +LS +L+G VS+DP+  AI+E +  AK + +EA
Sbjct  548  IGILLADEPLIPFDYTSYAQELQAHRDTLSKLLKGKVSVDPLSMAIQEFSLVAKEVADEA  607

Query  362  kkLR-----KDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFF  526
            KKL+     KD+  A     +RR LNDRLM  ERGFL+ EG+ G++W             
Sbjct  608  KKLKEKSYSKDDVAAAA---KRRELNDRLMLVERGFLDAEGIKGKEW-------------  651

Query  527  ILHWYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETEL  706
                ++HL                                        VYGP+   E++L
Sbjct  652  ----FKHL----------------------------------------VYGPAAEPESKL  667

Query  707  DFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
             FFPGI DA++    ++  E   +I+HEIWRV RAIQRA+ ALKG  T
Sbjct  668  GFFPGIADAIA----IDAPE--GVIEHEIWRVTRAIQRASKALKGGFT  709



>emb|CAB77592.1| Peptidase-like protein [Arabidopsis thaliana]
Length=703

 Score =   180 bits (457),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 117/288 (41%), Positives = 157/288 (55%), Gaps = 81/288 (28%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I SI +Y          +  D+PVYHTAFDSYDWMI   DP F RH+A++G+WGL
Sbjct  492  LHHAGIPSIDMY----------YGADYPVYHTAFDSYDWMIHNADPLFHRHVAMAGIWGL  541

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            LG+ LADE ++PF+Y  YA +L  +   LS +LEG VS++P+  AI+E +  AK   +EA
Sbjct  542  LGILLADEPLIPFDYISYADQLQAHRDKLSKLLEGKVSVNPLSMAIQEFSLVAKEAADEA  601

Query  362  kkLR-----KDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFF  526
            KKL+     K++  A     +RR LNDRLM  ERGFL+ EG+ G++W             
Sbjct  602  KKLKGKSYSKNDVAAAA---KRRELNDRLMLVERGFLDAEGIKGKEW-------------  645

Query  527  ILHWYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETEL  706
                ++HL                                        VYGP+   E++L
Sbjct  646  ----FKHL----------------------------------------VYGPAAEPESKL  661

Query  707  DFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
             FFPGI DA++    +N +E   II+HEIWRVARAIQRA+ ALKG  T
Sbjct  662  GFFPGIADAIA----MNASE--GIIEHEIWRVARAIQRASKALKGGFT  703



>ref|NP_567007.1| glutamate carboxypeptidase [Arabidopsis thaliana]
 sp|Q9M1S8.3|GCP2_ARATH RecName: Full=Probable glutamate carboxypeptidase 2; AltName: 
Full=Probable glutamate carboxypeptidase II [Arabidopsis thaliana]
 gb|ACI49799.1| At3g54720 [Arabidopsis thaliana]
 gb|AEE79270.1| glutamate carboxypeptidase [Arabidopsis thaliana]
Length=705

 Score =   180 bits (456),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 117/288 (41%), Positives = 157/288 (55%), Gaps = 81/288 (28%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I SI +Y          +  D+PVYHTAFDSYDWMI   DP F RH+A++G+WGL
Sbjct  494  LHHAGIPSIDMY----------YGADYPVYHTAFDSYDWMIHNADPLFHRHVAMAGIWGL  543

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            LG+ LADE ++PF+Y  YA +L  +   LS +LEG VS++P+  AI+E +  AK   +EA
Sbjct  544  LGILLADEPLIPFDYISYADQLQAHRDKLSKLLEGKVSVNPLSMAIQEFSLVAKEAADEA  603

Query  362  kkLR-----KDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFF  526
            KKL+     K++  A     +RR LNDRLM  ERGFL+ EG+ G++W             
Sbjct  604  KKLKGKSYSKNDVAAAA---KRRELNDRLMLVERGFLDAEGIKGKEW-------------  647

Query  527  ILHWYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETEL  706
                ++HL                                        VYGP+   E++L
Sbjct  648  ----FKHL----------------------------------------VYGPAAEPESKL  663

Query  707  DFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
             FFPGI DA++    +N +E   II+HEIWRVARAIQRA+ ALKG  T
Sbjct  664  GFFPGIADAIA----MNASE--GIIEHEIWRVARAIQRASKALKGGFT  705



>ref|XP_010908058.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X3 [Elaeis 
guineensis]
Length=626

 Score =   179 bits (454),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 109/262 (42%), Positives = 137/262 (52%), Gaps = 57/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  +F  YHTA D+YDWM K GDP F RH+A++ +WGLLGLHLAD+ VLPF+Y  YAA 
Sbjct  422  YYGKEFSGYHTALDTYDWMEKHGDPMFHRHVAIAEIWGLLGLHLADDPVLPFDYLSYAAR  481

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  +T  LS  L GG  L P+  +IRELT AA    EE K+L++ ETM     L+RR  N
Sbjct  482  LQEHTNELSAFLNGGEFLQPVNASIRELTVAANEASEEGKRLQEQETMEHFAALKRRAFN  541

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM  ER FL  EG+  R W                 ++HL                  
Sbjct  542  DRLMLTERSFLEAEGLKRRGW-----------------FKHL------------------  566

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  +Y P    E+ + FFPGIVDA++++      E    IQ
Sbjct  567  ----------------------LYSPPEDYESNVSFFPGIVDAIAQARKFAEGEGQLGIQ  604

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HEIWRVARAIQRAA  L+G LT
Sbjct  605  HEIWRVARAIQRAASVLRGELT  626



>ref|XP_010908056.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Elaeis 
guineensis]
Length=707

 Score =   179 bits (454),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 109/262 (42%), Positives = 137/262 (52%), Gaps = 57/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  +F  YHTA D+YDWM K GDP F RH+A++ +WGLLGLHLAD+ VLPF+Y  YAA 
Sbjct  503  YYGKEFSGYHTALDTYDWMEKHGDPMFHRHVAIAEIWGLLGLHLADDPVLPFDYLSYAAR  562

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  +T  LS  L GG  L P+  +IRELT AA    EE K+L++ ETM     L+RR  N
Sbjct  563  LQEHTNELSAFLNGGEFLQPVNASIRELTVAANEASEEGKRLQEQETMEHFAALKRRAFN  622

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM  ER FL  EG+  R W                 ++HL                  
Sbjct  623  DRLMLTERSFLEAEGLKRRGW-----------------FKHL------------------  647

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  +Y P    E+ + FFPGIVDA++++      E    IQ
Sbjct  648  ----------------------LYSPPEDYESNVSFFPGIVDAIAQARKFAEGEGQLGIQ  685

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HEIWRVARAIQRAA  L+G LT
Sbjct  686  HEIWRVARAIQRAASVLRGELT  707



>ref|XP_006604679.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Glycine 
max]
Length=696

 Score =   177 bits (450),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 115/262 (44%), Positives = 156/262 (60%), Gaps = 58/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSY+WM ++GDPFF RH+AV+GVWGLL LHLAD+ VLPFNY PYA E
Sbjct  493  YYGRDFPVYHTAFDSYNWMAEYGDPFFHRHVAVTGVWGLLALHLADDPVLPFNYVPYANE  552

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y  +LS +++  +SL P+  +I E  +AAK   +E KKLR  E+ +  + +++R LN
Sbjct  553  LQLYKNTLSNLIDQKISLHPLTLSIEEFASAAKEANDELKKLRLQESESCFVDMKKRALN  612

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AE+GFL+ +G+ GRQW                 ++HL                  
Sbjct  613  DRLMLAEKGFLDADGLQGRQW-----------------FKHL------------------  637

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  V+GPS+  E +L+FFPGI D+++R + ++  ER + IQ
Sbjct  638  ----------------------VFGPSSNHE-KLNFFPGISDSITRLSGISERERLSSIQ  674

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HEIWRVARAI+RAA AL G  T
Sbjct  675  HEIWRVARAIRRAASALSGEFT  696



>ref|XP_007029148.1| Transferrin receptor protein, putative isoform 1 [Theobroma cacao]
 gb|EOY09650.1| Transferrin receptor protein, putative isoform 1 [Theobroma cacao]
Length=702

 Score =   177 bits (450),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 153/258 (59%), Gaps = 57/258 (22%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            DFPVYHTAFDS++WMI F DPFF RH+AV+GVWGLLGLHLAD+ VLP NY  YA +L  +
Sbjct  502  DFPVYHTAFDSFNWMINFADPFFWRHVAVAGVWGLLGLHLADDPVLPLNYLSYAKQLQEH  561

Query  257  TRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
               LS  ++G +SL P+  +I+EL +AAK   +EAK+L +     +LL+L+ R LNDRLM
Sbjct  562  KDVLSSFVDGSMSLTPLDASIQELASAAKRANDEAKRLMEQGFTDDLLVLKVRALNDRLM  621

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
             AERGFL+T+G+ GR+W                 ++HL                      
Sbjct  622  LAERGFLDTDGIKGREW-----------------FKHL----------------------  642

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              +YGP     ++L+FFPGI DA++ ST L+  +  A I+HEIW
Sbjct  643  ------------------IYGPRRNHGSKLEFFPGISDAIAESTKLSQRDGQAAIRHEIW  684

Query  797  RVARAIQRAAYALKGNLT  850
            RVARAI+RAA ALKG LT
Sbjct  685  RVARAIRRAAVALKGELT  702



>emb|CDX78257.1| BnaA09g34520D [Brassica napus]
Length=705

 Score =   177 bits (450),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 116/285 (41%), Positives = 157/285 (55%), Gaps = 75/285 (26%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I SI +Y          +  D+PVYHTAFDSYDWMI+  DP F RH+A++GVWGL
Sbjct  494  LHHAGIPSIDMY----------YGADYPVYHTAFDSYDWMIRNADPLFHRHVAMAGVWGL  543

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            LG+ LADE V+PFNY  YA +L  +  +LS +L G  S+DP+  AI+E +  AK  ++EA
Sbjct  544  LGIILADEPVIPFNYISYAEQLHAHRDALSKLLVGKASVDPLSMAIKEFSLVAKEAKDEA  603

Query  362  kkLRKD--ETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILH  535
            KKL++             RR LNDR+M AERGFL++EG+ G++W                
Sbjct  604  KKLKEQAYNKNDAAAAARRRGLNDRMMLAERGFLDSEGIKGKEW----------------  647

Query  536  WYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFF  715
             ++HL                                        VYGP+   E++L FF
Sbjct  648  -FKHL----------------------------------------VYGPAAEPESKLGFF  666

Query  716  PGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
            PGI DA++    +N++E   +IQHEIWRVARAIQ+A+ ALKG  T
Sbjct  667  PGIADAIA----VNSSE--GMIQHEIWRVARAIQKASRALKGGFT  705



>gb|KHN43582.1| Putative glutamate carboxypeptidase 2 [Glycine soja]
Length=678

 Score =   177 bits (449),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 115/262 (44%), Positives = 156/262 (60%), Gaps = 58/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSY+WM ++GDPFF RH+AV+GVWGLL LHLAD+ VLPFNY PYA E
Sbjct  475  YYGRDFPVYHTAFDSYNWMAEYGDPFFHRHVAVTGVWGLLALHLADDPVLPFNYVPYANE  534

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y  +LS +++  +SL P+  +I E  +AAK   +E KKLR  E+ +  + +++R LN
Sbjct  535  LQLYKNTLSNLIDQKISLHPLTLSIEEFASAAKEANDELKKLRLQESESCFVDMKKRALN  594

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AE+GFL+ +G+ GRQW                 ++HL                  
Sbjct  595  DRLMLAEKGFLDADGLQGRQW-----------------FKHL------------------  619

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  V+GPS+  E +L+FFPGI D+++R + ++  ER + IQ
Sbjct  620  ----------------------VFGPSSNHE-KLNFFPGISDSITRLSGISERERLSSIQ  656

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HEIWRVARAI+RAA AL G  T
Sbjct  657  HEIWRVARAIRRAASALSGEFT  678



>ref|XP_010908057.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Elaeis 
guineensis]
Length=704

 Score =   177 bits (449),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/254 (43%), Positives = 133/254 (52%), Gaps = 57/254 (22%)
 Frame = +2

Query  89   YHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYTRSL  268
            YHTA D+YDWM K GDP F RH+A++ +WGLLGLHLAD+ VLPF+Y  YAA L  +T  L
Sbjct  508  YHTALDTYDWMEKHGDPMFHRHVAIAEIWGLLGLHLADDPVLPFDYLSYAARLQEHTNEL  567

Query  269  SGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLMSAER  448
            S  L GG  L P+  +IRELT AA    EE K+L++ ETM     L+RR  NDRLM  ER
Sbjct  568  SAFLNGGEFLQPVNASIRELTVAANEASEEGKRLQEQETMEHFAALKRRAFNDRLMLTER  627

Query  449  GFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVIAAYT  628
             FL  EG+  R W                 ++HL                          
Sbjct  628  SFLEAEGLKRRGW-----------------FKHL--------------------------  644

Query  629  YCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVAR  808
                          +Y P    E+ + FFPGIVDA++++      E    IQHEIWRVAR
Sbjct  645  --------------LYSPPEDYESNVSFFPGIVDAIAQARKFAEGEGQLGIQHEIWRVAR  690

Query  809  AIQRAAYALKGNLT  850
            AIQRAA  L+G LT
Sbjct  691  AIQRAASVLRGELT  704



>gb|ACU21428.1| unknown [Glycine max]
Length=205

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 98/240 (41%), Positives = 134/240 (56%), Gaps = 58/240 (24%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            DFPVYHTAFDSY+WM ++GDPFF RH+AV+GVWGLL LHLAD+ +LPFNY  YA EL  Y
Sbjct  6    DFPVYHTAFDSYNWMAEYGDPFFHRHVAVTGVWGLLALHLADDPILPFNYVSYANELQLY  65

Query  257  TRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
              +LS +++  +SL P+  +I E  +AAK  ++E K LR  ET    + +++R LNDRLM
Sbjct  66   KNTLSNLIDQKISLHPLTLSIEEFASAAKEADDEIKNLRLQETEGCFVDMKKRALNDRLM  125

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
             AE+GFL+ +G+ G+QW                 ++HL                      
Sbjct  126  LAEKGFLDADGLQGKQW-----------------FKHL----------------------  146

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              V+GPS+  E  ++FFPGI D+   S  ++  ER A I+HEIW
Sbjct  147  ------------------VFGPSSDHE-RINFFPGISDSTITSAGVSERERLASIRHEIW  187



>gb|KHG11397.1| putative glutamate carboxypeptidase 2 [Gossypium arboreum]
 gb|KHG11398.1| putative glutamate carboxypeptidase 2 [Gossypium arboreum]
Length=702

 Score =   176 bits (446),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 118/261 (45%), Positives = 154/261 (59%), Gaps = 57/261 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDS++WMI   DPFF RH+AV+GVWGLLGLHLAD+ VLPF+Y  YA +
Sbjct  498  YYGRDFPVYHTAFDSFNWMINNADPFFWRHVAVAGVWGLLGLHLADDPVLPFDYLSYAKQ  557

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y  + S VL+G +SL P+  +I+E T+AAK   EE KKL + E   +LL L+ R LN
Sbjct  558  LQEYKDAYSRVLDGNISLTPLAASIQEFTSAAKQANEETKKLMEQEFTNDLLALKIRALN  617

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            D LM AERGFL+T+G+ GR+W                 ++HL                  
Sbjct  618  DGLMLAERGFLDTDGIKGREW-----------------FKHL------------------  642

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  +YGP +  E+ L+FFPGI DA++ S +++  +  A I+
Sbjct  643  ----------------------IYGPRSNYESGLEFFPGISDAMAESKNMSQKDGHAAIK  680

Query  785  HEIWRVARAIQRAAYALKGNL  847
            HEIWRVARAIQRAA ALKG L
Sbjct  681  HEIWRVARAIQRAAAALKGEL  701



>ref|XP_009116147.1| PREDICTED: probable glutamate carboxypeptidase 2 [Brassica rapa]
Length=705

 Score =   176 bits (445),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 115/285 (40%), Positives = 157/285 (55%), Gaps = 75/285 (26%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I SI +Y          +  D+PVYHTAFDSYDWMI+  DP F RH+A++GVWGL
Sbjct  494  LHHAGIPSIDMY----------YGADYPVYHTAFDSYDWMIRNADPLFHRHVAMAGVWGL  543

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            LG+ LADE V+PF+Y  YA +L  +  +LS +L G  S+DP+  AI+E +  AK  ++EA
Sbjct  544  LGIILADEPVIPFDYISYAEQLHAHRDALSKLLVGKASVDPLSMAIKEFSLVAKEAKDEA  603

Query  362  kkLRKD--ETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILH  535
            KKL++             RR LNDR+M AERGFL++EG+ G++W                
Sbjct  604  KKLKEQAYNKNDAAAAARRRGLNDRMMLAERGFLDSEGIKGKEW----------------  647

Query  536  WYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFF  715
             ++HL                                        VYGP+   E++L FF
Sbjct  648  -FKHL----------------------------------------VYGPAAEPESKLGFF  666

Query  716  PGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
            PGI DA++    +N++E   +IQHEIWRVARAIQ+A+ ALKG  T
Sbjct  667  PGIADAIA----VNSSE--GMIQHEIWRVARAIQKASRALKGGFT  705



>ref|XP_006290666.1| hypothetical protein CARUB_v10016757mg [Capsella rubella]
 gb|EOA23564.1| hypothetical protein CARUB_v10016757mg [Capsella rubella]
Length=712

 Score =   176 bits (445),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 112/288 (39%), Positives = 155/288 (54%), Gaps = 81/288 (28%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I SI +Y          +  D+PVYHTAFDSYDWMI   DP F RH+A++G+WGL
Sbjct  501  LHHAGIPSIDMY----------YGADYPVYHTAFDSYDWMIHNADPLFHRHVAMAGIWGL  550

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELT-----aaaka  346
            LG+ LADE ++PF+Y  YA +L  +  +LS +LE  VS+DP+  AI+E       AA +A
Sbjct  551  LGILLADEPIIPFDYTSYAGQLQAHRDTLSKLLERKVSVDPLSMAIQEFALVAKKAADEA  610

Query  347  ieeeakkLRKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFF  526
             + + K   KD+  A     +RR LNDRLM AERGFL+ +G+ G++W             
Sbjct  611  KKFKEKSYSKDDVAAAA---KRRELNDRLMLAERGFLDAQGIKGKEW-------------  654

Query  527  ILHWYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETEL  706
                ++HL                                        VYGP+   E++L
Sbjct  655  ----FKHL----------------------------------------VYGPAAEPESKL  670

Query  707  DFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
             FFPGI DA++    ++ +E   +I+HEIWRV+RAIQRA+ ALKG  T
Sbjct  671  GFFPGIADAIA----IDASE--GVIEHEIWRVSRAIQRASKALKGGFT  712



>ref|XP_010555869.1| PREDICTED: probable glutamate carboxypeptidase 2 [Tarenaya hassleriana]
Length=718

 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 113/286 (40%), Positives = 159/286 (56%), Gaps = 71/286 (25%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I SI +Y          +  DFPVYHTAFDSYDWM+   DP F RH+A++G+WGL
Sbjct  501  LHHAGIPSIDMY----------YGEDFPVYHTAFDSYDWMVHHVDPLFHRHVAMAGIWGL  550

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            LGL +ADE ++PF+Y  YA +L  +  +LS +L+   S++P+ D+IRE    AK +++EA
Sbjct  551  LGLIIADEPLIPFDYISYADQLKSHRDALSKLLDRINSVNPLTDSIREFCTVAKQVKDEA  610

Query  362  kkLR-KDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHW  538
            +K++ +  + AE+     R LND+LM AERGFL+ +G+ G +W                 
Sbjct  611  EKMKGRSYSEAEVASSAIRQLNDKLMLAERGFLDEDGITGNEW-----------------  653

Query  539  YQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFP  718
            ++HL                                        VYGPS+  E++L FFP
Sbjct  654  FKHL----------------------------------------VYGPSSDPESKLGFFP  673

Query  719  GIVDAVSRSTHLNN--TERGAIIQHEIWRVARAIQRAAYALKGNLT  850
            GI DA++ ++   +  TE  AI QHEIWRVARAIQR+A ALKG  T
Sbjct  674  GIADAIAMASRQRDRDTETEAI-QHEIWRVARAIQRSAKALKGGFT  718



>ref|XP_008777140.1| PREDICTED: probable glutamate carboxypeptidase 2 [Phoenix dactylifera]
Length=706

 Score =   174 bits (441),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 146/284 (51%), Gaps = 70/284 (25%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  + +I LY          +  +F  YHTA DSYDWM K GDP F RH+A++ +WGL
Sbjct  492  LHHAGVPAIDLY----------YGKEFSGYHTALDSYDWMEKHGDPMFHRHVAIAEIWGL  541

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            LGLHLAD+ VLPF+Y  YAA+L  +T  L+  L GG  L P+  +I ELT  A    EE 
Sbjct  542  LGLHLADDPVLPFDYLSYAAQLQEHTNELNAFLNGGEFLKPVNASIHELTVVANEASEEG  601

Query  362  kkLRKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWY  541
            K+L++ ET+     L+RR  NDRLM AER FL  EG+  R W                 +
Sbjct  602  KRLQEQETLEGFAALKRRAFNDRLMLAERSFLEAEGLKRRGW-----------------F  644

Query  542  QHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPG  721
            +HL                                        +Y P    E+ + FFPG
Sbjct  645  KHL----------------------------------------LYSPPEDYESNITFFPG  664

Query  722  IVDAVSRSTHLNNTERGAI-IQHEIWRVARAIQRAAYALKGNLT  850
            IVDA++++      E G + IQHEIWRVARAIQRAA  L+G LT
Sbjct  665  IVDAIAQAR--KAAEEGQMGIQHEIWRVARAIQRAASVLRGELT  706



>ref|XP_003520727.2| PREDICTED: probable glutamate carboxypeptidase 2-like [Glycine 
max]
Length=694

 Score =   167 bits (424),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 100/244 (41%), Positives = 137/244 (56%), Gaps = 58/244 (24%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSY+WM ++GDPFF RH+AV+GVWGLL LHLAD+ +LPFNY  YA E
Sbjct  491  YYGRDFPVYHTAFDSYNWMAEYGDPFFHRHVAVTGVWGLLALHLADDPILPFNYVSYANE  550

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y  +LS +++  +SL P+  +I E  +AAK  ++E KKLR  ET    + +++R LN
Sbjct  551  LQLYKNTLSNLIDQKISLHPLTLSIEEFASAAKEADDEIKKLRLQETEGCFVDMKKRALN  610

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AE+GFL+ +G+ G+QW                 ++HL                  
Sbjct  611  DRLMLAEKGFLDADGLQGKQW-----------------FKHL------------------  635

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  V+GPS+  E  ++FFPGI D+   S  ++  ER A IQ
Sbjct  636  ----------------------VFGPSSDHE-RINFFPGISDSTITSAGVSERERLASIQ  672

Query  785  HEIW  796
            HEIW
Sbjct  673  HEIW  676



>ref|XP_008442988.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Cucumis 
melo]
Length=701

 Score =   167 bits (424),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 111/262 (42%), Positives = 149/262 (57%), Gaps = 57/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFD+YDWM  +GDP F RH+ V  +WGLL L L+D+ +LPF+Y  YA +
Sbjct  497  YYGRDFPVYHTAFDTYDWMANYGDPLFHRHVTVGSIWGLLALRLSDDLILPFSYVSYANQ  556

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y  +L+ +L+G VSL  +  +I EL +AA+ IE EAK+LR+ ET +++ + ++R LN
Sbjct  557  LQAYKDTLNHLLDGSVSLRTLSTSIEELKSAAQEIENEAKRLREQETSSDVALFQKRALN  616

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+ +G+ GR W                 ++HL                  
Sbjct  617  DRLMLAERGFLDVDGLRGRPW-----------------FKHL------------------  641

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  VYGP +  E+ L +FPGI DAVS S  +N      +IQ
Sbjct  642  ----------------------VYGPPSDYESALVYFPGIADAVSESKEMNKMGLEELIQ  679

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HEIWRVARAI RAA ALKG L+
Sbjct  680  HEIWRVARAIGRAAAALKGELS  701



>gb|KHN22574.1| Putative glutamate carboxypeptidase 2 [Glycine soja]
Length=594

 Score =   166 bits (419),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 135/240 (56%), Gaps = 58/240 (24%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            DFPVYHTAFDSY+WM ++GDPFF RH+AV+GVWGLL LHLA++ +LPFNY  YA EL  Y
Sbjct  395  DFPVYHTAFDSYNWMAEYGDPFFHRHVAVTGVWGLLALHLANDPILPFNYVSYANELQLY  454

Query  257  TRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
              +LS +++  +SL P+  +I E  +AAK  ++E KKLR  ET    + +++R LNDRLM
Sbjct  455  KNTLSNLIDQKISLHPLTLSIEEFASAAKEADDEIKKLRLQETEGCFVDMKKRALNDRLM  514

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
             AE+GFL+ +G+ G+QW                 ++HL                      
Sbjct  515  LAEKGFLDADGLQGKQW-----------------FKHL----------------------  535

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              V+GPS+  E  ++FFPGI D+   S  ++  ER A IQHEIW
Sbjct  536  ------------------VFGPSSDHE-RINFFPGISDSTITSAGVSERERLASIQHEIW  576



>ref|XP_004981489.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Setaria 
italica]
Length=715

 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 150/283 (53%), Gaps = 67/283 (24%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I S+ LY          +  +FP YHTA DSY+WM KFGDP F RH+A++ +WGL
Sbjct  486  LHHAGIPSVDLY----------YGKEFPGYHTALDSYNWMEKFGDPLFLRHLAITEIWGL  535

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            L L LAD+ VLPF+Y+ YA++L  +T +LS ++    +++ +   I +L+ AA  + +EA
Sbjct  536  LALRLADDPVLPFDYQVYASQLQEHTNALSALMSNSQAVNLMNGFINDLSGAATEVLKEA  595

Query  362  kkLRKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWY  541
            KKL++ +   E   + RR LND L+ AER FL  EG+ GR W                 +
Sbjct  596  KKLQQLDLYDEHARMRRRSLNDHLLLAERSFLQAEGLQGRAW-----------------F  638

Query  542  QHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPG  721
            +HL                                        +Y P    E++L FFPG
Sbjct  639  KHL----------------------------------------LYSPPEDYESKLSFFPG  658

Query  722  IVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
            I DA+SRS +L+  ER   IQHE+W+V+RAIQRAA  L+G  +
Sbjct  659  IADAISRSGNLSAEEREVSIQHEVWKVSRAIQRAASVLRGEFS  701



>ref|XP_009398816.1| PREDICTED: probable glutamate carboxypeptidase 2 [Musa acuminata 
subsp. malaccensis]
Length=390

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/284 (38%), Positives = 145/284 (51%), Gaps = 71/284 (25%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I S+ LY          +   F  YHTAFDSY WMI+ GDP F RH+A++ +WGL
Sbjct  175  LHHAGIPSVDLY----------YGEAFGGYHTAFDSYKWMIEHGDPSFHRHVAIAELWGL  224

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            LGL LAD+ VLPF+Y  Y+ +L  Y  +L   L+GG+S+ P+  ++ EL+AA +   EE 
Sbjct  225  LGLRLADDPVLPFDYLSYSTQLHEYATTLITFLDGGISVHPLNASVDELSAAIREALEEG  284

Query  362  kkLRKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWY  541
            KKL++ ET  E   L  R  NDRLM AERGFL  EG+  +Q                 W+
Sbjct  285  KKLQEVETSEEFAALRIRAFNDRLMLAERGFLEAEGLRRKQ-----------------WF  327

Query  542  QHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPG  721
            +H+                                        VY P    E+++ FFPG
Sbjct  328  KHM----------------------------------------VYSPPEDSESKMPFFPG  347

Query  722  IVDAVS--RSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNL  847
            I DA+S  R      T+ G  +QHEIWRVARAI+R A  L+G L
Sbjct  348  IADAISPARKHAGKGTQLG--VQHEIWRVARAIRRVAATLRGEL  389



>ref|XP_006826386.1| hypothetical protein AMTR_s00004p00142600 [Amborella trichopoda]
 gb|ERM93623.1| hypothetical protein AMTR_s00004p00142600 [Amborella trichopoda]
Length=744

 Score =   164 bits (416),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 150/262 (57%), Gaps = 58/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            FF  DFPVYHTA+D+Y+WM K+GDP F RH+AVSG+WGLL L LAD+ VLPF+Y  Y+ +
Sbjct  539  FFGEDFPVYHTAYDTYNWMRKYGDPLFHRHVAVSGIWGLLALRLADDLVLPFDYSSYSTQ  598

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  + ++L G++  G++L PI  AI+EL  AA  + +EA++LR   +      L+RR  N
Sbjct  599  LQEHAKALQGLMSAGITLQPINTAIQELKEAAVTVADEAEELRHGSSTDVAFELKRRAFN  658

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM  ER FL+  G+ GR+W                 ++HL                  
Sbjct  659  DRLMLTERAFLDAGGLRGREW-----------------FKHL------------------  683

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERG-AII  781
                                  +YGPS   E++L FFPGIVDA+ ++   +N E G A+I
Sbjct  684  ----------------------IYGPSKYSESKLGFFPGIVDAIYKAKERDNGEEGKALI  721

Query  782  QHEIWRVARAIQRAAYALKGNL  847
            QHEIWRVARAI RAA ALKGNL
Sbjct  722  QHEIWRVARAISRAAAALKGNL  743



>gb|KEH24313.1| glutamate carboxypeptidase, putative [Medicago truncatula]
Length=654

 Score =   163 bits (413),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 99/262 (38%), Positives = 130/262 (50%), Gaps = 96/262 (37%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSY+WM ++ DPFFQRH+AV+G+WGLL L LAD+++LPFNY  YA E
Sbjct  489  YYGKDFPVYHTAFDSYNWMAEYADPFFQRHVAVTGIWGLLALRLADDSILPFNYLSYANE  548

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L                        REL                 ET  + + ++RR +N
Sbjct  549  L------------------------RELKLV--------------ETSGQFVDMKRRAMN  570

