BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19772_g5_i1 len=885 path=[1509:0-315 735:316-884]

Length=885
                                                                      Score     E

ref|XP_002279636.1|  PREDICTED: putative DNA-binding protein ESCA...    112   4e-25   Vitis vinifera
ref|XP_009604907.1|  PREDICTED: putative DNA-binding protein ESCA...    106   3e-23   
ref|XP_007052032.1|  AT-hook motif nuclear-localized protein 22         106   7e-23   
ref|XP_009799054.1|  PREDICTED: putative DNA-binding protein ESCA...    105   1e-22   
emb|CDP17786.1|  unnamed protein product                                103   4e-22   
ref|XP_002301300.1|  DNA-binding family protein                         102   8e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011017502.1|  PREDICTED: putative DNA-binding protein ESCA...    102   8e-22   
gb|KDP28740.1|  hypothetical protein JCGZ_14511                         101   2e-21   
ref|NP_182067.1|  AT-hook motif nuclear-localized protein 22            101   3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002511734.1|  ESC, putative                                    98.2    2e-20   Ricinus communis
ref|XP_004229823.1|  PREDICTED: putative DNA-binding protein ESCA...  96.7    1e-19   
gb|KEH19036.1|  AT hook motif DNA-binding family protein              96.3    1e-19   
ref|XP_002880179.1|  hypothetical protein ARALYDRAFT_903987           96.3    1e-19   
ref|XP_006397724.1|  hypothetical protein EUTSA_v10001760mg           96.3    2e-19   
ref|XP_006296351.1|  hypothetical protein CARUB_v10025523mg           95.9    2e-19   
ref|XP_006339443.1|  PREDICTED: putative DNA-binding protein ESCA...  95.5    2e-19   
ref|XP_010508171.1|  PREDICTED: putative DNA-binding protein ESCA...  95.5    3e-19   
ref|XP_010506485.1|  PREDICTED: putative DNA-binding protein ESCA...  95.5    3e-19   
ref|XP_010518160.1|  PREDICTED: putative DNA-binding protein ESCA...  95.1    3e-19   
ref|XP_004510939.1|  PREDICTED: putative DNA-binding protein ESCA...  93.6    1e-18   
gb|KFK37336.1|  hypothetical protein AALP_AA4G243300                  93.2    1e-18   
gb|EYU29016.1|  hypothetical protein MIMGU_mgv1a023550mg              92.4    2e-18   
ref|XP_010276261.1|  PREDICTED: putative DNA-binding protein ESCA...  92.0    3e-18   
ref|XP_006445233.1|  hypothetical protein CICLE_v10024070mg           92.0    4e-18   
ref|XP_002876587.1|  hypothetical protein ARALYDRAFT_486561           91.3    4e-18   
emb|CDY27387.1|  BnaC04g50180D                                        91.7    5e-18   
ref|XP_009142337.1|  PREDICTED: putative DNA-binding protein ESCA...  91.3    6e-18   
emb|CDY37040.1|  BnaA04g26180D                                        91.3    6e-18   
ref|XP_007134900.1|  hypothetical protein PHAVU_010G085300g           91.3    7e-18   
ref|XP_010523691.1|  PREDICTED: putative DNA-binding protein ESCA...  90.9    8e-18   
ref|XP_011081090.1|  PREDICTED: putative DNA-binding protein ESCA...  90.5    1e-17   
ref|XP_009594477.1|  PREDICTED: putative DNA-binding protein ESCA...  89.4    1e-17   
ref|XP_009778295.1|  PREDICTED: putative DNA-binding protein ESCA...  90.1    2e-17   
ref|XP_006402533.1|  hypothetical protein EUTSA_v10006144mg           89.7    2e-17   
ref|XP_011014152.1|  PREDICTED: putative DNA-binding protein ESCA...  89.4    2e-17   
ref|XP_010324605.1|  PREDICTED: putative DNA-binding protein ESCA...  89.0    4e-17   
ref|XP_006358367.1|  PREDICTED: putative DNA-binding protein ESCA...  88.6    5e-17   
ref|XP_009788952.1|  PREDICTED: putative DNA-binding protein ESCA...  87.4    6e-17   
ref|XP_002303540.1|  DNA-binding family protein                       88.2    7e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011033866.1|  PREDICTED: putative DNA-binding protein ESCA...  88.2    7e-17   
ref|XP_002320066.1|  DNA-binding family protein                       87.8    8e-17   Populus trichocarpa [western balsam poplar]
ref|XP_004306909.1|  PREDICTED: putative DNA-binding protein ESCA...  88.2    8e-17   
ref|XP_010544659.1|  PREDICTED: putative DNA-binding protein ESCA...  87.4    9e-17   
ref|XP_009763802.1|  PREDICTED: putative DNA-binding protein ESCA...  87.8    1e-16   
ref|XP_011034536.1|  PREDICTED: putative DNA-binding protein ESCA...  87.8    1e-16   
ref|XP_009763803.1|  PREDICTED: putative DNA-binding protein ESCA...  87.4    1e-16   
ref|XP_009613222.1|  PREDICTED: putative DNA-binding protein ESCA...  87.0    1e-16   
ref|XP_009613223.1|  PREDICTED: putative DNA-binding protein ESCA...  87.0    1e-16   
ref|XP_003516470.1|  PREDICTED: putative DNA-binding protein ESCA...  87.0    2e-16   
ref|XP_009621304.1|  PREDICTED: putative DNA-binding protein ESCA...  87.0    2e-16   
ref|XP_003521618.1|  PREDICTED: putative DNA-binding protein ESCA...  87.0    2e-16   
gb|KGN56590.1|  hypothetical protein Csa_3G126060                     85.9    2e-16   
ref|XP_002509637.1|  ESC, putative                                    86.3    3e-16   Ricinus communis
ref|XP_011090893.1|  PREDICTED: putative DNA-binding protein ESCA...  86.3    3e-16   
ref|XP_007155606.1|  hypothetical protein PHAVU_003G216200g           85.5    4e-16   
ref|XP_004173725.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...  85.1    4e-16   
ref|XP_004133907.1|  PREDICTED: putative DNA-binding protein ESCA...  85.5    4e-16   
ref|XP_011029110.1|  PREDICTED: putative DNA-binding protein ESCA...  84.7    1e-15   
emb|CDP09863.1|  unnamed protein product                              84.3    1e-15   
ref|XP_007040019.1|  AT-hook DNA-binding family protein               84.3    1e-15   
ref|XP_008466998.1|  PREDICTED: putative DNA-binding protein ESCA...  83.6    2e-15   
ref|XP_010469137.1|  PREDICTED: putative DNA-binding protein ESCA...  83.6    2e-15   
ref|XP_010108102.1|  hypothetical protein L484_023188                 84.0    2e-15   
ref|XP_002299584.2|  DNA-binding family protein                       83.6    3e-15   Populus trichocarpa [western balsam poplar]
ref|XP_004245690.1|  PREDICTED: putative DNA-binding protein ESCA...  83.2    3e-15   
ref|XP_010053890.1|  PREDICTED: putative DNA-binding protein ESCA...  83.2    3e-15   
ref|XP_010325447.1|  PREDICTED: putative DNA-binding protein ESCA...  83.2    3e-15   
emb|CBI34813.3|  unnamed protein product                              82.4    3e-15   
ref|XP_003525782.1|  PREDICTED: putative DNA-binding protein ESCA...  82.8    4e-15   
gb|EYU30571.1|  hypothetical protein MIMGU_mgv1a010755mg              82.4    6e-15   
ref|XP_003549894.1|  PREDICTED: putative DNA-binding protein ESCA...  82.4    6e-15   
ref|XP_004298711.1|  PREDICTED: putative DNA-binding protein ESCA...  82.0    9e-15   
gb|EYU43510.1|  hypothetical protein MIMGU_mgv1a017700mg              82.0    1e-14   
gb|EYU40549.1|  hypothetical protein MIMGU_mgv1a021038mg              82.0    1e-14   
ref|XP_011093194.1|  PREDICTED: putative DNA-binding protein ESCA...  81.3    1e-14   
ref|XP_007158420.1|  hypothetical protein PHAVU_002G151600g           81.3    2e-14   
gb|KDP25577.1|  hypothetical protein JCGZ_20733                       80.9    2e-14   
ref|XP_010053390.1|  PREDICTED: putative DNA-binding protein ESCA...  80.1    4e-14   
ref|XP_010092850.1|  hypothetical protein L484_022445                 80.5    4e-14   
ref|XP_002281296.1|  PREDICTED: putative DNA-binding protein ESCA...  79.3    9e-14   Vitis vinifera
ref|XP_010692273.1|  PREDICTED: putative DNA-binding protein ESCA...  79.3    1e-13   
ref|XP_006363907.1|  PREDICTED: putative DNA-binding protein ESCA...  77.4    1e-13   
ref|XP_009143141.1|  PREDICTED: putative DNA-binding protein ESCA...  78.6    2e-13   
ref|XP_010676637.1|  PREDICTED: putative DNA-binding protein ESCA...  78.2    2e-13   
ref|XP_004242015.1|  PREDICTED: putative DNA-binding protein ESCA...  76.6    2e-13   
ref|XP_006363711.1|  PREDICTED: putative DNA-binding protein ESCA...  77.4    3e-13   
ref|XP_008238673.1|  PREDICTED: putative DNA-binding protein ESCA...  77.8    3e-13   
ref|XP_006851806.1|  hypothetical protein AMTR_s00041p00022450        77.4    4e-13   
ref|XP_008364289.1|  PREDICTED: putative DNA-binding protein ESCA...  77.4    5e-13   
emb|CDX74739.1|  BnaA05g04850D                                        77.4    5e-13   
ref|XP_004145056.1|  PREDICTED: putative DNA-binding protein ESCA...  76.6    5e-13   
ref|XP_008467078.1|  PREDICTED: putative DNA-binding protein ESCA...  75.9    1e-12   
ref|XP_008232681.1|  PREDICTED: putative DNA-binding protein ESCA...  75.9    2e-12   
ref|XP_009420779.1|  PREDICTED: putative DNA-binding protein ESCA...  75.9    2e-12   
ref|XP_006851807.1|  hypothetical protein AMTR_s00041p00025000        75.9    2e-12   
emb|CDY18931.1|  BnaC04g04190D                                        75.5    2e-12   
ref|XP_008804006.1|  PREDICTED: putative DNA-binding protein ESCA...  75.9    2e-12   
gb|KHN09773.1|  Putative DNA-binding protein ESCAROLA                 73.9    3e-12   
ref|NP_194012.1|  putative AT-hook DNA-binding family protein         75.5    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003517441.1|  PREDICTED: putative DNA-binding protein ESCA...  75.1    3e-12   
ref|XP_003538721.1|  PREDICTED: putative DNA-binding protein ESCA...  74.7    4e-12   
ref|XP_006440441.1|  hypothetical protein CICLE_v10021296mg           74.7    4e-12   
ref|XP_006477312.1|  PREDICTED: putative DNA-binding protein ESCA...  74.3    5e-12   
ref|XP_008346594.1|  PREDICTED: putative DNA-binding protein ESCA...  74.3    5e-12   
ref|XP_008373872.1|  PREDICTED: putative DNA-binding protein ESCA...  74.3    6e-12   
ref|XP_010448831.1|  PREDICTED: putative DNA-binding protein ESCA...  74.3    6e-12   
ref|XP_010439279.1|  PREDICTED: putative DNA-binding protein ESCA...  74.3    6e-12   
ref|XP_007220373.1|  hypothetical protein PRUPE_ppa018314mg           74.3    7e-12   
gb|KDO85858.1|  hypothetical protein CISIN_1g047830mg                 73.6    1e-11   
gb|KFK28863.1|  hypothetical protein AALP_AA7G058200                  73.6    1e-11   
ref|XP_009382863.1|  PREDICTED: putative DNA-binding protein ESCA...  73.2    1e-11   
ref|XP_004511639.1|  PREDICTED: putative DNA-binding protein ESCA...  72.4    1e-11   
gb|ABL63118.1|  AT-hook DNA-binding protein                           73.2    1e-11   Catharanthus roseus [chatas]
ref|XP_004511638.1|  PREDICTED: putative DNA-binding protein ESCA...  72.8    2e-11   
ref|XP_002869805.1|  hypothetical protein ARALYDRAFT_492588           72.8    2e-11   
ref|XP_010277406.1|  PREDICTED: putative DNA-binding protein ESCA...  71.6    3e-11   
ref|XP_010433825.1|  PREDICTED: putative DNA-binding protein ESCA...  72.0    4e-11   
ref|XP_009393002.1|  PREDICTED: putative DNA-binding protein ESCA...  71.6    5e-11   
dbj|BAF02122.1|  putative DNA binding protein                         72.0    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433987.1|  PREDICTED: putative DNA-binding protein ESCA...  70.9    1e-10   
ref|XP_010455638.1|  PREDICTED: putative DNA-binding protein ESCA...  70.9    1e-10   
emb|CDX82978.1|  BnaC01g14280D                                        69.7    3e-10   
gb|EPS64135.1|  hypothetical protein M569_10646                       69.3    3e-10   
gb|EPS68305.1|  hypothetical protein M569_06465                       67.8    3e-10   
gb|KHM98878.1|  hypothetical protein glysoja_040099                   65.5    4e-10   
ref|XP_004172826.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...  69.3    4e-10   
ref|XP_004147565.1|  PREDICTED: putative DNA-binding protein ESCA...  69.3    4e-10   
ref|XP_010908279.1|  PREDICTED: putative DNA-binding protein ESCA...  68.9    4e-10   
ref|XP_010917984.1|  PREDICTED: putative DNA-binding protein ESCA...  68.6    5e-10   
ref|XP_008811429.1|  PREDICTED: putative DNA-binding protein ESCA...  68.6    5e-10   
emb|CDY41289.1|  BnaA01g12500D                                        68.6    6e-10   
gb|KHN40136.1|  hypothetical protein glysoja_028757                   64.7    7e-10   
ref|XP_010422173.1|  PREDICTED: putative DNA-binding protein ESCA...  68.6    9e-10   
ref|XP_010262897.1|  PREDICTED: putative DNA-binding protein ESCA...  68.2    1e-09   
ref|NP_192942.1|  putative AT-hook DNA-binding family protein         68.2    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008437165.1|  PREDICTED: putative DNA-binding protein ESCA...  67.4    2e-09   
ref|XP_009136213.1|  PREDICTED: putative DNA-binding protein ESCA...  66.6    3e-09   
ref|XP_006289235.1|  hypothetical protein CARUB_v10002691mg           66.6    4e-09   
ref|XP_008791267.1|  PREDICTED: putative DNA-binding protein ESCA...  66.2    4e-09   
ref|XP_006284928.1|  hypothetical protein CARUB_v10006227mg           66.2    5e-09   
ref|XP_006413619.1|  hypothetical protein EUTSA_v10025672mg           66.2    6e-09   
ref|XP_010940981.1|  PREDICTED: putative DNA-binding protein ESCA...  65.9    6e-09   
ref|XP_002874744.1|  hypothetical protein ARALYDRAFT_490024           65.9    7e-09   
ref|XP_010540129.1|  PREDICTED: putative DNA-binding protein ESCA...  65.1    1e-08   
ref|NP_191646.1|  AT-hook motif nuclear-localized protein 18          64.3    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001056730.1|  Os06g0136900                                     65.1    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010934543.1|  PREDICTED: putative DNA-binding protein ESCA...  64.7    2e-08   
ref|XP_010038368.1|  PREDICTED: putative DNA-binding protein ESCA...  61.6    2e-08   
ref|XP_006846339.1|  hypothetical protein AMTR_s00012p00257450        63.9    2e-08   
ref|XP_002529315.1|  DNA binding protein, putative                    63.9    2e-08   Ricinus communis
gb|ABZ89182.1|  putative protein                                      63.9    3e-08   Coffea canephora [robusta coffee]
ref|NP_001046754.1|  Os02g0448000                                     63.9    3e-08   Oryza sativa Japonica Group [Japonica rice]
gb|ADY38789.1|  DNA-binding protein                                   63.5    3e-08   
ref|NP_001141263.1|  hypothetical protein                             63.5    3e-08   Zea mays [maize]
ref|XP_008805810.1|  PREDICTED: putative DNA-binding protein ESCA...  63.2    4e-08   
emb|CDY04391.1|  BnaC02g28570D                                        63.5    4e-08   
ref|XP_010532413.1|  PREDICTED: putative DNA-binding protein ESCA...  63.2    5e-08   
ref|XP_004952401.1|  PREDICTED: putative DNA-binding protein ESCA...  63.2    5e-08   
ref|XP_006420137.1|  hypothetical protein CICLE_v10005603mg           62.4    7e-08   
gb|KDP40294.1|  hypothetical protein JCGZ_02292                       60.8    7e-08   
ref|XP_002451872.1|  hypothetical protein SORBIDRAFT_04g009050        62.8    7e-08   Sorghum bicolor [broomcorn]
gb|AEX12482.1|  hypothetical protein 2_3808_01                        60.1    7e-08   
ref|XP_006647239.1|  PREDICTED: putative DNA-binding protein ESCA...  62.4    8e-08   
ref|XP_006396802.1|  hypothetical protein EUTSA_v10029174mg           62.8    8e-08   
ref|XP_009411479.1|  PREDICTED: putative DNA-binding protein ESCA...  62.4    1e-07   
ref|XP_011070911.1|  PREDICTED: putative DNA-binding protein ESCA...  61.6    1e-07   
ref|XP_010920512.1|  PREDICTED: putative DNA-binding protein ESCA...  62.4    1e-07   
ref|XP_010035901.1|  PREDICTED: putative DNA-binding protein ESCA...  61.2    1e-07   
gb|EEE65050.1|  hypothetical protein OsJ_20047                        60.1    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006591349.1|  PREDICTED: putative DNA-binding protein ESCA...  61.6    1e-07   
ref|XP_007043111.1|  AT-hook DNA-binding family protein, putative     61.6    2e-07   
ref|XP_010538771.1|  PREDICTED: putative DNA-binding protein ESCA...  61.6    2e-07   
gb|KDO42746.1|  hypothetical protein CISIN_1g040245mg                 61.2    2e-07   
ref|XP_006292551.1|  hypothetical protein CARUB_v10018786mg           60.8    2e-07   
dbj|BAK03205.1|  predicted protein                                    61.2    2e-07   
ref|XP_006601994.1|  PREDICTED: putative DNA-binding protein ESCA...  61.2    2e-07   
ref|XP_006477506.1|  PREDICTED: putative DNA-binding protein ESCA...  61.2    3e-07   
gb|KEH34733.1|  AT hook motif DNA-binding family protein              60.8    3e-07   
ref|XP_011029905.1|  PREDICTED: putative DNA-binding protein ESCA...  60.8    3e-07   
ref|XP_010257112.1|  PREDICTED: putative DNA-binding protein ESCA...  61.2    3e-07   
ref|XP_010032377.1|  PREDICTED: putative DNA-binding protein ESCA...  60.8    3e-07   
ref|XP_008229461.1|  PREDICTED: putative DNA-binding protein ESCA...  60.5    3e-07   
ref|XP_006656611.1|  PREDICTED: putative DNA-binding protein ESCA...  60.1    4e-07   
ref|NP_001146992.1|  DNA binding protein                              60.5    4e-07   Zea mays [maize]
ref|XP_003573204.1|  PREDICTED: putative DNA-binding protein ESCA...  60.5    4e-07   
ref|XP_008801621.1|  PREDICTED: putative DNA-binding protein ESCA...  60.5    5e-07   
gb|KGN63864.1|  hypothetical protein Csa_1G024960                     57.4    5e-07   
gb|EPS65599.1|  hypothetical protein M569_09178                       58.9    5e-07   
emb|CDP06170.1|  unnamed protein product                              59.3    7e-07   
ref|XP_004964470.1|  PREDICTED: putative DNA-binding protein ESCA...  59.7    8e-07   
ref|XP_002437782.1|  hypothetical protein SORBIDRAFT_10g002490        59.7    9e-07   Sorghum bicolor [broomcorn]
emb|CBI35166.3|  unnamed protein product                              58.9    9e-07   
ref|XP_002312579.2|  hypothetical protein POPTR_0008s16440g           59.3    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_011094152.1|  PREDICTED: putative DNA-binding protein ESCA...  58.5    1e-06   
ref|XP_007218339.1|  hypothetical protein PRUPE_ppa008610mg           59.3    1e-06   
ref|XP_006847733.1|  hypothetical protein AMTR_s00149p00093420        58.9    1e-06   
ref|XP_003611214.1|  AT-hook DNA-binding protein                      58.9    1e-06   
ref|XP_010024974.1|  PREDICTED: putative DNA-binding protein ESCA...  58.5    2e-06   
ref|XP_010320485.1|  PREDICTED: putative DNA-binding protein ESCA...  57.8    2e-06   
ref|XP_008233653.1|  PREDICTED: putative DNA-binding protein ESCA...  58.5    2e-06   
ref|XP_010090728.1|  hypothetical protein L484_013750                 58.2    2e-06   
gb|KFK31952.1|  hypothetical protein AALP_AA6G181300                  58.5    2e-06   
emb|CBI31637.3|  unnamed protein product                              58.2    2e-06   
ref|XP_010102152.1|  hypothetical protein L484_021386                 57.8    2e-06   
ref|XP_011085041.1|  PREDICTED: putative DNA-binding protein ESCA...  58.2    2e-06   
emb|CAN75757.1|  hypothetical protein VITISV_028561                   58.2    2e-06   Vitis vinifera
ref|XP_008380207.1|  PREDICTED: putative DNA-binding protein ESCA...  57.8    3e-06   
ref|XP_009137280.1|  PREDICTED: putative DNA-binding protein ESCA...  58.2    3e-06   
ref|XP_010658536.1|  PREDICTED: putative DNA-binding protein ESCA...  58.2    3e-06   
ref|XP_004305833.1|  PREDICTED: putative DNA-binding protein ESCA...  57.8    3e-06   
ref|XP_004137338.1|  PREDICTED: uncharacterized protein LOC101219306  58.2    3e-06   
ref|XP_003536146.1|  PREDICTED: putative DNA-binding protein ESCA...  57.8    3e-06   
emb|CDX94128.1|  BnaC07g37620D                                        57.8    3e-06   
ref|XP_009775204.1|  PREDICTED: putative DNA-binding protein ESCA...  57.4    3e-06   
emb|CDX98771.1|  BnaA03g45560D                                        57.8    3e-06   
ref|XP_003556450.2|  PREDICTED: putative DNA-binding protein ESCA...  57.4    3e-06   
ref|XP_004160444.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...  57.4    3e-06   
ref|XP_008453469.1|  PREDICTED: putative DNA-binding protein ESCA...  57.4    3e-06   
gb|AFW75435.1|  hypothetical protein ZEAMMB73_958269                  58.2    3e-06   
gb|KDP42477.1|  hypothetical protein JCGZ_00274                       58.5    3e-06   
ref|XP_009391843.1|  PREDICTED: putative DNA-binding protein ESCA...  57.4    4e-06   
ref|XP_007035040.1|  AT-hook motif nuclear localized protein 20       57.0    4e-06   
ref|XP_011030530.1|  PREDICTED: putative DNA-binding protein ESCA...  57.0    6e-06   
ref|XP_007048865.1|  AT-hook DNA-binding family protein               56.6    6e-06   
ref|XP_009356620.1|  PREDICTED: putative DNA-binding protein ESCA...  56.6    7e-06   
ref|XP_009139154.1|  PREDICTED: putative DNA-binding protein ESCA...  56.6    7e-06   
ref|XP_002314642.2|  hypothetical protein POPTR_0010s08500g           56.6    8e-06   Populus trichocarpa [western balsam poplar]