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AE+GFL+ +G+ G+QW                 ++HL                  
Sbjct  571  DRLMLAEKGFLDGDGLKGKQW-----------------FKHL------------------  595

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  V+GP    E +LDFFPGI D+++RST  +  ER A IQ
Sbjct  596  ----------------------VFGPPNDAE-KLDFFPGIADSMTRSTGTSERERLAEIQ  632

Query  785  HEIWRVARAIQRAAYALKGNLT  850
             EIWRV RAIQRA +AL+G  T
Sbjct  633  REIWRVTRAIQRATFALRGEFT  654



>gb|KCW48177.1| hypothetical protein EUGRSUZ_K01904 [Eucalyptus grandis]
Length=491

 Score =   161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/259 (42%), Positives = 142/259 (55%), Gaps = 58/259 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTA+D+YDWM+  GDPFFQRH+A +GVWGLL L LAD+ +LPFNY  Y  +
Sbjct  288  YYGKDFPVYHTAYDTYDWMVNHGDPFFQRHVAAAGVWGLLALRLADDLILPFNYLNYTNQ  347

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   L+ +L+G +S+ P+  +I+ L + AK +E EA+KL  ++T  E  +L RR LN
Sbjct  348  LRGYVDILNNLLDGNISVHPLTLSIQALASVAKEVELEAEKLSAEQTTGEPGVLRRRALN  407

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+ +G+   QW                 ++HL                  
Sbjct  408  DRLMLAERGFLDADGLPYGQW-----------------FKHL------------------  432

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  VYGPS    +   FFPGI +A+ RS  + + E  A IQ
Sbjct  433  ----------------------VYGPSDY-RSRTSFFPGIAEAIWRSARMRSGEGQASIQ  469

Query  785  HEIWRVARAIQRAAYALKG  841
            HEIWRVARAIQR A  L G
Sbjct  470  HEIWRVARAIQRVADVLGG  488



>gb|KEH24312.1| glutamate carboxypeptidase, putative [Medicago truncatula]
Length=650

 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSY+WM ++ DPFFQRH+AV+G+WGLL L LAD+++LPFNY  YA E
Sbjct  489  YYGKDFPVYHTAFDSYNWMAEYADPFFQRHVAVTGIWGLLALRLADDSILPFNYLSYANE  548

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   LS +L+  +SL P+  +I+E   AAK +++E K+L+  ET  + + ++RR +N
Sbjct  549  LRLYRDKLSNMLDHKMSLHPLTTSIQEFACAAKEVDDELKELKLVETSGQFVDMKRRAMN  608

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVS  505
            DRLM AE+GFL+ +G+ G+QWFKHLVS
Sbjct  609  DRLMLAEKGFLDGDGLKGKQWFKHLVS  635



>ref|XP_010036574.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamate carboxypeptidase 
2 [Eucalyptus grandis]
Length=701

 Score =   162 bits (409),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 108/259 (42%), Positives = 142/259 (55%), Gaps = 58/259 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTA+D+YDWM+  GDPFFQRH+A +GVWGLL L LAD+ +LPFNY  Y  +
Sbjct  498  YYGKDFPVYHTAYDTYDWMVNHGDPFFQRHVAAAGVWGLLALRLADDLILPFNYLNYTNQ  557

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  Y   L+ +L+G +S+ P+  +I+ L + AK +E EA+KL  ++T  E  +L RR LN
Sbjct  558  LRGYVDILNNLLDGNISVHPLTLSIQALASVAKEVELEAEKLSAEQTTGEPGVLRRRALN  617

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AERGFL+ +G+   QW                 ++HL                  
Sbjct  618  DRLMLAERGFLDADGLPYGQW-----------------FKHL------------------  642

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  VYGPS    +   FFPGI +A+ RS  + + E  A IQ
Sbjct  643  ----------------------VYGPSDY-RSRTSFFPGIAEAIWRSARMRSGEGQASIQ  679

Query  785  HEIWRVARAIQRAAYALKG  841
            HEIWRVARAIQR A  L G
Sbjct  680  HEIWRVARAIQRVADVLGG  698



>ref|XP_004136724.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Cucumis 
sativus]
Length=701

 Score =   156 bits (395),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 110/263 (42%), Positives = 148/263 (56%), Gaps = 57/263 (22%)
 Frame = +2

Query  62   TFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAA  241
             ++  DFPVYHTAFD+YDWM  +GDP F RH+ V  +WGLL L L+D+ +LPF+Y  YA 
Sbjct  496  VYYGRDFPVYHTAFDTYDWMANYGDPLFHRHVTVGSIWGLLALRLSDDLILPFSYISYAN  555

Query  242  ELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRML  421
            +L  Y  +L+ +L+G VSL  +  +I EL  AA+ IE EAK+LR+ E  +++ + ++R L
Sbjct  556  QLQAYKDTLNHLLDGSVSLHSLSSSIEELKFAAQEIENEAKRLREQEASSDVALFQKRAL  615

Query  422  NDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGS  601
            NDRLM AERGFL+ +G+ G  W                 ++HL                 
Sbjct  616  NDRLMLAERGFLDVDGLRGHPW-----------------FKHL-----------------  641

Query  602  SVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAII  781
                                   VYGP +  E+ L +FPGI DAVS S  +N  E   +I
Sbjct  642  -----------------------VYGPLSNYESALVYFPGIADAVSESKEINKRELEELI  678

Query  782  QHEIWRVARAIQRAAYALKGNLT  850
            QHEIWRVARAI+RAA ALKG L+
Sbjct  679  QHEIWRVARAIRRAAAALKGELS  701



>ref|XP_004165115.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Cucumis 
sativus]
Length=701

 Score =   156 bits (395),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 110/263 (42%), Positives = 148/263 (56%), Gaps = 57/263 (22%)
 Frame = +2

Query  62   TFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAA  241
             ++  DFPVYHTAFD+YDWM  +GDP F RH+ V  +WGLL L L+D+ +LPF+Y  YA 
Sbjct  496  VYYGRDFPVYHTAFDTYDWMANYGDPLFHRHVTVGSIWGLLALRLSDDLILPFSYISYAN  555

Query  242  ELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRML  421
            +L  Y  +L+ +L+G VSL  +  +I EL  AA+ IE EAK+LR+ E  +++ + ++R L
Sbjct  556  QLQAYKDTLNHLLDGSVSLHSLSSSIEELKFAAQEIENEAKRLREQEASSDVALFQKRAL  615

Query  422  NDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGS  601
            NDRLM AERGFL+ +G+ G  W                 ++HL                 
Sbjct  616  NDRLMLAERGFLDVDGLRGHPW-----------------FKHL-----------------  641

Query  602  SVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAII  781
                                   VYGP +  E+ L +FPGI DAVS S  +N  E   +I
Sbjct  642  -----------------------VYGPLSNYESALVYFPGIADAVSESKEINKRELEELI  678

Query  782  QHEIWRVARAIQRAAYALKGNLT  850
            QHEIWRVARAI+RAA ALKG L+
Sbjct  679  QHEIWRVARAIRRAAAALKGELS  701



>gb|KGN59254.1| hypothetical protein Csa_3G790960 [Cucumis sativus]
Length=701

 Score =   155 bits (392),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 110/258 (43%), Positives = 146/258 (57%), Gaps = 57/258 (22%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            DFPVYHTAFD+YDWM  +GDP F RH+ V  +WGLL L L+D+ +LPF+Y  YA +L  Y
Sbjct  501  DFPVYHTAFDTYDWMANYGDPLFHRHVTVGSIWGLLALRLSDDLILPFSYISYANQLQAY  560

Query  257  TRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
              +L+ +L+G VSL  +  +I EL  AA+ IE EAK+LR+ E  +++ + ++R LNDRLM
Sbjct  561  KDTLNHLLDGSVSLHSLSSSIEELKFAAQEIENEAKRLREQEASSDVALFQKRALNDRLM  620

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
             AERGFL+ +G+ G  W                 ++HL                      
Sbjct  621  LAERGFLDVDGLRGHPW-----------------FKHL----------------------  641

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              VYGP +  E+ L +FPGI DAVS S  +N  E   +IQHEIW
Sbjct  642  ------------------VYGPLSNYESALVYFPGIADAVSESKVINKRELEELIQHEIW  683

Query  797  RVARAIQRAAYALKGNLT  850
            RVARAI+RAA ALKG L+
Sbjct  684  RVARAIRRAAAALKGELS  701



>gb|KDP33786.1| hypothetical protein JCGZ_07357 [Jatropha curcas]
Length=703

 Score =   152 bits (384),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 131/261 (50%), Gaps = 61/261 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+AV+ VWGL+ L LADE  LPFNY  YA EL R  
Sbjct  500  YPVYHSMYDDFIWMKKFGDPMFQRHVAVASVWGLVALWLADEEFLPFNYLSYAYELQRSA  559

Query  260  RSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLI---LERRMLND  427
            + L  V+   G+SLDP+F +I ELT AA  I ++ K + +      +L    L+ R +ND
Sbjct  560  KELEDVISNKGISLDPLFKSIDELTKAATKIHKKRKAIEESRGWTSILKKDHLKVREIND  619

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM AER F + +G++GR W                 Y+HL                   
Sbjct  620  RLMMAERAFTDQDGLSGRPW-----------------YKHL-------------------  643

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +Y P+       + FPGI DA+ ++  L   E    +QH
Sbjct  644  ---------------------IYAPAKHNVYGSNSFPGIDDAIEKAKRLKTAESWQSVQH  682

Query  788  EIWRVARAIQRAAYALKGNLT  850
            E+WRV+RA+++ +  L G LT
Sbjct  683  EVWRVSRAVRQVSLVLSGELT  703



>ref|XP_011093646.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Sesamum 
indicum]
Length=705

 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 96/260 (37%), Positives = 129/260 (50%), Gaps = 60/260 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+AV+ +WGLL L LAD  +LPF+Y PYA EL R  
Sbjct  503  YPVYHSMYDDFIWMNKFGDPMFQRHVAVASIWGLLALKLADNEILPFDYLPYALELQRSV  562

Query  260  RSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRM--LNDR  430
             SL   V   G++L P+  +I+EL  AA  I EE K L   ++   +    +++  LNDR
Sbjct  563  ESLKDEVANRGITLVPLVKSIKELETAATKINEERKALEGSKSWTSMCKDSQKVRELNDR  622

Query  431  LMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVK  610
            LM  ER F + EG+ GR W                 Y+HL                    
Sbjct  623  LMMTERAFTDREGLPGRSW-----------------YKHL--------------------  645

Query  611  VIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHE  790
                                +Y PS   +     FPGI DA+ ++ +LN  +    +QHE
Sbjct  646  --------------------IYAPSKHNDYGSTSFPGIDDALEKAKNLNTADSWHSVQHE  685

Query  791  IWRVARAIQRAAYALKGNLT  850
            IWRVAR I +A+  LKG LT
Sbjct  686  IWRVARVITQASLCLKGKLT  705



>ref|XP_011093647.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Sesamum 
indicum]
Length=704

 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 96/260 (37%), Positives = 129/260 (50%), Gaps = 60/260 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+AV+ +WGLL L LAD  +LPF+Y PYA EL R  
Sbjct  502  YPVYHSMYDDFIWMNKFGDPMFQRHVAVASIWGLLALKLADNEILPFDYLPYALELQRSV  561

Query  260  RSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRM--LNDR  430
             SL   V   G++L P+  +I+EL  AA  I EE K L   ++   +    +++  LNDR
Sbjct  562  ESLKDEVANRGITLVPLVKSIKELETAATKINEERKALEGSKSWTSMCKDSQKVRELNDR  621

Query  431  LMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVK  610
            LM  ER F + EG+ GR W                 Y+HL                    
Sbjct  622  LMMTERAFTDREGLPGRSW-----------------YKHL--------------------  644

Query  611  VIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHE  790
                                +Y PS   +     FPGI DA+ ++ +LN  +    +QHE
Sbjct  645  --------------------IYAPSKHNDYGSTSFPGIDDALEKAKNLNTADSWHSVQHE  684

Query  791  IWRVARAIQRAAYALKGNLT  850
            IWRVAR I +A+  LKG LT
Sbjct  685  IWRVARVITQASLCLKGKLT  704



>ref|XP_006451321.1| hypothetical protein CICLE_v10007621mg [Citrus clementina]
 gb|ESR64561.1| hypothetical protein CICLE_v10007621mg [Citrus clementina]
Length=705

 Score =   149 bits (377),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 95/265 (36%), Positives = 132/265 (50%), Gaps = 61/265 (23%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F   +PVYH+ +D + WM KFGDP FQRH+A + +WGL+ L LADE  LPFNY  YA EL
Sbjct  498  FGTGYPVYHSMYDDFIWMEKFGDPTFQRHVAAASMWGLVALQLADEEFLPFNYLSYAFEL  557

Query  248  LRYTRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER---R  415
             + T+ L   + G G+SL P+F +I EL  AA  I+ E K+L+K +  A     ++   R
Sbjct  558  QKSTKDLENEVSGKGISLIPLFKSIEELAKAAAKIDNEKKELQKAKGWASTWKKDQYKVR  617

Query  416  MLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVL  595
             LNDRLM AER F + +G++GR W                 Y+HL               
Sbjct  618  ELNDRLMMAERAFTDRDGLSGRPW-----------------YKHL---------------  645

Query  596  GSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGA  775
                                     +Y PS   +    +FP I DA+  +  LN  +   
Sbjct  646  -------------------------IYAPSKHNDYGSKYFPAIDDAIEEAMKLNTAKSWH  680

Query  776  IIQHEIWRVARAIQRAAYALKGNLT  850
             +QHE+WRV+RA++ A+  L G LT
Sbjct  681  TVQHEVWRVSRAVRHASLVLNGKLT  705



>gb|KDO66598.1| hypothetical protein CISIN_1g005260mg [Citrus sinensis]
Length=705

 Score =   149 bits (377),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 95/265 (36%), Positives = 132/265 (50%), Gaps = 61/265 (23%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F   +PVYH+ +D + WM KFGDP FQRH+A + +WGL+ L LADE  LPFNY  YA EL
Sbjct  498  FGTGYPVYHSMYDDFIWMEKFGDPTFQRHVAAASMWGLVALQLADEEFLPFNYLSYAFEL  557

Query  248  LRYTRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER---R  415
             + T+ L   + G G+SL P+F +I EL  AA  I+ E K+L+K +  A     ++   R
Sbjct  558  QKSTKDLENEVSGKGISLIPLFKSIEELAKAAAKIDNEKKELQKAKGWASTWKKDQYKVR  617

Query  416  MLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVL  595
             LNDRLM AER F + +G++GR W                 Y+HL               
Sbjct  618  ELNDRLMMAERAFTDRDGLSGRPW-----------------YKHL---------------  645

Query  596  GSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGA  775
                                     +Y PS   +    +FP I DA+  +  LN  +   
Sbjct  646  -------------------------IYAPSKHNDYGSKYFPAIDDAIEEAMKLNTAKSWH  680

Query  776  IIQHEIWRVARAIQRAAYALKGNLT  850
             +QHE+WRV+RA++ A+  L G LT
Sbjct  681  TVQHEVWRVSRAVRHASLVLNGKLT  705



>ref|XP_006475591.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Citrus 
sinensis]
Length=705

 Score =   149 bits (377),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 95/265 (36%), Positives = 132/265 (50%), Gaps = 61/265 (23%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F   +PVYH+ +D + WM KFGDP FQRH+A + +WGL+ L LADE  LPFNY  YA EL
Sbjct  498  FGTGYPVYHSMYDDFIWMEKFGDPTFQRHVAAASMWGLVALQLADEEFLPFNYLSYAFEL  557

Query  248  LRYTRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER---R  415
             + T+ L   + G G+SL P+F +I EL  AA  I+ E K+L+K +  A     ++   R
Sbjct  558  QKSTKDLENEVSGKGISLIPLFKSIEELAKAAAKIDNEKKELQKAKGWASTWKKDQYKVR  617

Query  416  MLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVL  595
             LNDRLM AER F + +G++GR W                 Y+HL               
Sbjct  618  ELNDRLMMAERAFTDRDGLSGRPW-----------------YKHL---------------  645

Query  596  GSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGA  775
                                     +Y PS   +    +FP I DA+  +  LN  +   
Sbjct  646  -------------------------IYAPSKHNDYGSKYFPAIDDAIEEAMKLNTAKSWH  680

Query  776  IIQHEIWRVARAIQRAAYALKGNLT  850
             +QHE+WRV+RA++ A+  L G LT
Sbjct  681  TVQHEVWRVSRAVRHASLVLNGKLT  705



>ref|XP_006646308.1| PREDICTED: probable glutamate carboxypeptidase 2-like, partial 
[Oryza brachyantha]
Length=500

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/260 (37%), Positives = 128/260 (49%), Gaps = 60/260 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP F+RH A + +WG++ L LADE +LPFNY  Y  EL  YT
Sbjct  298  YPVYHSLYDDFVWMEKFGDPGFRRHAAAASIWGMMALRLADEQILPFNYMSYPIELEAYT  357

Query  260  RSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLNDR  430
            + +   L G  +S  P+ +AIR L  AA  +  E K+L++     +L    L+ R LNDR
Sbjct  358  KVVENELRGTAISCSPLHNAIRALKTAAIKVNGERKELQRQLLSNQLSKDSLKIRDLNDR  417

Query  431  LMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVK  610
            LM AER F N EG                  F   W++HL                    
Sbjct  418  LMQAERAFTNREG-----------------LFKQEWFKHL--------------------  440

Query  611  VIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHE  790
                                VYGPS   + E   FPG+ +A++ +   N TE    +QHE
Sbjct  441  --------------------VYGPSEQNDWESASFPGVGNAIASARRDNTTESWKFVQHE  480

Query  791  IWRVARAIQRAAYALKGNLT  850
            I+RVARAI +A+  L GNLT
Sbjct  481  IYRVARAITQASVVLTGNLT  500



>ref|NP_001146679.1| uncharacterized protein LOC100280279 [Zea mays]
 gb|ACL54512.1| unknown [Zea mays]
 tpg|DAA57716.1| TPA: hypothetical protein ZEAMMB73_602143 [Zea mays]
Length=343

 Score =   143 bits (360),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 85/260 (33%), Positives = 127/260 (49%), Gaps = 60/260 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D Y WM KFGDP F+RH+A + +WG++ L LA+E +LPFNY  YA EL  YT
Sbjct  141  YPVYHSLYDDYVWMAKFGDPAFRRHVAAASIWGMMALRLANEDILPFNYMSYAIELEAYT  200

Query  260  RSLSGVLEGG-VSLDPIFDAIREL--TaaakaieeeakkLRKDETMAELLILERRMLNDR  430
            +++   ++G  V+  P++++IR L   A     E++  +            L+ R LNDR
Sbjct  201  KTVENEVKGTTVTCSPLYNSIRTLGAAATKVNNEQKELQKLLLSKQLNKDSLKIRQLNDR  260

Query  431  LMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVK  610
            LM  ER F + EG+                 F L W++HL                    
Sbjct  261  LMQTERAFTSREGI-----------------FKLEWFKHL--------------------  283

Query  611  VIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHE  790
                                VYGPS   + +   +PGI +A++ +   N +E    +QHE
Sbjct  284  --------------------VYGPSDQNDWDTAVYPGIANAIASARSSNTSESWKFVQHE  323

Query  791  IWRVARAIQRAAYALKGNLT  850
            I+RVARA+ +A+  L G LT
Sbjct  324  IYRVARAVTQASAILSGRLT  343



>ref|XP_009591681.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Nicotiana 
tomentosiformis]
Length=695

 Score =   147 bits (370),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 130/258 (50%), Gaps = 63/258 (24%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP F RH+AV+ VWGLL L LAD+ VLPFNY  YA EL +  
Sbjct  500  YPVYHSMYDDFVWMKKFGDPMFHRHVAVASVWGLLALRLADDEVLPFNYLTYAYELQKSA  559

Query  260  RSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
              L   + E G+SL P++ +I +L  AA  IE++ K L+   + A +     R LNDRL+
Sbjct  560  EQLEAEISENGISLVPLYASIEKLRKAAIKIEDDVKALKAKRSWASV-----RELNDRLI  614

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
              ER F + +G++ R W                 Y+HL                      
Sbjct  615  MTERAFTDKDGLSSRTW-----------------YKHL----------------------  635

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              +Y PS   +   + FPGI DA+ R+  L++T+    +QHE+W
Sbjct  636  ------------------IYAPSRHDDYGSNSFPGISDAIERAKSLDSTDSWRSVQHEVW  677

Query  797  RVARAIQRAAYALKGNLT  850
            RVARAI +A+  L G LT
Sbjct  678  RVARAITQASLVLSGRLT  695



>emb|CDP03245.1| unnamed protein product [Coffea canephora]
Length=704

 Score =   147 bits (370),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 95/262 (36%), Positives = 128/262 (49%), Gaps = 61/262 (23%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            D+PVYH+ +D + WM KFGDP F RH+AV+ +WGLL L LADE  LPF+Y  YA EL R 
Sbjct  500  DYPVYHSMYDDFIWMKKFGDPKFHRHVAVTSIWGLLALQLADEEFLPFDYLSYANELQRS  559

Query  257  TRSLSGVL-EGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER---RMLN  424
               L   L E G+ L P+F++I+EL  AA  I  E K L+     A +   +    R LN
Sbjct  560  VEELKIELSEKGIKLFPLFNSIKELRMAATKIANEIKVLQDRNVWASVSKNDHYKVRELN  619

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AER F + EG+ GR W                 Y+HL                  
Sbjct  620  DRLMMAERSFTDREGLPGRTW-----------------YKHL------------------  644

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  ++ PS   +    +FPGI DA+ ++  +N T+    +Q
Sbjct  645  ----------------------IFAPSKHNDYGSKYFPGIDDAIEKAKSINTTDLWLAVQ  682

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HE+WRV+R I+ A+  L G LT
Sbjct  683  HEVWRVSRVIKHASLVLSGQLT  704



>ref|XP_002458463.1| hypothetical protein SORBIDRAFT_03g034150 [Sorghum bicolor]
 gb|EES03583.1| hypothetical protein SORBIDRAFT_03g034150 [Sorghum bicolor]
Length=728

 Score =   147 bits (370),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 90/260 (35%), Positives = 133/260 (51%), Gaps = 60/260 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D Y WM KFGDP F+RH+A + +WG++ L LA+E +LPFNY  YA EL  YT
Sbjct  526  YPVYHSLYDDYVWMAKFGDPGFRRHVAAASIWGMMALRLANEEILPFNYMSYAIELEEYT  585

Query  260  RSLSGVLEGG-VSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLNDR  430
            +++   ++G  V+  P++++IR L AAA  +  E K+L+K     +L    L  R LNDR
Sbjct  586  KTVENEVKGTTVTCSPLYNSIRTLRAAATKVNNEQKELQKQLLSKQLNKDSLRIRQLNDR  645

Query  431  LMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVK  610
            LM  ER F + EG+                 F L W++HL                    
Sbjct  646  LMQTERAFTSREGI-----------------FKLEWFKHL--------------------  668

Query  611  VIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHE  790
                                VYGPS   + +   +PGI +A++ +   N +E    +QHE
Sbjct  669  --------------------VYGPSDQNDWDTAVYPGIANAIASARSSNTSESWKFVQHE  708

Query  791  IWRVARAIQRAAYALKGNLT  850
            ++RVARA+ +A+  L G LT
Sbjct  709  VYRVARAVTQASAILSGRLT  728



>gb|EEC71454.1| hypothetical protein OsI_03680 [Oryza sativa Indica Group]
Length=543

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/261 (34%), Positives = 129/261 (49%), Gaps = 60/261 (23%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            D+PVYH+ +D Y WM +FGDP F RH+A++ VWGL+ L LAD+ +LP NY  YA+EL + 
Sbjct  340  DYPVYHSLYDDYVWMERFGDPLFHRHVALASVWGLIALRLADDEILPLNYVSYASELEKC  399

Query  257  TRSLSGVLEGG-VSLDPIFDAIRELTaaakaieeeakkLRKD--ETMAELLILERRMLND  427
            T+ + G   G  VS  P+  +I +L  AA  I +E   L+ +          ++ R +ND
Sbjct  400  TKLVEGGCTGCPVSFAPLHKSIDQLRKAANKIHKEKMMLQAENWSLKTRAYTVKVRDIND  459

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM AERGF+N EG++GR W                 Y+H+                   
Sbjct  460  RLMMAERGFINREGLDGRPW-----------------YKHM-------------------  483

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +Y  S   +     FPGIV A+ ++  LN TE   ++QH
Sbjct  484  ---------------------IYASSDQDDWGTKAFPGIVSAIDKANKLNTTESWQLLQH  522

Query  788  EIWRVARAIQRAAYALKGNLT  850
            EI+R ARA+ +A+  L G LT
Sbjct  523  EIYRAARAVSKASAVLDGRLT  543



>ref|XP_006644681.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Oryza 
brachyantha]
Length=716

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/260 (36%), Positives = 128/260 (49%), Gaps = 60/260 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYHT +D + WM  FGDP F+RH A + +WG++ L LADE +LPFNY  Y  EL  YT
Sbjct  514  YPVYHTLYDDFVWMENFGDPGFRRHAAAASIWGMMALSLADEEILPFNYMSYTIELEAYT  573

Query  260  RSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLNDR  430
            + +   + G  +S  P+ +AIR L  AA  +  E K+L++     +L+   L+ R LNDR
Sbjct  574  KLVENEVRGTAISCSPLHNAIRALKTAATKVNGERKELQRQLLSNQLIKDSLKTRSLNDR  633

Query  431  LMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVK  610
            LM AER F + EG                  F   W++HL                    
Sbjct  634  LMQAERAFTSREG-----------------LFKQEWFKHL--------------------  656

Query  611  VIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHE  790
                                VYGPS   + E   FPG+ +A++ +   N TE    +QHE
Sbjct  657  --------------------VYGPSEQNDWESASFPGVGNAIASARRDNTTESWKFVQHE  696

Query  791  IWRVARAIQRAAYALKGNLT  850
            I+RVARAI +A+  L GNLT
Sbjct  697  IYRVARAITQASVVLTGNLT  716



>ref|XP_004969898.1| PREDICTED: probable glutamate carboxypeptidase 2-like isoform 
X1 [Setaria italica]
Length=734

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/260 (35%), Positives = 130/260 (50%), Gaps = 60/260 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D Y WM KFGDP F+RH+A + +WG++ L LAD+ ++PFNY  YA EL  YT
Sbjct  532  YPVYHSLYDDYVWMAKFGDPGFRRHVAAASIWGMMALRLADDEIIPFNYMSYAIELQAYT  591

Query  260  RSLSGVLEGG-VSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLNDR  430
            + L   ++G  V+  P++++IR L  AA  +  E K+L+K     +L    L+ R LNDR
Sbjct  592  KVLENKVKGTDVTCSPLYNSIRALKTAATTVNNEQKELQKQLLSKQLNKDALKIRQLNDR  651

Query  431  LMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVK  610
            LM AER F + EG+                 F   W +HL                    
Sbjct  652  LMQAERAFTSREGI-----------------FKQEWCKHL--------------------  674

Query  611  VIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHE  790
                                VYGPS   + +   +PGI +A+  +   N +E    +QHE
Sbjct  675  --------------------VYGPSDQNDWDTAVYPGIANAIGSARSSNTSESWKSVQHE  714

Query  791  IWRVARAIQRAAYALKGNLT  850
            I+RVARA+ +A+  L G LT
Sbjct  715  IYRVARAVTQASAVLSGRLT  734



>ref|XP_006853725.1| hypothetical protein AMTR_s00056p00162910 [Amborella trichopoda]
 gb|ERN15192.1| hypothetical protein AMTR_s00056p00162910 [Amborella trichopoda]
Length=704

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 131/261 (50%), Gaps = 61/261 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            FPVYH+ +D + WM KFGDP FQRH+AV  +WGL+ L LADE  LPFNY  YA+EL   T
Sbjct  501  FPVYHSLYDDFVWMKKFGDPSFQRHVAVGSIWGLVALRLADEEFLPFNYSAYASELHSNT  560

Query  260  RSL-SGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL---ILERRMLND  427
            ++L +  L+  +S  P++++I+EL  AA  I +E K L +D   +       L  R LND
Sbjct  561  KALETPGLDKSLSFSPLYNSIKELEKAASKIMKERKALEEDGWASRFRKENALLVRDLND  620

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM AER F + +G+ GR W                 ++HL                   
Sbjct  621  RLMMAERAFADPDGLFGRPW-----------------HKHL-------------------  644

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 VYGPS   +     FPG+ DA+  +   N TE  A +QH
Sbjct  645  ---------------------VYGPSNHDQYGSRSFPGVEDAIVEARRSNTTESWAFVQH  683

Query  788  EIWRVARAIQRAAYALKGNLT  850
            +IWRV+R + +A+  L+G+ T
Sbjct  684  QIWRVSRVVSQASLVLRGDFT  704



>ref|XP_006646309.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Oryza 
brachyantha]
Length=768

 Score =   146 bits (368),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/264 (34%), Positives = 130/264 (49%), Gaps = 60/264 (23%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
             + D+PVYH+ +D Y WM +FGDP F RH+A++ VWGL+ L LAD+ +LPFNY+ YA+EL
Sbjct  562  IMEDYPVYHSLYDDYVWMERFGDPLFHRHVALASVWGLIALRLADDEILPFNYDSYASEL  621

Query  248  LRYTRSLSGVLEGG-VSLDPIFDAIRELTaaakaieeeakkLRKDE--TMAELLILERRM  418
             + T+ + G   G  VS  P+  +I +L  AA  I +E   L+ D          ++ R 
Sbjct  622  EKCTKVVEGGCPGCPVSFAPLHKSINQLRKAANKIHKEKMMLQADNWRLKTRDYTVKVRD  681

Query  419  LNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLG  598
            +NDRLM AER F+N EG++GR W                 Y+H+                
Sbjct  682  INDRLMMAERAFINREGLDGRPW-----------------YKHM----------------  708

Query  599  SSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAI  778
                                    +Y  S   +     FPGIV A+ ++  LN  E   +
Sbjct  709  ------------------------IYASSDQDDWGTKAFPGIVSAIDKANKLNTAESWQL  744

Query  779  IQHEIWRVARAIQRAAYALKGNLT  850
            +QHEI+R ARA+ +A+  L G LT
Sbjct  745  LQHEIYRAARAVSKASAVLDGRLT  768



>ref|NP_001120724.1| viviparous8 [Zea mays]
 gb|ACA62934.1| putative membrane localized peptidase [Zea mays]
Length=713

 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 99/283 (35%), Positives = 150/283 (53%), Gaps = 67/283 (24%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I S+ LY          +  +FP YHTA D+Y+WM K GDPFF RH+A++ +WGL
Sbjct  485  LHHAGIPSVDLY----------YGEEFPGYHTALDTYNWMEKHGDPFFLRHLAITEIWGL  534

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            L L LA++ VLPF+Y+ Y ++L  + ++LS +   G +++ +   + +L+ AA  + +E 
Sbjct  535  LALRLANDPVLPFDYQAYTSQLQEHIKTLSALTSNGHAVNLMNGCVNDLSGAAMEVLKEM  594

Query  362  kkLRKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWY  541
            KKL++ +   E   + RR+LNDRL+ AER FL  EG+ GR W                 +
Sbjct  595  KKLQQMDLYDEHARMRRRLLNDRLLLAERSFLQPEGLQGRGW-----------------F  637

Query  542  QHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPG  721
            +HL                                        +Y P    E++L FFPG
Sbjct  638  KHL----------------------------------------LYSPPEDYESKLSFFPG  657

Query  722  IVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
            I DA+SRS +L++ E+   +QHE+W+V RAIQRAA  L+G  +
Sbjct  658  IADAISRSANLSDKEQEVAMQHEVWKVCRAIQRAASVLRGEFS  700



>tpg|DAA51821.1| TPA: viviparous8 [Zea mays]
Length=713

 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 99/283 (35%), Positives = 150/283 (53%), Gaps = 67/283 (24%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I S+ LY          +  +FP YHTA D+Y+WM K GDPFF RH+A++ +WGL
Sbjct  485  LHHAGIPSVDLY----------YGEEFPGYHTALDTYNWMEKHGDPFFLRHLAITEIWGL  534

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            L L LA++ VLPF+Y+ Y ++L  + ++LS +   G +++ +   + +L+ AA  + +E 
Sbjct  535  LALRLANDPVLPFDYQAYTSQLQEHIKTLSALTSNGHAVNLMNGCVNDLSGAAMEVLKEM  594

Query  362  kkLRKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWY  541
            KKL++ +   E   + RR+LNDRL+ AER FL  EG+ GR W                 +
Sbjct  595  KKLQQMDLYDEHARMRRRLLNDRLLLAERSFLQPEGLQGRGW-----------------F  637

Query  542  QHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPG  721
            +HL                                        +Y P    E++L FFPG
Sbjct  638  KHL----------------------------------------LYSPPEDYESKLSFFPG  657

Query  722  IVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
            I DA+SRS +L++ E+   +QHE+W+V RAIQRAA  L+G  +
Sbjct  658  IADAISRSANLSDKEQEVAMQHEVWKVCRAIQRAASVLRGEFS  700



>tpg|DAA57714.1| TPA: hypothetical protein ZEAMMB73_602143 [Zea mays]
Length=464

 Score =   142 bits (357),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 134/260 (52%), Gaps = 60/260 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D Y WM KFGDP F+RH+A + +WG++ L LA+E +LPFNY  YA EL  YT
Sbjct  262  YPVYHSLYDDYVWMAKFGDPAFRRHVAAASIWGMMALRLANEDILPFNYMSYAIELEAYT  321

Query  260  RSLSGVLEGG-VSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLNDR  430
            +++   ++G  V+  P++++IR L AAA  +  E K+L+K     +L    L+ R LNDR
Sbjct  322  KTVENEVKGTTVTCSPLYNSIRTLGAAATKVNNEQKELQKLLLSKQLNKDSLKIRQLNDR  381

Query  431  LMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVK  610
            LM  ER F + EG+                 F L W++HL                    
Sbjct  382  LMQTERAFTSREGI-----------------FKLEWFKHL--------------------  404

Query  611  VIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHE  790
                                VYGPS   + +   +PGI +A++ +   N +E    +QHE
Sbjct  405  --------------------VYGPSDQNDWDTAVYPGIANAIASARSSNTSESWKFVQHE  444

Query  791  IWRVARAIQRAAYALKGNLT  850
            I+RVARA+ +A+  L G LT
Sbjct  445  IYRVARAVTQASAILSGRLT  464



>gb|KDO66599.1| hypothetical protein CISIN_1g005260mg [Citrus sinensis]
Length=701

 Score =   143 bits (361),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 93/265 (35%), Positives = 129/265 (49%), Gaps = 65/265 (25%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F   +PVYH+ +D + WM KFGDP FQRH+A + +WGL+ L LADE  LPFNY  YA EL
Sbjct  498  FGTGYPVYHSMYDDFIWMEKFGDPTFQRHVAAASMWGLVALQLADEEFLPFNYLSYAFEL  557

Query  248  LRYTRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER---R  415
             + T+ L   + G G+SL P+F +I EL  AA  I+ E    +K +  A     ++   R
Sbjct  558  QKSTKDLENEVSGKGISLIPLFKSIEELAKAAAKIDNE----KKAKGWASTWKKDQYKVR  613

Query  416  MLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVL  595
             LNDRLM AER F + +G++GR W                 Y+HL               
Sbjct  614  ELNDRLMMAERAFTDRDGLSGRPW-----------------YKHL---------------  641

Query  596  GSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGA  775
                                     +Y PS   +    +FP I DA+  +  LN  +   
Sbjct  642  -------------------------IYAPSKHNDYGSKYFPAIDDAIEEAMKLNTAKSWH  676

Query  776  IIQHEIWRVARAIQRAAYALKGNLT  850
             +QHE+WRV+RA++ A+  L G LT
Sbjct  677  TVQHEVWRVSRAVRHASLVLNGKLT  701



>ref|XP_008804069.1| PREDICTED: probable glutamate carboxypeptidase 2 [Phoenix dactylifera]
Length=342

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 95/278 (34%), Positives = 129/278 (46%), Gaps = 75/278 (27%)
 Frame = +2

Query  47   QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNY  226
             N G T  L  +PVYH+ +D + WM KFGDP F RH+A + +WGL+ L LADE  LPFNY
Sbjct  130  SNGGLTS-LSGYPVYHSMYDDFVWMGKFGDPMFHRHVAAASIWGLVALRLADEEFLPFNY  188

Query  227  EPYAAELLRYTRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkL---------RK  376
              YA+EL R  + L     G  V+  P++ +I++L  AA  I  + K L         RK
Sbjct  189  ISYASELQRSAKILEDDALGLPVTFAPLYKSIKKLKKAATEIHNQRKALERNFLSLNWRK  248

Query  377  DETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK  556
            D        L+ R LNDRLM AER F + +G+ GR W                 Y+HL  
Sbjct  249  DP-------LKVRELNDRLMMAERAFTDRDGLFGRVW-----------------YKHL--  282

Query  557  *N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAV  736
                                                  +YGPS   +     +PGI DA+
Sbjct  283  --------------------------------------IYGPSMQDDYGSKSYPGIDDAI  304

Query  737  SRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
             ++   N +E  + +QHE+WR ARA+ +AA  L G  T
Sbjct  305  EKAKSSNTSESCSFVQHEVWRAARAVTQAALVLNGKFT  342



>gb|EEC71453.1| hypothetical protein OsI_03679 [Oryza sativa Indica Group]
Length=733

 Score =   142 bits (359),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/260 (35%), Positives = 127/260 (49%), Gaps = 60/260 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +P+YH+ +D + WM KFGDP F RH A + +WG++ L LADE +LPFNY  Y  EL  YT
Sbjct  531  YPIYHSLYDDFVWMEKFGDPGFSRHAAAASIWGMMALRLADEEILPFNYMSYPVELEAYT  590

Query  260  RSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLNDR  430
            + +   + G  +S  P+ +AIR L  AA  +  E K+L++  +  +L    ++ R LNDR
Sbjct  591  KVVENEVRGTAISCSPLHNAIRTLKTAATKVNGERKELQRQLSSNQLKKDSMKIRSLNDR  650

Query  431  LMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVK  610
            LM AER F N EG                  F   W++HL                    
Sbjct  651  LMQAERAFTNREG-----------------LFKQEWFKHL--------------------  673

Query  611  VIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHE  790
                                VYGPS   + E   +PG+ +A++ +   N TE    +QHE
Sbjct  674  --------------------VYGPSEQNDWESASYPGVENAIASARKENTTESWKFVQHE  713

Query  791  IWRVARAIQRAAYALKGNLT  850
            I RVARAI +A+  L G+LT
Sbjct  714  IHRVARAITQASVVLAGSLT  733



>ref|NP_001044202.2| Os01g0740500 [Oryza sativa Japonica Group]
 dbj|BAF06116.2| Os01g0740500 [Oryza sativa Japonica Group]
Length=713

 Score =   142 bits (358),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/260 (35%), Positives = 127/260 (49%), Gaps = 60/260 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +P+YH+ +D + WM KFGDP F RH A + +WG++ L LADE +LPFNY  Y  EL  YT
Sbjct  511  YPIYHSLYDDFVWMEKFGDPGFSRHAAAASIWGMMALRLADEEILPFNYMSYPVELEAYT  570

Query  260  RSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLNDR  430
            + +   + G  +S  P+ +AIR L  AA  +  E K+L++  +  +L    ++ R LNDR
Sbjct  571  KVVENEVRGTAISCSPLHNAIRALKTAATKVNGERKELQRQLSSNQLKKDSMKIRSLNDR  630

Query  431  LMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVK  610
            LM AER F N EG                  F   W++HL                    
Sbjct  631  LMQAERAFTNREG-----------------LFKREWFKHL--------------------  653

Query  611  VIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHE  790
                                VYGPS   + E   +PG+ +A++ +   N TE    +QHE
Sbjct  654  --------------------VYGPSEQNDWESASYPGVENAIASARKENTTESWKFVQHE  693

Query  791  IWRVARAIQRAAYALKGNLT  850
            I RVARAI +A+  L G+LT
Sbjct  694  IHRVARAITQASVVLAGSLT  713



>tpg|DAA57713.1| TPA: hypothetical protein ZEAMMB73_749382 [Zea mays]
Length=442

 Score =   140 bits (352),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/261 (34%), Positives = 130/261 (50%), Gaps = 60/261 (23%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            ++PVYH+ +D Y W+ +FGDP F RH+AV+ VWGL+ L LAD+ ++PFNY  YA+EL   
Sbjct  239  EYPVYHSLYDDYVWVERFGDPLFHRHVAVASVWGLIALKLADDEIIPFNYVSYASELEEC  298

Query  257  TRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKD--ETMAELLILERRMLND  427
            T+ +    +G  VS  P+ ++I++L +AA  I +E K L+ +          L+ R +ND
Sbjct  299  TKDIVDKCKGFPVSFSPLQNSIKQLESAATKIYKEKKLLQAENWSLKTSKYTLKVREIND  358

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM AER F N EG+ GR W                 Y+H+                   
Sbjct  359  RLMMAERAFTNREGLVGRPW-----------------YKHM-------------------  382

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +Y  S   +     FPGIV A+ ++   N TE   ++QH
Sbjct  383  ---------------------IYASSDQDDWGTKAFPGIVSAMDKAKKSNTTETWRLLQH  421

Query  788  EIWRVARAIQRAAYALKGNLT  850
            EI+RVARA+ +A+  L G LT
Sbjct  422  EIYRVARAVSKASAVLDGKLT  442



>ref|XP_008242478.1| PREDICTED: probable glutamate carboxypeptidase 2 [Prunus mume]
Length=708

 Score =   141 bits (355),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 88/261 (34%), Positives = 130/261 (50%), Gaps = 61/261 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+AV+ +WGL+ L LAD   LPFNY  YA EL R+ 
Sbjct  505  YPVYHSMYDDFIWMQKFGDPMFQRHVAVASLWGLVALWLADAEFLPFNYHSYALELQRHM  564

Query  260  RSLSGVL-EGGVSLDPIFDAIRELTaaakaieeeakkLRKDET---MAELLILERRMLND  427
            + L   L +  ++L P+F +I EL  AA  I  + +++ + ++   + +    + R LND
Sbjct  565  KDLEDELPDKNINLAPLFKSIEELKKAATKINSQREEIEQHKSWQFIGKNDHFKVRELND  624

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM AER F + +G+ GR W                 Y+HL                   
Sbjct  625  RLMMAERAFTDQDGLLGRSW-----------------YKHL-------------------  648

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +YGPS   +     FPGI +A+ ++  L   E   ++QH
Sbjct  649  ---------------------IYGPSKHDDYGSKSFPGIDEAIEKAKSLKTAESWKLVQH  687

Query  788  EIWRVARAIQRAAYALKGNLT  850
            E+WRVARA++ A+  + G LT
Sbjct  688  EVWRVARAVRHASQIINGELT  708



>gb|ACL52515.1| unknown [Zea mays]
 gb|AFW85114.1| hypothetical protein ZEAMMB73_052433 [Zea mays]
Length=384

 Score =   138 bits (347),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 90/261 (34%), Positives = 126/261 (48%), Gaps = 60/261 (23%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            D+PVYH+ +D + WM KFGDP FQRH+A + +WGL+ L L+DE +LPFNY  YA EL   
Sbjct  181  DYPVYHSLYDDFIWMEKFGDPLFQRHVAAASMWGLVALRLSDEEILPFNYSNYATELENG  240

Query  257  TRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLND  427
               +S  ++G  VSL P+  +I+E   A   ++ E K L+  +  +      L+ R +ND
Sbjct  241  ALGISERVQGMPVSLSPLHKSIKEFRKAVAKVDSELKALQTWKIWSPWRNNPLKVRDIND  300

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM  ER F + EG++GR W                 Y+HL                   
Sbjct  301  RLMMTERAFTDREGLSGRPW-----------------YKHL-------------------  324

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +Y PS   +   + +PGI DA+ R    N +E    IQH
Sbjct  325  ---------------------IYAPSLHNDYGAEVYPGIGDAIERVKKTNTSESLQSIQH  363

Query  788  EIWRVARAIQRAAYALKGNLT  850
            EI+RV+R I +AA  L G LT
Sbjct  364  EIYRVSRVINQAALVLSGGLT  384



>ref|XP_002466328.1| hypothetical protein SORBIDRAFT_01g005710 [Sorghum bicolor]
 gb|EER93326.1| hypothetical protein SORBIDRAFT_01g005710 [Sorghum bicolor]
Length=711

 Score =   141 bits (355),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 98/292 (34%), Positives = 153/292 (52%), Gaps = 70/292 (24%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I S+ LY          +  +FP YHTA D+Y+WM K GDP F RH+A++ +WGL
Sbjct  483  LHHAGIPSVDLY----------YGEEFPGYHTALDTYNWMEKHGDPLFLRHLAITEIWGL  532

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            L L LA++ VLPF+Y+ Y ++L  + ++ S + + G +++ +   + +L+ AA  + +E 
Sbjct  533  LALRLANDPVLPFDYQAYTSDLQEHIKTFSALTDNGHAVNLMNGFVNDLSGAAMEVVKEM  592

Query  362  kkLRKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWY  541
            KKL++ +   +   + RR+LNDRL+ AER FL  EG+ GR W                 +
Sbjct  593  KKLQQLDLYDDHARMRRRLLNDRLLLAERSFLQPEGLQGRGW-----------------F  635

Query  542  QHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPG  721
            +HL                                        +Y P    E++  FFPG
Sbjct  636  KHL----------------------------------------LYSPPEDYESKFSFFPG  655

Query  722  IVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT*VPDRQPCS  877
            I DA+SRS +L++ ER   +QHE+W+V RAIQRAA  L+G  +   +R+P +
Sbjct  656  IADAISRSANLSDKEREVAVQHEVWKVCRAIQRAASVLRGEFS---ERKPIN  704



>ref|XP_008672765.1| PREDICTED: uncharacterized protein LOC100280279 isoform X1 [Zea 
mays]
Length=732

 Score =   141 bits (355),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 134/260 (52%), Gaps = 60/260 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D Y WM KFGDP F+RH+A + +WG++ L LA+E +LPFNY  YA EL  YT
Sbjct  530  YPVYHSLYDDYVWMAKFGDPAFRRHVAAASIWGMMALRLANEDILPFNYMSYAIELEAYT  589

Query  260  RSLSGVLEGG-VSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLNDR  430
            +++   ++G  V+  P++++IR L AAA  +  E K+L+K     +L    L+ R LNDR
Sbjct  590  KTVENEVKGTTVTCSPLYNSIRTLGAAATKVNNEQKELQKLLLSKQLNKDSLKIRQLNDR  649

Query  431  LMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVK  610
            LM  ER F + EG+                 F L W++HL                    
Sbjct  650  LMQTERAFTSREGI-----------------FKLEWFKHL--------------------  672

Query  611  VIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHE  790
                                VYGPS   + +   +PGI +A++ +   N +E    +QHE
Sbjct  673  --------------------VYGPSDQNDWDTAVYPGIANAIASARSSNTSESWKFVQHE  712

Query  791  IWRVARAIQRAAYALKGNLT  850
            I+RVARA+ +A+  L G LT
Sbjct  713  IYRVARAVTQASAILSGRLT  732



>ref|XP_010249479.1| PREDICTED: probable glutamate carboxypeptidase 2 [Nelumbo nucifera]
Length=780

 Score =   141 bits (355),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 90/266 (34%), Positives = 129/266 (48%), Gaps = 61/266 (23%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            FF   +PVYH+ +D++ WM KFGDP F RH+AV+ +WGLL L LADE  LPFNY  YA E
Sbjct  572  FFGGAYPVYHSMYDAFVWMEKFGDPMFHRHVAVASIWGLLALKLADEEFLPFNYLSYACE  631

Query  245  LLRYTRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDE---TMAELLILER  412
            L +  + +   + G GV++ P++ +I +L  AA  I+ + K L +     +M +   ++ 
Sbjct  632  LQKSAKEIEDEVSGKGVTVIPLYKSIGKLKKAATKIKSQIKALEESSGWSSMWKKDPIKV  691

Query  413  RMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPV  592
            R LNDRLM AER F + +G+ GR W                 Y+HL              
Sbjct  692  RELNDRLMMAERAFTDKDGLFGRPW-----------------YKHL--------------  720

Query  593  LGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERG  772
                                      +YGPS   +     FPGI DA+ ++  LN  E  
Sbjct  721  --------------------------IYGPSKHDDYGSKSFPGIDDAIEKAKSLNTLEAW  754

Query  773  AIIQHEIWRVARAIQRAAYALKGNLT  850
              +QHE+WR +R +  A+  L G  T
Sbjct  755  RFVQHEVWRASRVVTHASLVLSGEFT  780



>ref|XP_007203613.1| hypothetical protein PRUPE_ppa002244mg [Prunus persica]
 gb|EMJ04812.1| hypothetical protein PRUPE_ppa002244mg [Prunus persica]
Length=696

 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/261 (34%), Positives = 128/261 (49%), Gaps = 61/261 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+AV+ +WGL+ L LAD   LPFNY  YA EL RY 
Sbjct  493  YPVYHSMYDDFIWMQKFGDPMFQRHVAVASLWGLVALWLADAEFLPFNYLSYALELQRYM  552

Query  260  RSLSGVL-EGGVSLDPIFDAIRELTaaakaieeeakkLRKDET---MAELLILERRMLND  427
            + L   L +  ++L P+F +I EL  AA  I    +++ + +    + +    + R LND
Sbjct  553  KDLEDELPDKNINLAPLFKSIEELKKAAMKINSHREEIEQHKGWQFIGKNDHFKVRELND  612

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM AER F + +G+ GR W                 Y+HL                   
Sbjct  613  RLMMAERAFTDQDGLLGRSW-----------------YKHL-------------------  636

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +YGPS   +     FPGI +A+ ++  L   E   ++QH
Sbjct  637  ---------------------IYGPSKHDDYGSKSFPGIDEAIEKAKSLKTAESRKLVQH  675

Query  788  EIWRVARAIQRAAYALKGNLT  850
            E+WRVARA++ A+  + G LT
Sbjct  676  EVWRVARAVRHASQIINGELT  696



>ref|XP_002960093.1| hypothetical protein SELMODRAFT_73556 [Selaginella moellendorffii]
 gb|EFJ37632.1| hypothetical protein SELMODRAFT_73556 [Selaginella moellendorffii]
Length=690

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/257 (34%), Positives = 123/257 (48%), Gaps = 70/257 (27%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +P+YH+ +D Y+WM +FGDP F RH+AVSG+WGLL +HLA +AVL FNY  YA EL    
Sbjct  502  YPMYHSLYDDYNWMERFGDPMFHRHVAVSGIWGLLAIHLASDAVLSFNYANYADELEAGA  561

Query  260  RSLS-GVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
             +L   +L   ++ +P+F AI +L AAA             +  AE++ ++ R LNDR++
Sbjct  562  MALQKNLLSENITANPLFPAISKLRAAAA------------QLGAEMIQMKLRSLNDRML  609

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
             AER FL+  G+    W                 Y+HL                      
Sbjct  610  LAERSFLDPSGLTRTSW-----------------YKHL----------------------  630

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              +YGPS         FPG+ DA++ +  +NN      +QHEIW
Sbjct  631  ------------------IYGPSGKNHYNSQLFPGVCDALAAAMSINNKASWNALQHEIW  672

Query  797  RVARAIQRAAYALKGNL  847
            +VARAI   A+ L G L
Sbjct  673  KVARAITNVAHFLSGEL  689



>dbj|BAK02935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=764

 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/260 (32%), Positives = 129/260 (50%), Gaps = 60/260 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + W+ KF DP F+RH+A + +WG++ L LADE ++PF+Y  Y  EL  YT
Sbjct  562  YPVYHSLYDDFVWVEKFADPGFRRHVAAASIWGIMALRLADEEIIPFDYMSYTTELEAYT  621

Query  260  RSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLNDR  430
            + +    EG  VS  P++++IR L  AA  +  E K ++++ +  +L    +  R LNDR
Sbjct  622  KVVEKETEGTAVSCSPLYNSIRALKKAAAKVNSERKDIQRELSSKQLSKDSMRIRALNDR  681

Query  431  LMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVK  610
            LM AER F N EG+                 F   WY+HL                    
Sbjct  682  LMQAERAFTNREGI-----------------FKQAWYKHL--------------------  704

Query  611  VIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHE  790
                                +YGPS   + +   +PGI DA++ +   N +    ++QHE
Sbjct  705  --------------------IYGPSEQNDWDTASYPGIADAIATARRSNTSASWKLVQHE  744

Query  791  IWRVARAIQRAAYALKGNLT  850
            + RVARA+ +A+  L G+LT
Sbjct  745  VHRVARAVAKASAVLSGSLT  764



>gb|EYU27261.1| hypothetical protein MIMGU_mgv1a002132mg [Erythranthe guttata]
Length=709

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 125/260 (48%), Gaps = 60/260 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+AV+ +WGL+ L LAD+ +LPFNY  YA EL +  
Sbjct  507  YPVYHSMYDDFTWMKKFGDPMFQRHVAVASLWGLVALKLADDELLPFNYHSYALELQKSA  566

Query  260  RSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLI--LERRMLNDR  430
              L    L   V+L P+  +I E   AA  I +E + L + +    +     + R LNDR
Sbjct  567  EELKDRALNKVVTLVPLLKSISEFEKAATKINDEREALIESKGWKSMWKDGHKIRELNDR  626

Query  431  LMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVK  610
            LM AER F + EG++GR W                 Y+HL                    
Sbjct  627  LMMAERAFTDREGLSGRSW-----------------YKHL--------------------  649

Query  611  VIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHE  790
                                +Y PS   +     FPGI DA+ ++  +N TE    +QHE
Sbjct  650  --------------------IYAPSKHDDYGSKSFPGIDDAIEKAKSINTTESWRSVQHE  689

Query  791  IWRVARAIQRAAYALKGNLT  850
            IWRVAR I +A+  L G LT
Sbjct  690  IWRVARVITQASLCLVGKLT  709



>ref|XP_002992244.1| hypothetical protein SELMODRAFT_134963 [Selaginella moellendorffii]
 gb|EFJ06741.1| hypothetical protein SELMODRAFT_134963 [Selaginella moellendorffii]
Length=742

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 128/267 (48%), Gaps = 66/267 (25%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            +F   +PVYH+ +D+YDWM ++GDP F RH+AVS +WGL+ L LAD  VLPFNY  YA +
Sbjct  537  YFGKSYPVYHSLYDNYDWMKRYGDPLFHRHVAVSSIWGLMALRLADCLVLPFNYGSYATQ  596

Query  245  LLRYTRSLSGVLEGG-----VSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILE  409
               Y  ++   L        V+  P+  ++      AK    ++KKL ++ +    L+L 
Sbjct  597  AQVYGNAVEDALRAAKAPHNVTASPLRTSLASFVEGAKQAGHDSKKLEREIS----LLLP  652

Query  410  RRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGP  589
            RR LNDRLM AER FL   G+ GR W                 ++HL             
Sbjct  653  RRTLNDRLMLAERAFLEEGGIPGRTW-----------------HKHL-------------  682

Query  590  VLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTER  769
                                       +YGPS     + + FP ++DA+  ++   N ++
Sbjct  683  ---------------------------IYGPSKNNGYQSEAFPAVLDAIVEASGSTNPDK  715

Query  770  GAIIQHEIWRVARAIQRAAYALKGNLT  850
               +QH+IWRV+R ++RA   L+G LT
Sbjct  716  WDAVQHQIWRVSRVLERATLVLRGELT  742



>ref|XP_003569769.2| PREDICTED: probable glutamate carboxypeptidase 2 [Brachypodium 
distachyon]
Length=741

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/261 (34%), Positives = 129/261 (49%), Gaps = 60/261 (23%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            ++PVYH+ +D Y WM +FGDP F RH+A++ VWGL+ L LAD+ ++PFNY  Y +EL   
Sbjct  538  EYPVYHSLYDDYVWMERFGDPLFHRHVALASVWGLIALRLADDEIIPFNYVSYTSELEEC  597

Query  257  TRSL-SGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDE--TMAELLILERRMLND  427
            T+ + +G     VS  P+  +I++L  AA  I  E K L+ ++    +    L+ R +ND
Sbjct  598  TKVVEAGCPRCPVSFTPLHKSIKQLEKAATKIHGEKKVLQAEKWGLNSRQRTLKVREIND  657

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM AER F N EG+ GR W                 Y+H+                   
Sbjct  658  RLMMAERAFTNREGLVGRPW-----------------YKHM-------------------  681

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +Y  S   +     FPGIV A++ + HLN TE   ++QH
Sbjct  682  ---------------------IYASSDQDDWGTKAFPGIVSAIANAKHLNTTESWRLLQH  720

Query  788  EIWRVARAIQRAAYALKGNLT  850
            EI+R ARA+ +A+  L G LT
Sbjct  721  EIYRGARAVSKASAVLDGRLT  741



>ref|XP_004304505.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Fragaria 
vesca subsp. vesca]
Length=695

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/262 (34%), Positives = 129/262 (49%), Gaps = 68/262 (26%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F   +PVYH+ +D + WM KFGDP F RH+AV+ +WGL+ L LAD   LPF+Y  YA EL
Sbjct  501  FGKGYPVYHSMYDDFVWMEKFGDPSFHRHVAVASLWGLVALWLADAEFLPFDYTSYALEL  560

Query  248  LRYTRSLS-GVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
             +Y ++L   +L+  ++L P+F +I EL  AA  I  + +K R           + R +N
Sbjct  561  QKYMKNLEVEILDKNINLTPLFKSIEELKEAATIINNQRRKNR----------FKVREVN  610

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AER F + +G+ GR W+KHL+                                  
Sbjct  611  DRLMMAERAFTDQDGLFGRSWYKHLI----------------------------------  636

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                        +G +R     VYG  +        FPGI +A+ ++  L   E    +Q
Sbjct  637  ------------YGPSRN---DVYGSES--------FPGIDEAIVKAKRLKTAESWKFVQ  673

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HE+WRVARA++ AA  + G LT
Sbjct  674  HEVWRVARAVRHAAKVINGELT  695



>ref|XP_002982216.1| hypothetical protein SELMODRAFT_421595 [Selaginella moellendorffii]
 gb|EFJ16884.1| hypothetical protein SELMODRAFT_421595 [Selaginella moellendorffii]
Length=783

 Score =   139 bits (351),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 128/267 (48%), Gaps = 66/267 (25%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            +F   +PVYH+ +D+YDWM ++GDP F RH+AVS +WGL+ L LAD  VLPFNY  YA +
Sbjct  578  YFGKSYPVYHSLYDNYDWMKRYGDPLFHRHVAVSSIWGLMALRLADCLVLPFNYGSYATQ  637

Query  245  LLRYTRSLSGVLEGG-----VSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILE  409
               Y  ++   L        V+  P+  ++      AK    ++KKL ++ +    L+L 
Sbjct  638  AQVYGNAVEDALRAAKAPRNVTASPLRTSLASFVEGAKQAGHDSKKLEREIS----LLLP  693

Query  410  RRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGP  589
            RR LNDRLM AER FL   G+ GR W                 ++HL             
Sbjct  694  RRTLNDRLMLAERAFLEEGGIPGRTW-----------------HKHL-------------  723

Query  590  VLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTER  769
                                       +YGPS     + + FP ++DA+  ++   N ++
Sbjct  724  ---------------------------IYGPSKNNGYQSEAFPAVLDAIVEASGSTNPDK  756

Query  770  GAIIQHEIWRVARAIQRAAYALKGNLT  850
               +QH+IWRV+R ++RA   L+G LT
Sbjct  757  WDAVQHQIWRVSRVLERATLVLRGELT  783