ref|XP_007144002.1|  hypothetical protein PHAVU_007G120900g           56.2    8e-06   
ref|XP_010554616.1|  PREDICTED: putative DNA-binding protein ESCA...  56.6    9e-06   
ref|XP_010940763.1|  PREDICTED: putative DNA-binding protein ESCA...  56.6    9e-06   
ref|XP_008799138.1|  PREDICTED: putative DNA-binding protein ESCA...  56.2    1e-05   
ref|XP_007009270.1|  AT-hook protein of GA feedback 2                 56.2    1e-05   
ref|XP_010262258.1|  PREDICTED: putative DNA-binding protein ESCA...  55.8    1e-05   
ref|XP_004238464.1|  PREDICTED: putative DNA-binding protein ESCA...  55.5    1e-05   
ref|XP_008796249.1|  PREDICTED: putative DNA-binding protein ESCA...  56.2    1e-05   
ref|XP_010918771.1|  PREDICTED: putative DNA-binding protein ESCA...  55.5    1e-05   
gb|EYU41285.1|  hypothetical protein MIMGU_mgv1a025243mg              55.8    1e-05   
ref|XP_006435633.1|  hypothetical protein CICLE_v10032034mg           56.2    1e-05   
emb|CDP00129.1|  unnamed protein product                              55.8    1e-05   
ref|XP_007144108.1|  hypothetical protein PHAVU_007G129400g           55.8    1e-05   
ref|XP_010694781.1|  PREDICTED: putative DNA-binding protein ESCA...  55.8    1e-05   
ref|XP_010266286.1|  PREDICTED: putative DNA-binding protein ESCA...  55.8    1e-05   
ref|XP_008780228.1|  PREDICTED: putative DNA-binding protein ESCA...  55.5    1e-05   
gb|AGC22550.1|  male sterility related AT-hook DNA binding protein    55.5    1e-05   
ref|XP_011038532.1|  PREDICTED: putative DNA-binding protein ESCA...  55.8    1e-05   
ref|XP_010524099.1|  PREDICTED: putative DNA-binding protein ESCA...  55.5    1e-05   
ref|XP_006408178.1|  hypothetical protein EUTSA_v10021166mg           55.8    1e-05   
emb|CDX83510.1|  BnaA03g19960D                                        56.2    1e-05   
gb|ABL63119.1|  AT-hook DNA-binding protein                           55.5    1e-05   Catharanthus roseus [chatas]
gb|KCW61537.1|  hypothetical protein EUGRSUZ_H04257                   55.5    1e-05   
emb|CDY21124.1|  BnaA01g33550D                                        55.5    2e-05   
gb|KDO60958.1|  hypothetical protein CISIN_1g040216mg                 55.5    2e-05   
ref|XP_006589299.1|  PREDICTED: putative DNA-binding protein ESCA...  55.8    2e-05   
ref|XP_002279677.2|  PREDICTED: putative DNA-binding protein ESCA...  55.5    2e-05   Vitis vinifera
ref|XP_006437176.1|  hypothetical protein CICLE_v10032444mg           55.5    2e-05   
ref|XP_004147679.1|  PREDICTED: putative DNA-binding protein ESCA...  55.5    2e-05   
ref|XP_010055327.1|  PREDICTED: putative DNA-binding protein ESCA...  55.5    2e-05   
emb|CDY02949.1|  BnaC04g25370D                                        55.5    2e-05   
gb|KCW71795.1|  hypothetical protein EUGRSUZ_E00284                   55.5    2e-05   
ref|XP_010927299.1|  PREDICTED: putative DNA-binding protein ESCA...  55.5    2e-05   
ref|XP_002273442.1|  PREDICTED: putative DNA-binding protein ESCA...  55.5    2e-05   Vitis vinifera
emb|CDY42810.1|  BnaC03g23960D                                        55.8    2e-05   
ref|XP_009103966.1|  PREDICTED: putative DNA-binding protein ESCA...  55.1    2e-05   
ref|XP_002319649.1|  DNA-binding family protein                       55.5    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_007155775.1|  hypothetical protein PHAVU_003G230600g           55.1    2e-05   
gb|KHN30735.1|  Putative DNA-binding protein ESCAROLA                 55.1    2e-05   
emb|CDY49327.1|  BnaA05g32890D                                        55.1    2e-05   
ref|XP_009103959.1|  PREDICTED: putative DNA-binding protein ESCA...  55.1    2e-05   
ref|XP_003590930.1|  DNA-binding protein                              55.1    2e-05   
emb|CDY53687.1|  BnaA07g37810D                                        55.1    2e-05   
ref|XP_004503162.1|  PREDICTED: putative DNA-binding protein ESCA...  55.1    3e-05   
gb|AFK41919.1|  unknown                                               55.1    3e-05   
ref|XP_009607803.1|  PREDICTED: putative DNA-binding protein ESCA...  55.1    3e-05   
ref|XP_009123977.1|  PREDICTED: putative DNA-binding protein ESCA...  55.1    3e-05   
emb|CAN61523.1|  hypothetical protein VITISV_016751                   54.3    3e-05   Vitis vinifera
ref|XP_002271606.1|  PREDICTED: putative DNA-binding protein ESCA...  54.7    3e-05   Vitis vinifera
gb|EYU19935.1|  hypothetical protein MIMGU_mgv1a017709mg              54.7    3e-05   
ref|XP_010941441.1|  PREDICTED: putative DNA-binding protein ESCA...  52.0    4e-05   
gb|AFK45154.1|  unknown                                               51.6    4e-05   
ref|XP_004954422.1|  PREDICTED: putative DNA-binding protein ESCA...  54.3    4e-05   
ref|XP_009589526.1|  PREDICTED: putative DNA-binding protein ESCA...  54.7    4e-05   
ref|XP_008353637.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    4e-05   
emb|CDX84222.1|  BnaC04g09840D                                        53.1    4e-05   
ref|XP_011002630.1|  PREDICTED: putative DNA-binding protein ESCA...  54.7    4e-05   
ref|XP_002315208.2|  hypothetical protein POPTR_0010s20780g           54.7    4e-05   
ref|XP_009351431.1|  PREDICTED: putative DNA-binding protein ESCA...  54.3    4e-05   
ref|XP_008362336.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    4e-05   
ref|XP_002312113.2|  hypothetical protein POPTR_0008s05890g           54.7    4e-05   
ref|XP_008342359.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    4e-05   
ref|XP_004161914.1|  PREDICTED: putative DNA-binding protein ESCA...  54.3    4e-05   
ref|XP_007141404.1|  hypothetical protein PHAVU_008G192600g           54.3    4e-05   
ref|XP_009133560.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    4e-05   
ref|XP_009377422.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    5e-05   
ref|XP_010907805.1|  PREDICTED: putative DNA-binding protein ESCA...  54.3    5e-05   
ref|XP_011086333.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    5e-05   
ref|XP_010923237.1|  PREDICTED: putative DNA-binding protein ESCA...  54.3    5e-05   
ref|XP_009344356.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    5e-05   
emb|CDY12779.1|  BnaC04g28620D                                        53.9    5e-05   
ref|XP_006293018.1|  hypothetical protein CARUB_v10019296mg           53.9    6e-05   
ref|XP_004302076.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    6e-05   
emb|CDO99189.1|  unnamed protein product                              53.9    6e-05   
ref|XP_010243718.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    6e-05   
ref|XP_010516134.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    6e-05   
ref|XP_010435119.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    6e-05   
ref|XP_009589802.1|  PREDICTED: putative DNA-binding protein ESCA...  53.5    6e-05   
ref|XP_008461695.1|  PREDICTED: putative DNA-binding protein ESCA...  53.5    7e-05   
ref|NP_567432.1|  AT-hook motif nuclear-localized protein 20          53.5    7e-05   
gb|AAM65129.1|  putative DNA-binding protein                          53.5    7e-05   
ref|XP_010275243.1|  PREDICTED: putative DNA-binding protein ESCA...  53.5    7e-05   
ref|XP_010104063.1|  hypothetical protein L484_008144                 53.9    7e-05   
ref|XP_010440458.1|  PREDICTED: putative DNA-binding protein ESCA...  53.5    7e-05   
ref|XP_009379018.1|  PREDICTED: putative DNA-binding protein ESCA...  53.5    7e-05   
ref|XP_010450033.1|  PREDICTED: putative DNA-binding protein ESCA...  53.5    8e-05   
ref|XP_010274873.1|  PREDICTED: putative DNA-binding protein ESCA...  53.5    8e-05   
ref|XP_009794976.1|  PREDICTED: putative DNA-binding protein ESCA...  53.1    8e-05   
ref|XP_008794313.1|  PREDICTED: putative DNA-binding protein ESCA...  53.5    8e-05   
ref|XP_010437478.1|  PREDICTED: putative DNA-binding protein ESCA...  53.5    8e-05   
tpg|DAA36260.1|  TPA: hypothetical protein ZEAMMB73_652841            53.5    9e-05   
ref|XP_009384866.1|  PREDICTED: putative DNA-binding protein ESCA...  53.5    9e-05   
ref|XP_010506134.1|  PREDICTED: putative DNA-binding protein ESCA...  53.1    9e-05   
ref|XP_010516702.1|  PREDICTED: putative DNA-binding protein ESCA...  53.1    9e-05   
ref|XP_010508503.1|  PREDICTED: putative DNA-binding protein ESCA...  53.1    9e-05   
ref|NP_181070.1|  protein GIANT KILLER                                53.1    9e-05   
ref|XP_010509635.1|  PREDICTED: putative DNA-binding protein ESCA...  53.1    9e-05   
ref|XP_010505030.1|  PREDICTED: putative DNA-binding protein ESCA...  53.1    9e-05   
ref|XP_010432287.1|  PREDICTED: putative DNA-binding protein ESCA...  53.1    9e-05   
ref|XP_009592710.1|  PREDICTED: putative DNA-binding protein ESCA...  53.1    1e-04   
ref|XP_010270573.1|  PREDICTED: putative DNA-binding protein ESCA...  53.1    1e-04   
ref|XP_002879544.1|  hypothetical protein ARALYDRAFT_482492           53.1    1e-04   
ref|XP_006296261.1|  hypothetical protein CARUB_v10025435mg           53.1    1e-04   
ref|XP_011074056.1|  PREDICTED: putative DNA-binding protein ESCA...  53.1    1e-04   
emb|CDY60321.1|  BnaCnng36000D                                        53.1    1e-04   
ref|XP_008391057.1|  PREDICTED: putative DNA-binding protein ESCA...  53.1    1e-04   
ref|XP_010677251.1|  PREDICTED: putative DNA-binding protein ESCA...  53.1    1e-04   
ref|XP_010446930.1|  PREDICTED: putative DNA-binding protein ESCA...  53.1    1e-04   
ref|XP_002448423.1|  hypothetical protein SORBIDRAFT_06g026940        53.1    1e-04   
ref|XP_002468116.1|  hypothetical protein SORBIDRAFT_01g039840        52.8    1e-04   
ref|XP_002524209.1|  ESC, putative                                    53.1    1e-04   
ref|XP_010935004.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...  52.8    1e-04   
ref|XP_008668970.1|  PREDICTED: putative DNA-binding protein ESCA...  52.8    1e-04   
ref|XP_006588553.1|  PREDICTED: putative DNA-binding protein ESCA...  52.4    1e-04   
ref|XP_009402315.1|  PREDICTED: putative DNA-binding protein ESCA...  52.8    1e-04   
gb|EPS62166.1|  hypothetical protein M569_12627                       51.6    1e-04   
ref|XP_004976643.1|  PREDICTED: putative DNA-binding protein ESCA...  52.8    1e-04   
emb|CDY30003.1|  BnaC01g40050D                                        52.8    1e-04   
ref|XP_009774038.1|  PREDICTED: putative DNA-binding protein ESCA...  52.8    1e-04   
ref|XP_009616004.1|  PREDICTED: putative DNA-binding protein ESCA...  52.4    1e-04   
ref|XP_003570419.1|  PREDICTED: putative DNA-binding protein ESCA...  52.4    2e-04   
ref|NP_001150826.1|  DNA-binding protein                              52.4    2e-04   
ref|XP_008788674.1|  PREDICTED: putative DNA-binding protein ESCA...  52.8    2e-04   
gb|AFW74083.1|  DNA-binding protein                                   52.0    2e-04   
ref|XP_009399398.1|  PREDICTED: putative DNA-binding protein ESCA...  52.4    2e-04   
ref|XP_009762421.1|  PREDICTED: putative DNA-binding protein ESCA...  52.4    2e-04   
emb|CDP09327.1|  unnamed protein product                              52.4    2e-04   
ref|XP_004491337.1|  PREDICTED: putative DNA-binding protein ESCA...  52.0    2e-04   
ref|XP_003617443.1|  hypothetical protein MTR_5g091630                52.0    2e-04   
ref|XP_009142892.1|  PREDICTED: putative DNA-binding protein ESCA...  52.0    2e-04   
ref|XP_010548186.1|  PREDICTED: putative DNA-binding protein ESCA...  52.0    2e-04   
ref|XP_004307477.1|  PREDICTED: putative DNA-binding protein ESCA...  52.4    2e-04   
ref|XP_009386251.1|  PREDICTED: putative DNA-binding protein ESCA...  52.4    2e-04   
ref|XP_009399397.1|  PREDICTED: putative DNA-binding protein ESCA...  52.4    2e-04   
emb|CDY53650.1|  BnaC04g52840D                                        52.0    2e-04   
ref|XP_009409024.1|  PREDICTED: putative DNA-binding protein ESCA...  52.4    2e-04   
emb|CDX79838.1|  BnaA05g03180D                                        52.0    2e-04   
ref|XP_002444566.1|  hypothetical protein SORBIDRAFT_07g023830        50.4    2e-04   
emb|CDY31677.1|  BnaA05g08700D                                        51.2    2e-04   
ref|XP_006295752.1|  hypothetical protein CARUB_v10024872mg           52.0    2e-04   
ref|XP_006655164.1|  PREDICTED: putative DNA-binding protein ESCA...  52.0    2e-04   
ref|XP_010506133.1|  PREDICTED: putative DNA-binding protein ESCA...  52.0    2e-04   
ref|NP_181822.1|  AT-hook motif nuclear-localized protein 16          52.0    2e-04   
ref|XP_010269998.1|  PREDICTED: putative DNA-binding protein ESCA...  52.0    2e-04   
ref|XP_006487869.1|  PREDICTED: putative DNA-binding protein ESCA...  52.0    2e-04   
ref|XP_006442718.1|  hypothetical protein CICLE_v10023369mg           52.0    2e-04   
ref|XP_006411566.1|  hypothetical protein EUTSA_v10017103mg           52.0    2e-04   
dbj|BAK02723.1|  predicted protein                                    52.0    2e-04   
ref|XP_002881881.1|  DNA-binding family protein                       52.0    2e-04   
ref|XP_010690586.1|  PREDICTED: putative DNA-binding protein ESCA...  51.6    2e-04   
ref|XP_011041154.1|  PREDICTED: putative DNA-binding protein ESCA...  52.0    2e-04   
ref|XP_008237909.1|  PREDICTED: putative DNA-binding protein ESCA...  52.0    2e-04   
ref|XP_006354520.1|  PREDICTED: putative DNA-binding protein ESCA...  52.0    3e-04   
ref|XP_007210817.1|  hypothetical protein PRUPE_ppa020689mg           52.0    3e-04   
ref|XP_008460074.1|  PREDICTED: putative DNA-binding protein ESCA...  52.0    3e-04   
ref|XP_002300879.2|  hypothetical protein POPTR_0002s06030g           51.6    3e-04   
ref|XP_004296621.1|  PREDICTED: putative DNA-binding protein ESCA...  51.6    3e-04   
ref|XP_006342185.1|  PREDICTED: putative DNA-binding protein ESCA...  50.8    3e-04   
ref|XP_004153985.1|  PREDICTED: putative DNA-binding protein ESCA...  51.6    3e-04   
ref|XP_004145070.1|  PREDICTED: putative DNA-binding protein ESCA...  51.6    3e-04   
ref|XP_008460731.1|  PREDICTED: putative DNA-binding protein ESCA...  51.6    3e-04   
ref|XP_011026257.1|  PREDICTED: putative DNA-binding protein ESCA...  51.6    3e-04   
ref|XP_004495563.1|  PREDICTED: putative DNA-binding protein ESCA...  51.6    3e-04   
ref|XP_010531743.1|  PREDICTED: putative DNA-binding protein ESCA...  51.6    3e-04   
ref|XP_003568662.1|  PREDICTED: putative DNA-binding protein ESCA...  51.6    3e-04   
ref|XP_006576099.1|  PREDICTED: putative DNA-binding protein ESCA...  51.2    3e-04   
gb|ACU24276.1|  unknown                                               51.2    3e-04   
ref|XP_010497513.1|  PREDICTED: putative DNA-binding protein ESCA...  50.4    3e-04   
ref|XP_009141480.1|  PREDICTED: putative DNA-binding protein ESCA...  51.6    3e-04   
ref|XP_004144628.1|  PREDICTED: putative DNA-binding protein ESCA...  51.2    3e-04   
gb|KGN43375.1|  hypothetical protein Csa_7G029400                     50.8    3e-04   
ref|XP_008799381.1|  PREDICTED: putative DNA-binding protein ESCA...  51.6    3e-04   
gb|KDP46909.1|  hypothetical protein JCGZ_10400                       51.2    3e-04   
ref|XP_002307001.2|  hypothetical protein POPTR_0005s27850g           51.6    3e-04   
ref|XP_010534520.1|  PREDICTED: putative DNA-binding protein ESCA...  51.6    3e-04   
gb|KDP36737.1|  hypothetical protein JCGZ_08028                       51.6    4e-04   
ref|XP_004984928.1|  PREDICTED: putative DNA-binding protein ESCA...  51.2    4e-04   
ref|XP_009133171.1|  PREDICTED: putative DNA-binding protein ESCA...  51.2    4e-04   
gb|AIV43385.1|  AHL protein                                           51.2    4e-04   
ref|NP_001151240.1|  DNA-binding protein                              51.2    4e-04   
emb|CDY72485.1|  BnaCnng77890D                                        51.2    4e-04   
tpg|DAA48555.1|  TPA: hypothetical protein ZEAMMB73_420043            51.2    4e-04   
ref|XP_006606925.1|  PREDICTED: putative DNA-binding protein ESCA...  51.6    4e-04   
ref|XP_011100032.1|  PREDICTED: putative DNA-binding protein ESCA...  51.6    4e-04   
ref|XP_009143684.1|  PREDICTED: putative DNA-binding protein ESCA...  51.2    4e-04   
gb|KHN01050.1|  Putative DNA-binding protein ESCAROLA                 51.2    4e-04   
emb|CDX79599.1|  BnaC03g19350D                                        51.2    4e-04   
ref|XP_004492894.1|  PREDICTED: putative DNA-binding protein ESCA...  51.2    4e-04   
ref|XP_009403254.1|  PREDICTED: putative DNA-binding protein ESCA...  51.2    4e-04   
ref|XP_003534486.1|  PREDICTED: putative DNA-binding protein ESCA...  51.2    4e-04   
ref|XP_004247701.1|  PREDICTED: putative DNA-binding protein ESCA...  51.2    4e-04   
ref|XP_002510734.1|  DNA binding protein, putative                    51.2    4e-04   
ref|XP_008371927.1|  PREDICTED: putative DNA-binding protein ESCA...  51.2    4e-04   
gb|KHN38329.1|  Putative DNA-binding protein ESCAROLA                 51.2    4e-04   
ref|XP_008681074.1|  PREDICTED: DNA-binding protein isoform X1        51.2    4e-04   
ref|XP_006342184.1|  PREDICTED: putative DNA-binding protein ESCA...  50.8    4e-04   
gb|KFK37871.1|  hypothetical protein AALP_AA3G040100                  51.2    5e-04   
ref|XP_007141856.1|  hypothetical protein PHAVU_008G231500g           50.8    5e-04   
gb|AAY86771.1|  putative DNA-binding protein                          51.2    5e-04   
ref|NP_001152652.1|  DNA-binding protein                              50.8    5e-04   
ref|XP_010063173.1|  PREDICTED: putative DNA-binding protein ESCA...  50.8    5e-04   
ref|XP_010485835.1|  PREDICTED: putative DNA-binding protein ESCA...  51.2    5e-04   
ref|XP_007226723.1|  hypothetical protein PRUPE_ppa019745mg           50.8    5e-04   
ref|XP_010463937.1|  PREDICTED: putative DNA-binding protein ESCA...  51.2    5e-04   
ref|XP_010416191.1|  PREDICTED: putative DNA-binding protein ESCA...  51.2    5e-04   
gb|KFK36425.1|  hypothetical protein AALP_AA4G122700                  50.8    5e-04   
gb|KCW70368.1|  hypothetical protein EUGRSUZ_F03609                   50.8    5e-04   
ref|XP_006285829.1|  hypothetical protein CARUB_v10007306mg           50.8    5e-04   
gb|EPS65852.1|  hypothetical protein M569_08925                       50.8    5e-04   
ref|XP_002882363.1|  hypothetical protein ARALYDRAFT_477713           51.2    5e-04   
ref|NP_566232.1|  AT-hook motif nuclear-localized protein             51.2    5e-04   
ref|XP_008224392.1|  PREDICTED: putative DNA-binding protein ESCA...  50.8    5e-04   
gb|KHN11964.1|  Putative DNA-binding protein ESCAROLA                 50.4    5e-04   
ref|XP_010063174.1|  PREDICTED: putative DNA-binding protein ESCA...  50.8    5e-04   
ref|XP_003518506.2|  PREDICTED: putative DNA-binding protein ESCA...  50.4    6e-04   
ref|XP_011033055.1|  PREDICTED: putative DNA-binding protein ESCA...  50.8    6e-04   
ref|XP_002870310.1|  hypothetical protein ARALYDRAFT_493459           50.8    6e-04   
ref|XP_006595755.1|  PREDICTED: putative DNA-binding protein ESCA...  50.4    6e-04   
emb|CDY64701.1|  BnaCnng44570D                                        50.8    6e-04   
ref|XP_006410687.1|  hypothetical protein EUTSA_v10017027mg           50.8    6e-04   
ref|XP_007163438.1|  hypothetical protein PHAVU_001G234600g           50.8    6e-04   
ref|XP_003524711.1|  PREDICTED: putative DNA-binding protein ESCA...  50.4    6e-04   
emb|CDP07852.1|  unnamed protein product                              48.9    6e-04   
ref|XP_002527105.1|  DNA binding protein, putative                    50.4    7e-04   
ref|XP_008803114.1|  PREDICTED: putative DNA-binding protein ESCA...  50.4    7e-04   
ref|XP_009379269.1|  PREDICTED: putative DNA-binding protein ESCA...  50.4    7e-04   
ref|XP_008785537.1|  PREDICTED: putative DNA-binding protein ESCA...  50.4    7e-04   
emb|CDP13007.1|  unnamed protein product                              50.4    7e-04   
ref|XP_008388703.1|  PREDICTED: putative DNA-binding protein ESCA...  50.4    8e-04   
gb|KCW77938.1|  hypothetical protein EUGRSUZ_D02188                   50.4    8e-04   
gb|EYU18229.1|  hypothetical protein MIMGU_mgv1a020284mg              50.1    8e-04   
gb|KCW60423.1|  hypothetical protein EUGRSUZ_H03144                   49.3    8e-04   
ref|XP_009364460.1|  PREDICTED: putative DNA-binding protein ESCA...  50.4    8e-04   
ref|XP_009343806.1|  PREDICTED: putative DNA-binding protein ESCA...  50.4    9e-04   
gb|KFK37136.1|  hypothetical protein AALP_AA4G217700                  50.1    9e-04   
ref|XP_010097716.1|  hypothetical protein L484_023857                 50.1    0.001   
ref|XP_006649829.1|  PREDICTED: putative DNA-binding protein ESCA...  50.1    0.001   
ref|XP_007039519.1|  AT-hook DNA-binding family protein               50.1    0.001   