>ref|NP_001147292.1| glutamate carboxypeptidase 2 [Zea mays]
 gb|ACG26627.1| glutamate carboxypeptidase 2 [Zea mays]
 gb|ACN33904.1| unknown [Zea mays]
 tpg|DAA57712.1| TPA: glutamate carboxypeptidase 2 [Zea mays]
Length=738

 Score =   139 bits (350),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/261 (34%), Positives = 130/261 (50%), Gaps = 60/261 (23%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            ++PVYH+ +D Y W+ +FGDP F RH+AV+ VWGL+ L LAD+ ++PFNY  YA+EL   
Sbjct  535  EYPVYHSLYDDYVWVERFGDPLFHRHVAVASVWGLIALKLADDEIIPFNYVSYASELEEC  594

Query  257  TRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKD--ETMAELLILERRMLND  427
            T+ +    +G  VS  P+ ++I++L +AA  I +E K L+ +          L+ R +ND
Sbjct  595  TKDIVDKCKGFPVSFSPLQNSIKQLESAATKIYKEKKLLQAENWSLKTSKYTLKVREIND  654

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM AER F N EG+ GR W                 Y+H+                   
Sbjct  655  RLMMAERAFTNREGLVGRPW-----------------YKHM-------------------  678

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +Y  S   +     FPGIV A+ ++   N TE   ++QH
Sbjct  679  ---------------------IYASSDQDDWGTKAFPGIVSAMDKAKKSNTTETWRLLQH  717

Query  788  EIWRVARAIQRAAYALKGNLT  850
            EI+RVARA+ +A+  L G LT
Sbjct  718  EIYRVARAVSKASAVLDGKLT  738



>gb|KHG30466.1| putative glutamate carboxypeptidase 2 -like protein [Gossypium 
arboreum]
Length=705

 Score =   139 bits (349),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/265 (34%), Positives = 130/265 (49%), Gaps = 61/265 (23%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F   +PVYH+ +D Y W+  FGDP F R++AV+ VWGL+ L LADE  LPFNY  YA EL
Sbjct  498  FGAGYPVYHSMYDDYTWIENFGDPMFHRNVAVASVWGLVALRLADEEFLPFNYHSYALEL  557

Query  248  LRYTRSLSGVL-EGGVSLDPIFDAIRELTaaakaieeeakkLRKDE---TMAELLILERR  415
             +    L   + + G++  P+F +I EL+ AA+ I  + K++++ +   +M     ++ R
Sbjct  558  QKRAEDLENEMSDKGITFSPLFKSIEELSKAARKINYQKKEIKEAKGWTSMWRNDHVKLR  617

Query  416  MLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVL  595
             LNDRLM AER F + +G+  R W                 Y+HL               
Sbjct  618  ELNDRLMMAERAFTDCDGLLRRPW-----------------YKHL---------------  645

Query  596  GSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGA  775
                                     +Y PS   +     FPGI DA+  + +LN  E   
Sbjct  646  -------------------------IYAPSRHNDYGSTSFPGIDDAIENAKNLNTAESWH  680

Query  776  IIQHEIWRVARAIQRAAYALKGNLT  850
            ++QHE+WRVARA++ A+  L G LT
Sbjct  681  VVQHEVWRVARAVKHASLVLDGKLT  705



>ref|XP_004287483.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Fragaria 
vesca subsp. vesca]
Length=550

 Score =   137 bits (344),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/281 (32%), Positives = 132/281 (47%), Gaps = 74/281 (26%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDPFF RH+AV+ +WGL+ L LAD   LPF+Y  YA EL +Y 
Sbjct  338  YPVYHSMYDDFVWMEKFGDPFFHRHVAVASLWGLIALWLADAEFLPFDYTSYALELQKYM  397

Query  260  RSLS-GVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER---RMLND  427
            + L   + +  ++L P+F ++ EL  AA  I  + ++++++     +   +    R LND
Sbjct  398  KDLEIEISDKNINLTPLFKSVEELKKAATLINNQQREIKQNNGWPSIRKKDHFKVRELND  457

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM AER F + +G+ GR W                 Y+HL                   
Sbjct  458  RLMMAERAFTDQDGLFGRSW-----------------YKHL-------------------  481

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 VYGP+   +     FPG+ +A  ++  LN  E    +QH
Sbjct  482  ---------------------VYGPARNDDYGTKSFPGVDEATEKAKRLNTAESWKFVQH  520

Query  788  EIWRVARAIQRAAYALKGNLT*VPDRQPCS*CVVRSYIFRK  910
            E+WRVARA++ AA  +        +  PCS      Y F K
Sbjct  521  EVWRVARAVRHAAIVI--------NDFPCS-----DYCFAK  548



>ref|XP_010049609.1| PREDICTED: probable glutamate carboxypeptidase 2 [Eucalyptus 
grandis]
 gb|KCW82314.1| hypothetical protein EUGRSUZ_C03720 [Eucalyptus grandis]
Length=707

 Score =   138 bits (348),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 129/266 (48%), Gaps = 61/266 (23%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            FF   +PVYH+ +D + WM K+GDP F RH+AV+ +WGL+ L LADE  LPF+Y  YA+E
Sbjct  499  FFGGGYPVYHSMYDDFVWMEKYGDPMFHRHLAVASIWGLIALRLADEEFLPFDYLSYASE  558

Query  245  LLRYTRSLSGVL-EGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER---  412
            L    + L   L + G++L P+F AI +   AA  I  + + +++  + + +    R   
Sbjct  559  LQESAKDLEDELSDKGLNLIPLFKAIEDFRGAATKINIDVEAIKESSSWSSIWKEYRMRV  618

Query  413  RMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPV  592
            R LNDRLM AER F + +G+ GR W                 Y+HL              
Sbjct  619  RELNDRLMMAERAFADPDGLFGRSW-----------------YKHL--------------  647

Query  593  LGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERG  772
                                      +YGPS   +     FPGI DA+  +  ++ ++  
Sbjct  648  --------------------------IYGPSKHNDYGSKSFPGIDDAIEEAKKVSTSDSW  681

Query  773  AIIQHEIWRVARAIQRAAYALKGNLT  850
              +QHEIWRV+RA++ A   L G LT
Sbjct  682  HSVQHEIWRVSRAVKHATQVLSGKLT  707



>ref|XP_006353498.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Solanum 
tuberosum]
Length=693

 Score =   138 bits (347),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 85/258 (33%), Positives = 126/258 (49%), Gaps = 63/258 (24%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +P+YH+ +D + WM KFGDP F RH+A + +WGL+ L LAD+ VLPFNY  YA EL +  
Sbjct  498  YPIYHSMYDDFVWMKKFGDPMFHRHVAAASIWGLVALRLADDEVLPFNYLSYAYELQKSA  557

Query  260  RSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
              L   + + G+SL P++ +I +L  AA  I+ + K L+   + A +     R LNDRL+
Sbjct  558  EHLEAEISDKGISLVPLYASIEKLRKAATRIKNDIKALKAKRSRASM-----RELNDRLI  612

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
              ER F + +G++ R W                 Y+HL                      
Sbjct  613  MTERAFTDRDGLSSRTW-----------------YKHL----------------------  633

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              +Y P+   +     FPGI DA+  +  LN+++    +QHE+W
Sbjct  634  ------------------IYAPAKHDDYGSKSFPGISDAIENAKSLNSSDSWHSVQHEVW  675

Query  797  RVARAIQRAAYALKGNLT  850
            RVARAI +A+  L G LT
Sbjct  676  RVARAITQASLVLSGRLT  693



>ref|XP_008776572.1| PREDICTED: probable glutamate carboxypeptidase 2, partial [Phoenix 
dactylifera]
Length=668

 Score =   138 bits (347),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 93/267 (35%), Positives = 127/267 (48%), Gaps = 74/267 (28%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP F RH+AV+  WGL+ L LADE  LPFNY  YA+EL R  
Sbjct  466  YPVYHSMYDDFVWMEKFGDPMFHRHVAVASFWGLVALRLADEEFLPFNYISYASELQRSA  525

Query  260  RSL-SGVLEGGVSLDPIFDAIRELTaaakaieeeakkL---------RKDETMAELLILE  409
            + L    L   V+  P++ +I+EL  AA  I+ + K L         RKD        L+
Sbjct  526  KILEDDALGMPVTFAPLYKSIKELKKAATEIDNQRKALERNFLSLNWRKDP-------LK  578

Query  410  RRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGP  589
             R LNDRLM AER F + +G+ GR+W                 Y+HL             
Sbjct  579  VRELNDRLMMAERAFTDRDGLFGREW-----------------YKHL-------------  608

Query  590  VLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTER  769
                                       +YGPST        +PGI DA+ ++   N ++ 
Sbjct  609  ---------------------------IYGPSTHDSYGSKSYPGIDDAIEKAKSSNTSDS  641

Query  770  GAIIQHEIWRVARAIQRAAYALKGNLT  850
             + +QHE+WR ARA+ +AA  L G  T
Sbjct  642  WSFVQHEVWRAARAVTQAALVLNGKFT  668



>ref|XP_001774966.1| predicted protein [Physcomitrella patens]
 gb|EDQ60232.1| predicted protein [Physcomitrella patens]
Length=675

 Score =   137 bits (346),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 98/152 (64%), Gaps = 6/152 (4%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            FF  D+PVYH+ FD+Y+WM KFGDP F RH+AV+ VWGLL L LAD+ +LP  YE YA E
Sbjct  461  FFAADYPVYHSTFDNYNWMTKFGDPLFHRHVAVTSVWGLLALRLADDEILPMKYEAYAKE  520

Query  245  LLRY-----TRSLSGVLEGGVSLDPIFDAIRELTaaaka-ieeeakkLRKDETMAELLIL  406
            L  Y     +  LS      VS+ P+F +I+ L A+     +E  + ++    ++  ++ 
Sbjct  521  LHSYALEINSEFLSSNAPESVSIAPLFSSIKGLQASTHQLAQEVEEGMQMQSGLSSGILY  580

Query  407  ERRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
             RR LNDRL+ AER FL+++G++G  W+KHLV
Sbjct  581  RRRGLNDRLLRAERAFLDSDGLSGASWYKHLV  612



>gb|KEH27221.1| peptidase M28 family protein [Medicago truncatula]
Length=704

 Score =   137 bits (346),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 91/261 (35%), Positives = 126/261 (48%), Gaps = 61/261 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+A + VWGL+ L LADE  LPFNY  YA EL    
Sbjct  501  YPVYHSQYDDFVWMTKFGDPVFQRHVAAASVWGLVALWLADEEFLPFNYSSYAKELQLSM  560

Query  260  RSLSGVL--EGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLI--LERRMLND  427
             SL   +  E  ++L P++ +I+EL  AA  I E+ K++   +      +  L+ R LND
Sbjct  561  ESLKNEISNEDIINLSPMYKSIKELEKAATKINEQIKEIEASKGWKTWKMDHLKVRELND  620

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM AER F + +G+ G                 + WY+HL                   
Sbjct  621  RLMMAERAFTDRDGLLG-----------------IPWYKHL-------------------  644

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +YGPS         FPGI DA   +  L++ E  + +QH
Sbjct  645  ---------------------IYGPSKHNNYGSQSFPGIYDAAKMARSLHSAESWSQVQH  683

Query  788  EIWRVARAIQRAAYALKGNLT  850
            E+WRV+R I+ A+  L G LT
Sbjct  684  EVWRVSRVIKHASLVLSGQLT  704



>ref|XP_002309233.2| hypothetical protein POPTR_0006s15820g [Populus trichocarpa]
 gb|EEE92756.2| hypothetical protein POPTR_0006s15820g [Populus trichocarpa]
Length=728

 Score =   137 bits (346),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 128/261 (49%), Gaps = 61/261 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP F+RH+AV+ VWGL  L LADE  LPF+Y  YA EL +  
Sbjct  525  YPVYHSMYDDFVWMEKFGDPMFRRHIAVASVWGLTALQLADEEFLPFDYLSYAYELQKNA  584

Query  260  RSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER---RMLND  427
            + L   + + G+ L P+F++I+ L  AA  I +E K + ++   A     ++   R +ND
Sbjct  585  KDLEDEISDKGIRLAPLFESIKRLRDAATKINQERKAIEENRVWAWKFKKDQVKVREIND  644

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM AER F + EG++GR W                 Y+HL                   
Sbjct  645  RLMMAERAFTDAEGLSGRSW-----------------YKHL-------------------  668

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +Y PS   +    +FPGI DA+  +  L+  E    +QH
Sbjct  669  ---------------------IYAPSKHDDYGSSYFPGIDDAIEEARSLSTPEAWRSVQH  707

Query  788  EIWRVARAIQRAAYALKGNLT  850
            ++WRV+RA++  +  L G LT
Sbjct  708  QVWRVSRAVRHVSQVLTGELT  728



>ref|XP_003559345.1| PREDICTED: probable glutamate carboxypeptidase 2 [Brachypodium 
distachyon]
Length=717

 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 101/283 (36%), Positives = 146/283 (52%), Gaps = 67/283 (24%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I  + LY          +  +FP YHTA DSY WM K GDP F RH+A++ +WGL
Sbjct  488  LHHAGIPCVDLY----------YGKEFPGYHTALDSYVWMEKHGDPLFHRHLAIAEIWGL  537

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            L L LAD+ VL F+Y+ YA++L  +   L  V+    S++ I  AI  L+ AA  +++EA
Sbjct  538  LALRLADDPVLSFDYQTYASQLQEHANVLVAVMNNNQSVNFINGAIDALSGAATEVQKEA  597

Query  362  kkLRKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWY  541
            K+L++ +T     ++ RR+LNDRL+ AER FL  EG+ GR W                 +
Sbjct  598  KELKQLDTRDGHALMRRRLLNDRLLLAERSFLQAEGLQGRAW-----------------F  640

Query  542  QHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPG  721
            +HL                                        +Y P    E+EL FFPG
Sbjct  641  KHL----------------------------------------LYSPPEDYESELSFFPG  660

Query  722  IVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
            I DA+SRS + +  ++ A ++HE+WRV+ AIQRAA  L+G  +
Sbjct  661  IADAISRSRNQSAKQQQAAVRHEMWRVSMAIQRAAGVLRGGFS  703



>gb|AFW85116.1| hypothetical protein ZEAMMB73_052433 [Zea mays]
Length=725

 Score =   137 bits (346),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/261 (34%), Positives = 126/261 (48%), Gaps = 60/261 (23%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            D+PVYH+ +D + WM KFGDP FQRH+A + +WGL+ L L+DE +LPFNY  YA EL   
Sbjct  522  DYPVYHSLYDDFIWMEKFGDPLFQRHVAAASMWGLVALRLSDEEILPFNYSNYATELENG  581

Query  257  TRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLND  427
               +S  ++G  VSL P+  +I+E   A   ++ E K L+  +  +      L+ R +ND
Sbjct  582  ALGISERVQGMPVSLSPLHKSIKEFRKAVAKVDSELKALQTWKIWSPWRNNPLKVRDIND  641

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM  ER F + EG++GR W                 Y+HL                   
Sbjct  642  RLMMTERAFTDREGLSGRPW-----------------YKHL-------------------  665

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +Y PS   +   + +PGI DA+ R    N +E    IQH
Sbjct  666  ---------------------IYAPSLHNDYGAEVYPGIGDAIERVKKTNTSESLQSIQH  704

Query  788  EIWRVARAIQRAAYALKGNLT  850
            EI+RV+R I +AA  L G LT
Sbjct  705  EIYRVSRVINQAALVLSGGLT  725



>emb|CDY42292.1| BnaC02g08980D [Brassica napus]
Length=676

 Score =   137 bits (344),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/257 (35%), Positives = 125/257 (49%), Gaps = 66/257 (26%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+A++ V GL+ L LADE VLPFNY  YA EL++  
Sbjct  484  YPVYHSMYDDFTWMEKFGDPMFQRHVAMASVLGLVALRLADEEVLPFNYVSYATELMKSA  543

Query  260  RSL-SGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
              L    L  G+ + P+F +I++L  +A+ I  E + ++          L+ R LNDRLM
Sbjct  544  EDLEKDNLGHGIDVSPLFKSIQDLYTSAQGIHIEKEGIKG--------ALKARELNDRLM  595

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
             AER   + +G++GR W                 Y+HL                      
Sbjct  596  MAERALTDRDGLSGRTW-----------------YKHL----------------------  616

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              VYGP+   E   + FPGI DA+  +  +       ++QHEIW
Sbjct  617  ------------------VYGPAKYDEYGSESFPGIDDAIDNAKRVKTKNYWGLVQHEIW  658

Query  797  RVARAIQRAAYALKGNL  847
            RV+RAI  A+  LKG L
Sbjct  659  RVSRAITHASLVLKGVL  675



>gb|ACG29176.1| glutamate carboxypeptidase 2 [Zea mays]
Length=693

 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/261 (34%), Positives = 126/261 (48%), Gaps = 60/261 (23%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            D+PVYH+ +D + WM KFGDP FQRH+A + +WGL+ L L+DE +LPFNY  YA EL   
Sbjct  490  DYPVYHSLYDDFIWMEKFGDPLFQRHVAAASMWGLVALRLSDEEILPFNYSNYATELENG  549

Query  257  TRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLND  427
               +S  ++G  VSL P+  +I+E   A   ++ E K L+  +  +      L+ R +ND
Sbjct  550  ALGISERVQGMPVSLSPLHKSIKEFRKAVAKVDSELKALQTWKIWSPWRNNPLKVRDIND  609

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM  ER F + EG++GR W                 Y+HL                   
Sbjct  610  RLMMTERAFTDREGLSGRPW-----------------YKHL-------------------  633

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +Y PS   +   + +PGI DA+ R    N +E    IQH
Sbjct  634  ---------------------IYAPSLHNDYGAEVYPGIGDAIERVKKTNTSESLQSIQH  672

Query  788  EIWRVARAIQRAAYALKGNLT  850
            EI+RV+R I +AA  L G LT
Sbjct  673  EIYRVSRVINQAALVLSGGLT  693



>ref|XP_009776393.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Nicotiana 
sylvestris]
Length=695

 Score =   137 bits (344),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/258 (34%), Positives = 126/258 (49%), Gaps = 63/258 (24%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP F RH+AV+ VWGLL L LAD+ VLPFNY  YA EL +  
Sbjct  500  YPVYHSMYDDFVWMKKFGDPMFHRHVAVASVWGLLALRLADDEVLPFNYLTYAYELQKSA  559

Query  260  RSLSGVLE-GGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
              L   +   G+ L P++ +I +L  AA  IE++ K L+   +   +     R LNDRL+
Sbjct  560  EQLEAEISVNGIKLVPLYASIEKLRKAAIKIEDDIKALKAKRSWESV-----RELNDRLI  614

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
              ER F + +G++ R W                 Y+HL                      
Sbjct  615  MTERAFTDKDGLSSRTW-----------------YKHL----------------------  635

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              +Y P+   +   + FPG+ DA+ ++  L +T+    +QHE+W
Sbjct  636  ------------------IYAPARHDDYGSNSFPGVSDAIEKAKSLKSTDSWRSVQHEVW  677

Query  797  RVARAIQRAAYALKGNLT  850
            RVARAI +A+  L G LT
Sbjct  678  RVARAITQASLVLSGRLT  695



>ref|XP_008363032.1| PREDICTED: probable glutamate carboxypeptidase 2, partial [Malus 
domestica]
Length=705

 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 92/267 (34%), Positives = 130/267 (49%), Gaps = 65/267 (24%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F   +PVYH+ +D + WM KFGDP FQRH+AV+ +WGL+ L LAD  VLP NY  YA EL
Sbjct  498  FGKGYPVYHSMYDDFIWMQKFGDPLFQRHVAVASLWGLVALWLADAEVLPXNYLSYALEL  557

Query  248  LRYTRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER----  412
              Y + L   L G  V+L P+F +I EL  AA  I  + +++  ++  A L I ++    
Sbjct  558  QSYXKDLEDXLSGKNVNLTPLFKSIEELEKAAXNINSQREEI--EQXKANLXIGKKDXFK  615

Query  413  -RMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGP  589
             R LNDRLM AER F +  G+ GR W                 ++HL             
Sbjct  616  VRELNDRLMMAERAFTDQXGLLGRSW-----------------FKHL-------------  645

Query  590  VLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTER  769
                                       +YGPS   +     FPGI +A+ ++  L   E 
Sbjct  646  ---------------------------IYGPSXHDDYGSVSFPGIGEAIEKAKSLKTAES  678

Query  770  GAIIQHEIWRVARAIQRAAYALKGNLT  850
              I+QHE++RV+RA++ A+  + G LT
Sbjct  679  WKIVQHEVYRVSRAVKHASQIINGELT  705



>ref|XP_009776392.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Nicotiana 
sylvestris]
Length=698

 Score =   137 bits (344),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/258 (34%), Positives = 126/258 (49%), Gaps = 63/258 (24%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP F RH+AV+ VWGLL L LAD+ VLPFNY  YA EL +  
Sbjct  503  YPVYHSMYDDFVWMKKFGDPMFHRHVAVASVWGLLALRLADDEVLPFNYLTYAYELQKSA  562

Query  260  RSLSGVLE-GGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
              L   +   G+ L P++ +I +L  AA  IE++ K L+   +   +     R LNDRL+
Sbjct  563  EQLEAEISVNGIKLVPLYASIEKLRKAAIKIEDDIKALKAKRSWESV-----RELNDRLI  617

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
              ER F + +G++ R W                 Y+HL                      
Sbjct  618  MTERAFTDKDGLSSRTW-----------------YKHL----------------------  638

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              +Y P+   +   + FPG+ DA+ ++  L +T+    +QHE+W
Sbjct  639  ------------------IYAPARHDDYGSNSFPGVSDAIEKAKSLKSTDSWRSVQHEVW  680

Query  797  RVARAIQRAAYALKGNLT  850
            RVARAI +A+  L G LT
Sbjct  681  RVARAITQASLVLSGRLT  698



>emb|CBI27988.3| unnamed protein product [Vitis vinifera]
Length=425

 Score =   134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 127/265 (48%), Gaps = 61/265 (23%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F   +PVYH+ +D + WM KFGDP F RH A + +WGL+ L LADE  LPF+Y  YA EL
Sbjct  218  FGAGYPVYHSMYDDFIWMKKFGDPMFHRHAAAASIWGLVALRLADEEFLPFDYLSYAYEL  277

Query  248  LRYTRSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER---R  415
             +  + L G +   G++L P+F +I +   AA  I  + K++ +++  A +   E    R
Sbjct  278  QKSAKELEGEISNKGINLIPLFKSIEKFKRAATKINHQRKEIEENKGWASIWKKEHLKVR  337

Query  416  MLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVL  595
             LNDRLM AER F + +G+ GR W                 Y+HL               
Sbjct  338  ELNDRLMMAERAFTDRDGLLGRPW-----------------YKHL---------------  365

Query  596  GSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGA  775
                                     +YGP    +     FPGI DA+ ++   +  +  +
Sbjct  366  -------------------------IYGPLKHDDYGSKSFPGIDDAIEKAKSQSTEKSWS  400

Query  776  IIQHEIWRVARAIQRAAYALKGNLT  850
            ++QHE+WRV+RA+  A+  L G LT
Sbjct  401  LVQHEVWRVSRAVIDASLVLNGELT  425



>gb|ABF99278.1| glutamate carboxypeptidase II, putative, expressed [Oryza sativa 
Japonica Group]
Length=248

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/262 (34%), Positives = 136/262 (52%), Gaps = 57/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  +FP YHTA DSY WM K GDP F RH+A+  +WGLL L LAD+ VLPF+Y+ YA++
Sbjct  30   YYGKEFPGYHTALDSYHWMEKHGDPLFLRHVAIVEIWGLLALRLADDPVLPFDYQTYASQ  89

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  +  + S ++E    +  +  +I +L+ A     +EAKKL+         ++ RR+LN
Sbjct  90   LQEHANAFSSMMENSKWVHLLNRSIEDLSDAGLEFLKEAKKLQDQNISDGYSLMRRRLLN  149

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRL+ AER FL  +G+ GR W                 ++HL                  
Sbjct  150  DRLLLAERSFLQADGLQGRGW-----------------FKHL------------------  174

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  +Y P    E++L FFPG+ DA+SRS++ +  E+ A ++
Sbjct  175  ----------------------MYSPPEDYESKLSFFPGVADAISRSSNRSAKEQQAAVR  212

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HE+ +++RAIQRAA  L+G  +
Sbjct  213  HEVRKISRAIQRAADVLRGEFS  234



>emb|CDM84003.1| unnamed protein product [Triticum aestivum]
Length=729

 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/260 (32%), Positives = 127/260 (49%), Gaps = 60/260 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + W+ KF DP F+RH+A + +WG++ L LADE ++PF+Y  Y  EL  YT
Sbjct  527  YPVYHSLYDDFVWVEKFADPGFRRHVAAASIWGIMALRLADEEIIPFDYMSYTTELEAYT  586

Query  260  RSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLNDR  430
            + +    EG  VS  P++++IR L  AA  +  E K + +  +  +L     + R LNDR
Sbjct  587  KVVEKETEGTAVSCSPLYNSIRALKKAATKVNSERKDIERALSSKQLSKDSTKIRGLNDR  646

Query  431  LMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVK  610
            LM AER F N EG+                 F   WY+HL                    
Sbjct  647  LMQAERAFTNREGI-----------------FKQAWYKHL--------------------  669

Query  611  VIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHE  790
                                +YGPS   + +   +PGI DA++ +   N +    ++QHE
Sbjct  670  --------------------IYGPSEQNDWDTASYPGIADAIATARSSNTSASWKLVQHE  709

Query  791  IWRVARAIQRAAYALKGNLT  850
            + RVARA+ +A+  L G+LT
Sbjct  710  VHRVARAVAQASAVLSGSLT  729



>ref|XP_002514209.1| dipeptidase, putative [Ricinus communis]
 gb|EEF48163.1| dipeptidase, putative [Ricinus communis]
Length=648

 Score =   135 bits (340),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 89/269 (33%), Positives = 127/269 (47%), Gaps = 69/269 (26%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+AV+ VWGL+ L LADE  LPFNY  YA EL    
Sbjct  437  YPVYHSMYDDFVWMKKFGDPMFQRHIAVASVWGLVALQLADEEFLPFNYLSYANELQESN  496

Query  260  RSLS---------GVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLI---  403
            +S +          V +  +++DP+F +I ELT AA  I+ E K + + +    +     
Sbjct  497  KSTNRKIAKDLEDEVSDKDINIDPLFKSIEELTNAATQIDSERKAIEESKGWGSIFKKDH  556

Query  404  LERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSI  583
            L  R LNDRL+ AER F + +G++ R+                 W +HL           
Sbjct  557  LRVRELNDRLVIAERAFTDQDGLSRRR-----------------WNKHL-----------  588

Query  584  GPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNT  763
                                         +Y      +     FPGIVDA+ ++  L   
Sbjct  589  -----------------------------IYASLKHNDYRSKSFPGIVDAIEKAKSLKTA  619

Query  764  ERGAIIQHEIWRVARAIQRAAYALKGNLT  850
            E    +QHE+WRV+RA++ A+  L G LT
Sbjct  620  ESWHYVQHEVWRVSRAVRHASLVLSGELT  648



>ref|XP_002984044.1| hypothetical protein SELMODRAFT_119241 [Selaginella moellendorffii]
 gb|EFJ15056.1| hypothetical protein SELMODRAFT_119241 [Selaginella moellendorffii]
Length=704

 Score =   135 bits (341),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 87/260 (33%), Positives = 126/260 (48%), Gaps = 62/260 (24%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +P+YH+ +D Y+WM +FGDP F RH+AVSG+WGLL +HLA +AVL FNY  YA EL    
Sbjct  502  YPMYHSLYDDYNWMERFGDPMFHRHVAVSGIWGLLAIHLAGDAVLSFNYANYADELEVIF  561

Query  260  RSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRK---DETMAELLILER-RMLND  427
             +L    E  ++ +P+F AI +L AAA  +  E  +++     + + +   L + R LND
Sbjct  562  DNLLQASEN-ITANPLFPAISKLRAAAAQLGAEMIQMKIFWLHQVLTDAQTLSKLRSLND  620

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            R++ AER FL+  G+ G  W                 Y+H+                   
Sbjct  621  RMLLAERSFLDPSGLTGTSW-----------------YKHV-------------------  644

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +YGPS         FPG+ DA++ +  +NN      +QH
Sbjct  645  ---------------------IYGPSGKNHYNSQLFPGVCDALAAAMSINNKASWNALQH  683

Query  788  EIWRVARAIQRAAYALKGNL  847
            EIW+VARAI   A+ L G L
Sbjct  684  EIWKVARAITNVAHFLSGEL  703



>ref|XP_011007261.1| PREDICTED: probable glutamate carboxypeptidase 2 [Populus euphratica]
Length=733

 Score =   136 bits (342),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 127/261 (49%), Gaps = 61/261 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQR++AV+ VWGL  L LADE  LPF+Y  YA EL +  
Sbjct  530  YPVYHSMYDDFVWMEKFGDPMFQRNIAVASVWGLTALQLADEEFLPFDYLSYAYELQKNA  589

Query  260  RSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER---RMLND  427
            + L   + + G+ L P+F++I+ L  AA  I +E K + ++   A     ++   R +ND
Sbjct  590  KDLEDEISDKGIRLAPLFESIKRLRDAATKINQERKAIEENRVWAWKFKKDQVKVREIND  649

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM AER F + EG++GR W                 Y+HL                   
Sbjct  650  RLMMAERAFTDAEGLSGRSW-----------------YKHL-------------------  673

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +Y PS   +     FPGI DA+  +  L+  E    +QH
Sbjct  674  ---------------------IYAPSKHDDYGSSCFPGIDDAIEEARSLSTPEAWRSVQH  712

Query  788  EIWRVARAIQRAAYALKGNLT  850
            ++WRV+RA++  +  L G LT
Sbjct  713  QVWRVSRAVRHVSQVLTGELT  733



>ref|XP_001784043.1| predicted protein [Physcomitrella patens]
 gb|EDQ51149.1| predicted protein [Physcomitrella patens]
Length=672

 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 129/270 (48%), Gaps = 79/270 (29%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  D+ VYH+ FD+Y+WM KFGDP F+RH++V+ VWGLL L LAD+ VLP  YE YA+EL
Sbjct  473  FGADYSVYHSTFDNYNWMAKFGDPLFRRHVSVTSVWGLLALRLADDKVLPMKYEKYASEL  532

Query  248  LRYTRSLSGVLEG-----GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER  412
              Y  +++  L        +++ P+F AI++L             L   +   EL ++ R
Sbjct  533  YSYALAINSGLSSSEAPKSITVAPLFSAIKDL------------HLSTYQLTDELNVI-R  579

Query  413  RMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPV  592
            R LNDRL+ AER FL+++G+ G  W+KHLV                           GPV
Sbjct  580  RELNDRLLRAERAFLDSDGIPGASWYKHLV--------------------------YGPV  613

Query  593  LGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNT---  763
                           N+G                   L F P I   +  +T   N+   
Sbjct  614  PND------------NYG------------------SLSF-PAIWGTIHEATGNGNSALN  642

Query  764  -ERGAIIQHEIWRVARAIQRAAYALKGNLT  850
              + A +QHE++R AR  +RA+  L+G LT
Sbjct  643  ATKWAAVQHEVYRSARVTRRASLVLRGKLT  672



>ref|XP_006650705.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Oryza 
brachyantha]
Length=448

 Score =   133 bits (334),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 90/262 (34%), Positives = 140/262 (53%), Gaps = 57/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  +FP YHTA DSY+WM K+GDP F RH+A++ +WGLL L LAD+ VLPF+Y+ YA++
Sbjct  230  YYGKEFPGYHTALDSYNWMEKYGDPLFLRHVAIAEIWGLLALRLADDPVLPFDYQTYASQ  289

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  +    S +++    ++ +     +L+ AA  + +EA+KL+  +      ++ RR+LN
Sbjct  290  LQGHANVFSAMMQNSTFVNLMNKFADDLSGAAMQVLKEAEKLQDLDVSDGYSLMRRRLLN  349

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRL+ AER FL  +G+ GR W                 ++HL                  
Sbjct  350  DRLLLAERSFLQPDGLQGRGW-----------------FKHL------------------  374

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  +Y P    E+ L FFPG+ DA+SRS++ +  ER A++Q
Sbjct  375  ----------------------LYSPPEDYESRLSFFPGVADAMSRSSNRSAKERRALVQ  412

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HEIW+++RAI RAA  L+G  +
Sbjct  413  HEIWKISRAIGRAANVLRGEFS  434



>ref|XP_002456339.1| hypothetical protein SORBIDRAFT_03g034260 [Sorghum bicolor]
 gb|EES01459.1| hypothetical protein SORBIDRAFT_03g034260 [Sorghum bicolor]
Length=726

 Score =   135 bits (340),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 89/261 (34%), Positives = 127/261 (49%), Gaps = 60/261 (23%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            D+ VYH+ +D + WM KFGDP FQRH+AV+ +WGL+ L L+DE +LPFNY  YA EL   
Sbjct  523  DYAVYHSLYDDFIWMEKFGDPLFQRHVAVASMWGLVALRLSDEEILPFNYSNYATELENG  582

Query  257  TRSLS-GVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMA--ELLILERRMLND  427
               +S  VL   VSL P+  +I+E   A   ++ E K L+  +  A  +   L+ R +ND
Sbjct  583  ALDISESVLGVSVSLSPLHKSIKEFRKAVLKVDSELKALQTWKFWAPWKNSPLKVRDIND  642

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM  ER F + EG++GR W                 Y+HL                   
Sbjct  643  RLMMTERAFTDREGLSGRPW-----------------YKHL-------------------  666

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +Y PS   +     +PG+ DA+ ++   N +E    +QH
Sbjct  667  ---------------------IYAPSLHNDYGAQVYPGVDDAIQKAKKTNTSESWQSVQH  705

Query  788  EIWRVARAIQRAAYALKGNLT  850
            EI+RV+R I +AA  L G+LT
Sbjct  706  EIYRVSRVINQAALVLSGDLT  726



>tpg|DAA51820.1| TPA: viviparous8 [Zea mays]
Length=739

 Score =   135 bits (339),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 96/303 (32%), Positives = 147/303 (49%), Gaps = 87/303 (29%)
 Frame = +2

Query  2    LHNQVILSIRLYTP*QNSGYTFFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGL  181
            LH+  I S+ LY          +  +FP YHTA D+Y+WM K GDPFF RH+A++ +WGL
Sbjct  491  LHHAGIPSVDLY----------YGEEFPGYHTALDTYNWMEKHGDPFFLRHLAITEIWGL  540

Query  182  LGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeea  361
            L L LA++ VLPF+Y+ Y ++L  + ++LS +   G +++ +   + +L+ AA  + +E 
Sbjct  541  LALRLANDPVLPFDYQAYTSQLQEHIKTLSALTSNGHAVNLMNGCVNDLSGAAMEVLKEM  600

Query  362  kk----LRKDETMA----ELLILERRMLNDR------------LMSAERGFLNTEGVNGR  481
            KK    L  D  +     ++  L++  L D             L+ AER FL  EG+ GR
Sbjct  601  KKWCLKLADDVLLCMFGFKIQKLQQMDLYDEHARMRRRLLNDRLLLAERSFLQPEGLQGR  660

Query  482  QWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGV  661
             W                 ++HL                                     
Sbjct  661  GW-----------------FKHL-------------------------------------  666

Query  662  EMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKG  841
               +Y P    E++L FFPGI DA+SRS +L++ E+   +QHE+W+V RAIQRAA  L+G
Sbjct  667  ---LYSPPEDYESKLSFFPGIADAISRSANLSDKEQEVAMQHEVWKVCRAIQRAASVLRG  723

Query  842  NLT  850
              +
Sbjct  724  EFS  726



>ref|XP_009121355.1| PREDICTED: probable glutamate carboxypeptidase 2, partial [Brassica 
rapa]
Length=652

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/257 (34%), Positives = 124/257 (48%), Gaps = 65/257 (25%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+A++ V GL+ L LAD+  LPFNY  YA+EL +  
Sbjct  459  YPVYHSMYDDFTWMEKFGDPMFQRHVAIASVLGLVALRLADDEFLPFNYSSYASELKKSA  518

Query  260  RSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
              L   + G  + + P+  +I++L+ AA+ I      + K+E +   L +  R LNDRLM
Sbjct  519  EDLEKEMLGHSIDISPLIKSIQDLSTAAQEIN-----IEKEEGVKGALRV--RELNDRLM  571

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
             AER   + +G++GR W                 Y+HL                      
Sbjct  572  MAERALTDRDGLSGRTW-----------------YKHL----------------------  592

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              VYGPS   +     FPG+ DA+  +  +        +QHEIW
Sbjct  593  ------------------VYGPSKYDDYGSKSFPGVDDAIDNAKRVKTKASWEHVQHEIW  634

Query  797  RVARAIQRAAYALKGNL  847
            RV+RAI+ AA  LKG L
Sbjct  635  RVSRAIRHAALVLKGEL  651



>ref|XP_002283565.3| PREDICTED: probable glutamate carboxypeptidase 2 [Vitis vinifera]
Length=776

 Score =   134 bits (337),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 127/265 (48%), Gaps = 61/265 (23%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F   +PVYH+ +D + WM KFGDP F RH A + +WGL+ L LADE  LPF+Y  YA EL
Sbjct  569  FGAGYPVYHSMYDDFIWMKKFGDPMFHRHAAAASIWGLVALRLADEEFLPFDYLSYAYEL  628

Query  248  LRYTRSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER---R  415
             +  + L G +   G++L P+F +I +   AA  I  + K++ +++  A +   E    R
Sbjct  629  QKSAKELEGEISNKGINLIPLFKSIEKFKRAATKINHQRKEIEENKGWASIWKKEHLKVR  688

Query  416  MLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVL  595
             LNDRLM AER F + +G+ GR W                 Y+HL               
Sbjct  689  ELNDRLMMAERAFTDRDGLLGRPW-----------------YKHL---------------  716

Query  596  GSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGA  775
                                     +YGP    +     FPGI DA+ ++   +  +  +
Sbjct  717  -------------------------IYGPLKHDDYGSKSFPGIDDAIEKAKSQSTEKSWS  751

Query  776  IIQHEIWRVARAIQRAAYALKGNLT  850
            ++QHE+WRV+RA+  A+  L G LT
Sbjct  752  LVQHEVWRVSRAVIDASLVLNGELT  776



>gb|KFK26210.1| peptidase m28 family protein [Arabis alpina]
Length=673

 Score =   134 bits (336),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/262 (34%), Positives = 127/262 (48%), Gaps = 66/262 (25%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  D+PVYH+ +D + WM KFGDP F RH+A++ V+GL+ L LADE  LPFNY  YA+EL
Sbjct  477  FGKDYPVYHSMYDDFTWMEKFGDPMFHRHVAMASVFGLVALRLADEEFLPFNYISYASEL  536

Query  248  LRYTRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
             +  + L     G  + +  +  AI +L+ AA+AI  E + ++         +L+ R LN
Sbjct  537  KKSVKDLEKEKLGHDIDVSQLLKAIEDLSTAAQAINTEKQAIKG--------VLKVRELN  588

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AER   + +G++ R W                 Y+HL                  
Sbjct  589  DRLMMAERALTDRDGLSERPW-----------------YKHL------------------  613

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  +YGPS   +     FPG+ DA+  +  LN       +Q
Sbjct  614  ----------------------IYGPSKYNDYGTKSFPGVDDAIDNAKKLNTKASWENVQ  651

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            H+IWRV+RAI+ A+  LKG+LT
Sbjct  652  HQIWRVSRAIKHASLVLKGDLT  673



>ref|XP_010917281.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamate carboxypeptidase 
2 [Elaeis guineensis]
Length=808

 Score =   134 bits (338),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 94/267 (35%), Positives = 130/267 (49%), Gaps = 68/267 (25%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP F RH+AV+ +WGL+ L LADE  LPF+Y  YA+EL R T
Sbjct  600  YPVYHSMYDDFVWMEKFGDPMFHRHVAVASIWGLVALRLADEEFLPFDYISYASELQRST  659

Query  260  RSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkL---------RKDETMAELLILE  409
            + +    L   V+  P++ +I EL  AA  I+ + K L         RKD        L+
Sbjct  660  KIVEDDALGMPVTFAPLYKSIEELKKAATKIDNQIKALERNFLSLNWRKDP-------LK  712

Query  410  RRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGP  589
             R LNDRLM AER F + +G+ GR+W                 Y+HL           GP
Sbjct  713  VRELNDRLMMAERAFTDRDGLFGREW-----------------YKHLI---------YGP  746

Query  590  VLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTER  769
             +         Y                     G ++    FPGI DA  ++  LN ++ 
Sbjct  747  SMHDXXXXXXGY---------------------GSKS----FPGIDDATEKAKSLNTSDS  781

Query  770  GAIIQHEIWRVARAIQRAAYALKGNLT  850
             + +QHE+WRVARA+ +AA  L G  T
Sbjct  782  WSFVQHEVWRVARAVTQAALVLNGKFT  808



>gb|EMT26362.1| Putative glutamate carboxypeptidase 2 [Aegilops tauschii]
Length=487

 Score =   131 bits (330),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 95/260 (37%), Positives = 137/260 (53%), Gaps = 57/260 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  +FP YHTA DSY WM K GDP F RH+A++ +WGLL L LA++ VLPF+Y  YA++
Sbjct  190  YYGKEFPGYHTALDSYIWMEKHGDPLFLRHLAITEIWGLLALRLANDLVLPFDYHTYASQ  249

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  +T  L+  +    S+  I   I +L++AA  +++EAK+L+  +      ++ RR+LN
Sbjct  250  LQEHTNVLADRMNNSQSVSVINGFINDLSSAATEVQKEAKELKLLDIHDGRGLIRRRLLN  309

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRL+ AER FL+ EG+ GR W                 Y+HL                  
Sbjct  310  DRLLLAERSFLHAEGLQGRTW-----------------YKHL------------------  334

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  +Y P    E+EL FFPGI DA+SR  + +  +R A ++
Sbjct  335  ----------------------MYSPPEDYESELSFFPGIADAISRRGNQSTRQRQAAVR  372

Query  785  HEIWRVARAIQRAAYALKGN  844
             E+WRVA AIQRAA  L+ N
Sbjct  373  QELWRVAMAIQRAANVLRVN  392



>ref|XP_007013008.1| Peptidase M28 family protein isoform 1 [Theobroma cacao]
 gb|EOY30627.1| Peptidase M28 family protein isoform 1 [Theobroma cacao]
Length=717

 Score =   134 bits (336),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/261 (34%), Positives = 129/261 (49%), Gaps = 61/261 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM  FGDP F RH+AV+ VWGL+ L LADE  LPF+Y  YA EL +  
Sbjct  514  YPVYHSMYDDFVWMENFGDPMFHRHVAVASVWGLVALRLADEEFLPFDYHSYAFELQKSA  573

Query  260  RSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDE---TMAELLILERRMLND  427
              L   + + GV+   +F +I EL+ AA+ I  + K++++ +   +M     ++ R LND
Sbjct  574  EELEDEISDKGVTFSHLFKSIEELSEAARKINNQKKEIKEAKGWTSMWRNDHVKVRELND  633

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM AER F + +G+  R W                 Y+HL                   
Sbjct  634  RLMMAERAFTDRDGLLRRPW-----------------YKHL-------------------  657

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +Y PS   +     FPGI DA+ ++ +LN  E   ++QH
Sbjct  658  ---------------------IYAPSRHNDYGSTSFPGINDAIEKAKNLNTVESWDLVQH  696

Query  788  EIWRVARAIQRAAYALKGNLT  850
            E+WRV+RA+  A+  LKG LT
Sbjct  697  EVWRVSRAVGHASLVLKGELT  717



>ref|XP_008344001.1| PREDICTED: probable glutamate carboxypeptidase 2 [Malus domestica]
Length=706

 Score =   132 bits (332),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 129/263 (49%), Gaps = 65/263 (25%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + W+ KFGDP F RH+AV+ VWGL+ L LAD  +LPFNY  YA EL  Y 
Sbjct  503  YPVYHSMYDDFIWVKKFGDPMFHRHVAVASVWGLVTLWLADAELLPFNYLSYAMELQTYA  562

Query  260  RSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER-----RML  421
              L   + +  ++L P+  +I EL  AA  I  E K++ +++    LL  ++     R L
Sbjct  563  NDLEDDISDTNINLTPLLKSIEELKRAATEINNERKEIEQNKGW--LLTWKKDHVKVREL  620

Query  422  NDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGS  601
            NDRLM AER F + +G+ GR W                 Y+HL                 
Sbjct  621  NDRLMMAERAFTDQDGLFGRSW-----------------YKHL-----------------  646

Query  602  SVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAII  781
                                   +YGPS   +   + FPGI DA++++   N  E    +
Sbjct  647  -----------------------IYGPSKYDDYASESFPGIYDAIAKAKISNTAESWKFV  683

Query  782  QHEIWRVARAIQRAAYALKGNLT  850
            QHE++RV+RA++ A+  + G LT
Sbjct  684  QHEVYRVSRAVKHASQIINGELT  706



>ref|XP_008354418.1| PREDICTED: probable glutamate carboxypeptidase 2 [Malus domestica]
 ref|XP_008354419.1| PREDICTED: probable glutamate carboxypeptidase 2 [Malus domestica]
Length=706

 Score =   132 bits (332),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 129/263 (49%), Gaps = 65/263 (25%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + W+ KFGDP F RH+AV+ VWGL+ L LAD  +LPFNY  YA EL  Y 
Sbjct  503  YPVYHSMYDDFIWVKKFGDPMFHRHVAVASVWGLVTLWLADAELLPFNYLSYAMELQTYA  562

Query  260  RSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER-----RML  421
              L   + +  ++L P+  +I EL  AA  I  E K++ +++    LL  ++     R L
Sbjct  563  NDLEDDISDTNINLTPLLKSIEELKRAATEINNERKEIEQNKGW--LLTWKKDHVKVREL  620

Query  422  NDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGS  601
            NDRLM AER F + +G+ GR W                 Y+HL                 
Sbjct  621  NDRLMMAERAFTDQDGLFGRSW-----------------YKHL-----------------  646

Query  602  SVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAII  781
                                   +YGPS   +   + FPGI DA++++   N  E    +
Sbjct  647  -----------------------IYGPSKYDDYASESFPGIYDAIAKAKISNTAESWKFV  683

Query  782  QHEIWRVARAIQRAAYALKGNLT  850
            QHE++RV+RA++ A+  + G LT
Sbjct  684  QHEVYRVSRAVKHASQIINGELT  706



>emb|CDX92505.1| BnaA10g15440D [Brassica napus]
Length=669

 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/257 (34%), Positives = 123/257 (48%), Gaps = 65/257 (25%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+A++ V GL+ L LAD+  LPFNY  YA+EL +  
Sbjct  476  YPVYHSMYDDFTWMEKFGDPMFQRHVAIASVLGLVALRLADDEFLPFNYSSYASELKKSA  535

Query  260  RSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
              L   + G  +   P+  +I++L+ AA+ I      + K+E +   L +  R LNDRLM
Sbjct  536  EDLEKEMLGHSIDASPLIKSIQDLSTAAQEIN-----IEKEEGVKGALRV--RELNDRLM  588

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
             AER   + +G++GR W                 Y+HL                      
Sbjct  589  MAERALTDRDGLSGRTW-----------------YKHL----------------------  609

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              VYGPS   +     FPG+ DAV  +  +        +QHEIW
Sbjct  610  ------------------VYGPSKYDDYGSKSFPGVDDAVDTAKRVKTKASWEHVQHEIW  651

Query  797  RVARAIQRAAYALKGNL  847
            RV+RAI+ A+  LKG L
Sbjct  652  RVSRAIRHASLVLKGEL  668



>ref|NP_001051516.2| Os03g0790600 [Oryza sativa Japonica Group]
 gb|ABF99277.1| glutamate carboxypeptidase II, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EEC76310.1| hypothetical protein OsI_13841 [Oryza sativa Indica Group]
 dbj|BAF13430.2| Os03g0790600 [Oryza sativa Japonica Group]
Length=448

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 89/262 (34%), Positives = 136/262 (52%), Gaps = 57/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  +FP YHTA DSY WM K GDP F RH+A+  +WGLL L LAD+ VLPF+Y+ YA++
Sbjct  230  YYGKEFPGYHTALDSYHWMEKHGDPLFLRHVAIVEIWGLLALRLADDPVLPFDYQTYASQ  289

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  +  + S ++E    +  +  +I +L+ A     +EAKKL+         ++ RR+LN
Sbjct  290  LQEHANAFSSMMENSKWVHLLNRSIEDLSDAGLEFLKEAKKLQDQNISDGYSLMRRRLLN  349

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRL+ AER FL  +G+ GR W                 ++HL                  
Sbjct  350  DRLLLAERSFLQADGLQGRGW-----------------FKHL------------------  374

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  +Y P    E++L FFPG+ DA+SRS++ +  E+ A ++
Sbjct  375  ----------------------MYSPPEDYESKLSFFPGVADAISRSSNRSAKEQQAAVR  412

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HE+ +++RAIQRAA  L+G  +
Sbjct  413  HEVRKISRAIQRAADVLRGEFS  434



>ref|XP_009416468.1| PREDICTED: probable glutamate carboxypeptidase 2 [Musa acuminata 
subsp. malaccensis]
Length=726

 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 128/272 (47%), Gaps = 74/272 (27%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            FF   +PVYH+ +D + WM KFGDP F R +AV+ +WGL+ L LAD+  LPFNY  YA E
Sbjct  519  FFGGGYPVYHSLYDDFVWMQKFGDPLFHRQVAVASIWGLVALRLADDEFLPFNYISYALE  578

Query  245  LLRYTRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkL---------RKDETMAE  394
            L   T++L     G  V+  P++ +I EL  AA  I++E K L         RKD     
Sbjct  579  LQGSTKTLEDRALGMPVTFTPLYRSIEELEKAATNIDKEKKALELEVGLVGRRKD-----  633

Query  395  LLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*  574
              +L+ R LNDRLM AER F + EG+                 F   WY+HL        
Sbjct  634  --LLKVRELNDRLMMAERAFTDREGL-----------------FHREWYKHL--------  666

Query  575  VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHL  754
                                            +YGPS   +   + FPGI DA+ ++  L
Sbjct  667  --------------------------------IYGPSLHDDYGSNSFPGIDDAIEKAKSL  694

Query  755  NNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
            N ++    +QHE+WR AR + +A+  L G  T
Sbjct  695  NTSDSWRFVQHEVWRAARVVTQASLVLHGKFT  726



>dbj|BAJ99016.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=751

 Score =   131 bits (330),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/260 (32%), Positives = 124/260 (48%), Gaps = 60/260 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            + VYH+ +D + WM K+GDP F+RH+AV+ VWGL+ L L+DE +LPFNY  YAAEL    
Sbjct  549  YAVYHSLYDDFTWMEKYGDPMFRRHVAVASVWGLVALRLSDEEILPFNYSSYAAELENGA  608

Query  260  RSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDE--TMAELLILERRMLNDR  430
              +S  + G  VSL P+  +I++   A   ++ E + L+  +  ++     L  R LNDR
Sbjct  609  VDISKRILGMPVSLSPLHKSIKQFNTAVLKVDSELQALQTSKFWSLRRNNPLRMRDLNDR  668

Query  431  LMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVK  610
            LM  ER F   EG++GR W                 Y+H+                    
Sbjct  669  LMMTERAFTEREGLSGRPW-----------------YKHM--------------------  691

Query  611  VIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHE  790
                                +YGPS   +   + +PG+ DA+  +   N ++    +QHE
Sbjct  692  --------------------IYGPSLYNDYGAEVYPGVDDAIQTAKKTNTSQSWQSVQHE  731

Query  791  IWRVARAIQRAAYALKGNLT  850
            I R+AR I +AA  L G LT
Sbjct  732  IHRIARVISQAALVLSGGLT  751



>ref|XP_004491175.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Cicer 
arietinum]
Length=706

 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/263 (34%), Positives = 125/263 (48%), Gaps = 66/263 (25%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+A + VWGL+ L LADE  LPF+Y  YA EL    
Sbjct  504  YPVYHSLYDDFIWMKKFGDPMFQRHVAAASVWGLVALWLADEEFLPFDYLSYAKELKLNM  563

Query  260  RSLSGVLEGG-VSLDPIFDAIRELTaaakaieeeakkLRKDE-----TMAELLILERRML  421
              L   +    V+L P+  +I+EL  AA  I  + K++   +      M EL +   R +
Sbjct  564  EELKNQISNKDVTLSPMDKSIKELEKAATKINNQRKEIEASKGWRTWKMDELKV---REV  620

Query  422  NDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGS  601
            NDRLM AER F + +G                  F + WY+HL                 
Sbjct  621  NDRLMMAERAFTDRDG-----------------LFGMPWYKHL-----------------  646

Query  602  SVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAII  781
                                   +YGPS   +     FPGIVDA++ + ++  TE    +
Sbjct  647  -----------------------IYGPSKHNDYGSQSFPGIVDALTIAKNVQTTESWHHV  683

Query  782  QHEIWRVARAIQRAAYALKGNLT  850
            QH++WRV+R I+ A+  L G LT
Sbjct  684  QHQVWRVSRVIRHASLVLSGQLT  706



>ref|XP_006289406.1| hypothetical protein CARUB_v10002906mg [Capsella rubella]
 gb|EOA22304.1| hypothetical protein CARUB_v10002906mg [Capsella rubella]
Length=679

 Score =   130 bits (327),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 88/267 (33%), Positives = 123/267 (46%), Gaps = 88/267 (33%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+A++ V+GL+ L LADE +LPFNY  YA+EL +  
Sbjct  489  YPVYHSMYDDFTWMEKFGDPMFQRHVAMASVFGLVALRLADEEILPFNYISYASELKKSA  548

Query  260  RSLSGVLEGGVSLD--PIFDAIRELTaaakaieeeakkLRKDETMAELLILER-------  412
              L  +   G S+D  P+  +I +L+                 T AE +I E+       
Sbjct  549  EDLEKL---GHSIDVYPLIKSIEDLS-----------------TAAEGIITEKEGIKGAL  588

Query  413  --RMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIG  586
              R LNDRLM AER   + +G++ R W                 Y+HL            
Sbjct  589  KVRELNDRLMMAERALTDRDGLSERPW-----------------YKHL------------  619

Query  587  PVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTE  766
                                        VYGPS   +     FPG+ DA+  +  LN   
Sbjct  620  ----------------------------VYGPSKYDDYGSKSFPGVDDAIENAKKLNTKA  651

Query  767  RGAIIQHEIWRVARAIQRAAYALKGNL  847
                +QH+IWRV+RAI++A+  LKG L
Sbjct  652  SWENVQHQIWRVSRAIRQASLVLKGEL  678



>ref|XP_010420791.1| PREDICTED: probable glutamate carboxypeptidase 2 [Camelina sativa]
Length=678

 Score =   130 bits (326),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/256 (33%), Positives = 125/256 (49%), Gaps = 66/256 (26%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+A++ V+GL+ L LADE VLPFNY  YA+EL +  
Sbjct  488  YPVYHSIYDDFTWMEKFGDPMFQRHVAMASVFGLVALRLADEEVLPFNYITYASELKKSA  547

Query  260  RSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLMS  439
              L   L   + + P+  +I +L+ +A+ I +E + ++          L+ R +NDRLM 
Sbjct  548  EDLEK-LGHTIDVSPLIKSIEDLSTSAQGINKEKEGIKG--------ALKVREINDRLMM  598

Query  440  AERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVIA  619
            AER   + +G++ R W                 Y+HL                       
Sbjct  599  AERAMTDRDGLSERPW-----------------YKHL-----------------------  618

Query  620  AYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWR  799
                             VYGPS   +     FPG+ DA+  +  LN       +QH+IWR
Sbjct  619  -----------------VYGPSKYDDYGSKSFPGVDDAIENAKKLNTKASWENVQHQIWR  661

Query  800  VARAIQRAAYALKGNL  847
            V+RA+++A+  LKG L
Sbjct  662  VSRAVRQASLVLKGEL  677



>ref|XP_010535936.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamate carboxypeptidase 
2 [Tarenaya hassleriana]
Length=699

 Score =   128 bits (322),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 125/262 (48%), Gaps = 62/262 (24%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+AV+ V GL+ L LADE +LPF+Y  YA+EL +  
Sbjct  485  YPVYHSMYDDFTWMEKFGDPSFQRHVAVASVLGLVALRLADEVILPFDYLSYASELQKSV  544

Query  260  RSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDE----TMAELLILERRMLN  424
              L     G  + L P+  +I +L+ AA+ I  E + + + +    TM     L+ R LN
Sbjct  545  EELQSETSGHNIDLSPLLKSIGDLSKAAEGINREKQAMIEGDKGWKTMWWKEPLKERELN  604

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRLM AER   + +G++ R W                 Y+HL                  
Sbjct  605  DRLMMAERALTDPDGLSERTW-----------------YKHL------------------  629

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  +YGPS   +     FPG+ DA+  +  LN  E    ++
Sbjct  630  ----------------------IYGPSKHDDYGSKSFPGVDDALENAKRLNTEESWQSVR  667

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HEIWRV+RAI+ ++  L   LT
Sbjct  668  HEIWRVSRAIRHSSLVLMAQLT  689



>emb|CDY35864.1| BnaC09g37960D [Brassica napus]
Length=668

 Score =   127 bits (320),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 123/257 (48%), Gaps = 65/257 (25%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP F RH+A++ V G++ L LAD+  LPFNY  YA+EL +  
Sbjct  475  YPVYHSMYDDFTWMEKFGDPMFHRHVAIASVLGMVALRLADDEFLPFNYTSYASELKKSA  534

Query  260  RSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
              L   +L   + + P+  +I++L+ AA+ I      + K+E +   L +  R +NDRLM
Sbjct  535  EDLEEEMLAHSIDISPLIKSIQDLSTAAQEIN-----IEKEEGVKGALRV--REVNDRLM  587

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
             AER   + +G++GR W                 Y+HL                      
Sbjct  588  MAERALTDRDGLSGRTW-----------------YKHL----------------------  608

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              VYGPS   +     FPG+ DA+  +  +        +QHEIW
Sbjct  609  ------------------VYGPSKYDDYGSKSFPGVDDAIDNAKRVKTKASWEHVQHEIW  650

Query  797  RVARAIQRAAYALKGNL  847
            RV+RAI+ A+  LKG L
Sbjct  651  RVSRAIRHASLVLKGEL  667



>gb|AAO24914.1| putative glutamate carboxypeptidase [Oryza sativa Japonica Group]
 dbj|BAH22722.1| plastochron3 [Oryza sativa Japonica Group]
Length=772

 Score =   128 bits (321),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 89/262 (34%), Positives = 136/262 (52%), Gaps = 57/262 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  +FP YHTA DSY WM K GDP F RH+A+  +WGLL L LAD+ VLPF+Y+ YA++
Sbjct  554  YYGKEFPGYHTALDSYHWMEKHGDPLFLRHVAIVEIWGLLALRLADDPVLPFDYQTYASQ  613

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  +  + S ++E    +  +  +I +L+ A     +EAKKL+         ++ RR+LN
Sbjct  614  LQEHANAFSSMMENSKWVHLLNRSIEDLSDAGLEFLKEAKKLQDQNISDGYSLMRRRLLN  673

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSS  604
            DRL+ AER FL  +G+ GR W                 ++HL                  
Sbjct  674  DRLLLAERSFLQADGLQGRGW-----------------FKHL------------------  698

Query  605  VKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQ  784
                                  +Y P    E++L FFPG+ DA+SRS++ +  E+ A ++
Sbjct  699  ----------------------MYSPPEDYESKLSFFPGVADAISRSSNRSAKEQQAAVR  736