>ref|XP_002279636.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
 emb|CAN81187.1| hypothetical protein VITISV_029906 [Vitis vinifera]
 emb|CBI38865.3| unnamed protein product [Vitis vinifera]
Length=300

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 91/114 (80%), Gaps = 3/114 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVGPL+ASGPV+IMAASFGNAAYERLP+ED+E  V  PG+ PL
Sbjct  187  GLTIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEDEEPQVPIPGSGPL  246

Query  704  GG---AGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G     G    QQQ   Q++   +A+  QGLPPNL+NSCQLPAEA+WGT RPPY
Sbjct  247  GSPGMVGQQPQQQQQQQQLLPDPNASLFQGLPPNLLNSCQLPAEAYWGTARPPY  300



>ref|XP_009604907.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=304

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVGPL ASGPV+IMAASFGNAAYERLP+ED+ESPV   G+  L
Sbjct  193  GLTIYLAGGQGQVVGGSVVGPLNASGPVVIMAASFGNAAYERLPLEDEESPVGQQGSGAL  252

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTP-RPPY  552
                     QQ         +A  LQGLPPNL+NSCQLPAEA+WGT  RPPY
Sbjct  253  PIVSNQQQHQQQIMGGNSDPNANLLQGLPPNLLNSCQLPAEAYWGTAGRPPY  304



>ref|XP_007052032.1| AT-hook motif nuclear-localized protein 22 [Theobroma cacao]
 gb|EOX96189.1| AT-hook motif nuclear-localized protein 22 [Theobroma cacao]
Length=326

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 92/118 (78%), Gaps = 7/118 (6%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQP-PGTEP  708
            GLTIYLAGGQGQVVGGSVVGPL+ASGPV+IMAASFGNAAYERLP+E++E PV P PG+ P
Sbjct  209  GLTIYLAGGQGQVVGGSVVGPLVASGPVVIMAASFGNAAYERLPLEEEEQPVAPIPGSGP  268

Query  707  LGG----AGivssqqqsppqimvsSDATG--LQGLPPNLINSCQLPAEAFWGTPRPPY  552
            LG      G    QQQ P Q  +  D  G  +QGLPPNL+NS QLPAEA+WGT RPPY
Sbjct  269  LGSPSSMVGQQQQQQQPPQQQQLLQDPNGSFVQGLPPNLLNSVQLPAEAYWGTGRPPY  326



>ref|XP_009799054.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009799060.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
sylvestris]
Length=304

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVGPL ASGPV+IMAASFGNAAYERLP+ED+ESPV   G+  L
Sbjct  193  GLTIYLAGGQGQVVGGSVVGPLNASGPVVIMAASFGNAAYERLPLEDEESPVGQQGSGAL  252

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTP-RPPY  552
                     QQ         +A  LQGLPPNL+NSCQLPA+A+WGT  RPPY
Sbjct  253  PIVNNQQQHQQQIMGGNSDPNANLLQGLPPNLLNSCQLPADAYWGTAGRPPY  304



>emb|CDP17786.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 95/116 (82%), Gaps = 5/116 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES-PVQPPGTEP  708
            GLTIYLAGGQGQVVGGSVVGPL+A+GPV+IMAASFGNAAYERLP+EDDE+  V PPG+ P
Sbjct  195  GLTIYLAGGQGQVVGGSVVGPLLAAGPVVIMAASFGNAAYERLPLEDDETAAVPPPGSGP  254

Query  707  LG--GAGivssqqqsppqimvsSDATGL-QGLPPNLINSCQLPAE-AFWGTPRPPY  552
            LG  GAGIV  QQ    Q ++   ++ L  G+PPNL+NSCQLPAE A+WGT RPP+
Sbjct  255  LGSPGAGIVGQQQPQQSQQLLPDPSSSLFHGMPPNLLNSCQLPAEAAYWGTGRPPF  310



>ref|XP_002301300.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE80573.1| DNA-binding family protein [Populus trichocarpa]
Length=298

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 89/114 (78%), Gaps = 3/114 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVGPL+ASGPV+IMAASFGNAAYERLP+E+DES    PGT PL
Sbjct  185  GLTIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEEDESQTPVPGTGPL  244

Query  704  GGAGivssqqqsppqimvsSD--ATGLQGLPPNLINSCQLPAEAFWGT-PRPPY  552
            G  G+ S  QQ+  Q  +  D   +  QGLP NL+NS QLP+EA+WGT  RPPY
Sbjct  245  GSPGVSSIGQQNQQQHQLMQDPNTSLFQGLPQNLLNSVQLPSEAYWGTGGRPPY  298



>ref|XP_011017502.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=298

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 89/114 (78%), Gaps = 3/114 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVGPL+ASGPV+IMAASFGNAAYERLP+E+DES    PGT PL
Sbjct  185  GLTIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEEDESQTPVPGTGPL  244

Query  704  GGAGivssqqqsppqimvsSD--ATGLQGLPPNLINSCQLPAEAFWGT-PRPPY  552
            G  G+ S  QQ+  Q  +  D   +  QGLP NL+NS QLP+EA+WGT  RPPY
Sbjct  245  GSPGVNSIGQQNQQQHQLMQDPNTSLFQGLPQNLLNSVQLPSEAYWGTGGRPPY  298



>gb|KDP28740.1| hypothetical protein JCGZ_14511 [Jatropha curcas]
Length=308

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 87/119 (73%), Gaps = 8/119 (7%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVGPL+ASGPV+IMAASFGNAAYERLP+E+DE  V   G  PL
Sbjct  190  GLTIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEEDEGQVAVAGNGPL  249

Query  704  GGAGivssqqqsppqimvsS--------DATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G  G V   QQ P Q   +         + +  QGLPPNL+NS QLPAEA+WGT RPPY
Sbjct  250  GSPGAVGQPQQQPQQQQQTQQQQLMQDPNPSLFQGLPPNLLNSVQLPAEAYWGTGRPPY  308



>ref|NP_182067.1| AT-hook motif nuclear-localized protein 22 [Arabidopsis thaliana]
 gb|AAB82621.1| putative AT-hook DNA-binding protein [Arabidopsis thaliana]
 gb|AAT70431.1| At2g45430 [Arabidopsis thaliana]
 gb|AAV74244.1| At2g45430 [Arabidopsis thaliana]
 tpd|FAA00293.1| TPA: AT-hook motif nuclear localized protein 22 [Arabidopsis 
thaliana]
 dbj|BAH30430.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10552.1| AT-hook motif nuclear-localized protein 22 [Arabidopsis thaliana]
Length=317

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 86/120 (72%), Gaps = 9/120 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQP------  723
            GLTIYLAGGQGQVVGGSVVGPLMASGPV+IMAASFGNAAYERLP+E+D+   Q       
Sbjct  198  GLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQEEQTAGAVAN  257

Query  722  --PGTEPLGGAGivssqqqsppqimvsSDATG-LQGLPPNLINSCQLPAEAFWGTPRPPY  552
               G   +GG     +Q Q   Q  +  D T  +QGLPPNL+NS QLPAEA+WGTPRP +
Sbjct  258  NIDGNATMGGGTQTQTQTQQQQQQQLMQDPTSFIQGLPPNLMNSVQLPAEAYWGTPRPSF  317



>ref|XP_002511734.1| ESC, putative [Ricinus communis]
 gb|EEF50403.1| ESC, putative [Ricinus communis]
Length=299

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 87/112 (78%), Gaps = 1/112 (1%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVGPL+ASGPV+IMAASFGNAAYERLP+E+D+  V  PG+ PL
Sbjct  188  GLTIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEEDDGQVPVPGSGPL  247

Query  704  GGAGivssqqqsppqimvsSDATGL-QGLPPNLINSCQLPAEAFWGTPRPPY  552
               G+V   Q   PQ ++      L QGLPPNL+NS QLPAEA+WG  RPP+
Sbjct  248  DSPGVVGQTQPQQPQQLMQDPNPPLFQGLPPNLLNSVQLPAEAYWGAARPPF  299



>ref|XP_004229823.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=302

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVGPL ASGPV+IMAASFGNAAYERLP+ED+ESPV   G+   
Sbjct  189  GLTIYLAGGQGQVVGGSVVGPLNASGPVVIMAASFGNAAYERLPLEDEESPVGQQGSGGN  248

Query  704  GGAGivssqqqsppqimvsSDATG-LQGLPPNLINSCQL-PAEAFWG-TPRPPY  552
             G         +   +    +A   LQGLP NL+NSCQL PAEA+WG   RPPY
Sbjct  249  LGTSTNQGAAAAQQIMGTDPNANNLLQGLPQNLLNSCQLPPAEAYWGPGARPPY  302



>gb|KEH19036.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=308

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 88/118 (75%), Gaps = 7/118 (6%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL IYLAGGQGQVVGGSVVGPL+ASGPV+IMAASFGNAAYERLP+ED+E+PV  PG   L
Sbjct  191  GLAIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEDEETPVNVPGNGGL  250

Query  704  G-----GAGivssqqqsppqimvsSDATGL-QGLPPNLINSCQLPAEAFW-GTPRPPY  552
            G     G+     Q Q   Q++   +A+ L  G+P NL+NSCQLPAE +W G+ RPP+
Sbjct  251  GSPGTMGSQQQQQQNQQQQQLVADPNASSLFHGVPQNLLNSCQLPAEGYWGGSARPPF  308



>ref|XP_002880179.1| hypothetical protein ARALYDRAFT_903987 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56438.1| hypothetical protein ARALYDRAFT_903987 [Arabidopsis lyrata subsp. 
lyrata]
Length=318

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 85/122 (70%), Gaps = 11/122 (9%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQP------  723
            GLTIYLAGGQGQVVGGSVVGPLMASGPV+IMAASFGNAAYERLP+E+D+   Q       
Sbjct  197  GLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQEEQTAGAVAN  256

Query  722  --PGTEPLGGAGivssqqqsppqimv--sSDATG-LQGLPPNLINSCQLPAEAFWGTPRP  558
               G   +GG     +Q Q   Q       D T  +QGLPPNL+NS QLPAEA+WGTPRP
Sbjct  257  NIDGNATMGGGTQTQTQTQQQQQQQQQLMQDPTSFIQGLPPNLMNSVQLPAEAYWGTPRP  316

Query  557  PY  552
             +
Sbjct  317  SF  318



>ref|XP_006397724.1| hypothetical protein EUTSA_v10001760mg [Eutrema salsugineum]
 gb|ESQ39177.1| hypothetical protein EUTSA_v10001760mg [Eutrema salsugineum]
Length=319

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 86/123 (70%), Gaps = 12/123 (10%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPP-----  720
            GLTIYLAGGQGQVVGGSVVGPLMASGPV+IMAASFGNAAYERLP+E+D+   Q       
Sbjct  197  GLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQEEQQTAGAVA  256

Query  719  ----GTEPLGGAGivssqqqsppqimv--sSDATG-LQGLPPNLINSCQLPAEAFWGTPR  561
                G   +GG     +Q Q+  Q       D T  +QGLPPNL+NS QLPAEA+WGTPR
Sbjct  257  NNIDGNASMGGGTQTQTQSQTQTQQQQQLMQDPTSFIQGLPPNLMNSVQLPAEAYWGTPR  316

Query  560  PPY  552
            P +
Sbjct  317  PSF  319



>ref|XP_006296351.1| hypothetical protein CARUB_v10025523mg [Capsella rubella]
 gb|EOA29249.1| hypothetical protein CARUB_v10025523mg [Capsella rubella]
Length=316

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 86/123 (70%), Gaps = 12/123 (10%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQP------  723
            GLTIYLAGGQGQVVGGSVVGPLMASGPV+IMAASFGNAAYERLP+E+D+   Q       
Sbjct  194  GLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQEEQTAGAVAN  253

Query  722  --PGTEPLGGAGivssqqqsppqimv---sSDATG-LQGLPPNLINSCQLPAEAFWGTPR  561
               G   +GG     +Q Q+  Q        D T  +QGLPPNL+NS QLPAEA+WGTPR
Sbjct  254  NIDGNAAMGGGTPTQTQPQNQTQQQQQQLMQDPTSFIQGLPPNLMNSVQLPAEAYWGTPR  313

Query  560  PPY  552
            P +
Sbjct  314  PSF  316



>ref|XP_006339443.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=308

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 87/117 (74%), Gaps = 9/117 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVGPL ASGPV+IMAASFGNAAYERLP+ED+ESPV   G +  
Sbjct  195  GLTIYLAGGQGQVVGGSVVGPLNASGPVVIMAASFGNAAYERLPLEDEESPV---GQQGN  251

Query  704  GG----AGivssqqqsppqimvsSDATGLQGLPPNLINSCQL-PAEAFWGT-PRPPY  552
            GG    +  + S  Q+   +    +A  LQGLP NL+NSCQL PAEA+WG   RPPY
Sbjct  252  GGNLPTSSGIVSTNQAQQIMGTDPNANLLQGLPQNLLNSCQLPPAEAYWGAGGRPPY  308



>ref|XP_010508171.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=322

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 86/125 (69%), Gaps = 14/125 (11%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPP-----  720
            GLTIYLAGGQGQVVGGSVVGPLMASGPV+IMAASFGNAAYERLP+E+D+   Q       
Sbjct  198  GLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQEEQTAGAVAN  257

Query  719  ---GTEPLGGAGivssqqqsppqimv-----sSDATG-LQGLPPNLINSCQLPAEAFWGT  567
               G   +GG     +Q Q+  Q          D T  +QGLPPNL+NS QLPAEA+WGT
Sbjct  258  NIDGNAAMGGGTQTPTQTQNQTQQQQQQQQLMQDPTSFIQGLPPNLMNSVQLPAEAYWGT  317

Query  566  PRPPY  552
            PRP +
Sbjct  318  PRPSF  322



>ref|XP_010506485.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=322

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 86/125 (69%), Gaps = 14/125 (11%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPP-----  720
            GLTIYLAGGQGQVVGGSVVGPLMASGPV+IMAASFGNAAYERLP+E+D+   Q       
Sbjct  198  GLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQEEQTAGAVAN  257

Query  719  ---GTEPLGGAGivssqqqsppqimv-----sSDATG-LQGLPPNLINSCQLPAEAFWGT  567
               G   +GG     +Q Q+  Q          D T  +QGLPPNL+NS QLPAEA+WGT
Sbjct  258  NIDGNAAMGGGTQTPTQTQNQTQQQQQQQQLMQDPTSFIQGLPPNLMNSVQLPAEAYWGT  317

Query  566  PRPPY  552
            PRP +
Sbjct  318  PRPSF  322



>ref|XP_010518160.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=321

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 85/124 (69%), Gaps = 13/124 (10%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQP------  723
            GLTIYLAGGQGQVVGGSVVGPLMASGPV+IMAASFGNAAYERLP+E+D+   Q       
Sbjct  198  GLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQEEQTAGAVAN  257

Query  722  --PGTEPLGGAGivssqqqsppqimvsSD-----ATGLQGLPPNLINSCQLPAEAFWGTP  564
               G   +GG     +Q Q+  Q            + +QGLPPNL+NS QLPAEA+WGTP
Sbjct  258  NIDGNAAMGGGTQTPTQTQNQMQQQQQQQLMQDPTSFIQGLPPNLMNSVQLPAEAYWGTP  317

Query  563  RPPY  552
            RP +
Sbjct  318  RPSF  321



>ref|XP_004510939.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=305

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 89/116 (77%), Gaps = 5/116 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL IYLAGGQGQVVGGSVVGPL+ASGPV+IMAASFGNAAYERLP+ED+E+PV   G+  L
Sbjct  190  GLAIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEDEETPVNVQGSGGL  249

Query  704  GGAGivssqqqsppqimvs----SDATGLQGLPPNLINSCQLPAEAFW-GTPRPPY  552
            G  GIV +QQQ   Q  +     + ++   G+P NL+NSCQLPAE +W G+ RPP+
Sbjct  250  GSPGIVGTQQQQQQQQQLVQQDPNTSSLFHGVPQNLLNSCQLPAEGYWGGSVRPPF  305



>gb|KFK37336.1| hypothetical protein AALP_AA4G243300 [Arabis alpina]
Length=314

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 83/124 (67%), Gaps = 17/124 (14%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVGPLMASGPV+IMAASFGNAAYERLP+E+D+   Q  G    
Sbjct  195  GLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQEEQQTG----  250

Query  704  GGAGivssqqqsppqimvsSD-------------ATGLQGLPPNLINSCQLPAEAFWGTP  564
            G  G  ++   +      +               ++ +QGLPPNL+NS QLP+EA+WG P
Sbjct  251  GAVGNNNNIDGNATLGGGTQTPQTQQQQQLMQDPSSFIQGLPPNLMNSVQLPSEAYWGAP  310

Query  563  RPPY  552
            RP +
Sbjct  311  RPSF  314



>gb|EYU29016.1| hypothetical protein MIMGU_mgv1a023550mg [Erythranthe guttata]
Length=298

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 82/116 (71%), Gaps = 5/116 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPI-EDDESPVQPPGTE-  711
            GLTIYLAGGQGQVVGG VVGPL+ASGPV++MAASF NAAYERLP+ EDD++ VQ  G   
Sbjct  183  GLTIYLAGGQGQVVGGGVVGPLVASGPVIVMAASFSNAAYERLPLEEDDQNGVQGQGNSL  242

Query  710  ---PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
               P GG G  +       Q  + +D +  QG+PPNL+NS Q+P + FW T RPP+
Sbjct  243  GSPPQGGGGRAAPPPSLQQQQQILADPSLFQGMPPNLLNSIQMPNDEFWATGRPPF  298



>ref|XP_010276261.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=295

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 83/113 (73%), Gaps = 2/113 (2%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IMAASFGNAAYERLP+ED+E P+      PL
Sbjct  183  GLTIYLAGGQGQVVGGSVVGALVASGPVVIMAASFGNAAYERLPLEDEEPPLPMQSGGPL  242

Query  704  GGAGivssqqqsppqimvsSDATG--LQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G  G+V  QQQ   Q  +  D       GLPPNL+  CQLPAEA+W T RPP+
Sbjct  243  GSPGMVDQQQQQQQQQQLLPDPNMPLFHGLPPNLLTPCQLPAEAYWATGRPPF  295



>ref|XP_006445233.1| hypothetical protein CICLE_v10024070mg [Citrus clementina]
 ref|XP_006490941.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|ESR58473.1| hypothetical protein CICLE_v10024070mg [Citrus clementina]
Length=313

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 86/118 (73%), Gaps = 9/118 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQP-PGTEP  708
            GLTIYLAGGQGQVVGGSVVGPL+ASGPV+IMAASFGNAAYERLP+E++E+PV   PG+ P
Sbjct  193  GLTIYLAGGQGQVVGGSVVGPLVASGPVVIMAASFGNAAYERLPLEEEETPVASIPGSRP  252

Query  707  LG------GAGivssqqqsppqimvsSD--ATGLQGLPPNLINSCQLPAEAFWGTPRP  558
            LG      G      QQ    Q  +  D  A+ + GLPPNL++S QLPAE +W T RP
Sbjct  253  LGSPEVNVGQPQQQQQQSQSHQQQLLQDPNASFIHGLPPNLLSSVQLPAEPYWATGRP  310



>ref|XP_002876587.1| hypothetical protein ARALYDRAFT_486561 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52846.1| hypothetical protein ARALYDRAFT_486561 [Arabidopsis lyrata subsp. 
lyrata]
Length=264

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 79/112 (71%), Gaps = 9/112 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQV+GGS+VGPLMASGPV+IMAASFGNAAYERL +E++E+  +  G   +
Sbjct  161  GLTVYLAGGQGQVIGGSLVGPLMASGPVVIMAASFGNAAYERLQLEEEETDREIDGNASM  220

Query  704  GGAGivssqqqsppqimvsSDATG-LQGLPPNLINSCQLPAEAFWGTPRPPY  552
                       +  Q  +  DAT  +QG P NLINS  LP+EA+WGT RP +
Sbjct  221  A--------VGTQTQKQLMHDATSFVQGSPSNLINSVSLPSEAYWGTQRPSF  264



>emb|CDY27387.1| BnaC04g50180D [Brassica napus]
Length=312

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPG---T  714
            GLTIYLAGGQGQVVGGSVVGPLMASGPV+IMAASFGNAAYERLP+E+D+   Q       
Sbjct  200  GLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQDEQQTAGAVA  259

Query  713  EPLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
              + G   +    Q+ PQ ++    + +QGLPP+L+NS QLPAEA+WGTPRP +
Sbjct  260  NNMDGNATMGGGTQTQPQQLMQDPTSFIQGLPPSLMNS-QLPAEAYWGTPRPSF  312



>ref|XP_009142337.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=308

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPG---T  714
            GLTIYLAGGQGQVVGGSVVGPLMASGPV+IMAASFGNAAYERLP+E+D+   Q       
Sbjct  196  GLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQDEQQTAGAVA  255

Query  713  EPLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
              + G   +    Q+ PQ ++    + +QGLPP+L+NS QLPAEA+WGTPRP +
Sbjct  256  NNIDGNATMGGGTQTQPQQLMQDPTSFIQGLPPSLMNS-QLPAEAYWGTPRPSF  308



>emb|CDY37040.1| BnaA04g26180D [Brassica napus]
Length=308

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPG---T  714
            GLTIYLAGGQGQVVGGSVVGPLMASGPV+IMAASFGNAAYERLP+E+D+   Q       
Sbjct  196  GLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEDDQDEQQTAGAVA  255

Query  713  EPLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
              + G   +    Q+ PQ ++    + +QGLPP+L+NS QLPAEA+WGTPRP +
Sbjct  256  NNIDGNATMGGGTQTRPQQLMQDPTSFIQGLPPSLMNS-QLPAEAYWGTPRPSF  308



>ref|XP_007134900.1| hypothetical protein PHAVU_010G085300g [Phaseolus vulgaris]
 gb|ESW06894.1| hypothetical protein PHAVU_010G085300g [Phaseolus vulgaris]
Length=310

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 85/119 (71%), Gaps = 8/119 (7%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL IYLAGGQGQVVGGSVVGPL+ASGPV+IMAASFGNAAYERLP+ED+E+PV  PGT  L
Sbjct  192  GLAIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEDEETPVPVPGTGGL  251

Query  704  GGAGivssqqqsppqimvsSDATG-------LQGLPPNLINSCQLPAEAFW-GTPRPPY  552
            G  GI  +QQQS  Q        G         G+P NL+NS QLPAE +W GT RP +
Sbjct  252  GSPGIAGTQQQSQSQPQQPQQLVGDPNTSSLFHGVPQNLLNSVQLPAEGYWGGTARPSF  310



>ref|XP_010523691.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=297

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVGPLMASGPV+IMAASFGNAAYERLP+E+++           
Sbjct  187  GLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEEDEEHAAVVAAVD  246

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
              A + S+   +  Q  +  + + +QGL P+LINS QLP+E++WGTPRP +
Sbjct  247  ANANLGSAGGGTQTQQQLMQEPSFIQGLNPSLINSVQLPSESYWGTPRPSF  297



>ref|XP_011081090.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=285

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 84/121 (69%), Gaps = 21/121 (17%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES--PVQ-----  726
            GLTIYLAGGQGQVVGGSVVG L+ASGPVMIMAASF NAAYERLPIE++E+  PVQ     
Sbjct  176  GLTIYLAGGQGQVVGGSVVGQLLASGPVMIMAASFSNAAYERLPIEEEENAIPVQGGSLG  235

Query  725  ---PPGTEPLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPP  555
               PPG+  +GG            Q  +  D +  QG+PPNL+NS Q+P EAFW T RPP
Sbjct  236  SPPPPGS--VGGQ---------QQQQQILPDPSLFQGMPPNLLNSIQMPNEAFWATGRPP  284

Query  554  Y  552
            +
Sbjct  285  F  285



>ref|XP_009594477.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=219

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 80/115 (70%), Gaps = 13/115 (11%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQP--PGTE  711
            GLTIYLAGGQGQVVGGSVVG LMASGPV+IMAASF NAAYERLP+E+D+    P  PG  
Sbjct  114  GLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEEDDQNPHPVAPGDS  173

Query  710  P--LGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            P   GG G          Q  + +D + L G+PPNL+NS QLP E +W T RPP+
Sbjct  174  PGATGGHG---------QQQQLLADGSILHGMPPNLLNSIQLPPEGYWATGRPPF  219



>ref|XP_009778295.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=306

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGG VVG LMASGPV+IMAASF NAAYERLP+E+D+S   PP    L
Sbjct  195  GLTIYLAGGQGQVVGGCVVGALMASGPVVIMAASFSNAAYERLPLEEDDSNSLPPQGGSL  254

Query  704  GG-AGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G    I    QQ   Q  + +D +   G+PPNL+N+ QLP+EA+W T RPP+
Sbjct  255  GSPRAIAPGGQQQQQQQQLLTDPSLFHGMPPNLLNNVQLPSEAYWATGRPPF  306



>ref|XP_006402533.1| hypothetical protein EUTSA_v10006144mg [Eutrema salsugineum]
 gb|ESQ43986.1| hypothetical protein EUTSA_v10006144mg [Eutrema salsugineum]
Length=282

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 80/112 (71%), Gaps = 11/112 (10%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGG+VVGPLMASG V+IMAASFGNAAYERLP+E +E           
Sbjct  181  GLTVYLAGGQGQVVGGNVVGPLMASGRVVIMAASFGNAAYERLPLEKEEED---------  231

Query  704  GGAGivssqqqsppqimvsSDAT-GLQGLPPNLINSCQLPAEAFWGTPRPPY  552
             G   V+ + Q+  Q  +  DAT  +QGLP N++NS  LP+EA+WGT RP +
Sbjct  232  -GNATVADESQTQTQKQLMQDATPFIQGLPSNIMNSVSLPSEAYWGTQRPSF  282



>ref|XP_011014152.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=302

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDD--ESPVQPPGTE  711
            GLTIYLAGGQGQVVGGSVVGPL ASGPV+IMAASF NAAYERLP+E++  + P+Q  G  
Sbjct  191  GLTIYLAGGQGQVVGGSVVGPLTASGPVVIMAASFSNAAYERLPLEEEDPQMPMQGGGMG  250

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
               G G    QQ    Q+M   +A    GLPPNL+NS QLPAEA+W T RPPY
Sbjct  251  SPEGVG-QQQQQPQQHQVMAEQNAQLFHGLPPNLLNSIQLPAEAYWATGRPPY  302



>ref|XP_010324605.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=319

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGG VVG LMASGPV+IMAASF NAAYERLP+E+D+S   P     L
Sbjct  210  GLTIYLAGGQGQVVGGCVVGSLMASGPVVIMAASFSNAAYERLPLEEDDSNQLPVQGGSL  269

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G  G  +     P    +  D +   G+PPNL+N+ QLP+EA+W T RPP+
Sbjct  270  GSPG-ATVAPGGPQHQQLLGDPSLFHGMPPNLLNNVQLPSEAYWATGRPPF  319



>ref|XP_006358367.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=311

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 80/111 (72%), Gaps = 2/111 (2%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGG VVG LMASGPV+IMAASF NAAYERLP+++D+S   P     L
Sbjct  203  GLTIYLAGGQGQVVGGCVVGSLMASGPVVIMAASFSNAAYERLPLDEDDSNQLPVQGGSL  262

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G  G  ++      Q  + +D +   G+PPNL+N+ QLP+EA+W T RPP+
Sbjct  263  GSPG--ATIAPGGQQQQLLADPSLFHGMPPNLLNNVQLPSEAYWATGRPPF  311



>ref|XP_009788952.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=219

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 81/115 (70%), Gaps = 13/115 (11%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES---PVQPPGT  714
            GLTIYLAGGQGQVVGGSVVG LMASGPV+IMAASFGNAAYERLP+E+D+    PV P G+
Sbjct  114  GLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFGNAAYERLPLEEDDQNPLPVAPGGS  173

Query  713  -EPLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
                GG G          Q  + +D + L  +PPNL+NS QLP E +W T RPP+
Sbjct  174  PGATGGHG---------QQQQLLADGSILHVMPPNLLNSIQLPPEGYWATGRPPF  219



>ref|XP_002303540.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE78519.1| DNA-binding family protein [Populus trichocarpa]
Length=303

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 80/113 (71%), Gaps = 3/113 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L ASGPV+IMAASF NAAYERLP+E +E P  P     +
Sbjct  192  GLTIYLAGGQGQVVGGSVVGTLTASGPVVIMAASFSNAAYERLPLE-EEDPQMPMQGGEM  250

Query  704  G--GAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G  GA     QQ    Q+M   +A    GLPPNL+NS QLPAEA+W T RPPY
Sbjct  251  GSPGAVGQQQQQPQQQQVMAEQNAQLFHGLPPNLLNSIQLPAEAYWATGRPPY  303



>ref|XP_011033866.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=303

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 80/113 (71%), Gaps = 3/113 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L ASGPV+IMAASF NAAYERLP+E +E P  P     +
Sbjct  192  GLTIYLAGGQGQVVGGSVVGTLTASGPVVIMAASFSNAAYERLPLE-EEDPQMPMQGGEM  250

Query  704  G--GAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G  GA     QQ    Q+M   +A    GLPPNL+NS QLPAEA+W T RPPY
Sbjct  251  GSPGAVGQQQQQPQQQQVMAEQNAQLFHGLPPNLLNSIQLPAEAYWATGRPPY  303



>ref|XP_002320066.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE98381.1| DNA-binding family protein [Populus trichocarpa]
Length=300

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 83/117 (71%), Gaps = 6/117 (5%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDD-ESPVQPPGTEP  708
            GLT+YLAGGQGQV+GGSV GPL+ASGPV++MAASFGNAAYERLP+E+D ES     G+ P
Sbjct  184  GLTVYLAGGQGQVIGGSVAGPLLASGPVVVMAASFGNAAYERLPLEEDIESQTPMLGSGP  243

Query  707  LGG----AGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGT-PRPPY  552
            LG           Q Q   Q+M     +  QGLP NL+NS QLPAEA+WGT  RPPY
Sbjct  244  LGSPGINNIGQQQQNQQQQQLMQDPKTSLFQGLPQNLLNSVQLPAEAYWGTGGRPPY  300



>ref|XP_004306909.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=325

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 86/127 (68%), Gaps = 16/127 (13%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPI-EDDESPVQP-PGTE  711
            GLTIYLAGGQGQVVGGSVVGPL+ASGPV+IMAASFGNAAYERLP+ E+D + V P PG+ 
Sbjct  199  GLTIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEEEDATAVTPMPGSG  258

Query  710  PLGGAG-------ivssqqqsppqimvsSDATG-------LQGLPPNLINSCQLPAEAFW  573
            PLG  G         S  QQ   Q  +  DA           G+  NL+NS QLP+EA+W
Sbjct  259  PLGSPGIGGGEQQQQSQVQQVQQQQQMLQDANNSSPPPSLFHGMQQNLLNSVQLPSEAYW  318

Query  572  GTPRPPY  552
            GT RPPY
Sbjct  319  GTARPPY  325



>ref|XP_010544659.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=281

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 76/112 (68%), Gaps = 8/112 (7%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDD-ESPVQPPGTEP  708
            GLTIYLAGGQGQV+GG   GPL ASGPV+IMAASFGNA+YERLP+E+  E+ V    T  
Sbjct  177  GLTIYLAGGQGQVIGGGGGGPLTASGPVVIMAASFGNASYERLPVEEQSEAAVDGNPTLR  236

Query  707  LGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
             G  G       +  Q  +  D   +QGL P+L NS QLPAEA+W TPRPP+
Sbjct  237  SGADG-------TQTQQQLMQDPLFIQGLNPSLTNSAQLPAEAYWVTPRPPF  281



>ref|XP_009763802.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
sylvestris]
Length=294

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 79/112 (71%), Gaps = 1/112 (1%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE-SPVQPPGTEP  708
            GLTIYLAGGQGQVVGGSVVG LMASGPV+IMAASF NAAYERLP+E+DE +P+  PG   
Sbjct  183  GLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEEDEQNPLPVPGGGT  242

Query  707  LGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            LG             Q  + +D +   G+PPNL+NS QLP E +W T RPP+
Sbjct  243  LGSPPGNIGGPGQQQQQQLMADPSLFHGMPPNLLNSIQLPTEPYWATGRPPF  294



>ref|XP_011034536.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=300

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 83/117 (71%), Gaps = 6/117 (5%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDD-ESPVQPPGTEP  708
            GLT+YLAGGQGQV+GGSV GPL+ASGPV++MAASFGNAAYERLP+E+D ES     G+ P
Sbjct  184  GLTVYLAGGQGQVIGGSVAGPLLASGPVVVMAASFGNAAYERLPLEEDIESQTPMLGSGP  243

Query  707  LGG----AGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGT-PRPPY  552
            LG           Q Q   Q+M     +  QGLP NL+NS QLPAEA+WGT  RPPY
Sbjct  244  LGSPGINNIGQQQQNQQQQQLMQDPKTSLFQGLPQNLLNSVQLPAEAYWGTGGRPPY  300



>ref|XP_009763803.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
sylvestris]
Length=291

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 79/112 (71%), Gaps = 1/112 (1%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE-SPVQPPGTEP  708
            GLTIYLAGGQGQVVGGSVVG LMASGPV+IMAASF NAAYERLP+E+DE +P+  PG   
Sbjct  180  GLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEEDEQNPLPVPGGGT  239

Query  707  LGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            LG             Q  + +D +   G+PPNL+NS QLP E +W T RPP+
Sbjct  240  LGSPPGNIGGPGQQQQQQLMADPSLFHGMPPNLLNSIQLPTEPYWATGRPPF  291



>ref|XP_009613222.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
tomentosiformis]
Length=299

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 83/114 (73%), Gaps = 3/114 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPI-EDDESPVQPPGTEP  708
            GLTIYLAGGQGQVVGGSVVG LMASGPV+IMAASF NAAYERLP+ EDD++P+  PG   
Sbjct  186  GLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEEDDQNPLPVPGGGT  245

Query  707  LGG--AGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            LG     I    +Q   Q  + +D +   G+ PNL+NS QLP+E++W T RPP+
Sbjct  246  LGSPPGNIGGQGRQQQQQQQLMADPSLFHGMQPNLLNSIQLPSESYWATGRPPF  299



>ref|XP_009613223.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
tomentosiformis]
Length=296

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 83/114 (73%), Gaps = 3/114 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPI-EDDESPVQPPGTEP  708
            GLTIYLAGGQGQVVGGSVVG LMASGPV+IMAASF NAAYERLP+ EDD++P+  PG   
Sbjct  183  GLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEEDDQNPLPVPGGGT  242

Query  707  LGG--AGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            LG     I    +Q   Q  + +D +   G+ PNL+NS QLP+E++W T RPP+
Sbjct  243  LGSPPGNIGGQGRQQQQQQQLMADPSLFHGMQPNLLNSIQLPSESYWATGRPPF  296



>ref|XP_003516470.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=288

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 83/117 (71%), Gaps = 6/117 (5%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL IYLAGGQGQVVGGSVVGPL+ASGPV+IMAASFGNAAYERLP+E++E+PV   G   L
Sbjct  172  GLAIYLAGGQGQVVGGSVVGPLVASGPVVIMAASFGNAAYERLPLEEEETPVAVAGNGGL  231

Query  704  G-----GAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFW-GTPRPPY  552
            G     G      QQQ    +   + ++   G+P NL+NS QLPAE +W G+ RPP+
Sbjct  232  GSPGIPGTQQQPQQQQQQQLVGDPNSSSLFHGMPQNLLNSVQLPAEGYWGGSARPPF  288



>ref|XP_009621304.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=307

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGG VVG LMASGPV+IMAASF NAAYERLP+E+D+    PP    L
Sbjct  197  GLTIYLAGGQGQVVGGCVVGALMASGPVVIMAASFSNAAYERLPLEEDDLNSLPPQGGSL  256

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G    ++  ++   Q  +  D +   G+PPNL+N+ QLP+E +W T +PP+
Sbjct  257  GSPRAIAPGERQQQQQQLLIDPSLFHGMPPNLLNNVQLPSEGYWATGQPPF  307



>ref|XP_003521618.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=310

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 88/120 (73%), Gaps = 9/120 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL IYLAGGQGQVVGGSVVGPL+ASGPV+IMAASFGNAAYERLP+E++E+PV   GTE L
Sbjct  191  GLAIYLAGGQGQVVGGSVVGPLVASGPVVIMAASFGNAAYERLPLEEEETPVPYHGTEGL  250