Query  785  HEIWRVARAIQRAAYALKGNLT  850
            HE+ +++RAIQRAA  L+G  +
Sbjct  737  HEVRKISRAIQRAADVLRGEFS  758



>ref|XP_006572934.1| PREDICTED: probable glutamate carboxypeptidase 2-like isoform 
X1 [Glycine max]
Length=708

 Score =   127 bits (319),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 89/263 (34%), Positives = 125/263 (48%), Gaps = 60/263 (23%)
 Frame = +2

Query  71   LVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELL  250
            +  +PVYH+ +D + WM KFGDP FQRH+A + VWGL+ L LADE  LPF+Y  YA EL 
Sbjct  503  VAGYPVYHSLYDDFVWMEKFGDPMFQRHVAAASVWGLVALWLADEEFLPFDYLSYAKELQ  562

Query  251  RYTRSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLR--KDETMAELLILERRML  421
                +L   +    ++L PIF +I+ L  AA  I+ + K++   K     +   L  R L
Sbjct  563  LSVENLEDEISNKDINLSPIFKSIKGLEKAAIKIDSQRKEIEAGKGWITGKKDHLRVREL  622

Query  422  NDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGS  601
            NDRLM AER F + +G                  F + WY+HL                 
Sbjct  623  NDRLMMAERAFTDRDG-----------------LFGMSWYKHL-----------------  648

Query  602  SVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAII  781
                                   +YGPS   +     FPGI DAV  + +L+  E    +
Sbjct  649  -----------------------IYGPSKHNDYGSQSFPGIDDAVKMAKNLHTAESWHRV  685

Query  782  QHEIWRVARAIQRAAYALKGNLT  850
            QHE+WRV+R I++A+  L G L+
Sbjct  686  QHEVWRVSRVIKQASLVLFGLLS  708



>ref|XP_006572935.1| PREDICTED: probable glutamate carboxypeptidase 2-like isoform 
X2 [Glycine max]
 gb|KHN40372.1| Putative glutamate carboxypeptidase 2 [Glycine soja]
Length=705

 Score =   127 bits (319),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 124/260 (48%), Gaps = 60/260 (23%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+A + VWGL+ L LADE  LPF+Y  YA EL    
Sbjct  503  YPVYHSLYDDFVWMEKFGDPMFQRHVAAASVWGLVALWLADEEFLPFDYLSYAKELQLSV  562

Query  260  RSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLR--KDETMAELLILERRMLNDR  430
             +L   +    ++L PIF +I+ L  AA  I+ + K++   K     +   L  R LNDR
Sbjct  563  ENLEDEISNKDINLSPIFKSIKGLEKAAIKIDSQRKEIEAGKGWITGKKDHLRVRELNDR  622

Query  431  LMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVK  610
            LM AER F + +G                  F + WY+HL                    
Sbjct  623  LMMAERAFTDRDG-----------------LFGMSWYKHL--------------------  645

Query  611  VIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHE  790
                                +YGPS   +     FPGI DAV  + +L+  E    +QHE
Sbjct  646  --------------------IYGPSKHNDYGSQSFPGIDDAVKMAKNLHTAESWHRVQHE  685

Query  791  IWRVARAIQRAAYALKGNLT  850
            +WRV+R I++A+  L G L+
Sbjct  686  VWRVSRVIKQASLVLFGLLS  705



>gb|EPS58906.1| hypothetical protein M569_15905, partial [Genlisea aurea]
Length=645

 Score =   126 bits (317),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 92/146 (63%), Gaps = 1/146 (1%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  D+PVYH+ +D + WM KFGDP F RH+AV+  WGL  L LAD+ +LPFNY  YA EL
Sbjct  500  FDGDYPVYHSMYDDFVWMKKFGDPGFHRHVAVANFWGLTALRLADDVILPFNYVTYAREL  559

Query  248  LRYTRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  T  L   L G  ++LDP+FD+I +L  AA  I  EA +L+ +  + +      R +N
Sbjct  560  LSSTEKLKTELAGREINLDPLFDSIDQLERAAVRINGEAGELKSERWLTKRRASRARDVN  619

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLV  502
            DRLM AER F + +G+  R W KHLV
Sbjct  620  DRLMVAERAFADRDGLRARPWRKHLV  645



>ref|XP_010493052.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Camelina 
sativa]
Length=551

 Score =   125 bits (314),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 84/256 (33%), Positives = 123/256 (48%), Gaps = 66/256 (26%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP F RH+A++ V+GL+ L LADE VLPFNY  YA+EL +  
Sbjct  361  YPVYHSIYDDFTWMEKFGDPMFHRHVAMASVFGLVALRLADEEVLPFNYITYASELKKSA  420

Query  260  RSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLMS  439
              L   L   + + P+  +I +L+ AA+ I +E + ++          L+ R +NDRLM 
Sbjct  421  EDLEK-LGHSIDVSPLIKSIEDLSTAAQGINKEKEGIKG--------ALKVREINDRLMM  471

Query  440  AERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVIA  619
            AER   + +G++ R W                 Y+HL                       
Sbjct  472  AERAMTDRDGLSERPW-----------------YKHL-----------------------  491

Query  620  AYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWR  799
                             VYGPS   +     FPG+ DA+  +  L+       +QH IWR
Sbjct  492  -----------------VYGPSKYDDYGSKSFPGVDDAIENAKKLDTKASWENVQHHIWR  534

Query  800  VARAIQRAAYALKGNL  847
            V+RAI++A+  LKG L
Sbjct  535  VSRAIRQASLVLKGQL  550



>ref|XP_010493051.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Camelina 
sativa]
Length=677

 Score =   126 bits (317),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 84/256 (33%), Positives = 123/256 (48%), Gaps = 66/256 (26%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP F RH+A++ V+GL+ L LADE VLPFNY  YA+EL +  
Sbjct  487  YPVYHSIYDDFTWMEKFGDPMFHRHVAMASVFGLVALRLADEEVLPFNYITYASELKKSA  546

Query  260  RSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLMS  439
              L   L   + + P+  +I +L+ AA+ I +E + ++          L+ R +NDRLM 
Sbjct  547  EDLEK-LGHSIDVSPLIKSIEDLSTAAQGINKEKEGIKG--------ALKVREINDRLMM  597

Query  440  AERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVIA  619
            AER   + +G++ R W                 Y+HL                       
Sbjct  598  AERAMTDRDGLSERPW-----------------YKHL-----------------------  617

Query  620  AYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWR  799
                             VYGPS   +     FPG+ DA+  +  L+       +QH IWR
Sbjct  618  -----------------VYGPSKYDDYGSKSFPGVDDAIENAKKLDTKASWENVQHHIWR  660

Query  800  VARAIQRAAYALKGNL  847
            V+RAI++A+  LKG L
Sbjct  661  VSRAIRQASLVLKGQL  676



>ref|XP_006400535.1| hypothetical protein EUTSA_v10012881mg [Eutrema salsugineum]
 gb|ESQ41988.1| hypothetical protein EUTSA_v10012881mg [Eutrema salsugineum]
Length=673

 Score =   126 bits (316),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 87/260 (33%), Positives = 122/260 (47%), Gaps = 66/260 (25%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  D+PVYH+ +D + WM KFGD  FQRH+A++ V GL+ L LADE  LPFNY  YA+EL
Sbjct  479  FGKDYPVYHSMYDDFTWMEKFGDSMFQRHVAMASVLGLVALRLADEEFLPFNYISYASEL  538

Query  248  LRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLND  427
             +    L   L   + + P+  +I++L+ AA+ I  E K ++          L  R LND
Sbjct  539  KKSAEDLEK-LGHSIDVSPLIKSIQDLSTAARGINIEKKGIKG--------ALRVRELND  589

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM AER   + +G++ R W                 Y+HL                   
Sbjct  590  RLMMAERALTDRDGLSERPW-----------------YKHL-------------------  613

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 VYGPS   +     FPG+ DA+  +  L       ++QH
Sbjct  614  ---------------------VYGPSKYDDYGSKSFPGVDDAIDDAKRLKTKASWELVQH  652

Query  788  EIWRVARAIQRAAYALKGNL  847
            +IWRVARA++ A+  LKG L
Sbjct  653  QIWRVARAVRHASLVLKGEL  672



>ref|XP_002871904.1| peptidase M28 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48163.1| peptidase M28 family protein [Arabidopsis lyrata subsp. lyrata]
Length=682

 Score =   126 bits (316),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 87/263 (33%), Positives = 125/263 (48%), Gaps = 76/263 (29%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+A++ V GL+ L LADE +LPFNY  YA EL +  
Sbjct  488  YPVYHSMYDDFTWMEKFGDPMFQRHVAMASVLGLVALRLADEEILPFNYTSYALELKKSA  547

Query  260  RSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
              L     G  + + P+  +I +L+ AA+ I  E + ++          L+ R LNDRLM
Sbjct  548  EDLENEKLGHNIDVYPLIKSIEDLSTAAQYINIEKEAVKG--------ALKVRELNDRLM  599

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
             AER   + +G++ R W                 Y+HL                      
Sbjct  600  MAERALTDRDGLSERPW-----------------YKHL----------------------  620

Query  617  AAYTYCINFGLTRGVEMQVYGPST------GGETELDFFPGIVDAVSRSTHLNNTERGAI  778
                              +YGPST      G ++    FPG+ DA+  +  LN       
Sbjct  621  ------------------IYGPSTYDDYGYGSKS----FPGVDDAIDNAKKLNTKASWEY  658

Query  779  IQHEIWRVARAIQRAAYALKGNL  847
            +QH+IWRV+RAI++A+  LKG L
Sbjct  659  VQHQIWRVSRAIRQASLVLKGEL  681



>ref|NP_197475.2| peptidase M28 family protein [Arabidopsis thaliana]
 gb|AAP37682.1| At5g19740 [Arabidopsis thaliana]
 gb|AED92744.1| peptidase M28 family protein [Arabidopsis thaliana]
Length=681

 Score =   125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 119/257 (46%), Gaps = 66/257 (26%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+A++ V GL+ L LADE ++PFNY  YA EL +  
Sbjct  489  YPVYHSMYDDFTWMEKFGDPMFQRHVAMASVLGLVALRLADEEIIPFNYTSYALELKKSA  548

Query  260  RSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
              L     G  + +  +  +I +L+ AAK I      L K+     L +   R LNDRLM
Sbjct  549  EDLENEKLGHNIDVSTLIKSIEDLSTAAKHIS-----LEKEAIKGALKV---RELNDRLM  600

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
             AER   + +G++ R W                 Y+HL                      
Sbjct  601  MAERALTDRDGLSERPW-----------------YKHL----------------------  621

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              +YGPS   +     FPG+ DA+  +  LN       +QH+IW
Sbjct  622  ------------------IYGPSKYDDYGSKSFPGVDDAIDNAKKLNTKASWENVQHQIW  663

Query  797  RVARAIQRAAYALKGNL  847
            RV+RAI+ A+  LKG L
Sbjct  664  RVSRAIRHASLVLKGEL  680



>ref|XP_006644691.1| PREDICTED: probable glutamate carboxypeptidase 2-like, partial 
[Oryza brachyantha]
Length=683

 Score =   123 bits (308),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 86/268 (32%), Positives = 124/268 (46%), Gaps = 74/268 (28%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            ++PVYH+ +D + WM KFGDP F+RH+AV+ +WGL+ L L+DE +LPFNY  YA EL   
Sbjct  480  EYPVYHSLYDDFVWMEKFGDPLFRRHVAVASMWGLVALRLSDEEILPFNYSTYAVELENG  539

Query  257  TRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkL---------RKDETMAELLIL  406
               ++  L G  VSL P+  +I +   A   ++ E K L         RK+        L
Sbjct  540  AIDINERLLGVPVSLSPLQKSIEDFKRATLQVDSELKALQTWKVWYPWRKNP-------L  592

Query  407  ERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIG  586
              R LN+RLM  ER F + EG++GR W                 Y+HL            
Sbjct  593  TVRDLNERLMMTERAFTDREGLSGRPW-----------------YKHL------------  623

Query  587  PVLGSSVKVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTE  766
                                        +Y PS   +     +PG+ DA+  +   N +E
Sbjct  624  ----------------------------IYAPSLHDDYGAQVYPGVDDAIQMAERTNTSE  655

Query  767  RGAIIQHEIWRVARAIQRAAYALKGNLT  850
                +QHEI+R+AR I++A+  L G LT
Sbjct  656  SWRSVQHEIYRIARVIKQASLVLSGGLT  683



>ref|XP_004969900.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Setaria 
italica]
Length=738

 Score =   123 bits (309),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 93/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  71   LVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELL  250
            + ++PVYH+ +D Y W+ +FGDP F RH+AV+ VWGL+ L LAD+ ++PFNY  YA+EL 
Sbjct  533  IKEYPVYHSLYDDYVWVERFGDPLFHRHVAVASVWGLIALKLADDEIIPFNYVSYASELE  592

Query  251  RYTRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKD--ETMAELLILERRML  421
              T+ +    +G  VS  P+  +I++L  AA  I +E   L+ +          L+ R +
Sbjct  593  ECTKDIVDKCKGFPVSFSPLQKSIKQLERAATKIHKEKMLLQAENWSLKTRQYTLKVREM  652

Query  422  NDRLMSAERGFLNTEGVNGRQWFKHLV  502
            NDRLM AER F N EG+ GR W+KH++
Sbjct  653  NDRLMMAERAFTNREGLAGRPWYKHMI  679



>gb|EMT32222.1| Putative glutamate carboxypeptidase 2 [Aegilops tauschii]
Length=620

 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 92/145 (63%), Gaps = 3/145 (2%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            ++PVYH+ +D + WM +FGDP F RH+A++ VWGL+ L LAD+ ++PFNY  YA+EL   
Sbjct  417  EYPVYHSLYDDFVWMQRFGDPLFHRHVALASVWGLIALRLADDEIIPFNYVSYASELEES  476

Query  257  TRSLS-GVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDE--TMAELLILERRMLND  427
            ++ +  G     VS  P+  +I++L  AA  I  E K L+ D+         L+ R +ND
Sbjct  477  SKVVEDGCPGCAVSFSPLHKSIKQLEKAAMKIHMEKKVLQADKWGLNTRERTLKVREMND  536

Query  428  RLMSAERGFLNTEGVNGRQWFKHLV  502
            RLM AER F N EG+ GR W+KH++
Sbjct  537  RLMMAERAFTNREGLAGRPWYKHMI  561



>gb|EEE55358.1| hypothetical protein OsJ_03401 [Oryza sativa Japonica Group]
Length=504

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/258 (30%), Positives = 109/258 (42%), Gaps = 93/258 (36%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            D+PVYH+ +D Y WM +FGDP F RH+A++ VWGL+ L LAD+ +LP NY  YA+EL   
Sbjct  340  DYPVYHSLYDDYVWMERFGDPLFHRHVALASVWGLIALRLADDEILPLNYVSYASEL---  396

Query  257  TRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
                                             E  +            ++ R +NDRLM
Sbjct  397  ---------------------------------EMLQAENWSLKTRAYTVKVRDINDRLM  423

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
             AERGF+N EG++GR W                 Y+H+                      
Sbjct  424  MAERGFINREGLDGRPW-----------------YKHM----------------------  444

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              +Y  S   +     FPGIV A+ ++  LN TE   ++QHEI+
Sbjct  445  ------------------IYASSDQDDWGTKAFPGIVSAIDKANKLNTTESWQLLQHEIY  486

Query  797  RVARAIQRAAYALKGNLT  850
            R ARA+ +A+  L G LT
Sbjct  487  RAARAVSKASAVLDGRLT  504



>gb|EAY75780.1| hypothetical protein OsI_03696 [Oryza sativa Indica Group]
Length=728

 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 86/261 (33%), Positives = 123/261 (47%), Gaps = 60/261 (23%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            ++ VYH+ +D + WM KFGDP F+RH+AV+ +WGL+ L L+DE +LPFNY  YA EL + 
Sbjct  525  EYAVYHSLYDDFVWMEKFGDPLFRRHVAVASMWGLVALRLSDEEILPFNYSTYAVELEKG  584

Query  257  TRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkL--RKDETMAELLILERRMLND  427
               ++  L G  VS  P+  +I E   AA  ++ E K L  RK         L+ R LN+
Sbjct  585  AIDINKRLLGVPVSSSPLQKSIAEFKRAALQMDSEMKALQTRKVWNPWRNNPLKVRDLNE  644

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM  ER F + EG++GR W                 Y+HL                   
Sbjct  645  RLMMTERAFTDREGLSGRPW-----------------YKHL-------------------  668

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +Y PS   +     +PG+ DA+  +   N +E    +QH
Sbjct  669  ---------------------IYAPSLHDDYGAQVYPGVDDAIQMAERTNTSESWRSVQH  707

Query  788  EIWRVARAIQRAAYALKGNLT  850
            EI+R+AR I +A+  L G LT
Sbjct  708  EIYRIARVINQASLVLSGGLT  728



>ref|XP_010915061.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X4 [Elaeis 
guineensis]
Length=671

 Score =   120 bits (301),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 96/160 (60%), Gaps = 17/160 (11%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            FF   +PVYH+ +D + WM KFGDP F RH+A + +WGL+ L LADE  LPFNY  YA+E
Sbjct  519  FFGGGYPVYHSMYDDFVWMEKFGDPMFHRHVAAASMWGLVALRLADEEFLPFNYISYASE  578

Query  245  LLRYTRSLS-GVLEGGVSLDPIFDAIRELTaaakaieeeakkL---------RKDETMAE  394
            L R  + L   VL   V+  P++ +I+ L  AA  I+ + K L         RKD     
Sbjct  579  LQRSAKILEDDVLGMPVTFAPLYKSIKALKKAATKIDNQRKALERNFLSLNWRKDP----  634

Query  395  LLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFV  514
               L+ R LNDRLM AER F + +G+ GR+W+KHLV  ++
Sbjct  635  ---LKVRELNDRLMMAERAFTDRDGLFGREWYKHLVGFYI  671



>gb|EMT08802.1| Putative glutamate carboxypeptidase 2 [Aegilops tauschii]
Length=623

 Score =   120 bits (300),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 96/157 (61%), Gaps = 7/157 (4%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + W+ KF DP F+RH+A + +WG++ L LADE ++PF+Y  Y  EL  YT
Sbjct  379  YPVYHSLYDDFVWVEKFADPGFRRHVAAASIWGIMALRLADEEIIPFDYMSYTTELEAYT  438

Query  260  RSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkLRKD---ETMAELLILER---RM  418
            + +    EG  VS  P++++IR L  AA  +  E K   +D   E  ++ L  +    R 
Sbjct  439  KVVEKETEGTTVSCSPLYNSIRALKKAATKVNSERKNWYQDIQRELSSKQLSKDSMRIRG  498

Query  419  LNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFI  529
            LNDRLM AER F N EG+  + W+KHLVS  +V  FI
Sbjct  499  LNDRLMQAERAFTNREGIFKQAWYKHLVSQQLVYTFI  535



>ref|XP_004969919.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Setaria 
italica]
Length=724

 Score =   120 bits (301),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 91/145 (63%), Gaps = 3/145 (2%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            D+PVYH+ +D + WM KFGDP FQRH+A + +WGL+ L L+DE +LPFNY  YA EL   
Sbjct  521  DYPVYHSLYDDFIWMEKFGDPLFQRHVAAASMWGLVALRLSDEEILPFNYSYYATELENG  580

Query  257  TRSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAE--LLILERRMLND  427
               ++  VL   VSL P+  +I+E   A   ++ E K LR  +  A+     L+ R +ND
Sbjct  581  VMGINERVLGMPVSLSPLHKSIKEFRRAVLKVDSELKALRTWKIWAQWRSCPLKVRDIND  640

Query  428  RLMSAERGFLNTEGVNGRQWFKHLV  502
            RLM  ER F   EG++GR W+KHL+
Sbjct  641  RLMMTERAFTEREGLSGRPWYKHLI  665



>ref|NP_001044217.1| Os01g0743300 [Oryza sativa Japonica Group]
 dbj|BAD87907.1| putative glutamate carboxypeptidase [Oryza sativa Japonica Group]
 dbj|BAF06131.1| Os01g0743300 [Oryza sativa Japonica Group]
Length=728

 Score =   120 bits (300),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 85/261 (33%), Positives = 122/261 (47%), Gaps = 60/261 (23%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            ++ VYH+ +D + WM KFGDP F+RH+A + +WGL+ L L+DE +LPFNY  YA EL + 
Sbjct  525  EYAVYHSLYDDFVWMEKFGDPLFRRHVAAASMWGLVALRLSDEEILPFNYSTYAVELEKG  584

Query  257  TRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkL--RKDETMAELLILERRMLND  427
               ++  L G  VS  P+  +I E   AA  ++ E K L  RK         L+ R LN+
Sbjct  585  AIDINKRLLGVPVSSSPLQKSIAEFKRAALQMDSEMKALQTRKVWNPWRNNPLKVRDLNE  644

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM  ER F + EG++GR W                 Y+HL                   
Sbjct  645  RLMMTERAFTDREGLSGRPW-----------------YKHL-------------------  668

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +Y PS   +     +PG+ DA+  +   N +E    +QH
Sbjct  669  ---------------------IYAPSLHDDYGAQVYPGVDDAIQMAERTNTSESWRSVQH  707

Query  788  EIWRVARAIQRAAYALKGNLT  850
            EI+R+AR I +A+  L G LT
Sbjct  708  EIYRIARVINQASLVLSGGLT  728



>gb|EEE55364.1| hypothetical protein OsJ_03414 [Oryza sativa Japonica Group]
Length=704

 Score =   120 bits (300),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 85/261 (33%), Positives = 122/261 (47%), Gaps = 60/261 (23%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            ++ VYH+ +D + WM KFGDP F+RH+A + +WGL+ L L+DE +LPFNY  YA EL + 
Sbjct  501  EYAVYHSLYDDFVWMEKFGDPLFRRHVAAASMWGLVALRLSDEEILPFNYSTYAVELEKG  560

Query  257  TRSLSGVLEG-GVSLDPIFDAIRELTaaakaieeeakkL--RKDETMAELLILERRMLND  427
               ++  L G  VS  P+  +I E   AA  ++ E K L  RK         L+ R LN+
Sbjct  561  AIDINKRLLGVPVSSSPLQKSIAEFKRAALQMDSEMKALQTRKVWNPWRNNPLKVRDLNE  620

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
            RLM  ER F + EG++GR W                 Y+HL                   
Sbjct  621  RLMMTERAFTDREGLSGRPW-----------------YKHL-------------------  644

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQH  787
                                 +Y PS   +     +PG+ DA+  +   N +E    +QH
Sbjct  645  ---------------------IYAPSLHDDYGAQVYPGVDDAIQMAERTNTSESWRSVQH  683

Query  788  EIWRVARAIQRAAYALKGNLT  850
            EI+R+AR I +A+  L G LT
Sbjct  684  EIYRIARVINQASLVLSGGLT  704



>ref|XP_004969899.1| PREDICTED: probable glutamate carboxypeptidase 2-like isoform 
X2 [Setaria italica]
Length=678

 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 91/139 (65%), Gaps = 3/139 (2%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D Y WM KFGDP F+RH+A + +WG++ L LAD+ ++PFNY  YA EL  YT
Sbjct  532  YPVYHSLYDDYVWMAKFGDPGFRRHVAAASIWGMMALRLADDEIIPFNYMSYAIELQAYT  591

Query  260  RSLSGVLEGG-VSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLNDR  430
            + L   ++G  V+  P++++IR L  AA  +  E K+L+K     +L    L+ R LNDR
Sbjct  592  KVLENKVKGTDVTCSPLYNSIRALKTAATTVNNEQKELQKQLLSKQLNKDALKIRQLNDR  651

Query  431  LMSAERGFLNTEGVNGRQW  487
            LM AER F + EG+  ++W
Sbjct  652  LMQAERAFTSREGIFKQEW  670



>ref|XP_010232288.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Brachypodium 
distachyon]
Length=733

 Score =   118 bits (296),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 94/144 (65%), Gaps = 3/144 (2%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP F+RH+A + +WG++ L LADE ++PF+Y  Y  EL +YT
Sbjct  531  YPVYHSLYDDFVWMEKFGDPGFRRHVAAASIWGIMALRLADEEIIPFDYMSYTVELEKYT  590

Query  260  RSLSGVLEGG-VSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLNDR  430
              +   + G  +S  P++++I+ L  AA  +  E K++ ++ +  +L     + R LNDR
Sbjct  591  EVVERDVRGTPISCSPLYNSIKALKRAATKVNNERKEILRELSRKQLSKGSSKVRGLNDR  650

Query  431  LMSAERGFLNTEGVNGRQWFKHLV  502
            LM AER F N EG+  ++WFKHL+
Sbjct  651  LMQAERAFTNREGIFKQEWFKHLI  674



>ref|XP_010232289.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Brachypodium 
distachyon]
Length=732

 Score =   118 bits (296),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 94/144 (65%), Gaps = 3/144 (2%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP F+RH+A + +WG++ L LADE ++PF+Y  Y  EL +YT
Sbjct  530  YPVYHSLYDDFVWMEKFGDPGFRRHVAAASIWGIMALRLADEEIIPFDYMSYTVELEKYT  589

Query  260  RSLSGVLEGG-VSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLNDR  430
              +   + G  +S  P++++I+ L  AA  +  E K++ ++ +  +L     + R LNDR
Sbjct  590  EVVERDVRGTPISCSPLYNSIKALKRAATKVNNERKEILRELSRKQLSKGSSKVRGLNDR  649

Query  431  LMSAERGFLNTEGVNGRQWFKHLV  502
            LM AER F N EG+  ++WFKHL+
Sbjct  650  LMQAERAFTNREGIFKQEWFKHLI  673



>ref|XP_006381925.1| hypothetical protein POPTR_0006s21270g [Populus trichocarpa]
 gb|ERP59722.1| hypothetical protein POPTR_0006s21270g [Populus trichocarpa]
Length=127

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 87/121 (72%), Gaps = 6/121 (5%)
 Frame = +2

Query  155  MAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEGGVSLDPIFDAIRELTa  334
            ++V+G+WGLL LHLADE++LPF+Y  Y  +L  +T SLS +L+  +SL  + ++I+EL +
Sbjct  8    VSVAGIWGLLALHLADESILPFDYHSYVEQLQGHTGSLSKLLDWNISLHALVNSIQELAS  67

Query  335  aakaieeeakkLRKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFV  514
            AAK +E       + ++  + + L+ R+LNDRLM AERGFL+ EG+  RQWFKHLVS+ +
Sbjct  68   AAKVVE------HEIKSRGDYVDLKLRVLNDRLMPAERGFLDAEGLRARQWFKHLVSVLL  121

Query  515  V  517
            V
Sbjct  122  V  122



>ref|XP_010915053.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X3 [Elaeis 
guineensis]
Length=697

 Score =   117 bits (292),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 93/156 (60%), Gaps = 17/156 (11%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            FF   +PVYH+ +D + WM KFGDP F RH+A + +WGL+ L LADE  LPFNY  YA+E
Sbjct  519  FFGGGYPVYHSMYDDFVWMEKFGDPMFHRHVAAASMWGLVALRLADEEFLPFNYISYASE  578

Query  245  LLRYTRSLS-GVLEGGVSLDPIFDAIRELTaaakaieeeakkL---------RKDETMAE  394
            L R  + L   VL   V+  P++ +I+ L  AA  I+ + K L         RKD     
Sbjct  579  LQRSAKILEDDVLGMPVTFAPLYKSIKALKKAATKIDNQRKALERNFLSLNWRKDP----  634

Query  395  LLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
               L+ R LNDRLM AER F + +G+ GR+W+KHL 
Sbjct  635  ---LKVRELNDRLMMAERAFTDRDGLFGREWYKHLA  667



>ref|XP_002964367.1| hypothetical protein SELMODRAFT_81471 [Selaginella moellendorffii]
 gb|EFJ34700.1| hypothetical protein SELMODRAFT_81471 [Selaginella moellendorffii]
Length=703

 Score =   114 bits (285),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 86/145 (59%), Gaps = 11/145 (8%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            +   FPVYH+ +D Y+WM  FGDP FQRH+AVS +WGLL +H  ++ ++PF+Y  YA+ L
Sbjct  511  YQTSFPVYHSLYDDYNWMKGFGDPLFQRHVAVSAIWGLLSIHFINDDIIPFDYSSYASVL  570

Query  248  LRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLND  427
                R+L G+L   + + P+  AI EL +AA          R+    A    L+RR LND
Sbjct  571  EADVRALKGLLPEDIDVTPLLRAISELQSAA----------RQINAEAS-SSLKRRSLND  619

Query  428  RLMSAERGFLNTEGVNGRQWFKHLV  502
            RLM AER FL+  G+      KHL+
Sbjct  620  RLMLAERSFLDPMGLAQDPSSKHLI  644



>ref|XP_006853724.1| hypothetical protein AMTR_s00056p00161720 [Amborella trichopoda]
 gb|ERN15191.1| hypothetical protein AMTR_s00056p00161720 [Amborella trichopoda]
Length=665

 Score =   113 bits (283),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 82/257 (32%), Positives = 112/257 (44%), Gaps = 92/257 (36%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            FPVYH+ +D++ WM KFGDP FQR++AV  +WGL+ L LADE  LPFNY  YA+EL    
Sbjct  501  FPVYHSLYDNFVWMKKFGDPSFQRNVAVGSIWGLVALRLADEEFLPFNYSAYASEL----  556

Query  260  RSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLMS  439
                              A+ E        +  A + RK+     LL+   R LNDRLM 
Sbjct  557  -----------------HALEE--------DGWASRFRKENA---LLV---RDLNDRLMM  585

Query  440  AERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVIA  619
            AER F + +G+ GR W                 ++HL                       
Sbjct  586  AERAFADPDGLFGRSW-----------------HKHL-----------------------  605

Query  620  AYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWR  799
                             VYGPS   +     FPGI DA+      +  E  A +QH+IWR
Sbjct  606  -----------------VYGPSKHNDYGSRSFPGIEDAIEEGRSSSTRESWAFVQHQIWR  648

Query  800  VARAIQRAAYALKGNLT  850
             +R + +A+  L+G+ T
Sbjct  649  ASRVVSQASLVLRGDFT  665



>ref|XP_002961183.1| hypothetical protein SELMODRAFT_61589, partial [Selaginella moellendorffii]
 gb|EFJ38722.1| hypothetical protein SELMODRAFT_61589, partial [Selaginella moellendorffii]
Length=641

 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 113/261 (43%), Gaps = 78/261 (30%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            DFPVYH+ +D+Y+WM  FGDP F RH  V  VWGLL   LA + +LPFNY  YA  L   
Sbjct  454  DFPVYHSLYDNYNWMKNFGDPEFHRHATVVKVWGLLARRLAMDTILPFNYVSYANVLEVN  513

Query  257  TRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
              SLS   +  V+  P+  A+ +L   A  I                     R  ND LM
Sbjct  514  ILSLSKSHD--VNFFPLHSAVDQLRELASKIPS---------------FTAPRSKNDILM  556

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
              ER FL+ EG+ G+ WFKHL+                           GP         
Sbjct  557  LGERCFLDGEGLPGKPWFKHLI--------------------------YGP---------  581

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSR-STHLNNTERGAI---IQ  784
                           +  VYG ST        FP I D +S+ +   +  E  A+   +Q
Sbjct  582  --------------TQTNVYGTST--------FPAIADVISKMAVGEDKEELKALKQDLQ  619

Query  785  HEIWRVARAIQRAAYALKGNL  847
            HEIWR +RAIQ AA  +KG++
Sbjct  620  HEIWRASRAIQCAANVIKGDI  640



>ref|XP_002967665.1| hypothetical protein SELMODRAFT_88219 [Selaginella moellendorffii]
 gb|EFJ31012.1| hypothetical protein SELMODRAFT_88219 [Selaginella moellendorffii]
Length=703

 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 86/145 (59%), Gaps = 11/145 (8%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            +   FPVYH+ +D Y+WM  FGDP FQRH+A+S +WGLL +H  ++ ++PF+Y  YA+ L
Sbjct  511  YQTSFPVYHSLYDDYNWMKGFGDPLFQRHVAMSAIWGLLSIHFINDDIIPFDYSSYASVL  570

Query  248  LRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLND  427
                R+L G+L   + + P+  AI EL +AA          R+    A    L+RR LND
Sbjct  571  EADVRTLKGLLPEDIDVTPLLRAISELQSAA----------RQINAEAS-SSLKRRSLND  619

Query  428  RLMSAERGFLNTEGVNGRQWFKHLV  502
            RLM AER FL+  G+      KHL+
Sbjct  620  RLMLAERSFLDPMGLAQDPSSKHLI  644



>gb|ABF99279.1| glutamate carboxypeptidase II, putative, expressed [Oryza sativa 
Japonica Group]
Length=389

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 98/152 (64%), Gaps = 0/152 (0%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  +FP YHTA DSY WM K GDP F RH+A+  +WGLL L LAD+ VLPF+Y+ YA++
Sbjct  230  YYGKEFPGYHTALDSYHWMEKHGDPLFLRHVAIVEIWGLLALRLADDPVLPFDYQTYASQ  289

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLN  424
            L  +  + S ++E    +  +  +I +L+ A     +EAKKL+         ++ RR+LN
Sbjct  290  LQEHANAFSSMMENSKWVHLLNRSIEDLSDAGLEFLKEAKKLQDQNISDGYSLMRRRLLN  349

Query  425  DRLMSAERGFLNTEGVNGRQWFKHLVSIFVVS  520
            DRL+ AER FL  +G+ GR WFKHLVS+  VS
Sbjct  350  DRLLLAERSFLQADGLQGRGWFKHLVSLKWVS  381



>gb|KEH24310.1| glutamate carboxypeptidase, putative [Medicago truncatula]
Length=590

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSY+WM ++ DPFFQRH+AV+G+WGLL L LAD+++LPFNY  YA E
Sbjct  489  YYGKDFPVYHTAFDSYNWMAEYADPFFQRHVAVTGIWGLLALRLADDSILPFNYLSYANE  548

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRE  325
            L  Y   LS +L+  +SL P+  +I+E
Sbjct  549  LRLYRDKLSNMLDHKMSLHPLTTSIQE  575



>ref|XP_002966822.1| hypothetical protein SELMODRAFT_87649, partial [Selaginella moellendorffii]
 gb|EFJ31421.1| hypothetical protein SELMODRAFT_87649, partial [Selaginella moellendorffii]
Length=616

 Score =   110 bits (276),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 86/264 (33%), Positives = 113/264 (43%), Gaps = 84/264 (32%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            DFPVYH+ +D+Y+WM  FGDP F RH  V  VWGLL   L  + +LPFNY  YA  L   
Sbjct  428  DFPVYHSLYDNYNWMKNFGDPEFHRHATVVKVWGLLARRLVMDTILPFNYVSYANVLEVN  487

Query  257  TRSLSGVLEGGVSLDPI---FDAIRELTaaakaieeeakkLRKDETMAELLILERRMLND  427
              SLS   +  V+  P+    D +REL +   +                      R  ND
Sbjct  488  ILSLSKSRD--VNFFPLHFAVDQLRELASKIPS------------------FTAPRSKND  527

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
             LM  ER FL+ EG+ G+ WFKHL+                           GP      
Sbjct  528  ILMLGERCFLDGEGLPGKPWFKHLI--------------------------YGP------  555

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSR-STHLNNTERGAI--  778
                              +  VYG ST        FP I D +S+ +   +  E  A+  
Sbjct  556  -----------------TQTNVYGTST--------FPAIADVISKMAVGEDKEELKALKQ  590

Query  779  -IQHEIWRVARAIQRAAYALKGNL  847
             +QHEIWR +RA+Q AA  LKG++
Sbjct  591  DLQHEIWRASRAVQCAANVLKGDI  614



>ref|XP_009776394.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X3 [Nicotiana 
sylvestris]
Length=685

 Score =   110 bits (275),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 78/258 (30%), Positives = 116/258 (45%), Gaps = 76/258 (29%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP F RH             +AD+ VLPFNY  YA EL +  
Sbjct  503  YPVYHSMYDDFVWMKKFGDPMFHRH-------------VADDEVLPFNYLTYAYELQKSA  549

Query  260  RSLSGVLE-GGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
              L   +   G+ L P++ +I +L  AA  IE++ K L+   +   +     R LNDRL+
Sbjct  550  EQLEAEISVNGIKLVPLYASIEKLRKAAIKIEDDIKALKAKRSWESV-----RELNDRLI  604

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
              ER F + +G++ R W                 Y+HL                      
Sbjct  605  MTERAFTDKDGLSSRTW-----------------YKHL----------------------  625

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              +Y P+   +   + FPG+ DA+ ++  L +T+    +QHE+W
Sbjct  626  ------------------IYAPARHDDYGSNSFPGVSDAIEKAKSLKSTDSWRSVQHEVW  667

Query  797  RVARAIQRAAYALKGNLT  850
            RVARAI +A+  L G LT
Sbjct  668  RVARAITQASLVLSGRLT  685



>ref|XP_002966823.1| hypothetical protein SELMODRAFT_61588, partial [Selaginella moellendorffii]
 gb|EFJ31422.1| hypothetical protein SELMODRAFT_61588, partial [Selaginella moellendorffii]
Length=634

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 84/261 (32%), Positives = 110/261 (42%), Gaps = 85/261 (33%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            DFPVYH+ +D+Y+WM  FGDP F RH  V  VWGLL   LA + +LPFNY  YA  L + 
Sbjct  454  DFPVYHSLYDNYNWMKNFGDPEFHRHATVVKVWGLLARRLAMDTILPFNYVSYANVLSK-  512

Query  257  TRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
                       V+  P+  A+ +L   A  I                     R  ND LM
Sbjct  513  --------SHDVNFFPLHSAVDQLRELASKIPS---------------FTAPRSKNDILM  549

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
              ER FL+ EG+ G+ WFKHL+                           GP         
Sbjct  550  LGERCFLDGEGLPGKPWFKHLI--------------------------YGP---------  574

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSR-STHLNNTERGAI---IQ  784
                           +  VYG ST        FP I D +S+ +   +  E  A+   +Q
Sbjct  575  --------------TQTNVYGTST--------FPAIADVISKMAVGEDKEELKALKQDLQ  612

Query  785  HEIWRVARAIQRAAYALKGNL  847
            HEIWR +RAIQ AA  +KG++
Sbjct  613  HEIWRASRAIQCAANVIKGDI  633



>gb|KCW82315.1| hypothetical protein EUGRSUZ_C03720 [Eucalyptus grandis]
Length=658

 Score =   108 bits (270),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 94/155 (61%), Gaps = 6/155 (4%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            FF   +PVYH+ +D + WM K+GDP F RH+AV+ +WGL+ L LADE  LPF+Y  YA+E
Sbjct  499  FFGGGYPVYHSMYDDFVWMEKYGDPMFHRHLAVASIWGLIALRLADEEFLPFDYLSYASE  558

Query  245  LLRYTRSLSGVL-EGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER---  412
            L    + L   L + G++L P+F AI +   AA  I  + + +++  + + +    R   
Sbjct  559  LQESAKDLEDELSDKGLNLIPLFKAIEDFRGAATKINIDVEAIKESSSWSSIWKEYRMRV  618

Query  413  RMLNDRLMSAERGFLNTEGVNGRQWFKHLVSIFVV  517
            R LNDRLM AER F + +G+ GR  F  L SI ++
Sbjct  619  RELNDRLMMAERAFADPDGLFGR--FMALQSIMIM  651



>gb|EEE55357.1| hypothetical protein OsJ_03400 [Oryza sativa Japonica Group]
Length=556

 Score =   107 bits (268),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 113/251 (45%), Gaps = 61/251 (24%)
 Frame = +2

Query  110  YD-WMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEG  286
            YD W+     P     +  + +WG++ L LADE +LPFNY  Y  EL  YT+ +   + G
Sbjct  363  YDSWVKSNISPLRHFRITAASIWGMMALRLADEEILPFNYMSYPVELEAYTKVVENEVRG  422

Query  287  -GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLNDRLMSAERGFL  457
              +S  P+ +AIR L  AA  +  E K+L++  +  +L    ++ R LNDRLM AER F 
Sbjct  423  TAISCSPLHNAIRALKTAATKVNGERKELQRQLSSNQLKKDSMKIRSLNDRLMQAERAFT  482

Query  458  NTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCI  637
            N EG                  F   W++HL                             
Sbjct  483  NREG-----------------LFKREWFKHL-----------------------------  496

Query  638  NFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQ  817
                       VYGPS   + E   +PG+ +A++ +   N TE    +QHEI RVARAI 
Sbjct  497  -----------VYGPSEQNDWESASYPGVENAIASARKENTTESWKFVQHEIHRVARAIT  545

Query  818  RAAYALKGNLT  850
            +A+  L G+LT
Sbjct  546  QASVVLAGSLT  556



>ref|XP_003569777.1| PREDICTED: probable glutamate carboxypeptidase 2 [Brachypodium 
distachyon]
Length=724

 Score =   107 bits (267),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 87/144 (60%), Gaps = 3/144 (2%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            + VYH+ +D + WM KFGDP F+RH+A + +WGL+ L L+DE +LPFNY  Y AEL    
Sbjct  522  YAVYHSLYDDFAWMEKFGDPLFRRHVAAASIWGLVALKLSDEEILPFNYSSYVAELENGA  581

Query  260  RSLSG-VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELL--ILERRMLNDR  430
              ++  VL   VS+ P+  +I+E   A   ++ E K L+  +  +      +  R LNDR
Sbjct  582  VDINERVLGMPVSVSPLHKSIKEFNRAVIKVDSELKVLQTWKVWSPWRNNPMRVRDLNDR  641

Query  431  LMSAERGFLNTEGVNGRQWFKHLV  502
            LM  ER F + EG+ GR W+KH++
Sbjct  642  LMMTERAFTDREGLFGRPWYKHMI  665



>emb|CBI25817.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            DFPVYHTAFDSY+WM   GDP FQRH+AV+GVWGLL LHLAD+ +LPFNY  Y  +L  Y
Sbjct  255  DFPVYHTAFDSYNWMTNHGDPLFQRHVAVAGVWGLLALHLADDPILPFNYVSYIEQLWNY  314

Query  257  TRSLSGVLE  283
            T  L  + E
Sbjct  315  TNLLRNLGE  323



>ref|XP_008363033.1| PREDICTED: probable glutamate carboxypeptidase 2 [Malus domestica]
Length=413

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 104/258 (40%), Gaps = 105/258 (41%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL-LRY  256
            +PVYH+ +D + W+ KFGDP F RH+AV+ VWGL+ L LAD  +LPFNY  YA EL +R 
Sbjct  260  YPVYHSMYDDFIWVKKFGDPMFHRHVAVASVWGLVTLWLADAELLPFNYLSYAMELQVRK  319

Query  257  TRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLM  436
            T S                                                 + L+  LM
Sbjct  320  TFS-----------------------------------------------SNQQLHALLM  332

Query  437  SAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVI  616
             AER F + +G+ GR W                 Y+HL                      
Sbjct  333  MAERAFTDQDGLFGRSW-----------------YKHL----------------------  353

Query  617  AAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIW  796
                              +YGPS   +   + FPGI DA++++   N  E    +QHE++
Sbjct  354  ------------------IYGPSKYDDYASESFPGIYDAIAKAKISNTAESWKFVQHEVY  395

Query  797  RVARAIQRAAYALKGNLT  850
            RV+RA++ A+  + G LT
Sbjct  396  RVSRAVKHASQIINGELT  413



>ref|XP_010646810.1| PREDICTED: probable glutamate carboxypeptidase 2 [Vitis vinifera]
Length=338

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSY+WM   GDP FQRH+AV+GVWGLL LHLAD+ +LPFNY  Y  +
Sbjct  244  YYGRDFPVYHTAFDSYNWMTNHGDPLFQRHVAVAGVWGLLALHLADDPILPFNYVSYIEQ  303

Query  245  LLRYTRSLSGVLE  283
            L  YT  L  + E
Sbjct  304  LWNYTNLLRNLGE  316



>ref|XP_010915036.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Elaeis 
guineensis]
Length=720

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 93/179 (52%), Gaps = 40/179 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMA-----------------------VSGVW  175
            FF   +PVYH+ +D + WM KFGDP F RH+A                        + +W
Sbjct  519  FFGGGYPVYHSMYDDFVWMEKFGDPMFHRHVAEDHHFTYSISSTTSYLREWQNQRSASMW  578

Query  176  GLLGLHLADEAVLPFNYEPYAAELLRYTRSLS-GVLEGGVSLDPIFDAIRELTaaakaie  352
            GL+ L LADE  LPFNY  YA+EL R  + L   VL   V+  P++ +I+ L  AA  I+
Sbjct  579  GLVALRLADEEFLPFNYISYASELQRSAKILEDDVLGMPVTFAPLYKSIKALKKAATKID  638

Query  353  eeakkL---------RKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
             + K L         RKD        L+ R LNDRLM AER F + +G+ GR+W+KHL 
Sbjct  639  NQRKALERNFLSLNWRKDP-------LKVRELNDRLMMAERAFTDRDGLFGREWYKHLA  690



>ref|XP_010915044.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Elaeis 
guineensis]
Length=716

 Score =   103 bits (256),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 93/179 (52%), Gaps = 40/179 (22%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMA-----------------------VSGVW  175
            FF   +PVYH+ +D + WM KFGDP F RH+A                        + +W
Sbjct  515  FFGGGYPVYHSMYDDFVWMEKFGDPMFHRHVAEDHHFTYSISSTTSYLREWQNQRSASMW  574

Query  176  GLLGLHLADEAVLPFNYEPYAAELLRYTRSLS-GVLEGGVSLDPIFDAIRELTaaakaie  352
            GL+ L LADE  LPFNY  YA+EL R  + L   VL   V+  P++ +I+ L  AA  I+
Sbjct  575  GLVALRLADEEFLPFNYISYASELQRSAKILEDDVLGMPVTFAPLYKSIKALKKAATKID  634

Query  353  eeakkL---------RKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
             + K L         RKD        L+ R LNDRLM AER F + +G+ GR+W+KHL 
Sbjct  635  NQRKALERNFLSLNWRKDP-------LKVRELNDRLMMAERAFTDRDGLFGREWYKHLA  686



>ref|XP_010646825.1| PREDICTED: probable glutamate carboxypeptidase 2 [Vitis vinifera]
Length=173

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNY  226
            DFPVYHTAFDSY+WM   GDP FQRH+AV+GVWGLL LHLAD+ +LPFNY
Sbjct  107  DFPVYHTAFDSYNWMTNHGDPLFQRHVAVAGVWGLLALHLADDPILPFNY  156



>ref|XP_007029149.1| Transferrin receptor protein, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOY09651.1| Transferrin receptor protein, putative isoform 2, partial [Theobroma 
cacao]
Length=556

 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            DFPVYHTAFDS++WMI F DPFF RH+AV+GVWGLLGLHLAD+ VLP NY  YA +L
Sbjct  499  DFPVYHTAFDSFNWMINFADPFFWRHVAVAGVWGLLGLHLADDPVLPLNYLSYAKQL  555



>gb|KEH24311.1| glutamate carboxypeptidase, putative [Medicago truncatula]
Length=551

 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  DFPVYHTAFDSY+WM ++ DPFFQRH+AV+G+WGLL L LAD+++LPFNY  YA E
Sbjct  489  YYGKDFPVYHTAFDSYNWMAEYADPFFQRHVAVTGIWGLLALRLADDSILPFNYLSYANE  548

Query  245  L  247
            L
Sbjct  549  L  549



>ref|XP_002966820.1| hypothetical protein SELMODRAFT_86742 [Selaginella moellendorffii]
 gb|EFJ31419.1| hypothetical protein SELMODRAFT_86742 [Selaginella moellendorffii]
Length=664

 Score = 98.6 bits (244),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 104/253 (41%), Gaps = 84/253 (33%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            DFPVYH+ +D+Y+WM  FGD  F RH  V  VWGLL   L  + +LPFNY  YA  L   
Sbjct  489  DFPVYHSLYDNYNWMKNFGDTQFHRHATVVKVWGLLARRLVMDTILPFNYVSYANVLEVN  548

Query  257  TRSLSGVLEGGVSLDPI---FDAIRELTaaakaieeeakkLRKDETMAELLILERRMLND  427
              SLS   +  V+  P+    D +REL +   +                      R  ND
Sbjct  549  ILSLSKSRD--VNFFPLHFAVDQLRELASKIPS------------------FTAPRSKND  588

Query  428  RLMSAERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSV  607
             LM  ER FL+ EG+ G+ WFKHL+                           GP      
Sbjct  589  ILMLGERCFLDGEGLPGKPWFKHLI--------------------------YGP------  616

Query  608  KVIAAYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSR-STHLNNTERGAI--  778
                              +  VYG ST        FP I D +S+ +   +  E  A+  
Sbjct  617  -----------------TQTNVYGTST--------FPAIADVISKMAVGEDKEELKALKQ  651

Query  779  -IQHEIWRVARAI  814
             +QHEIWR ARAI
Sbjct  652  DLQHEIWRAARAI  664



>emb|CBI23457.3| unnamed protein product [Vitis vinifera]
Length=285

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNY  226
            DFPVYHTAFDSY+WM   GDP FQRH+AV+GVWGLL LHLAD+ +LPFNY
Sbjct  217  DFPVYHTAFDSYNWMTNHGDPLFQRHVAVAGVWGLLALHLADDPILPFNY  266



>ref|XP_010646875.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Vitis 
vinifera]
Length=270

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNY  226
            DFPVYHTAFDSY+WM   GDP FQRH+AV+GVWGLL LHLAD+ +LPFNY
Sbjct  202  DFPVYHTAFDSYNWMTNHGDPLFQRHVAVAGVWGLLALHLADDPILPFNY  251



>ref|XP_010646874.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X1 [Vitis 
vinifera]
Length=316

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNY  226
            DFPVYHTAFDSY+WM   GDP FQRH+AV+GVWGLL LHLAD+ +LPFNY
Sbjct  248  DFPVYHTAFDSYNWMTNHGDPLFQRHVAVAGVWGLLALHLADDPILPFNY  297



>emb|CBI29491.3| unnamed protein product [Vitis vinifera]
Length=362

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNY  226
            DFPVYHTAFDSY+WM   GDP FQRH+AV+GVWGLL LHLAD+ +LPFNY
Sbjct  296  DFPVYHTAFDSYNWMTNHGDPLFQRHVAVAGVWGLLALHLADDPILPFNY  345



>ref|XP_009591682.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Nicotiana 
tomentosiformis]
Length=610

 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP F RH+AV+ VWGLL L LAD+ VLPFNY  YA EL +  
Sbjct  500  YPVYHSMYDDFVWMKKFGDPMFHRHVAVASVWGLLALRLADDEVLPFNYLTYAYELQKSA  559

Query  260  RSLSG-VLEGGVSLDPIFDAIREL  328
              L   + E G+SL P++ +I +L
Sbjct  560  EQLEAEISENGISLVPLYASIEKL  583



>ref|XP_009591683.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X3 [Nicotiana 
tomentosiformis]
Length=597

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP F RH+AV+ VWGLL L LAD+ VLPFNY  YA EL +  
Sbjct  500  YPVYHSMYDDFVWMKKFGDPMFHRHVAVASVWGLLALRLADDEVLPFNYLTYAYELQKSA  559

Query  260  RSLSG-VLEGGVSLDPIFDAIREL  328
              L   + E G+SL P++ +I +L
Sbjct  560  EQLEAEISENGISLVPLYASIEKL  583



>ref|XP_010314059.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamate carboxypeptidase 
2 [Solanum lycopersicum]
Length=524

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 113/257 (44%), Gaps = 72/257 (28%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP F RH+A    +  L   +    +L       +AE L   
Sbjct  340  YPVYHSMYDDFVWMKKFGDPMFHRHVA-DVTYSYLTSFIKHIILLGQK----SAEYLE--  392

Query  260  RSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLMS  439
               + + + G+SL P++ +I +L  AA  I+ + K L+   +   +     R LNDRL+ 
Sbjct  393  ---AEISDKGISLVPLYASIEKLRKAATGIKNDIKALKAKRSRGSV-----RELNDRLIM  444

Query  440  AERGFLNTEGVNGRQWFKHLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVIA  619
             ER F + +G++ R W                 Y+HL                       
Sbjct  445  TERAFTDRDGLSSRTW-----------------YKHL-----------------------  464

Query  620  AYTYCINFGLTRGVEMQVYGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWR  799
                             +Y P+   +   + FPGI DA+  +  LN+++    +QHE+WR
Sbjct  465  -----------------IYAPAKHNDYGFNSFPGISDAIENAKSLNSSDSWYSVQHEVWR  507

Query  800  VARAIQRAAYALKGNLT  850
            VARAI +A+  L G LT
Sbjct  508  VARAITQASLVLSGRLT  524



>emb|CEG79716.1| hypothetical protein RMATCC62417_14148 [Rhizopus microsporus]
Length=782

 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 86/152 (57%), Gaps = 8/152 (5%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  D+ VYH+ +DS+ WM KFGDP F+ H  +  +WGLL L L+D  +LP +   Y  EL
Sbjct  582  FSGDYGVYHSNYDSFHWMEKFGDPDFRYHQTLVKIWGLLTLRLSDSLILPLSPTDYTTEL  641

Query  248  LRYTRSLSGVLEGGVSLDPIFDAIRELTaaa----kaieeeakkLRKDETMAE---LLIL  406
             RY   LS        L  + DA+ +L   A    + ++  A +L + E++A+   +LI 
Sbjct  642  YRYVEDLS-TYASPYELKELPDALDKLERTARRFERRLQRLAGRLAEYESLADVPSVLID  700

Query  407  ERRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
                 N RL   ERGF++ EG+ GR+WFKH+V
Sbjct  701  RLEKANKRLTYFERGFIHPEGLPGREWFKHVV  732



>emb|CEG79717.1| hypothetical protein RMATCC62417_14148 [Rhizopus microsporus]
Length=783

 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 86/152 (57%), Gaps = 8/152 (5%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  D+ VYH+ +DS+ WM KFGDP F+ H  +  +WGLL L L+D  +LP +   Y  EL
Sbjct  583  FSGDYGVYHSNYDSFHWMEKFGDPDFRYHQTLVKIWGLLTLRLSDSLILPLSPTDYTTEL  642

Query  248  LRYTRSLSGVLEGGVSLDPIFDAIRELTaaa----kaieeeakkLRKDETMAE---LLIL  406
             RY   LS        L  + DA+ +L   A    + ++  A +L + E++A+   +LI 
Sbjct  643  YRYVEDLS-TYASPYELKELPDALDKLERTARRFERRLQRLAGRLAEYESLADVPSVLID  701

Query  407  ERRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
                 N RL   ERGF++ EG+ GR+WFKH+V
Sbjct  702  RLEKANKRLTYFERGFIHPEGLPGREWFKHVV  733



>gb|EIE82054.1| hypothetical protein RO3G_06759 [Rhizopus delemar RA 99-880]
Length=767

 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 87/152 (57%), Gaps = 10/152 (7%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  ++ VYH+ +DS+ WM KFGDP F+ H  +  +WGLL L L++  +LP +   YAA+L
Sbjct  569  FSGNYGVYHSNYDSFHWMEKFGDPDFRYHQTMVKIWGLLALRLSESLILPLHPADYAADL  628

Query  248  LRYTRSLSGVLEGGVSLDPIFDAI----RELTaaakaieeeakkLRKDETMAEL---LIL  406
             +Y  +LS       SL+ + DA+    R  T   + +E  A +L K + + ++   LI 
Sbjct  629  SKYVDNLSTYTS---SLNYLPDAVDKLERTATRFERRLERLAGRLAKYDNLDDVPAHLIQ  685

Query  407  ERRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
                 N RL   ERGF++ EG+ GR WFKH+V
Sbjct  686  RLEKANKRLTYFERGFIDPEGIPGRTWFKHVV  717



>gb|KEH27223.1| peptidase M28 family protein [Medicago truncatula]
Length=611

 Score = 92.8 bits (229),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +D + WM KFGDP FQRH+A + VWGL+ L LADE  LPFNY  YA EL    
Sbjct  501  YPVYHSQYDDFVWMTKFGDPVFQRHVAAASVWGLVALWLADEEFLPFNYSSYAKELQLSM  560

Query  260  RSLSGVL--EGGVSLDPIFDAIREL  328
             SL   +  E  ++L P++ +I+EL
Sbjct  561  ESLKNEISNEDIINLSPMYKSIKEL  585



>emb|CEG71914.1| hypothetical protein RMATCC62417_07563 [Rhizopus microsporus]
Length=782

 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 77/151 (51%), Gaps = 6/151 (4%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  D+ VYH+ +DS+ WM KFGDP F  H  +  +WGLL L L+D  +LP     Y  EL
Sbjct  582  FSGDYGVYHSNYDSFHWMEKFGDPEFLYHQTLVKIWGLLTLRLSDSLILPLMPADYTTEL  641

Query  248  LRYTRSLSG------VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILE  409
             RY   LS       + E   +LD +   +R      + +     +    E +  +LI  
Sbjct  642  YRYVEELSTYASPYELKELPDALDKLEKTVRRFERRLQRLAGRLAEYESLEDVPSVLIDR  701

Query  410  RRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
                N RL   ERGF++ +G+ GR+WFKH+V
Sbjct  702  LEKANKRLTYFERGFIHPDGLPGREWFKHVV  732



>emb|CEI91111.1| hypothetical protein RMCBS344292_05411 [Rhizopus microsporus]
Length=782

 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 77/151 (51%), Gaps = 6/151 (4%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  D+ VYH+ +DS+ WM KFGDP F  H  +  +WGLL L L+D  +LP     Y  EL
Sbjct  582  FSGDYGVYHSNYDSFHWMEKFGDPEFLYHQTLVKIWGLLTLRLSDSLILPLMPTDYTTEL  641

Query  248  LRYTRSLSG------VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILE  409
             RY   LS       + E   +LD +   +R      + +     +    E +  +LI  
Sbjct  642  YRYVEELSTYASPYELKELPDALDKLEKTVRRFERRLQRLAGRLAEYESLEDVPSVLIDR  701

Query  410  RRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
                N RL   ERGF++ +G+ GR+WFKH+V
Sbjct  702  LEKANKRLTYFERGFIHPDGLPGREWFKHVV  732



>emb|CEI91110.1| hypothetical protein RMCBS344292_05411 [Rhizopus microsporus]
Length=783

 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 77/151 (51%), Gaps = 6/151 (4%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  D+ VYH+ +DS+ WM KFGDP F  H  +  +WGLL L L+D  +LP     Y  EL
Sbjct  583  FSGDYGVYHSNYDSFHWMEKFGDPEFLYHQTLVKIWGLLTLRLSDSLILPLMPTDYTTEL  642

Query  248  LRYTRSLSG------VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILE  409
             RY   LS       + E   +LD +   +R      + +     +    E +  +LI  
Sbjct  643  YRYVEELSTYASPYELKELPDALDKLEKTVRRFERRLQRLAGRLAEYESLEDVPSVLIDR  702

Query  410  RRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
                N RL   ERGF++ +G+ GR+WFKH+V
Sbjct  703  LEKANKRLTYFERGFIHPDGLPGREWFKHVV  733



>gb|EPB82894.1| hypothetical protein HMPREF1544_10365 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=780

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 78/151 (52%), Gaps = 6/151 (4%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  D+ VYH+ +DS+ WM KFGDP F  H  +  +WGLL L LAD  VLP     Y+AEL
Sbjct  579  FDGDYGVYHSNYDSFHWMEKFGDPEFLYHQTLVKLWGLLALRLADSPVLPLYPTDYSAEL  638

Query  248  LRYTRSLSGVL------EGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILE  409
             +Y   L+         E   +LD +    R      + +EE   + +  + +  +L   
Sbjct  639  AKYVERLTEYAAPHTFPELESALDKLQKTARRFQHKRQRLEERLAEYKSLDNIPSVLAKR  698