Query  704  GGAGivssqqqsppqimvs--------SDATGLQGLPPNLINSCQLPAEAFW-GTPRPPY  552
            G  GI  +QQQS  Q            + ++   G+P NL+NS QLPAE +W G+ RPP+
Sbjct  251  GSPGIPGTQQQSQSQPQQQQQQLVGDPNSSSLFHGVPQNLLNSIQLPAEGYWGGSARPPF  310



>gb|KGN56590.1| hypothetical protein Csa_3G126060 [Cucumis sativus]
Length=246

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 75/110 (68%), Gaps = 9/110 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YL+GGQGQVVGGSVVGPLM+SGPV+I AASFGNAAYERLP+EDD+      G+ P+
Sbjct  144  GLTVYLSGGQGQVVGGSVVGPLMSSGPVVITAASFGNAAYERLPVEDDDVEAADAGSSPI  203

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPP  555
                    QQQ  P            GL PNL+N+CQLP E +WGT R P
Sbjct  204  RSPENAVQQQQFLP---------DFHGLAPNLMNTCQLPTEPYWGTGRTP  244



>ref|XP_002509637.1| ESC, putative [Ricinus communis]
 gb|EEF51024.1| ESC, putative [Ricinus communis]
Length=298

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 83/113 (73%), Gaps = 3/113 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES--PVQPPGTE  711
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IMAASF NAAYERLP+E++++  P+Q     
Sbjct  187  GLTIYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEEEDAQLPMQGGAIG  246

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
              G  G    Q Q   Q++  ++A   QGL PNL+NS QLPAEA+W T RPPY
Sbjct  247  SPGAVG-QQQQHQQQQQVLGEANAQLFQGLQPNLLNSIQLPAEAYWATGRPPY  298



>ref|XP_011090893.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=307

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 81/113 (72%), Gaps = 5/113 (4%)
 Frame = -2

Query  881  LTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPLG  702
            LTIYLAGGQGQV+GG+VVGPL+ASGPV+IMAASFGNAAYERLP+E++E+ V   G    G
Sbjct  197  LTIYLAGGQGQVMGGTVVGPLLASGPVVIMAASFGNAAYERLPLEEEETAV--GGVSSGG  254

Query  701  GAGivssqqqsppqimvsSDATGLQGL--PPNLINSC-QLPAEAFWGTPRPPY  552
              G      Q   Q+M   +    QG   P N++NSC QLPAEA+WGT RPP+
Sbjct  255  QMGSPGMVGQQGQQLMNDPNTNMFQGTMPPQNMLNSCGQLPAEAYWGTGRPPF  307



>ref|XP_007155606.1| hypothetical protein PHAVU_003G216200g [Phaseolus vulgaris]
 gb|ESW27600.1| hypothetical protein PHAVU_003G216200g [Phaseolus vulgaris]
Length=284

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 79/113 (70%), Gaps = 6/113 (5%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IM+ASF NAAYERLP+ED++  +Q  G    
Sbjct  176  GLTIYLAGGQGQVVGGSVVGTLVASGPVVIMSASFSNAAYERLPLEDEDPSLQMQG----  231

Query  704  GGAGivssqqqsppqimvsSDATG--LQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G  G   +      Q++   DA      GLPPNL+NS Q+P+E FW + RPP+
Sbjct  232  GSIGSPGASGVGQSQLLGGGDAAAPLFHGLPPNLLNSVQMPSEPFWASNRPPF  284



>ref|XP_004173725.1| PREDICTED: LOW QUALITY PROTEIN: putative DNA-binding protein 
ESCAROLA-like [Cucumis sativus]
Length=255

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 75/110 (68%), Gaps = 9/110 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YL+GGQGQVVGGSVVGPLM+SGPV+I AASFGNAAYERLP+EDD+      G+ P+
Sbjct  153  GLTVYLSGGQGQVVGGSVVGPLMSSGPVVITAASFGNAAYERLPVEDDDVEAADAGSSPI  212

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPP  555
                    QQQ  P            GL PNL+N+CQ+P E +WGT R P
Sbjct  213  RSPENAVQQQQFLP---------DFHGLAPNLMNTCQMPTEPYWGTGRTP  253



>ref|XP_004133907.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
Length=263

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 75/110 (68%), Gaps = 9/110 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YL+GGQGQVVGGSVVGPLM+SGPV+I AASFGNAAYERLP+EDD+      G+ P+
Sbjct  161  GLTVYLSGGQGQVVGGSVVGPLMSSGPVVITAASFGNAAYERLPVEDDDVEAADAGSSPI  220

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPP  555
                    QQQ  P            GL PNL+N+CQLP E +WGT R P
Sbjct  221  RSPENAVQQQQFLP---------DFHGLAPNLMNTCQLPTEPYWGTGRTP  261



>ref|XP_011029110.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=302

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 80/113 (71%), Gaps = 3/113 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDD--ESPVQPPGTE  711
            GLTIYLAGGQGQVVGGSVVGPL ASGPV+IMAASF NAAYERLP+E++  + P+Q     
Sbjct  191  GLTIYLAGGQGQVVGGSVVGPLTASGPVVIMAASFSNAAYERLPLEEEDPQMPMQGG-GM  249

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
               G      QQ    Q+M   +A    GLPPNL+NS QLPAEA+W T RPPY
Sbjct  250  GSPGGVGQQQQQPQQHQVMAEPNAQLFHGLPPNLLNSIQLPAEAYWATGRPPY  302



>emb|CDP09863.1| unnamed protein product [Coffea canephora]
Length=291

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = -2

Query  875  IYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPLGGA  696
            IYLAGGQGQVVGGSVVG LMASGPV+IMAASF NAAYERLP+++DES +Q  G   LG  
Sbjct  186  IYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLDEDESSLQMQGGS-LGSP  244

Query  695  GivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G V  QQQ   Q  + +D + L  +PPNL NS QLP EA+W T RPP+
Sbjct  245  GAVGGQQQQQQQQQLMADPS-LFSMPPNLFNSVQLPNEAYWATGRPPF  291



>ref|XP_007040019.1| AT-hook DNA-binding family protein [Theobroma cacao]
 gb|EOY24520.1| AT-hook DNA-binding family protein [Theobroma cacao]
Length=302

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L+ SGPV+IMAASF NAAYERLP+E++E      G    
Sbjct  192  GLTIYLAGGQGQVVGGSVVGTLICSGPVVIMAASFSNAAYERLPLEEEEQLPMQGGAIGS  251

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
             GA     QQQ   Q++  S+A    GLPPNL+NS QLP EAFW T RPP+
Sbjct  252  PGAIGGQQQQQQQQQVLAESNAPLFHGLPPNLLNSIQLPTEAFWATGRPPF  302



>ref|XP_008466998.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=263

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 76/110 (69%), Gaps = 9/110 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YL+GGQGQVVGGSVVGPL++SGPV+I AASFGNAAYERLP+EDD+      G+ P+
Sbjct  161  GLTVYLSGGQGQVVGGSVVGPLLSSGPVVITAASFGNAAYERLPVEDDDVEAANAGSSPI  220

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPP  555
                    QQQ  P+           GL PNL+N+CQLP E +WGT R P
Sbjct  221  RSPENAVQQQQFLPE---------FHGLAPNLMNTCQLPTEPYWGTGRTP  261



>ref|XP_010469137.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=267

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 70/111 (63%), Gaps = 13/111 (12%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGG+VVGPLM SGPV+IMAASFGN AYERLP+E+DE     P  E  
Sbjct  167  GLTVYLAGGQGQVVGGNVVGPLMTSGPVVIMAASFGNTAYERLPLEEDEVE---PQREID  223

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
              A      Q              L G P NLINS  LP EA+WGT RP +
Sbjct  224  ANADRAVGTQTQKQ----------LMGSPSNLINSVSLPDEAYWGTQRPCF  264



>ref|XP_010108102.1| hypothetical protein L484_023188 [Morus notabilis]
 gb|EXC17834.1| hypothetical protein L484_023188 [Morus notabilis]
Length=302

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES---PVQPPGT  714
            GLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERLP+E+D+    P+Q  G 
Sbjct  185  GLTIYLAGGQGQVVGGSVVGTLIASGPVVVMAASFSNAAYERLPLEEDDQTQLPLQGGGG  244

Query  713  EPLGGAGivssqqqsppqimvsSDATG----LQGLPPNLINSCQLPAEAFWGTPRPPY  552
                  G    Q  +      ++++ G      GLPPNL+NS Q+PAEA+W + RPPY
Sbjct  245  GVGSPTGGQQQQIMAAAAAAEAANSGGAPTLFHGLPPNLLNSIQMPAEAYWASGRPPY  302



>ref|XP_002299584.2| DNA-binding family protein [Populus trichocarpa]
 gb|EEE84389.2| DNA-binding family protein [Populus trichocarpa]
Length=302

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 79/113 (70%), Gaps = 3/113 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDD--ESPVQPPGTE  711
            GLTIYLAGGQGQVVGGSVVG L ASGPV+IMAASF NAAYERLP+E++  + P+Q     
Sbjct  191  GLTIYLAGGQGQVVGGSVVGTLTASGPVVIMAASFSNAAYERLPLEEEDPQMPMQGG-GM  249

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
               G      QQ    Q+M   +A    GLPPNL+NS QLPAEA+W T RPPY
Sbjct  250  GSPGGVGQQQQQPQQHQVMAEQNAQLFHGLPPNLLNSIQLPAEAYWATGRPPY  302



>ref|XP_004245690.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Solanum 
lycopersicum]
Length=292

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG LMASGPV+IM+ASF NAAYERLP+E+D+     P     
Sbjct  182  GLTIYLAGGQGQVVGGSVVGALMASGPVVIMSASFSNAAYERLPLEEDDQNHPLPIVPGG  241

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G  G          Q  + +D +   G+PPNL+NS QLP+E +W T RPP+
Sbjct  242  GSLGSPPGNIGQQQQQQIMADPSLFHGMPPNLLNSIQLPSEPYWATGRPPF  292



>ref|XP_010053890.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW78264.1| hypothetical protein EUGRSUZ_D02447 [Eucalyptus grandis]
Length=304

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 80/113 (71%), Gaps = 5/113 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGG+V GPLMASGPV+IMAASFGNAAYERLP+E++E+    P   P 
Sbjct  192  GLTVYLAGGQGQVVGGNVAGPLMASGPVVIMAASFGNAAYERLPLEEEEAGAAAP--VPS  249

Query  704  GGA-GivssqqqsppqimvsSDATG--LQGLPPNLINSCQLPAEAFWGTPRPP  555
            GG  G     QQ   Q ++  DA G  L G  PNL+NSC LP E +WG  RPP
Sbjct  250  GGQLGSPGMGQQQQQQQIMPVDANGALLHGFAPNLLNSCNLPGETYWGAARPP  302



>ref|XP_010325447.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Solanum 
lycopersicum]
Length=289

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG LMASGPV+IM+ASF NAAYERLP+E+D+     P     
Sbjct  179  GLTIYLAGGQGQVVGGSVVGALMASGPVVIMSASFSNAAYERLPLEEDDQNHPLPIVPGG  238

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G  G          Q  + +D +   G+PPNL+NS QLP+E +W T RPP+
Sbjct  239  GSLGSPPGNIGQQQQQQIMADPSLFHGMPPNLLNSIQLPSEPYWATGRPPF  289



>emb|CBI34813.3| unnamed protein product [Vitis vinifera]
Length=240

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 79/113 (70%), Gaps = 8/113 (7%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IMAASF NAAYERLP+E+++  +      P+
Sbjct  134  GLTIYLAGGQGQVVGGSVVGQLLASGPVVIMAASFSNAAYERLPLEEEDPAL------PM  187

Query  704  GGAGivssqqqsppqimvsSDATG--LQGLPPNLINSCQLPAEAFWGTPRPPY  552
             G  + S   Q      + +D       GLPPNL+NS QLPAEA+W T RPPY
Sbjct  188  PGGSLGSPGGQPQQPQQLLADPNAPLFHGLPPNLLNSIQLPAEAYWATGRPPY  240



>ref|XP_003525782.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Glycine max]
 ref|XP_006579618.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Glycine max]
 gb|KHN04317.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=283

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 78/114 (68%), Gaps = 8/114 (7%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IMAASF NAAYERLP+ED++     P  +  
Sbjct  175  GLTIYLAGGQGQVVGGSVVGTLVASGPVVIMAASFSNAAYERLPLEDED-----PSLQMQ  229

Query  704  GGAGivssqqqsppqimvsSDATG--LQGLPPNLINSCQLPAEAFW-GTPRPPY  552
            GG+             ++  DAT     GLPPNL+NS Q+P+E FW  + RPP+
Sbjct  230  GGSIGSPGASGVGQSQLLGGDATAPLFHGLPPNLLNSVQMPSEPFWAASARPPF  283



>gb|EYU30571.1| hypothetical protein MIMGU_mgv1a010755mg [Erythranthe guttata]
Length=302

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 76/111 (68%), Gaps = 4/111 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAG QGQVVGG+VVGPL+ASGPV+IMAASFGNAAYERLP+ED+E+     G    
Sbjct  196  GLTIYLAGAQGQVVGGAVVGPLLASGPVVIMAASFGNAAYERLPLEDEEAAAVSGG----  251

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G  G          Q+M   +    QG   N++NS QLPA+A+WG  RPP+
Sbjct  252  GQLGSPGISGGGGQQLMPDPNTNPFQGAAQNMLNSVQLPADAYWGAARPPF  302



>ref|XP_003549894.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=287

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IMAASF NAAYERLP+ED++    P   +  
Sbjct  178  GLTIYLAGGQGQVVGGSVVGTLVASGPVVIMAASFSNAAYERLPLEDED----PNSLQMQ  233

Query  704  GGAGivssqqqsppqimvsSDATG--LQGLPPNLINSCQLPAEAFW-GTPRPPY  552
            GG+             ++  DAT     GLPPNL+NS Q+P+E FW  + RPP+
Sbjct  234  GGSIGSPGASGVGQSQLLGGDATAPLFHGLPPNLLNSVQMPSEPFWAASTRPPF  287



>ref|XP_004298711.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=309

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPG----  717
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IMAASF NAAYERLP+E+DE  +  PG    
Sbjct  192  GLTIYLAGGQGQVVGGSVVGTLLASGPVVIMAASFSNAAYERLPLEEDEGSMPMPGGSMG  251

Query  716  --TEPLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAE-AFWGTPRPPY  552
              T           QQQ       +++A    GLPPNL+NS QLPAE A+W T RPP+
Sbjct  252  SPTAVGQQQHQQQQQQQQLLAEAANTNAPLFHGLPPNLLNSMQLPAEAAYWATGRPPF  309



>gb|EYU43510.1| hypothetical protein MIMGU_mgv1a017700mg [Erythranthe guttata]
Length=309

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 78/120 (65%), Gaps = 9/120 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQV+GGSVVG L+ASGPV+IMAASF NAAYERLP+E+DE+         +
Sbjct  190  GLTIYLAGGQGQVLGGSVVGQLLASGPVIIMAASFSNAAYERLPLEEDENAAINNNNNQV  249

Query  704  ---------GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
                      G    S Q     Q  V +D +  QG+PPNL NS Q+P EAFW T RPP+
Sbjct  250  PGSSSLGSPPGGLGGSGQPPQNHQQQVLADPSLFQGMPPNLFNSIQMPNEAFWATGRPPF  309



>gb|EYU40549.1| hypothetical protein MIMGU_mgv1a021038mg [Erythranthe guttata]
Length=310

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 78/120 (65%), Gaps = 9/120 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQV+GGSVVG L+ASGPV+IMAASF NAAYERLP+E+DE+         +
Sbjct  191  GLTIYLAGGQGQVLGGSVVGQLLASGPVIIMAASFSNAAYERLPLEEDENAAINNNNNQV  250

Query  704  ---------GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
                      G    S Q     Q  V +D +  QG+PPNL NS Q+P EAFW T RPP+
Sbjct  251  PGSSSLGSPPGGLGGSGQPPQNHQQQVLADPSLFQGMPPNLFNSIQMPNEAFWATGRPPF  310



>ref|XP_011093194.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=297

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 82/110 (75%), Gaps = 3/110 (3%)
 Frame = -2

Query  881  LTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPLG  702
            LTIYLAG QGQVVGG+VVGPL+ASGPVMIMAASFGNAAYERLP+ED+E   Q P    + 
Sbjct  191  LTIYLAGAQGQVVGGTVVGPLLASGPVMIMAASFGNAAYERLPLEDEEQQQQQP-PAAVP  249

Query  701  GAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G+G + S   S  Q+M   +    QG+P N++NS  LPAEA+WGT RPP+
Sbjct  250  GSGQLESPGISGQQLMNDPNTNMFQGMPQNMLNS--LPAEAYWGTGRPPF  297



>ref|XP_007158420.1| hypothetical protein PHAVU_002G151600g [Phaseolus vulgaris]
 gb|ESW30414.1| hypothetical protein PHAVU_002G151600g [Phaseolus vulgaris]
Length=299

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 75/113 (66%), Gaps = 3/113 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IM+ASF NAAYERLP+E DE P  P     +
Sbjct  188  GLTIYLAGGQGQVVGGSVVGALVASGPVVIMSASFSNAAYERLPLE-DEDPSMPLQGGSI  246

Query  704  GGAGivssqqqsppqimvsSDATG--LQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G  G      Q      +  D+T     GL PNL+NS Q+P+E FW T R PY
Sbjct  247  GSPGGGGGVGQPQTPQQLLGDSTAPLFHGLNPNLLNSVQMPSETFWATGRSPY  299



>gb|KDP25577.1| hypothetical protein JCGZ_20733 [Jatropha curcas]
Length=295

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 81/112 (72%), Gaps = 2/112 (2%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L ASGPV+IMAASF NAAYERLP+E +E P  P     +
Sbjct  185  GLTIYLAGGQGQVVGGSVVGTLTASGPVVIMAASFSNAAYERLPLE-EEDPQLPMQGGGI  243

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGT-PRPPY  552
            G  G V  QQQ P Q++  ++A    GL PNL+NS QLP EA+W T  RPPY
Sbjct  244  GSPGAVGQQQQQPQQVLGEANAQLFHGLQPNLLNSIQLPTEAYWATGGRPPY  295



>ref|XP_010053390.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW77667.1| hypothetical protein EUGRSUZ_D01968 [Eucalyptus grandis]
Length=303

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 78/117 (67%), Gaps = 6/117 (5%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IMAASF NAAYERLP+E+D++ +Q  G    
Sbjct  187  GLTIYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEEDDAGIQVQGGSMG  246

Query  704  GGAGivssqqqsppqimvs------SDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
                 V  Q     Q          ++A    GLPPNL+NS Q+P+EA+W   RPPY
Sbjct  247  SPGSGVGGQTPQQQQQPPPQLLGDPNNAGLFHGLPPNLLNSIQMPSEAYWSGARPPY  303



>ref|XP_010092850.1| hypothetical protein L484_022445 [Morus notabilis]
 gb|EXB52668.1| hypothetical protein L484_022445 [Morus notabilis]
Length=326

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVGPLMASGPV+IMAASFGNAAYERLP+E+++        +  
Sbjct  201  GLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEEDQANNQVSMQVS  260

Query  704  GGAGi------------vssqqqsppqimvsSDATGLQGLPP--NLINSCQLPAEAFWGT  567
            GG G                 QQ    +   + +T   G+P   NL+NSC LP++A+WGT
Sbjct  261  GGLGSPGSLNVGQQQQQQQPPQQQEQMLQDPNTSTLYHGVPAAQNLLNSCNLPSDAYWGT  320

Query  566  -PRPPY  552
              RPPY
Sbjct  321  AARPPY  326



>ref|XP_002281296.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=302

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 78/117 (67%), Gaps = 7/117 (6%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IMAASF NAAYERLP+E +E P  P     L
Sbjct  187  GLTIYLAGGQGQVVGGSVVGQLLASGPVVIMAASFSNAAYERLPLE-EEDPALPMPGGSL  245

Query  704  GGAGivssqqqsppqimvsS------DATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            G  G V   Q    Q           +A    GLPPNL+NS QLPAEA+W T RPPY
Sbjct  246  GSPGGVGQHQPPQQQPQQPQQLLADPNAPLFHGLPPNLLNSIQLPAEAYWATGRPPY  302



>ref|XP_010692273.1| PREDICTED: putative DNA-binding protein ESCAROLA [Beta vulgaris 
subsp. vulgaris]
Length=334

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 80/125 (64%), Gaps = 16/125 (13%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPI-EDDESPVQP-PGTE  711
            GLTIYLAGGQGQVVGG VVGPL+ASGPV++MAASFGNAAYERLP+ ED E P  P PG  
Sbjct  212  GLTIYLAGGQGQVVGGGVVGPLLASGPVVVMAASFGNAAYERLPLDEDQEGPGAPMPGVT  271

Query  710  PLGGA-----------GivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTP  564
              GGA            ++            S     LQGLPPNL+NS  LP EAFWGTP
Sbjct  272  SGGGALGSPPPGGVPGQVIDPGTNGSGGGSGSGSGGLLQGLPPNLLNS--LPPEAFWGTP  329

Query  563  -RPPY  552
             R PY
Sbjct  330  NRTPY  334



>ref|XP_006363907.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=221

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 74/113 (65%), Gaps = 7/113 (6%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG LMASGPV+IM ASF NAAYERLP+E+D+     P   PL
Sbjct  114  GLTIYLAGGQGQVVGGSVVGALMASGPVVIMGASFSNAAYERLPLEEDD-----PNNHPL  168

Query  704  GGAGivssqqqsppqimvsSDATGLQGL-PPNLINSC-QLPAEAFWGTPRPPY  552
               G          Q ++  D +   G  PPNL+NS  QLP E +W T RPP+
Sbjct  169  PMPGGPLGSPGGQQQQLLGGDPSMFHGTPPPNLLNSSMQLPHEGYWSTGRPPF  221



>ref|XP_009143141.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=308

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 80/119 (67%), Gaps = 8/119 (7%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPI------EDDESPVQP  723
            GLTIYLAGGQGQVVGGSVVGPLMASGPVMIMAASFGNAAYERLP+      E   S    
Sbjct  190  GLTIYLAGGQGQVVGGSVVGPLMASGPVMIMAASFGNAAYERLPLEEEDQEEQQTSGAVV  249

Query  722  PGTEPLGGAGivssqqqsppqimvsSDATG-LQGLPPNLI-NSCQLPAEAFWGTPRPPY  552
                 + G G +    Q+  Q  +  D T  +QGL PNL+ +S QLP EA+WGTPRP +
Sbjct  250  NNNNNIDGNGTMGGGTQTQQQQQLMQDPTSFIQGLQPNLMSSSVQLPGEAYWGTPRPSF  308



>ref|XP_010676637.1| PREDICTED: putative DNA-binding protein ESCAROLA [Beta vulgaris 
subsp. vulgaris]
Length=315

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 78/138 (57%), Gaps = 45/138 (33%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPV--------  729
            GL+IYLAGGQGQVVGGSVVG L+ASGPV+IMAASF NAAYERLP+E+D+           
Sbjct  196  GLSIYLAGGQGQVVGGSVVGQLLASGPVVIMAASFSNAAYERLPLEEDQEGGGATMGGGM  255

Query  728  ---------------QPP----GTEPLGGAGivssqqqsppqimvsSDATGLQGLPPNLI  606
                           QPP    G +P GG   +                   QG+PPNL+
Sbjct  256  QGGGSLSGMEHQGMQQPPQQLLGNDPNGGGSAM------------------FQGMPPNLL  297

Query  605  NSCQLPAEAFWGTPRPPY  552
            NS Q+P+E +WGT RP +
Sbjct  298  NSVQMPSEGYWGTGRPSF  315



>ref|XP_004242015.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=220

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 74/113 (65%), Gaps = 8/113 (7%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG LMASGPV+IMAASF NAAYERLP+E+D+         PL
Sbjct  114  GLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEEDDQ------NHPL  167

Query  704  GGAGivssqqqsppqimvsSDATGLQGL-PPNLINSC-QLPAEAFWGTPRPPY  552
               G          Q ++  D +   G  PPNL+NS  QLP E +W T RPP+
Sbjct  168  PMPGGPLGSPGGQQQQLLGGDPSMFHGTPPPNLLNSSMQLPHEGYWSTGRPPF  220



>ref|XP_006363711.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=293

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPP---GT  714
            GLTIYLAGGQGQVVGGSVVG LMASGPV+IM+ASF NAAYERLP+E+D      P   G 
Sbjct  180  GLTIYLAGGQGQVVGGSVVGALMASGPVVIMSASFSNAAYERLPLEEDNQNHPLPVVPGG  239

Query  713  EPLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
              LG        Q    Q  + +D +   G+PPNL+NS QLP+E +W T RPP+
Sbjct  240  GSLGSPPGNIGGQGGQQQQQMMADPSLFHGMPPNLLNSIQLPSEPYWATGRPPF  293



>ref|XP_008238673.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=309

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 82/124 (66%), Gaps = 13/124 (10%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES--PVQPPGTE  711
            GLTIYLAGG GQVVGGSVVG L+ASGPV+IMAASF NAAYERLP+E+DE   P+Q  G  
Sbjct  186  GLTIYLAGGGGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEEDEGQLPMQGGGGG  245

Query  710  PLGGAGivssqqqspp----------qimvsSDATGLQGLPPNLINSCQLPAE-AFWGTP  564
             LG    V  QQQ                 +++A    GLPPNL+NS QLPAE A+W T 
Sbjct  246  SLGSPSGVGHQQQQQHQQQQQQQQLLAEAANTNAPLFHGLPPNLLNSMQLPAEAAYWATG  305

Query  563  RPPY  552
            RPPY
Sbjct  306  RPPY  309



>ref|XP_006851806.1| hypothetical protein AMTR_s00041p00022450 [Amborella trichopoda]
 gb|ERN13273.1| hypothetical protein AMTR_s00041p00022450 [Amborella trichopoda]
Length=303

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 3/114 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGG+VVG L+ASGPV+IMAASFGNAA+ERLP+++DE+ +Q PG   +
Sbjct  190  GLTIYLAGGQGQVVGGTVVGALLASGPVIIMAASFGNAAFERLPLDEDEAVLQFPGGGGM  249

Query  704  GGAGivssqqqsppqimvsSDATG--LQGLPPNLINSCQLPAEAF-WGTPRPPY  552
            GG+      Q  P Q  +  D  G    GL PN  NS QLP EA+ W   RPPY
Sbjct  250  GGSQSSPEAQSQPQQQQMLGDPNGALFHGLLPNFTNSSQLPPEAYGWAGGRPPY  303



>ref|XP_008364289.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=308

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 85/122 (70%), Gaps = 12/122 (10%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES--PVQPPGTE  711
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IMAASF NAAYERLP+E+DE   P+Q  G  
Sbjct  188  GLTIYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEEDEGQLPMQGGGGS  247

Query  710  PLG---GAGivssqqqsppqimvsSDATG-----LQGLPPNLINSCQLPAE-AFWGTPRP  558
             +G   G G  + QQQ P    + ++A         GL PNL+NS +LPAE A+W T RP
Sbjct  248  -VGSPTGVGHQNQQQQQPQHQQLLAEAANSNAPLFHGLHPNLLNSMELPAEAAYWATSRP  306

Query  557  PY  552
            P+
Sbjct  307  PF  308



>emb|CDX74739.1| BnaA05g04850D [Brassica napus]
Length=310

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 83/118 (70%), Gaps = 7/118 (6%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPP-----  720
            GLTIYLAGGQGQVVGGSVVGPLMASGPV+IMAASFGNAAYERLP+E+++   Q       
Sbjct  193  GLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEEDQEEQQTSGAVV  252

Query  719  GTEPLGGAGivssqqqsppqimvsSDATG-LQGLPPNLI-NSCQLPAEAFWGTPRPPY  552
                + G G +    Q+  Q  +  D T  +QGL PNL+ +S QLP EA+WGTPRP +
Sbjct  253  NNNNIDGNGTMGGGTQTQQQQQLMQDPTSFIQGLQPNLMSSSVQLPGEAYWGTPRPSF  310



>ref|XP_004145056.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 ref|XP_004153892.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 ref|XP_004172845.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 gb|KGN46234.1| hypothetical protein Csa_6G076820 [Cucumis sativus]
Length=282

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 79/115 (69%), Gaps = 8/115 (7%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGG+V+GPL ASGPV+IMAASFGNAAYERLPI DDE    P    P 
Sbjct  172  GLTVYLAGGQGQVVGGNVIGPLSASGPVIIMAASFGNAAYERLPI-DDEDETSP---APD  227

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLIN-SCQLPAE---AFWGTPRPPY  552
              AG  ++    PPQ++   +     G+  N++N SCQLP E   AFWG  RPPY
Sbjct  228  QMAGQQAAAAPPPPQLLGDPNGGLFHGMAQNVVNSSCQLPGEAAAAFWGGGRPPY  282



>ref|XP_008467078.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
 ref|XP_008467079.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=282

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 74/117 (63%), Gaps = 12/117 (10%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGG+V+GPL ASGPV+IMAASFGNAAYERLPI+D++       T P 
Sbjct  172  GLTVYLAGGQGQVVGGNVIGPLSASGPVIIMAASFGNAAYERLPIDDEDE------TSPA  225

Query  704  GGAGivssqqqsppqimvsSDATG--LQGLPPNLIN-SCQLPAE---AFWGTPRPPY  552
                       + P   +  D  G    G+  N +N SCQLP E   AFWG  RPPY
Sbjct  226  ADQMAGQQAAAAAPPPQLLGDPNGGLFHGMAQNAVNSSCQLPGEAAAAFWGGGRPPY  282



>ref|XP_008232681.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=315

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 80/123 (65%), Gaps = 12/123 (10%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPV--QPPGTE  711
            GLTIYLAG QGQVVGG VVGPL+ASGPV+IMAASFGNAAYERLP+E++E     Q PG+ 
Sbjct  193  GLTIYLAGVQGQVVGGGVVGPLLASGPVVIMAASFGNAAYERLPLEEEEPAAAGQVPGSG  252

Query  710  PLGGAGivssqqqsppqimvsSDATG----------LQGLPPNLINSCQLPAEAFWGTPR  561
            PLG  G+   + Q                         G+P +L+NSCQLPAE +WGT R
Sbjct  253  PLGSPGVGGQEHQQQSIQQQQQQQQQLLQDPNAPSLFHGMPQSLLNSCQLPAEGYWGTAR  312

Query  560  PPY  552
            PPY
Sbjct  313  PPY  315



>ref|XP_009420779.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=305

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 77/115 (67%), Gaps = 6/115 (5%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQ+VGGSVVGPL+ASGPV+IMAASFGNAAYERLP+ DDE P+Q      L
Sbjct  193  GLTIYLAGGQGQIVGGSVVGPLIASGPVIIMAASFGNAAYERLPL-DDEEPLQAQ-QGGL  250

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAE----AFWGTPRPPY  552
            G  G+V        Q +       L GLPPNL+N+ QLP E    A  G  R PY
Sbjct  251  GSPGLVGQSPPLQQQQLHDPSNPLLHGLPPNLLNNVQLPGEPHGWATGGGGRTPY  305



>ref|XP_006851807.1| hypothetical protein AMTR_s00041p00025000 [Amborella trichopoda]
 gb|ERN13274.1| hypothetical protein AMTR_s00041p00025000 [Amborella trichopoda]
Length=307

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 79/117 (68%), Gaps = 6/117 (5%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IMAASFGNAAYERLP+++DE  +Q  G    
Sbjct  191  GLTIYLAGGQGQVVGGSVVGALVASGPVIIMAASFGNAAYERLPLDEDEGALQVAGGGGG  250

Query  704  GGAGivssqqqsppqimvsS-----DATGLQGLPPNLINSCQLPAEAF-WGTPRPPY  552
            GG G      QS  Q          +A     LPPNL+NS QLP +A+ W T RPPY
Sbjct  251  GGMGSPGGGSQSQSQSGPQQLLSDPNAPLFHSLPPNLLNSVQLPPDAYSWATGRPPY  307



>emb|CDY18931.1| BnaC04g04190D [Brassica napus]
Length=309

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 84/120 (70%), Gaps = 9/120 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE--------SPV  729
            GLTIYLAGGQGQVVGGSVVGPLMASGPV+IMAASFGNAAYERLP+E+++        + V
Sbjct  190  GLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEEEDQEEQQTSGAVV  249

Query  728  QPPGTEPLGGAGivssqqqsppqimvsSDATGLQGLPPNLI-NSCQLPAEAFWGTPRPPY  552
                 +  G  G  +  QQ   Q ++    + +QGL PNL+ +S QLP EA+WGTPRP +
Sbjct  250  NNNNIDGNGTMGGGTQTQQPQQQQLMQDPTSFIQGLQPNLMSSSVQLPGEAYWGTPRPSF  309



>ref|XP_008804006.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=314

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 80/118 (68%), Gaps = 10/118 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IMAASF NAAYERLP+ D+E PV  PG  PL
Sbjct  200  GLTIYLAGGQGQVVGGSVVGALIASGPVVIMAASFSNAAYERLPL-DEEEPVPVPG--PL  256

Query  704  GGAGivssqqqsppqimvsS----DATGLQGLPPNLINSCQLPAEAF-WGT--PRPPY  552
               G+V        Q         +   L GLPPNL+N+ QLPAEA+ W T   RPPY
Sbjct  257  DSPGLVGDSPPPLQQQQPQQLLDPNTPLLHGLPPNLLNNIQLPAEAYSWATGGGRPPY  314



>gb|KHN09773.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=230

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 58/93 (62%), Gaps = 7/93 (8%)
 Frame = -2

Query  821  LMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPLGGAGivssqqqsppqimvsSD  642
            L+ASGPV+IMAASF NAAYERLP+ED++    P   +  GG+             ++  D
Sbjct  142  LVASGPVVIMAASFSNAAYERLPLEDED----PNSLQMQGGSIGSPGASGVGQSQLLGGD  197

Query  641  ATG--LQGLPPNLINSCQLPAEAFW-GTPRPPY  552
            AT     GLPPNL+NS Q+P+E FW  + RPP+
Sbjct  198  ATAPLFHGLPPNLLNSVQMPSEPFWAASTRPPF  230



>ref|NP_194012.1| putative AT-hook DNA-binding family protein [Arabidopsis thaliana]
 emb|CAA16566.1| putative DNA binding protein [Arabidopsis thaliana]
 emb|CAB79236.1| putative DNA binding protein [Arabidopsis thaliana]
 dbj|BAF01184.1| putative DNA binding protein [Arabidopsis thaliana]
 tpd|FAA00295.1| TPA: AT-hook motif nuclear localized protein 24 [Arabidopsis 
thaliana]
 dbj|BAH30531.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84660.1| putative AT-hook DNA-binding family protein [Arabidopsis thaliana]
Length=324

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 76/114 (67%), Gaps = 5/114 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL++YLAGGQGQVVGGSVVGPL+ +GPV++MAASF NAAYERLP+E+DE  +Q P     
Sbjct  213  GLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEEDE--MQTPVHGGG  270

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPA---EAFWGTPRPPY  552
            GG  + S               +G QGLPPNL+ S QL     +++W T RPPY
Sbjct  271  GGGSLESPPMMGQQLQHQQQAMSGHQGLPPNLLGSVQLQQQHDQSYWSTGRPPY  324



>ref|XP_003517441.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=300

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPV----QPPG  717
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IM+ASF NAAYERLP+ED++  +        
Sbjct  184  GLTIYLAGGQGQVVGGSVVGALIASGPVVIMSASFSNAAYERLPLEDEDPSMALQGGGSI  243

Query  716  TEPLGGAGivssqqqsppqimvsSDATG--LQGLPPNLINSCQLPAEAFWGTPRPPY  552
              P GG G      Q  P   +  D+T     GL PNL+NS Q+P+E FW T R PY
Sbjct  244  GSPGGGGGGGGGVGQQQPSQQLMGDSTAPLFHGLNPNLLNSVQMPSETFWATGRSPY  300



>ref|XP_003538721.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=298

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 77/115 (67%), Gaps = 4/115 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IM+ASF NAAYERLP+ED+E  +   G   +
Sbjct  183  GLTIYLAGGQGQVVGGSVVGALIASGPVVIMSASFSNAAYERLPLEDEEPSIGLQGGGSI  242

Query  704  GGAGivssqqqsppqimvsSDATG---LQGLPPNLINSCQLPA-EAFWGTPRPPY  552
            G  G      QS     +  D+T      GL PNL+NS Q+P+ E FW T R PY
Sbjct  243  GSPGGGGGVGQSQAPHQLMGDSTTAPLFHGLNPNLLNSVQMPSTETFWATGRSPY  297



>ref|XP_006440441.1| hypothetical protein CICLE_v10021296mg [Citrus clementina]
 gb|ESR53681.1| hypothetical protein CICLE_v10021296mg [Citrus clementina]
Length=308

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 80/120 (67%), Gaps = 9/120 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPV----QPPG  717
            GLTIYLAGGQGQVVGGSVVG LM SGPV+IMAASF NAAYERLP+E++E  +       G
Sbjct  189  GLTIYLAGGQGQVVGGSVVGTLMTSGPVVIMAASFSNAAYERLPLEEEEGQLPMQGGSIG  248

Query  716  TEPLGGAGivssqqqsppqimvsSDATG----LQGLPPNLINSCQLPAEAFWGT-PRPPY  552
            +   G    V +QQQ   Q  V  DA        GLPPNL+NS QLP EA+W T  RPPY
Sbjct  249  SPGGGAGAGVVAQQQPQQQQPVMGDANNNGPLFHGLPPNLLNSIQLPTEAYWATGGRPPY  308



>ref|XP_006477312.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|KDO63720.1| hypothetical protein CISIN_1g021751mg [Citrus sinensis]
Length=308

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 79/120 (66%), Gaps = 9/120 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPV----QPPG  717
            GLTIYLAGGQGQVVGGSVVG LM SGPV+IMAASF NAAYERLP+E++E  +       G
Sbjct  189  GLTIYLAGGQGQVVGGSVVGTLMTSGPVVIMAASFSNAAYERLPLEEEEGQLPMQGGSIG  248

Query  716  TEPLGGAGivssqqqsppqimvsSDATG----LQGLPPNLINSCQLPAEAFWGT-PRPPY  552
            +   G    V  QQQ   Q  +  DA        GLPPNL+NS QLP EA+W T  RPPY
Sbjct  249  SPGGGAGAGVVGQQQPQQQQPLMGDANNNGPLFHGLPPNLLNSIQLPTEAYWATGGRPPY  308



>ref|XP_008346594.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=310

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 78/123 (63%), Gaps = 12/123 (10%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES--PVQPPGTE  711
            GLTIYLAGGQGQVVGGSVVG L ASGPV+IMAASF NAAYERLP+E+DE   P+Q  G  
Sbjct  188  GLTIYLAGGQGQVVGGSVVGTLTASGPVVIMAASFSNAAYERLPLEEDEGQLPMQGGGGG  247

Query  710  PLGGAGivssqqqsppqimvsSDATG---------LQGLPPNLINSCQLPAE-AFWGTPR  561
             LG    V  Q Q   Q                    GLPPNL+NS QLPAE A+W T R
Sbjct  248  SLGSPSGVGHQNQQQQQQQQQQQLMAEAANSNPPLFHGLPPNLLNSMQLPAEAAYWATGR  307

Query  560  PPY  552
            PP+
Sbjct  308  PPF  310



>ref|XP_008373872.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=310

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 78/123 (63%), Gaps = 12/123 (10%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES--PVQPPGTE  711
            GLTIYLAGGQGQVVGGSVVG L ASGPV+IMAASF NAAYERLP+E+DE   P+Q  G  
Sbjct  188  GLTIYLAGGQGQVVGGSVVGTLXASGPVVIMAASFSNAAYERLPLEEDEGQLPMQGGGGG  247

Query  710  PLGGAGivssqqqsppqimvsSDATG---------LQGLPPNLINSCQLPAE-AFWGTPR  561
             LG    V  Q Q   Q                    GLPPNL+NS QLPAE A+W T R
Sbjct  248  SLGSPSGVGHQNQQQQQQQQQQQLMAEAANSNPPLFHGLPPNLLNSMQLPAEAAYWATGR  307

Query  560  PPY  552
            PP+
Sbjct  308  PPF  310



>ref|XP_010448831.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=328

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL++YLAGGQGQVVGGSVVGPL+ +GPV++MAASF NAAYERLP+EDDE      G    
Sbjct  215  GLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEDDEMQTPVHGGGGG  274

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPA---EAFWGTPRPPY  552
            GG  + S               +G QGLPPNL+ S QL     +++W T RPPY
Sbjct  275  GGGSMESPPMMGQQLQHQQQAMSGHQGLPPNLLGSVQLQQQHDQSYWSTGRPPY  328



>ref|XP_010439279.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=328

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 6/115 (5%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL++YLAGGQGQVVGGSVVGPL+ +GPV++MAASF NAAYERLP+EDDE  +Q P     
Sbjct  216  GLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEDDE--MQTPVHGGG  273

Query  704  GGAGivssqqqsppqimvsSDA-TGLQGLPPNLINSCQLPA---EAFWGTPRPPY  552
            GG G + S      Q+     A +G QGLPPNL+ S QL     +++W T RPPY
Sbjct  274  GGGGSMESPPMMGQQLQHQQQAMSGHQGLPPNLLGSVQLQQQHDQSYWSTGRPPY  328



>ref|XP_007220373.1| hypothetical protein PRUPE_ppa018314mg [Prunus persica]
 gb|EMJ21572.1| hypothetical protein PRUPE_ppa018314mg [Prunus persica]
Length=312

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 79/120 (66%), Gaps = 9/120 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPV--QPPGTE  711
            GLTIYLAG QGQVVGG VVGPL+ASGPV+IMAASFGNAAYERLP+E++E     Q  G+ 
Sbjct  193  GLTIYLAGVQGQVVGGGVVGPLLASGPVVIMAASFGNAAYERLPLEEEEPAAAGQVQGSG  252