Query  410  RRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
                N+RL   ERG ++ EG+ GR WFKH+V
Sbjct  699  LARTNNRLTFFERGLIDPEGIPGRNWFKHVV  729



>ref|XP_005379781.1| PREDICTED: N-acetylated-alpha-linked acidic dipeptidase 2 [Chinchilla 
lanigera]
Length=778

 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 86/149 (58%), Gaps = 14/149 (9%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYHT +++++ + KF DP F++ ++V+ + G L   LAD AV+PFN E YA  L  Y 
Sbjct  577  YPVYHTIYETFELVEKFYDPMFKKQLSVAQLRGALVYELADSAVIPFNAEDYAKALKHYA  636

Query  260  RSLSGVL--------EGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERR  415
             S+  +         +  VS DP+F A++  + AA    +   +L  +  +A       R
Sbjct  637  ASIFSIARRHGQQLRDYKVSFDPLFSAVKNFSEAASDFHKRLTQLDHNNPIAV------R  690

Query  416  MLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
            ++ND+LM  ER F++  G+ GRQ+++H++
Sbjct  691  IMNDQLMLLERAFIDPLGLPGRQFYRHII  719



>ref|XP_007666301.1| PREDICTED: N-acetylated-alpha-linked acidic dipeptidase 2-like 
[Ornithorhynchus anatinus]
Length=644

 Score = 90.1 bits (222),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 86/150 (57%), Gaps = 14/150 (9%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            ++PVYHT +++++ + +F DP F +H+AVS V G L   LAD  V+PF+ + YA  L  Y
Sbjct  442  NYPVYHTIYETFEIVEQFYDPTFAKHLAVSKVRGGLVYELADSKVIPFDCQDYAGALANY  501

Query  257  TRSLSG--------VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER  412
               +          V E GVS +P+F A+R  + AA        ++  ++++A       
Sbjct  502  ASGIYNLSKKHEPRVKEYGVSFEPLFSAVRNFSRAATEFHRRLAQIDLNDSLA------V  555

Query  413  RMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
            R++ND+LM  ER F++  G+ GR +++H+V
Sbjct  556  RIVNDQLMLVERAFIDPLGLPGRPFYRHMV  585



>emb|CDH55564.1| glutamate [Lichtheimia corymbifera JMRC:FSU:9682]
Length=791

 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 86/164 (52%), Gaps = 19/164 (12%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  D+ VYH+ +DS+ WM KFGDP F  H  +  +WGL+ L LAD  +LP +   YA  L
Sbjct  580  FSGDYGVYHSVYDSFHWMDKFGDPGFLYHQTMCRIWGLMALRLADSPILPIHPADYADAL  639

Query  248  LRYTRSLS-----GVLEGGVSLD------PIFDA-IRELTaaakaieeeakkLRKD----  379
              Y   +S      V +  + +D      P+  A I +L+  A   E++ + L       
Sbjct  640  SGYMEDISSYAADAVTKNKIEIDDEQQRFPVLSAAIDKLSDIATKFEKKLQSLETQVHDY  699

Query  380  ---ETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
               +++ + L+   R +N++LM  ERG L+ EG+  R WFKH+V
Sbjct  700  SHLDSVPQSLLRRLRKINEQLMYFERGLLDPEGIQERTWFKHIV  743



>emb|CDH52307.1| glutamate carboxypeptidase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=804

 Score = 89.4 bits (220),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 87/164 (53%), Gaps = 19/164 (12%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  D  V ++A+DS+ WM KFGDP F+ H  ++ +WGLL  HLA + +LP   + Y  E+
Sbjct  589  FSGDMGVRYSAYDSFHWMEKFGDPTFEYHATLTKIWGLLTFHLAHDRILPMYPQDYYVEV  648

Query  248  LRYTR---SLSGVLEGGV-------SLDPIFDAIRELTaaakaieeeakkL---------  370
             +Y     S+S  +  G+       S  P    +++L   ++  E + +KL         
Sbjct  649  NQYIGDLLSMSTTMGNGIHQQIADLSHGPFHKPLKKLRKRSRKFEHKREKLKSSLEPYIN  708

Query  371  RKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
            R D+ + E ++      N RLM  ERGF + EG+ GR+WFKH++
Sbjct  709  RHDDQLPEDVLKHLIKANKRLMYFERGFASNEGIQGREWFKHVI  752



>emb|CEI90498.1| hypothetical protein RMCBS344292_04823 [Rhizopus microsporus]
Length=782

 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 77/151 (51%), Gaps = 6/151 (4%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  D+ VYH+ +DS+ WM KFGDP F  H  +  +WGLL L L+D  +LP +   Y  EL
Sbjct  582  FSGDYGVYHSNYDSFHWMEKFGDPEFLYHQTLVKIWGLLTLRLSDSLILPLSPVDYTIEL  641

Query  248  LRYTRSLSG------VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILE  409
             +Y   LS       + E   +LD +   +R      + +     +      +  +LI  
Sbjct  642  YKYVEELSTYASPYELKELPDALDKLKKTVRRFERRLQRLAGRLAEYESLTDVPSVLIDR  701

Query  410  RRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
                N RL   ERGF++ +G+ GR+WFKH+V
Sbjct  702  LEKANKRLTYFERGFIHPDGLPGREWFKHVV  732



>ref|XP_004661942.1| PREDICTED: N-acetylated-alpha-linked acidic dipeptidase 2 [Jaculus 
jaculus]
Length=790

 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 85/150 (57%), Gaps = 14/150 (9%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
             +PVYHT +++++ +  F DP F++ ++V+ + G L   LAD  V+PFN + YA  L  Y
Sbjct  588  SYPVYHTIYETFELVENFYDPTFKKQLSVAQLRGALVYQLADSTVIPFNIQDYAMALKNY  647

Query  257  TRSLSGVLEG--------GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER  412
              S+S V +         GVS D +F A++  + AA        ++  ++ MA       
Sbjct  648  ATSISSVSKKHGQQLTDYGVSFDSLFSAVKNFSEAASDFHRRLTQVDLNDPMA------V  701

Query  413  RMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
            R++ND+LM  ER F++  G+ GRQ+++H++
Sbjct  702  RIMNDQLMLLERAFIDPLGLPGRQFYRHII  731



>emb|CDS05363.1| hypothetical protein LRAMOSA07892 [Absidia idahoensis var. thermophila]
Length=779

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 87/163 (53%), Gaps = 18/163 (11%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  D  V ++A+DS+ WM KFGDP F+ H  ++ +WGL+ L LA++ +LP   + Y  ++
Sbjct  565  FSGDTGVRYSAYDSFHWMTKFGDPTFEYHATLTKIWGLVTLRLANDRILPMYPQDYYVQV  624

Query  248  LRYTRSLSGVLE---------GGVSLDPIFDAIRELTaaakaieeeakkL---------R  373
             +Y   LS               +S  P + ++++L   ++  E + + L         R
Sbjct  625  NQYIDDLSTAPMNTTMMHQQIADLSHGPFYKSLKKLRKRSRKFEHKRENLIRSLEPYINR  684

Query  374  KDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
             D+ + E ++      N RLM  ERGF++ EG+ GR+WFKH++
Sbjct  685  HDDQLPEDVLKHLVKANKRLMYFERGFVSNEGIQGREWFKHVI  727



>gb|KCW82316.1| hypothetical protein EUGRSUZ_C03720 [Eucalyptus grandis]
Length=604

 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            FF   +PVYH+ +D + WM K+GDP F RH+AV+ +WGL+ L LADE  LPF+Y  YA+E
Sbjct  499  FFGGGYPVYHSMYDDFVWMEKYGDPMFHRHLAVASIWGLIALRLADEEFLPFDYLSYASE  558

Query  245  LLRYTRSLSGVL-EGGVSLDPIFDAIRE  325
            L    + L   L + G++L P+F AI +
Sbjct  559  LQESAKDLEDELSDKGLNLIPLFKAIED  586



>dbj|BAD86951.1| putative glutamate carboxypeptidase [Oryza sativa Japonica Group]
Length=661

 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/239 (29%), Positives = 97/239 (41%), Gaps = 85/239 (36%)
 Frame = +2

Query  143  FQRH--MAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYTRSLSGVLEG-GVSLDPIFD  313
             QRH  +  + +WG++ L LADE +LPFNY  Y  EL  YT+ +   + G  +S  P+ +
Sbjct  505  LQRHFRITAASIWGMMALRLADEEILPFNYMSYPVELEAYTKVVENEVRGTAISCSPLHN  564

Query  314  AIRELTaaakaieeeakkLRKDETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFK  493
            AIR L                 +T A  +  ER+        AER F N EG        
Sbjct  565  AIRAL-----------------KTAATKVNGERK--------AERAFTNREG--------  591

Query  494  HLVSIFVVSFFILHWYQHLAK*N*SR*VSIGPVLGSSVKVIAAYTYCINFGLTRGVEMQV  673
                      F   W++HL                                        V
Sbjct  592  ---------LFKREWFKHL----------------------------------------V  602

Query  674  YGPSTGGETELDFFPGIVDAVSRSTHLNNTERGAIIQHEIWRVARAIQRAAYALKGNLT  850
            YGPS   + E   +PG+ +A++ +   N TE    +QHEI RVARAI +A+  L G+LT
Sbjct  603  YGPSEQNDWESASYPGVENAIASARKENTTESWKFVQHEIHRVARAITQASVVLAGSLT  661



>emb|CDM84002.1| unnamed protein product [Triticum aestivum]
Length=724

 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            ++PVYH+ +D + WM +FGDP F RH+A++ VWGL+ L LAD+ ++PFNY  YAAEL   
Sbjct  532  EYPVYHSLYDDFVWMERFGDPLFHRHVALASVWGLIALRLADDEIIPFNYVSYAAELEES  591

Query  257  TRSLS-GVLEGGVSLDPIFDAIREL  328
            ++ +  G     VS  P+  +I++L
Sbjct  592  SKVVEDGCPGCAVSFSPLHKSIKQL  616



>emb|CDS09725.1| hypothetical protein LRAMOSA02402 [Absidia idahoensis var. thermophila]
Length=791

 Score = 87.4 bits (215),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 82/164 (50%), Gaps = 19/164 (12%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  D+ VYH+ +DS+ WM KFGDP F  H  +  +W L+ L LAD  +LP +   YA  L
Sbjct  580  FSGDYGVYHSVYDSFHWMDKFGDPGFHYHATMCRIWALMALRLADSPILPIHPADYADAL  639

Query  248  LRYTRSLSGVLEGGVSLDPI------------FDAIRELTaaakaieeeakkLRKD----  379
              Y   +S      V+ + I              AI +L+  A   E++ + L       
Sbjct  640  SGYVDDISSYAADAVTKNKIEIGDEQQRFPVLSAAIEKLSDIATKFEKKLQSLEIQVQDY  699

Query  380  ---ETMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
               +++ + L+   R +N++LM  ERG L+ EG+  R WFKH+V
Sbjct  700  SHLDSVPKSLLRRLRKINEQLMYFERGLLDPEGIQERTWFKHIV  743



>ref|XP_008442989.1| PREDICTED: probable glutamate carboxypeptidase 2 isoform X2 [Cucumis 
melo]
Length=567

 Score = 87.0 bits (214),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            DFPVYHTAFD+YDWM  +GDP F RH+ V  +WGLL L L+D+ +LPF+Y  YA +L
Sbjct  501  DFPVYHTAFDTYDWMANYGDPLFHRHVTVGSIWGLLALRLSDDLILPFSYVSYANQL  557



>gb|EIE85140.1| hypothetical protein RO3G_09850 [Rhizopus delemar RA 99-880]
Length=650

 Score = 87.4 bits (215),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 82/154 (53%), Gaps = 10/154 (6%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  ++ VYH+ +DS+ +M KF DP F+ H+A++ +WGLL L LAD+ +LP +   Y+ EL
Sbjct  450  FEGNYGVYHSVYDSFHYMEKFADPTFEYHVAMTKIWGLLTLRLADDLILPIHPLDYSQEL  509

Query  248  LRYTRSLSGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRK---------DETMAELL  400
             +Y   L        S   +  ++  L   A + E   +++ +         D+ +A   
Sbjct  510  QKYVHKLHSYASPH-SFPTLKKSVHNLVKLATSFETSLEQINEKLKAFNQDDDKKLAPRW  568

Query  401  ILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
                  +N RL   ER F++ EG+ GR+WFKH+V
Sbjct  569  AKRVEKMNQRLTQFERSFIDPEGIKGREWFKHVV  602



>ref|XP_006260455.1| PREDICTED: putative N-acetylated-alpha-linked acidic dipeptidase-like 
[Alligator mississippiensis]
Length=442

 Score = 86.7 bits (213),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 83/149 (56%), Gaps = 14/149 (9%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYH+ +++Y+ + KF DP F+ H+ V+ V G L   LAD  VLPF+   YAA L  YT
Sbjct  241  YPVYHSIYETYEIVEKFYDPTFKNHLTVAQVRGGLVFELADSVVLPFDCRDYAAALSNYT  300

Query  260  RSL--------SGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERR  415
              +        S V +  V+ DP+F A++  T AA          R+ + +     ++ R
Sbjct  301  HIIYNLSKSHQSEVTKYSVTFDPLFSAVKNFTEAAIDFH------RRLQQVDISNPIDVR  354

Query  416  MLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
             LND+LM  ER F++  G+ GR +++H++
Sbjct  355  SLNDQLMLLERAFIDPLGLPGRPFYRHII  383



>gb|EIE80119.1| hypothetical protein RO3G_04824 [Rhizopus delemar RA 99-880]
Length=776

 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 80/153 (52%), Gaps = 8/153 (5%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  ++ VYH+ +DS+ WM KFGDP F  H+ +  +WGLL L L+D  +LP + E Y A L
Sbjct  576  FRGNYGVYHSNYDSFHWMEKFGDPGFDYHLTLVKIWGLLTLRLSDSIILPLHPEDYTAAL  635

Query  248  LRYTRSLSGV-LEGGVSLDPIFDAIRELTaaakaieeeakkL--RKDE-----TMAELLI  403
              Y   L    +        +  A+ +L  A +       +L  R DE      +  +L+
Sbjct  636  SAYVDRLHDYDVPSSYKFKHLSKAVHKLKKATRRFNRRLNRLIKRLDEYNSLDDVPSVLL  695

Query  404  LERRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
                  N RL   ERGF+++EG+ GR+WFKH+V
Sbjct  696  HRIEKANRRLTYFERGFIDSEGIPGREWFKHVV  728



>gb|EMS58125.1| putative glutamate carboxypeptidase 2 [Triticum urartu]
Length=395

 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = +2

Query  65   FFLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAE  244
            ++  +FP YHTA DSY WM   GDP F RH+A++ +WGLL L LA++ VLPF+Y  YA++
Sbjct  190  YYGKEFPGYHTALDSYIWMENHGDPLFLRHLAITEIWGLLALRLANDLVLPFDYHTYASQ  249

Query  245  LLRYTRSLSGVLEGGVSLDPIFDAIRELT  331
            L  +T  L+  +    S+  I   I +L+
Sbjct  250  LQEHTNVLADRMNNSQSVSVIHGFINDLS  278



>ref|XP_006021112.1| PREDICTED: N-acetylated-alpha-linked acidic dipeptidase 2-like 
isoform X2 [Alligator sinensis]
Length=502

 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 82/150 (55%), Gaps = 14/150 (9%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
             +P YH+ +++Y+ + KF DP F+ H+ V+ V G L   LAD  VLPF+   YAA L  Y
Sbjct  300  SYPAYHSIYETYEIVEKFYDPTFKNHVTVAQVRGGLVFELADSVVLPFDCRDYAAALSNY  359

Query  257  TRSL--------SGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER  412
            T  +        S V +  V+ DP+F A++  T AA          R+ + +     ++ 
Sbjct  360  THIIYNLSKSHQSEVTKYSVTFDPLFSAVKNFTEAAIDFH------RRLQQVDISNPIDV  413

Query  413  RMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
            R LND+LM  ER F++  G+ GR +++H++
Sbjct  414  RSLNDQLMLLERAFIDPLGLPGRPFYRHII  443



>dbj|BAB28132.1| unnamed protein product [Mus musculus]
Length=257

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 82/149 (55%), Gaps = 14/149 (9%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYHT +++++ +  F DP F++ ++V+ + G L   LAD  V+PFN + YA  L  Y 
Sbjct  56   YPVYHTIYETFELVQNFYDPTFKKQLSVAQLRGALVYELADSVVIPFNIQDYAKALKNYA  115

Query  260  RSLSGVLEG--------GVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERR  415
             S+  + +          VS DP+F A++  + AA        ++  +  +A       R
Sbjct  116  ASIFNISKKHDQQLRNHAVSFDPLFSAVKNFSEAASDFHRRLTQVDLNNPIAV------R  169

Query  416  MLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
            ++ND+ M  ER F++  G+ GR++++H++
Sbjct  170  IMNDQQMLLERAFIDPLGLPGRKFYRHII  198



>emb|CDH55560.1| glutamate carboxypeptidase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=786

 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 79/160 (49%), Gaps = 15/160 (9%)
 Frame = +2

Query  68   FLVDFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            F  D+ VYH+ +DS+ WM KFGDP F  H  ++ +WGLL L LAD  +LP +   YA  L
Sbjct  579  FSGDYGVYHSNYDSFHWMEKFGDPGFHYHATMTKIWGLLALRLADSPILPLHPVDYADAL  638

Query  248  LRY-------TRSLS-GVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKD-------E  382
              Y       T SLS    +   S   +  A+ +L   A   E+  + L           
Sbjct  639  DDYVDYLADFTTSLSTDAADSSRSFPLLRKAVHKLKKIAVKFEKNLQSLESQVYSYSHLA  698

Query  383  TMAELLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
             + + L    R +NDRL   ERG ++ EG+  R+WFKH+ 
Sbjct  699  DVPKSLSSSLRKVNDRLAFFERGLIDPEGIQNREWFKHIA  738



>gb|KEQ88865.1| putative glutamate carboxypeptidase [Aureobasidium pullulans 
EXF-150]
Length=779

 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 79/159 (50%), Gaps = 24/159 (15%)
 Frame = +2

Query  89   YHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYTRSL  268
            YH+ +DSY WM+K+GDP F+ H+  + VW LL   L+++AV+PFN   YA  L RY  S+
Sbjct  576  YHSNYDSYAWMVKYGDPSFEYHVTAAKVWSLLAASLSEKAVIPFNASDYAISLDRYLDSV  635

Query  269  ------------SGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAE------  394
                          V+     LD    AI  L  AA+  E  A  L    T AE      
Sbjct  636  KHMANASKIAHEKDVVHAFTDLD---RAIEHLQRAAQKFETRAGDLAIQATAAEGKYNPA  692

Query  395  ---LLILERRMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
                L  + R +N +    ER FL  +G++GR WFKH+V
Sbjct  693  ATNKLFADIRAVNTQYKVLERAFLYPKGLDGRSWFKHVV  731



>ref|XP_006021115.1| PREDICTED: N-acetylated-alpha-linked acidic dipeptidase 2-like 
isoform X5 [Alligator sinensis]
Length=442

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 82/149 (55%), Gaps = 14/149 (9%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +P YH+ +++Y+ + KF DP F+ H+ V+ V G L   LAD  VLPF+   YAA L  YT
Sbjct  241  YPAYHSIYETYEIVEKFYDPTFKNHVTVAQVRGGLVFELADSVVLPFDCRDYAAALSNYT  300

Query  260  RSL--------SGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERR  415
              +        S V +  V+ DP+F A++  T AA          R+ + +     ++ R
Sbjct  301  HIIYNLSKSHQSEVTKYSVTFDPLFSAVKNFTEAAIDFH------RRLQQVDISNPIDVR  354

Query  416  MLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
             LND+LM  ER F++  G+ GR +++H++
Sbjct  355  SLNDQLMLLERAFIDPLGLPGRPFYRHII  383



>ref|NP_001025553.1| N-acetylated-alpha-linked acidic dipeptidase 2 [Xenopus (Silurana) 
tropicalis]
 gb|AAH90593.1| MGC69500 protein [Xenopus (Silurana) tropicalis]
Length=738

 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 87/150 (58%), Gaps = 14/150 (9%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRY  256
            ++PVYHT +++++ + ++ DP F++ ++V+ V G L   LA+  V+PFN + Y   L  Y
Sbjct  536  NYPVYHTVYETFELVERYYDPSFKKQLSVAQVRGSLVYELANAPVIPFNVQDYGEALKSY  595

Query  257  TRSL--------SGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILER  412
              S+        S +   GVS +P+F AI+  T A+  + +  +KL     +A       
Sbjct  596  ATSIYSLAKRNRSQMETYGVSFEPLFSAIQNFTEASDGLHQRLEKLDHHNPLA------V  649

Query  413  RMLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
            R++ND+LM AER F +  G+ GRQ+++H++
Sbjct  650  RIMNDQLMFAERAFTDPLGLPGRQFYRHVI  679



>gb|KDE07172.1| hypothetical protein MVLG_02573 [Microbotryum violaceum p1A1 
Lamole]
Length=911

 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 101/173 (58%), Gaps = 23/173 (13%)
 Frame = +2

Query  50   NSGYTFFLVDFPVYH--TAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLP-F  220
            ++GY+    D PVYH  +++DS  WM  FGDP F+RH+A++ V GL+ L L++E VL   
Sbjct  686  DTGYSALPSD-PVYHYHSSYDSAYWMDHFGDPSFERHVAIAKVLGLVALRLSEERVLNGI  744

Query  221  NYEPYAAELLRYTRSLSGVLEG--------GVSLDPIFDAIRELTaaakaieeeakkLRK  376
            +   YA EL RY + +  V EG          ++  + DAI E+  AA+ +EEE +++  
Sbjct  745  DVLSYARELERYLKKVPSVPEGLQGDREALKDAIKEVGDAIEEVQRAAEELEEETREVED  804

Query  377  DETMAE---------LLILERRM--LNDRLMSAERGFLNTEGVNGRQWFKHLV  502
            D  + E         L  LERR+  +N R  + E+GFL+ +G+ GR+W+K+LV
Sbjct  805  DLRVVEGMFVMESSVLRDLERRVKSINTRRRTFEQGFLDDQGLKGREWYKNLV  857



>ref|XP_006021114.1| PREDICTED: N-acetylated-alpha-linked acidic dipeptidase 2-like 
isoform X4 [Alligator sinensis]
Length=481

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 82/149 (55%), Gaps = 14/149 (9%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +P YH+ +++Y+ + KF DP F+ H+ V+ V G L   LAD  VLPF+   YAA L  YT
Sbjct  280  YPAYHSIYETYEIVEKFYDPTFKNHVTVAQVRGGLVFELADSVVLPFDCRDYAAALSNYT  339

Query  260  RSL--------SGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERR  415
              +        S V +  V+ DP+F A++  T AA          R+ + +     ++ R
Sbjct  340  HIIYNLSKSHQSEVTKYSVTFDPLFSAVKNFTEAAIDFH------RRLQQVDISNPIDVR  393

Query  416  MLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
             LND+LM  ER F++  G+ GR +++H++
Sbjct  394  SLNDQLMLLERAFIDPLGLPGRPFYRHII  422



>emb|CBI23439.3| unnamed protein product [Vitis vinifera]
Length=405

 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            FPVYHTAFDSY+WM   GDP FQRH+A   VWGLL LHL D+ +LPFNY  Y  +L
Sbjct  334  FPVYHTAFDSYNWMTNHGDPLFQRHVAAR-VWGLLALHLVDDPILPFNYVSYTEQL  388



>ref|XP_010646730.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamate carboxypeptidase 
2 [Vitis vinifera]
Length=552

 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            FPVYHTAFDSY+WM   GDP FQRH+A   VWGLL LHL D+ +LPFNY  Y  +L
Sbjct  490  FPVYHTAFDSYNWMTNHGDPLFQRHVAAR-VWGLLALHLVDDPILPFNYVSYTEQL  544



>ref|XP_004868251.1| PREDICTED: N-acetylated-alpha-linked acidic dipeptidase 2 isoform 
X4 [Heterocephalus glaber]
Length=710

 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 83/149 (56%), Gaps = 14/149 (9%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYHT +++++ +  F DP F++ ++V+ + G L   LAD  ++PFN + YA  L  Y 
Sbjct  509  YPVYHTIYETFELVENFYDPMFKKQLSVAQLRGALVYELADSTIIPFNIQDYAKALKNYA  568

Query  260  RSL--------SGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERR  415
             S+          + + GVS D +F A++  + AA        +L  +  +A       R
Sbjct  569  ASIFNLAKKHNQQLTDYGVSFDSLFSAVKNFSEAASDFHRRLTQLDLNNPIA------VR  622

Query  416  MLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
            ++ND+LM  ER F++  G+ GRQ+++H++
Sbjct  623  IMNDQLMLLERAFIDPLGLPGRQFYRHII  651



>ref|XP_004868248.1| PREDICTED: N-acetylated-alpha-linked acidic dipeptidase 2 isoform 
X1 [Heterocephalus glaber]
Length=743

 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 83/149 (56%), Gaps = 14/149 (9%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYHT +++++ +  F DP F++ ++V+ + G L   LAD  ++PFN + YA  L  Y 
Sbjct  542  YPVYHTIYETFELVENFYDPMFKKQLSVAQLRGALVYELADSTIIPFNIQDYAKALKNYA  601

Query  260  RSL--------SGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERR  415
             S+          + + GVS D +F A++  + AA        +L  +  +A       R
Sbjct  602  ASIFNLAKKHNQQLTDYGVSFDSLFSAVKNFSEAASDFHRRLTQLDLNNPIA------VR  655

Query  416  MLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
            ++ND+LM  ER F++  G+ GRQ+++H++
Sbjct  656  IMNDQLMLLERAFIDPLGLPGRQFYRHII  684



>ref|XP_004893553.1| PREDICTED: N-acetylated-alpha-linked acidic dipeptidase 2 isoform 
X3 [Heterocephalus glaber]
Length=707

 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 83/149 (56%), Gaps = 14/149 (9%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYHT +++++ +  F DP F++ ++V+ + G L   LAD  ++PFN + YA  L  Y 
Sbjct  506  YPVYHTIYETFELVENFYDPMFKKQLSVAQLRGALVYELADSTIIPFNIQDYAKALKNYA  565

Query  260  RSL--------SGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERR  415
             S+          + + GVS D +F A++  + AA        +L  +  +A       R
Sbjct  566  ASIFNLAKKHNQQLTDYGVSFDSLFSAVKNFSEAASDFHRRLTQLDLNNPIA------VR  619

Query  416  MLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
            ++ND+LM  ER F++  G+ GRQ+++H++
Sbjct  620  IMNDQLMLLERAFIDPLGLPGRQFYRHII  648



>ref|XP_005307958.1| PREDICTED: N-acetylated-alpha-linked acidic dipeptidase-like 
protein [Chrysemys picta bellii]
Length=746

 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 80/147 (54%), Gaps = 9/147 (6%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLR-Y  256
            +P YHTAFD++D+  +F DP F  H AV+   G + L LAD  VLP N   Y  +L   Y
Sbjct  551  YPAYHTAFDTFDYADRFIDPGFTSHQAVARTAGNVLLRLADSLVLPLNVSDYGEKLDELY  610

Query  257  TRSLSG-----VLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERRML  421
            + +  G     +    +SLDP+  AI    + A    +   KL+K+E+ + L I   RM+
Sbjct  611  SAAAQGDFLDKLNANNLSLDPLKAAIDRFKSVAADFNQRITKLKKEESPSPLQI---RMV  667

Query  422  NDRLMSAERGFLNTEGVNGRQWFKHLV  502
            ND++M  ER FLN +    + ++ H++
Sbjct  668  NDQIMLLERAFLNPQAFPNKYYYSHVI  694



>gb|KEH27222.1| peptidase M28 family protein [Medicago truncatula]
Length=569

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            +PVYH+ +D + WM KFGDP FQRH+A + VWGL+ L LADE  LPFNY  YA EL
Sbjct  501  YPVYHSQYDDFVWMTKFGDPVFQRHVAAASVWGLVALWLADEEFLPFNYSSYAKEL  556



>gb|AFW85117.1| hypothetical protein ZEAMMB73_052433 [Zea mays]
Length=579

 Score = 84.0 bits (206),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  77   DFPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAEL  247
            D+PVYH+ +D + WM KFGDP FQRH+A + +WGL+ L L+DE +LPFNY  YA EL
Sbjct  522  DYPVYHSLYDDFIWMEKFGDPLFQRHVAAASMWGLVALRLSDEEILPFNYSNYATEL  578



>ref|XP_004893556.1| PREDICTED: N-acetylated-alpha-linked acidic dipeptidase 2 isoform 
X6 [Heterocephalus glaber]
 ref|XP_004868254.1| PREDICTED: N-acetylated-alpha-linked acidic dipeptidase 2 isoform 
X7 [Heterocephalus glaber]
Length=559

 Score = 84.0 bits (206),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 83/149 (56%), Gaps = 14/149 (9%)
 Frame = +2

Query  80   FPVYHTAFDSYDWMIKFGDPFFQRHMAVSGVWGLLGLHLADEAVLPFNYEPYAAELLRYT  259
            +PVYHT +++++ +  F DP F++ ++V+ + G L   LAD  ++PFN + YA  L  Y 
Sbjct  358  YPVYHTIYETFELVENFYDPMFKKQLSVAQLRGALVYELADSTIIPFNIQDYAKALKNYA  417

Query  260  RSL--------SGVLEGGVSLDPIFDAIRELTaaakaieeeakkLRKDETMAELLILERR  415
             S+          + + GVS D +F A++  + AA        +L  +  +A       R
Sbjct  418  ASIFNLAKKHNQQLTDYGVSFDSLFSAVKNFSEAASDFHRRLTQLDLNNPIA------VR  471

Query  416  MLNDRLMSAERGFLNTEGVNGRQWFKHLV  502
            ++ND+LM  ER F++  G+ GRQ+++H++
Sbjct  472  IMNDQLMLLERAFIDPLGLPGRQFYRHII  500



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3201701632912