Query  710  PLGGAGivssqqqsppqimvsSDATG-------LQGLPPNLINSCQLPAEAFWGTPRPPY  552
            PLG  G+   + Q                      G+P +L+NSCQLPAE +WGT RPPY
Sbjct  253  PLGSPGVGGQEHQQQSIQQQQQQLLQDPNAPSLFHGMPQSLLNSCQLPAEGYWGTARPPY  312



>gb|KDO85858.1| hypothetical protein CISIN_1g047830mg [Citrus sinensis]
Length=313

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 85/118 (72%), Gaps = 9/118 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQP-PGTEP  708
            GLTIYLAGGQGQVVGGSVVGPL+ASGPV+IMAASFGNAAYERLP+E++E+P    PG+ P
Sbjct  193  GLTIYLAGGQGQVVGGSVVGPLVASGPVVIMAASFGNAAYERLPLEEEETPEASIPGSRP  252

Query  707  LG------GAGivssqqqsppqimvsSD--ATGLQGLPPNLINSCQLPAEAFWGTPRP  558
            LG      G      QQ    Q  +  D  A+ + GLPPNL++S QLPAE +W T RP
Sbjct  253  LGSPEVNVGQPQQQQQQSQSHQQQLLQDPNASFIHGLPPNLLSSVQLPAEPYWATGRP  310



>gb|KFK28863.1| hypothetical protein AALP_AA7G058200 [Arabis alpina]
Length=324

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 74/116 (64%), Gaps = 7/116 (6%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL++YLAGGQGQVVGGSVVGPL+ +GPV++MAASF NAAYERLP+E+DE  +Q P     
Sbjct  211  GLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEEDE--MQTPVHGGG  268

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPA-----EAFWGTPRPPY  552
            GG+                   +G QGLPPNL+ S QL       +++W T RP Y
Sbjct  269  GGSMESPPMMGQQQLQHQQQAMSGHQGLPPNLLGSVQLQQPQHDNQSYWSTGRPTY  324



>ref|XP_009382863.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382873.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=309

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 79/117 (68%), Gaps = 11/117 (9%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQ+VGGSVVG L+AS PV+IMAASFGNAAYERLP+ D+E P+Q       
Sbjct  198  GLTIYLAGGQGQIVGGSVVGALIASSPVIIMAASFGNAAYERLPL-DEEEPLQ----AQQ  252

Query  704  GGAGivssqqqsppqimvsSDATG--LQGLPPNLINSCQLPAEAF-WGT---PRPPY  552
            GG G      QSPP      D     L GLPPNL+N+ QLPAEA+ W T    R PY
Sbjct  253  GGLGSPGLVGQSPPPQQQLLDPNNPLLHGLPPNLLNNVQLPAEAYGWATGGGGRTPY  309



>ref|XP_004511639.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Cicer arietinum]
Length=241

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 74/118 (63%), Gaps = 7/118 (6%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IM+ASF NAAYERLP+EDD+           
Sbjct  124  GLTIYLAGGQGQVVGGSVVGALIASGPVVIMSASFSNAAYERLPLEDDDGSNSMQLQGGG  183

Query  704  GGAGivssqqqsppqimvsSDATG--LQGLPP-----NLINSCQLPAEAFWGTPRPPY  552
            GG            Q  +  DAT    Q +PP     N+++S Q+P+E FW T R PY
Sbjct  184  GGGSPSGGGGVPQQQTQLLGDATAPLFQAMPPPNPNHNILSSVQMPSETFWPTGRSPY  241



>gb|ABL63118.1| AT-hook DNA-binding protein [Catharanthus roseus]
Length=293

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 78/125 (62%), Gaps = 14/125 (11%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPV--------  729
             LTIYLAGGQGQVVGGSVVG L+ASGPV+IMAASF NAAYERLP++++E+ +        
Sbjct  169  SLTIYLAGGQGQVVGGSVVGALLASGPVVIMAASFSNAAYERLPLDEEENSIPLQSGGSL  228

Query  728  -----QPPGTEPLGGAGivssqqqsppqimvsSDATGL-QGLPPNLINSCQLPAEAFWGT  567
                    G   + G       QQ    +    D + L  G+PPNL+NS QLP EA+W T
Sbjct  229  GSPGGGGGGNGGVPGQQQQQGGQQQQQLLGGGGDPSALFHGMPPNLLNSIQLPNEAYWAT  288

Query  566  PRPPY  552
             RPP+
Sbjct  289  GRPPF  293



>ref|XP_004511638.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Cicer arietinum]
Length=312

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 74/118 (63%), Gaps = 7/118 (6%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IM+ASF NAAYERLP+EDD+           
Sbjct  195  GLTIYLAGGQGQVVGGSVVGALIASGPVVIMSASFSNAAYERLPLEDDDGSNSMQLQGGG  254

Query  704  GGAGivssqqqsppqimvsSDATG--LQGLPP-----NLINSCQLPAEAFWGTPRPPY  552
            GG            Q  +  DAT    Q +PP     N+++S Q+P+E FW T R PY
Sbjct  255  GGGSPSGGGGVPQQQTQLLGDATAPLFQAMPPPNPNHNILSSVQMPSETFWPTGRSPY  312



>ref|XP_002869805.1| hypothetical protein ARALYDRAFT_492588 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46064.1| hypothetical protein ARALYDRAFT_492588 [Arabidopsis lyrata subsp. 
lyrata]
Length=319

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL++YLAGGQGQVVGGSVVGPL+ +GPV++MAASF NAAYERLP+E+DE      G    
Sbjct  206  GLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEEDEMQTPVHGGGGG  265

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPA---EAFWGTPRPPY  552
            GG  + S               +G QGLPPNL+ S QL     +++W T RPPY
Sbjct  266  GGGSMESPPMMGQQLQHQQQAMSGHQGLPPNLLGSVQLQQQHDQSYWSTGRPPY  319



>ref|XP_010277406.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=282

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 80/117 (68%), Gaps = 12/117 (10%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE--SPVQPPGTE  711
            GLTIYL+GGQGQVVGGSVVG L+ASGPV+IMAASF NAAYERLP+ED++   P+Q  G  
Sbjct  172  GLTIYLSGGQGQVVGGSVVGALVASGPVVIMAASFSNAAYERLPLEDEDPSLPIQSGG--  229

Query  710  PLGGAGivssqqqsppqimvsS----DATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            PLG  G+V  QQ  P Q         +     GLPPNL+     PAEAFW T RPP+
Sbjct  230  PLGSPGMVGQQQNQPQQQQQQLLPDPNNPLFHGLPPNLL----APAEAFWATARPPF  282



>ref|XP_010433825.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=336

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 76/118 (64%), Gaps = 7/118 (6%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE--SPVQPPGTE  711
            GL++YLAGGQGQVVGGSVVGPL+ SGPV++MAASF NAAYERLP+E+DE  +PVQ     
Sbjct  219  GLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLEEDEMQTPVQGGNGG  278

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLP-----AEAFWGTPRPPY  552
              GG G          Q    +     QGLPPNL+ S QLP      + +W T RPPY
Sbjct  279  GGGGGGGGMGSSPMMGQQQAMAAMAAAQGLPPNLLGSVQLPPPQQNDQQYWSTGRPPY  336



>ref|XP_009393002.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=307

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 79/110 (72%), Gaps = 6/110 (5%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQ+VGGSVVG L+ASGPV+IMAASFGNAAYERLP+ D+E P+Q      L
Sbjct  192  GLTIYLAGGQGQIVGGSVVGALIASGPVIIMAASFGNAAYERLPL-DEEEPLQAQ-QGAL  249

Query  704  GG---AGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF-WGT  567
            G     G  +  QQ   Q ++  +   L G+PPNL+N+ QLPAEA+ W T
Sbjct  250  GSPGLVGQSTPPQQPQQQQLLDPNNPLLHGIPPNLLNNLQLPAEAYSWAT  299



>dbj|BAF02122.1| putative DNA binding protein [Arabidopsis thaliana]
Length=324

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 5/114 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL++YLAGGQGQVVGGSVVGPL+ +GPV++MAASF NAAYERLP+E+ E  +Q P     
Sbjct  213  GLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEEGE--MQTPVHGGG  270

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPA---EAFWGTPRPPY  552
            GG  + S               +G QGLPPNL+ S QL     +++W T RPPY
Sbjct  271  GGGSLESPPMMGQQLQHQQQAMSGHQGLPPNLLGSVQLQQQHDQSYWSTGRPPY  324



>ref|XP_010433987.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=324

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 79/115 (69%), Gaps = 6/115 (5%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL++YLAGGQGQVVGGSVVGPL+ +GPV++MAASF NAAYERLP+E+DE  +Q P     
Sbjct  212  GLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEEDE--MQTPVHGGG  269

Query  704  GGAGivssqqqsppqimvsSDA-TGLQGLPPNLINSCQLPA---EAFWGTPRPPY  552
            GG G + S      Q+     A +G  GLPPNL+ S QL     +++W T RPPY
Sbjct  270  GGGGSMESPPMMGQQLQHQQQAMSGHHGLPPNLLGSVQLQQQHDQSYWSTGRPPY  324



>ref|XP_010455638.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=337

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 77/118 (65%), Gaps = 7/118 (6%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE--SPVQPPGTE  711
            GL++YLAGGQGQVVGGSVVGPL+ SGPV++MAASF NAAYERLP+E+DE  +PVQ  G  
Sbjct  220  GLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLEEDEMQTPVQGGGGG  279

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLP-----AEAFWGTPRPPY  552
              GG G          Q    +     QGLPPNL+ S QLP      + +W T RPPY
Sbjct  280  GGGGGGGGMGSPPMMGQQQAMAAMAAAQGLPPNLLGSVQLPPPQQNDQQYWSTGRPPY  337



>emb|CDX82978.1| BnaC01g14280D [Brassica napus]
Length=315

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 75/119 (63%), Gaps = 14/119 (12%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE--SPVQPPGTE  711
            GL++YLAGGQGQVVGGSVVGPL+ +GPV++MAASF NAAYERLP+E+DE  +PV      
Sbjct  203  GLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEEDEMQTPVHG----  258

Query  710  PLGGAGivssqqqsppqimvsSDA-TGLQGLPPNLINSC-----QLPAEAFWGTPRPPY  552
              GG G +         +     A +  QGLPPNL+        Q   +++W T RPPY
Sbjct  259  --GGGGSMEPPPMMGGPMPHQQQAMSAHQGLPPNLLGPAHQGLPQHDNQSYWSTGRPPY  315



>gb|EPS64135.1| hypothetical protein M569_10646 [Genlisea aurea]
Length=318

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = -2

Query  881  LTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPLG  702
            LTIYLAG QGQV+GG++VGPL+ASGPV+IMAASFGNAAYERLP+E++E   Q       G
Sbjct  201  LTIYLAGSQGQVMGGTIVGPLIASGPVVIMAASFGNAAYERLPLEEEEG--QSTAVHGRG  258

Query  701  GAGivssqqqsppqimvsSDATGLQGLPPNLINSC--QLPAEAFWG  570
              G      Q      +  +    QGLP  ++NS   Q+  E +WG
Sbjct  259  QMGSPVMMSQQLMNDPIHPNVNYFQGLPHGIMNSSSYQISGEGYWG  304



>gb|EPS68305.1| hypothetical protein M569_06465, partial [Genlisea aurea]
Length=209

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 65/112 (58%), Gaps = 16/112 (14%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLA  QGQVVGG V GPL+A GPV+IMAASFGNAAYERLP+++ E+          
Sbjct  113  GLTIYLAASQGQVVGGIVAGPLLAYGPVVIMAASFGNAAYERLPLDESEA----------  162

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGT-PRPPY  552
                      Q PP        T L     N++NSC LP E FWG   RPP+
Sbjct  163  -----PPLPPQPPPTRAEIETHTLLTDPFQNMVNSCPLPGENFWGALNRPPF  209



>gb|KHM98878.1| hypothetical protein glysoja_040099 [Glycine soja]
Length=90

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 59/90 (66%), Gaps = 9/90 (10%)
 Frame = -2

Query  794  MAASFGNAAYERLPIEDDESPVQPPGTEPLGGAGivssqqqsppqimvs--------SDA  639
            MAASFGNAAYERLP+E++E+PV   GTE LG  GI  +QQQS  Q            + +
Sbjct  1    MAASFGNAAYERLPLEEEETPVPYHGTEGLGSPGIPGTQQQSQSQPQQQQQQLVGDPNSS  60

Query  638  TGLQGLPPNLINSCQLPAEAFW-GTPRPPY  552
            +   G+P NL+NS QLPAE +W G+ RPP+
Sbjct  61   SLFHGVPQNLLNSIQLPAEGYWGGSARPPF  90



>ref|XP_004172826.1| PREDICTED: LOW QUALITY PROTEIN: putative DNA-binding protein 
ESCAROLA-like [Cucumis sativus]
 gb|KGN50183.1| hypothetical protein Csa_5G157420 [Cucumis sativus]
Length=303

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 75/128 (59%), Gaps = 21/128 (16%)
 Frame = -2

Query  875  IYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPLGGA  696
            IYLAGGQGQVVGGSVVG L+ASGPV+IMAASF NAAYERLP+E+D+ P Q P  +  GG 
Sbjct  177  IYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEEDDQP-QLPSLQGGGGI  235

Query  695  GivssqqqsppqimvsS------------------DATGLQGLPPNLINSCQLP--AEAF  576
            G      QS      +                   +A    GLPPNL+NS Q+P     +
Sbjct  236  GSPDEVGQSQITAQTAHHQQQQQNQQQQQQLLNDGNAPLFHGLPPNLLNSIQMPPSESPY  295

Query  575  WGTPRPPY  552
            W T RPPY
Sbjct  296  WATARPPY  303



>ref|XP_004147565.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
Length=303

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 75/128 (59%), Gaps = 21/128 (16%)
 Frame = -2

Query  875  IYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPLGGA  696
            IYLAGGQGQVVGGSVVG L+ASGPV+IMAASF NAAYERLP+E+D+ P Q P  +  GG 
Sbjct  177  IYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEEDDQP-QLPSLQGGGGI  235

Query  695  GivssqqqsppqimvsS------------------DATGLQGLPPNLINSCQLP--AEAF  576
            G      QS      +                   +A    GLPPNL+NS Q+P     +
Sbjct  236  GSPDEVGQSQITAQTAHHQQQQQNKQQQQQLLNDGNAPLFHGLPPNLLNSIQMPPSESPY  295

Query  575  WGTPRPPY  552
            W T RPPY
Sbjct  296  WATARPPY  303



>ref|XP_010908279.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=296

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES--PVQPPGTE  711
            GLT+YLAGGQGQVVGGSVVGPL ASG V+IMAASF NAAYE+LP+E++ES  P  P  T 
Sbjct  191  GLTVYLAGGQGQVVGGSVVGPLTASGHVVIMAASFSNAAYEKLPLEEEESLPPQGPVQTH  250

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF-W--GTPRPPY  552
             L G       Q+               GL PNL+NS  LP+E + W  G  RPPY
Sbjct  251  GLVGQEQQQLLQEPNL----------FHGLAPNLLNSVHLPSEPYSWTMGAGRPPY  296



>ref|XP_010917984.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=291

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 72/108 (67%), Gaps = 11/108 (10%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES-PVQPPGTEP  708
            GLT+YLAGGQGQVVGGSVVGPLMASGPV+IMAASF NAAY+RLP+E++ES P Q P  E 
Sbjct  188  GLTVYLAGGQGQVVGGSVVGPLMASGPVVIMAASFANAAYDRLPLEEEESLPAQGP-LES  246

Query  707  LGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAE-AFWGT  567
             G  G          Q     D +   GL PNL+ + QLP+E   W T
Sbjct  247  HGLVG--------QQQQQFLQDPSLFHGLAPNLLGNVQLPSEPNNWTT  286



>ref|XP_008811429.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=294

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 72/107 (67%), Gaps = 10/107 (9%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVGPLMASGPV+IMAASF NAAY+RLP+E++ES +Q  G  PL
Sbjct  192  GLTVYLAGGQGQVVGGSVVGPLMASGPVVIMAASFANAAYDRLPLEEEES-LQAQG--PL  248

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF-WGT  567
               G          Q     D     GL PNL+++ QLP+E   W T
Sbjct  249  ESHG------LLGQQQQFPQDPNLFHGLAPNLLSNVQLPSEPHSWTT  289



>emb|CDY41289.1| BnaA01g12500D [Brassica napus]
Length=315

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL++YLAGGQGQVVGGSVVGPL+ +GPV++MAASF NAAYERLP+E+DE  +Q P     
Sbjct  202  GLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEEDE--MQTPVHGGG  259

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSC-----QLPAEAFWGTPRPPY  552
            GG  +        P        +  QGLPPNL+        Q   +++W T RPPY
Sbjct  260  GGGSMEPPPMMGGPMPHQQQAMSAHQGLPPNLLGPAHQGLPQHDNQSYWSTGRPPY  315



>gb|KHN40136.1| hypothetical protein glysoja_028757 [Glycine soja]
Length=87

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 6/87 (7%)
 Frame = -2

Query  794  MAASFGNAAYERLPIEDDESPVQPPGTEPLG-----GAGivssqqqsppqimvsSDATGL  630
            MAASFGNAAYERLP+E++E+PV   G   LG     G      QQQ    +   + ++  
Sbjct  1    MAASFGNAAYERLPLEEEETPVAVAGNGGLGSPGIPGTQQQPQQQQQQQLVGDPNSSSLF  60

Query  629  QGLPPNLINSCQLPAEAFW-GTPRPPY  552
             G+P NL+NS QLPAE +W G+ RPP+
Sbjct  61   HGMPQNLLNSVQLPAEGYWGGSARPPF  87



>ref|XP_010422173.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=337

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 81/118 (69%), Gaps = 8/118 (7%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE--SPVQPPGTE  711
            GL++YLAGGQGQVVGGSVVGPL+ SGPV++MAASF NAAYERLP+E+DE  +PVQ  G  
Sbjct  221  GLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLEEDEMQTPVQGGGGG  280

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLP-----AEAFWGTPRPPY  552
              GG G + S      Q  +++     QGLPPNL+ S QLP      + +W T RPPY
Sbjct  281  GGGGGGGMGSPPMMGQQQAMAA-MAAAQGLPPNLLGSVQLPLPQQNDQQYWSTGRPPY  337



>ref|XP_010262897.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=360

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 0/110 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVG LMASGPVM++AA+F NA YERLPI+D+ +       +  
Sbjct  248  GLTVYLAGGQGQVVGGSVVGALMASGPVMVIAATFANATYERLPIKDEPAGEGMQLQQTS  307

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPP  555
            G     S    S   ++    +  +  LPPNL+ + Q+P + FW  PRPP
Sbjct  308  GVNSGTSGISASQSHVLPDPSSLPIYNLPPNLLTNGQMPHDVFWAPPRPP  357



>ref|NP_192942.1| putative AT-hook DNA-binding family protein [Arabidopsis thaliana]
 emb|CAB40946.1| putative DNA-binding protein [Arabidopsis thaliana]
 emb|CAB78248.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAP88365.1| At4g12050 [Arabidopsis thaliana]
 dbj|BAF00128.1| putative DNA-binding protein [Arabidopsis thaliana]
 tpd|FAA00297.1| TPA: AT-hook motif nuclear localized protein 26 [Arabidopsis 
thaliana]
 dbj|BAH30517.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83091.1| putative AT-hook DNA-binding family protein [Arabidopsis thaliana]
Length=339

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 77/118 (65%), Gaps = 9/118 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE--SPVQPPGTE  711
            GL++YLAGGQGQVVGGSVVGPL+ SGPV++MAASF NAAYERLP+E+DE  +PVQ  G  
Sbjct  224  GLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLEEDEMQTPVQ--GGG  281

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLP-----AEAFWGTPRPPY  552
              GG G          Q    +     QGLPPNL+ S QLP      + +W T RPPY
Sbjct  282  GGGGGGGGMGSPPMMGQQQAMAAMAAAQGLPPNLLGSVQLPPPQQNDQQYWSTGRPPY  339



>ref|XP_008437165.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=303

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 77/130 (59%), Gaps = 25/130 (19%)
 Frame = -2

Query  875  IYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPLGGA  696
            IYLAGGQGQVVGGSVVG L+ASGPV+IMAASF NAAYERLP+E+D+   QPP     GG 
Sbjct  177  IYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEEDD---QPPLPSLQGGG  233

Query  695  GivssqqqsppqimvsS--------------------DATGLQGLPPNLINSCQLP--AE  582
            GI S  +    QI   +                    +A    GLPPNL+NS Q+P    
Sbjct  234  GIGSPDEVGQSQITAQTAHHQQQQQNQQQQQQLLNDGNAPLFHGLPPNLLNSIQMPPSES  293

Query  581  AFWGTPRPPY  552
             +W T RPPY
Sbjct  294  PYWATARPPY  303



>ref|XP_009136213.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=326

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 73/117 (62%), Gaps = 8/117 (7%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL++YLAGGQGQVVGGS  GPL+ +GPV++MAASF NAAYERLP+E+DE  +Q P     
Sbjct  212  GLSVYLAGGQGQVVGGSGGGPLLCAGPVVVMAASFSNAAYERLPLEEDE--MQTPVHGGG  269

Query  704  GGAGivssqqqsppqimvsSDA-TGLQGLPPNLINSC-----QLPAEAFWGTPRPPY  552
            GG G +         +     A +  QGLPPNL+        Q   +++W T RPPY
Sbjct  270  GGGGSMEPPPMMGGPMPHQQQAMSAHQGLPPNLLGPTHQGLPQHDNQSYWSTGRPPY  326



>ref|XP_006289235.1| hypothetical protein CARUB_v10002691mg [Capsella rubella]
 gb|EOA22133.1| hypothetical protein CARUB_v10002691mg [Capsella rubella]
Length=340

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 76/121 (63%), Gaps = 10/121 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE--SPVQ---PP  720
            GL++YLAGGQGQVVGGSVVGPL+ SGPV++MAASF NAAYERLP+E+DE  +PVQ     
Sbjct  220  GLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLEEDEMQTPVQGGGGG  279

Query  719  GTEPLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLP-----AEAFWGTPRPP  555
            G    GG            Q    +     QGLPPNL+ S QLP      + +W T RPP
Sbjct  280  GGGGGGGGSGGMGSPPMMGQQQAMAAMAAAQGLPPNLLGSVQLPPQQQNDQQYWSTGRPP  339

Query  554  Y  552
            Y
Sbjct  340  Y  340



>ref|XP_008791267.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=322

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 79/125 (63%), Gaps = 17/125 (14%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSV+G L+ASGPV+IMAASFGNA YERLP+ D+E P+  PG+  L
Sbjct  201  GLTIYLAGGQGQVVGGSVLGALIASGPVVIMAASFGNAVYERLPL-DEEEPLPVPGS--L  257

Query  704  GGAGivssqqqsppqimvsS-----------DATGLQGLPPNLINSCQLPAEAF-W--GT  567
            G  G+V    Q   Q                +     GLPPNL+N+ QLP +A+ W  G 
Sbjct  258  GSPGLVGQSPQQQQQQQQQQQPQQQQLLPDPNTHLFHGLPPNLLNNVQLPTDAYGWAAGG  317

Query  566  PRPPY  552
             RP Y
Sbjct  318  GRPLY  322



>ref|XP_006284928.1| hypothetical protein CARUB_v10006227mg [Capsella rubella]
 gb|EOA17826.1| hypothetical protein CARUB_v10006227mg [Capsella rubella]
Length=330

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 73/115 (63%), Gaps = 4/115 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL++YLAGGQGQVVGGSVVGPL+ +GPV++MAASF NAAYERLP+E+DE      G    
Sbjct  216  GLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEEDEMQTPVHGGGGG  275

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSC----QLPAEAFWGTPRPPY  552
            GG  + S               +G QGLPPNL+ S     Q   +++W T RPPY
Sbjct  276  GGGSMESPPMMGQQLQHQQQAMSGHQGLPPNLLGSVQLQQQQHDQSYWSTGRPPY  330



>ref|XP_006413619.1| hypothetical protein EUTSA_v10025672mg [Eutrema salsugineum]
 gb|ESQ55072.1| hypothetical protein EUTSA_v10025672mg [Eutrema salsugineum]
Length=333

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 77/117 (66%), Gaps = 8/117 (7%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL++YLAGGQGQVVGGSVVGPL+ +GPV++MAASF NAAYERLP+EDDE  +Q P     
Sbjct  219  GLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEDDE--MQTPVHGGG  276

Query  704  GGAGivssqqqsppqimvsSDA-TGLQGLPPNLINSC-----QLPAEAFWGTPRPPY  552
            GG G + S      Q+     A +G QGLPPNL+        Q   +++W T RP Y
Sbjct  277  GGGGSMESPPMMGGQLPHQQQAMSGHQGLPPNLLGPAHQGLPQHDNQSYWSTGRPSY  333



>ref|XP_010940981.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=317

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVG L+ASGPV+IMAASF NAAYERLP+ ++E        E  
Sbjct  202  GLTVYLAGGQGQVVGGSVVGALIASGPVVIMAASFSNAAYERLPLGEEEPLPVSGALESP  261

Query  704  GGAGivssqqqsppqimvsSDATGL-QGLPPNLI-NSCQLPAEAF-WGT--PRPPY  552
            G  G    QQQ      +      L  GLPPNL+ N+ QLPAEA+ W T   RPPY
Sbjct  262  GVVGQSPPQQQQQQPQQLPDPNQPLFHGLPPNLVLNNVQLPAEAYGWATGGGRPPY  317



>ref|XP_002874744.1| hypothetical protein ARALYDRAFT_490024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51003.1| hypothetical protein ARALYDRAFT_490024 [Arabidopsis lyrata subsp. 
lyrata]
Length=331

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 73/116 (63%), Gaps = 5/116 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL++YLAGGQGQVVGGSVVGPL+ SGPV++MAASF NAAYERLP+E+DE      G    
Sbjct  216  GLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLEEDEMQTPVHGGGGG  275

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLP-----AEAFWGTPRPPY  552
            GG G          Q    +     QGLPPNL+ S QLP      + +W T RPPY
Sbjct  276  GGEGGGMGSPPMMGQQQAMAAMAAAQGLPPNLLGSVQLPPPQQNDQQYWSTGRPPY  331



>ref|XP_010540129.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
 ref|XP_010540136.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=333

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 77/126 (61%), Gaps = 24/126 (19%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE--SPVQPP---  720
            GL++YLAGGQGQVVGGSVVGPL+ +GPV++MAASF NAAYERLP+E++E  +PV      
Sbjct  217  GLSVYLAGGQGQVVGGSVVGPLVCAGPVVVMAASFSNAAYERLPLEEEEMQTPVHGGGGG  276

Query  719  -------GTEPLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLP---AEAFWG  570
                   G+ P+ G    + Q            A    GLPPNL+ S QLP    + +W 
Sbjct  277  GSGGGVMGSPPMMGQQSSNQQAGL---------AAMAGGLPPNLLGSVQLPPPHDQPYWA  327

Query  569  TPRPPY  552
            T RPP+
Sbjct  328  TGRPPF  333



>ref|NP_191646.1| AT-hook motif nuclear-localized protein 18 [Arabidopsis thaliana]
 emb|CAB82691.1| putative protein [Arabidopsis thaliana]
 tpd|FAA00289.1| TPA: AT-hook motif nuclear localized protein 18 [Arabidopsis 
thaliana]
 gb|AEE80119.1| AT-hook motif nuclear-localized protein 18 [Arabidopsis thaliana]
Length=265

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 73/119 (61%), Gaps = 23/119 (19%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIED--------DESPV  729
            GL +YLAGGQGQV+GGSVVGPL AS PV++MAASFGNA+YERLP+E+        D +  
Sbjct  162  GLKVYLAGGQGQVIGGSVVGPLTASSPVVVMAASFGNASYERLPLEEEEETEREIDGNAA  221

Query  728  QPPGTEPLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
            +  GT+                Q  +  DAT   G P NLINS  LP EA+WGT RP +
Sbjct  222  RAIGTQT---------------QKQLMQDATSFIGSPSNLINSVSLPGEAYWGTQRPSF  265



>ref|NP_001056730.1| Os06g0136900 [Oryza sativa Japonica Group]
 dbj|BAD68464.1| putative AT-hook protein 2 [Oryza sativa Japonica Group]
 dbj|BAF18644.1| Os06g0136900 [Oryza sativa Japonica Group]
 gb|EAY99567.1| hypothetical protein OsI_21541 [Oryza sativa Indica Group]
 dbj|BAG98046.1| unnamed protein product [Oryza sativa Japonica Group]
Length=328

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 68/106 (64%), Gaps = 9/106 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+Y++GGQGQVVGG+V GPL+A GPV+IMAASFGNAAYERLP+EDDE P      + +
Sbjct  217  GLTVYVSGGQGQVVGGTVAGPLIAVGPVVIMAASFGNAAYERLPLEDDEPP------QHM  270

Query  704  GGAGivssqqqsppqimvsSDATGLQ-GLPPNLINSCQLPAEAFWG  570
             G G  S      P          LQ  LP NL+N   LP +A +G
Sbjct  271  AGGGQSSPPPPPLPLPPHQQPI--LQDHLPHNLMNGIHLPGDAAYG  314



>ref|XP_010934543.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=319

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 79/119 (66%), Gaps = 11/119 (9%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IMAASFGNA YERLP+ D+E P+  PG  PL
Sbjct  204  GLTIYLAGGQGQVVGGSVVGALIASGPVVIMAASFGNAVYERLPL-DEEEPLPVPG--PL  260

Query  704  GGAGivssqqqsppqimvsS----DATGLQGLPPNLI-NSCQLPAEAF-W--GTPRPPY  552
            G  G+V        Q         +A    GLPPNL+ N+ QLPA+ + W  G  RP Y
Sbjct  261  GSPGLVGQSPPQQQQQQQQLLPDPNAPLFHGLPPNLVLNNVQLPADPYGWAAGGGRPLY  319



>ref|XP_010038368.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
Length=146

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 64/110 (58%), Gaps = 15/110 (14%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAG QGQVVGG VVG L+ASGPVMIMAASF N  ++RLP++DDE  V        
Sbjct  45   GLTIYLAGAQGQVVGGGVVGGLIASGPVMIMAASFMNVTFDRLPLDDDEVSVAIQNQHYQ  104

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSC-QLPAEAF-WGTPR  561
             G                 +D + L G+P NL+N+   L  E + WG+ R
Sbjct  105  NG-------------RHQHADISDLYGMPQNLLNNAGSLHTEMYAWGSAR  141



>ref|XP_006846339.1| hypothetical protein AMTR_s00012p00257450 [Amborella trichopoda]
 gb|ERN08014.1| hypothetical protein AMTR_s00012p00257450 [Amborella trichopoda]
Length=284

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 73/119 (61%), Gaps = 17/119 (14%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDD-ESPVQPPGTEP  708
            GLT+YLAGGQGQVVGGSVVG L+ASGPVM++AA+F NA YERLP++DD ES  Q   T  
Sbjct  175  GLTVYLAGGQGQVVGGSVVGALVASGPVMVIAATFSNATYERLPLDDDAESSAQGQLTPA  234

Query  707  LGGAGivssqqqsppqimvsSDATGLQ------GLPPNLINSCQLPAEAFWG-TPRPPY  552
              G               V   + GLQ       LPPNL+ + QLP + +W   PRPPY
Sbjct  235  AHGG---------EQGSSVVPGSMGLQSEMPVYNLPPNLMPNGQLPHDVYWTPPPRPPY  284



>ref|XP_002529315.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF33084.1| DNA binding protein, putative [Ricinus communis]
Length=301

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 71/115 (62%), Gaps = 4/115 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVG L+A+GPVM++AA+F NA YERLP+EDDE           
Sbjct  186  GLTVYLAGGQGQVVGGSVVGSLIAAGPVMVIAATFANATYERLPLEDDEEAASAGQGHIQ  245

Query  704  GGAGivssqqqsppqimvsSDATGL--QGLPPNLI-NSCQLPAEAF-WGTPRPPY  552
            GG+        S  Q     D + L    LPPNLI N  QL  +A+ W   RPPY
Sbjct  246  GGSNNSPPPIGSTGQQPGLPDPSALPVYNLPPNLIPNGGQLGHDAYAWAHGRPPY  300



>gb|ABZ89182.1| putative protein [Coffea canephora]
 gb|ADZ55300.1| DNA-binding protein [Coffea arabica]
 emb|CDO99972.1| unnamed protein product [Coffea canephora]
Length=289

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 72/120 (60%), Gaps = 15/120 (13%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPP-----  720
            GLTIYLAGGQGQVVGGSVVG L+ASGPVM++A++F NA YERLPIE+DE           
Sbjct  176  GLTIYLAGGQGQVVGGSVVGSLVASGPVMVIASTFSNATYERLPIEEDEEGGGAAQGQLG  235

Query  719  --GTEPLGGAGivssqqqsppqimvsSDATGLQGLPPNLI-NSCQLPAEAF-WGTPRPPY  552
              G+ PLG  G         P  M       +  LPPNL+ N  QL  EAF W   RPPY
Sbjct  236  GNGSPPLGSGGAPQQGGLGDPSSMP------VYNLPPNLMPNGGQLNHEAFAWAHGRPPY  289



>ref|NP_001046754.1| Os02g0448000 [Oryza sativa Japonica Group]
 dbj|BAD28974.1| putative DNA-binding protein AT-hook 2 [Oryza sativa Japonica 
Group]
 dbj|BAF08668.1| Os02g0448000 [Oryza sativa Japonica Group]
 gb|EAY85693.1| hypothetical protein OsI_07061 [Oryza sativa Indica Group]
 gb|EAZ22891.1| hypothetical protein OsJ_06576 [Oryza sativa Japonica Group]
Length=316

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 70/111 (63%), Gaps = 15/111 (14%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVG L A+GPV+IMAASF NA YERLP+EDDE          L
Sbjct  202  GLTVYLAGGQGQVVGGSVVGALTAAGPVVIMAASFANAVYERLPLEDDEL---------L  252

Query  704  GGAGivss------qqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWG  570
               G   S       QQ+      + D +  QGLPPNL+ + QLP EA +G
Sbjct  253  AAQGQADSAGLLAAGQQAAQLAGGAVDPSLFQGLPPNLLGNVQLPPEAAYG  303



>gb|ADY38789.1| DNA-binding protein [Coffea arabica]
Length=289

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 72/120 (60%), Gaps = 15/120 (13%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPP-----  720
            GLTIYLAGGQGQVVGGSVVG L+ASGPVM++A++F NA YERLPIE+DE           
Sbjct  176  GLTIYLAGGQGQVVGGSVVGSLVASGPVMVIASTFSNATYERLPIEEDEEGGGAAQGQLG  235

Query  719  --GTEPLGGAGivssqqqsppqimvsSDATGLQGLPPNLI-NSCQLPAEAF-WGTPRPPY  552
              G+ PLG  G         P  M       +  LPPNL+ N  QL  EAF W   RPPY
Sbjct  236  GNGSPPLGSGGAPQQGGLGDPSSMP------VYSLPPNLMPNGGQLNHEAFAWAHGRPPY  289



>ref|NP_001141263.1| hypothetical protein [Zea mays]
 gb|ACF85898.1| unknown [Zea mays]
 gb|ACF88117.1| unknown [Zea mays]
 gb|AFW71087.1| hypothetical protein ZEAMMB73_730676 [Zea mays]
Length=309

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 71/108 (66%), Gaps = 14/108 (13%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE---SPVQPPGT  714
            GLT+YLAGGQGQVVGGSVVG L A+GPV+IMAASF NA YERLP+E+D+   +  Q    
Sbjct  200  GLTVYLAGGQGQVVGGSVVGALTAAGPVVIMAASFANAVYERLPLEEDDMLAAQAQADSA  259

Query  713  EPLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWG  570
              L GA           Q+  + D +  QGLPPNL+ + Q+P EA +G
Sbjct  260  GILAGA-----------QLAGAVDPSLFQGLPPNLMCNVQMPPEAAYG  296



>ref|XP_008805810.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=297

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 68/115 (59%), Gaps = 12/115 (10%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvG-PLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEP  708
            GLTIYLAGGQGQVV G  V  PL ASG V+IMAASF NAAYERLP+E++ES       E 
Sbjct  191  GLTIYLAGGQGQVVVGGSVVGPLTASGHVVIMAASFSNAAYERLPLEEEESAPPQRLVES  250

Query  707  LGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF-W--GTPRPPY  552
             G  G    Q    P +           L PNL+N+ QLP+E + W  G  RPPY
Sbjct  251  HGLVGQEQQQLLQEPNL--------FHALAPNLLNNVQLPSEPYSWTAGAGRPPY  297



>emb|CDY04391.1| BnaC02g28570D [Brassica napus]
Length=327

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 75/116 (65%), Gaps = 12/116 (10%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL++YLAGGQGQVVGGSVVGPL+ SGPV++MAASF NAAY+RLP+E+DE        +  
Sbjct  219  GLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYQRLPLEEDE-------MQTP  271

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEA-----FWGTPRPPY  552
            GG G       SPP +         QGLPPNL+ S QLP +      +W T RPPY
Sbjct  272  GGGGGGGGGMGSPPMMGQQQAMAAAQGLPPNLLGSVQLPPQQQNDQPYWPTGRPPY  327



>ref|XP_010532413.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
 ref|XP_010532462.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
 ref|XP_010532533.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=317

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 70/121 (58%), Gaps = 15/121 (12%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGG V GPL+ASGPV+++AA+F NA YERLPIED+  P      +  
Sbjct  198  GLTIYLAGGQGQVVGGCVAGPLVASGPVIVIAATFSNATYERLPIEDNNQPE----QQQQ  253

Query  704  GGAGivssqqqsppqimvsSDATG---------LQGLPPNLINSCQLP-AEAFWGT-PRP  558
                    +         + D TG         +  +PPN + + Q+P  + FWGT PRP
Sbjct  254  EQGDEAKEENDDNVDDDNAKDETGNNSNEGSIPMYNMPPNFMTNGQMPHHDVFWGTPPRP  313

Query  557  P  555
            P
Sbjct  314  P  314



>ref|XP_004952401.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=318

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 71/105 (68%), Gaps = 4/105 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVG L A+GPV+IMAASF NA YERLP+E+D+        +  
Sbjct  205  GLTVYLAGGQGQVVGGSVVGALTAAGPVVIMAASFANAVYERLPLEEDDMLAAQAQADSA  264

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWG  570
            G    + +  Q   Q+  S D +  QGLPPNL+ + QLP E+ +G
Sbjct  265  G----ILAGAQQAAQLAGSVDPSLFQGLPPNLLGNVQLPPESAYG  305



>ref|XP_006420137.1| hypothetical protein CICLE_v10005603mg [Citrus clementina]
 gb|ESR33377.1| hypothetical protein CICLE_v10005603mg [Citrus clementina]
Length=276

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 68/119 (57%), Gaps = 8/119 (7%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVG L+A+GPVM++AA+F NA YERLP+EDDE      G    
Sbjct  157  GLTVYLAGGQGQVVGGSVVGQLVAAGPVMVIAATFANATYERLPLEDDEEVTGTQGQIQS  216

Query  704  GGAGivssqqqsppqimvsSDATGL-------QGLPPNLI-NSCQLPAEAFWGTPRPPY  552
             GA   ++             + GL         LPPNLI N  QL     W   RPPY
Sbjct  217  TGAAANNNNSPPQIGSSGQPSSAGLPDPSSLTYNLPPNLIPNGGQLHEAYAWAHARPPY  275



>gb|KDP40294.1| hypothetical protein JCGZ_02292 [Jatropha curcas]
Length=189

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 73/127 (57%), Gaps = 27/127 (21%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPV--------  729
            GLT+YLAGGQGQVVGGSVVG L+A+GPVM++AA+F NA YERLP+EDDE           
Sbjct  74   GLTVYLAGGQGQVVGGSVVGSLIAAGPVMVIAATFANATYERLPLEDDEEAAGSGGQGQI  133

Query  728  ------QPPGTEPLGGAGivssqqqsppqimvsSDATGLQGLPPNLI-NSCQLPAEAF-W  573
                   PP   P+G +G            +    A  +  LPPNL+ N  QL  +AF W
Sbjct  134  QGGANNSPP---PIGNSG--------QQSGLPDPSALPVYNLPPNLMPNGAQLGHDAFAW  182

Query  572  GTPRPPY  552
               RPPY
Sbjct  183  AHTRPPY  189



>ref|XP_002451872.1| hypothetical protein SORBIDRAFT_04g009050 [Sorghum bicolor]
 gb|EES04848.1| hypothetical protein SORBIDRAFT_04g009050 [Sorghum bicolor]
Length=327

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 70/105 (67%), Gaps = 2/105 (2%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVG L A+GPV+IMAASF NA YERLP+E+D+        +  
Sbjct  212  GLTVYLAGGQGQVVGGSVVGALTAAGPVVIMAASFANAVYERLPLEEDDMLAAQAQADSA  271

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWG  570
            G      +QQ +      + D +  QGLPPNL+ + QLP EA +G
Sbjct  272  GIL--AGAQQAAQLAAAGAVDPSLFQGLPPNLLGNVQLPPEAAYG  314



>gb|AEX12482.1| hypothetical protein 2_3808_01 [Pinus taeda]
 gb|AEX12483.1| hypothetical protein 2_3808_01 [Pinus taeda]
 gb|AEX12484.1| hypothetical protein 2_3808_01 [Pinus taeda]
 gb|AEX12485.1| hypothetical protein 2_3808_01 [Pinus taeda]
 gb|AEX12486.1| hypothetical protein 2_3808_01 [Pinus taeda]
 gb|AEX12487.1| hypothetical protein 2_3808_01 [Pinus taeda]
 gb|AEX12488.1| hypothetical protein 2_3808_01 [Pinus taeda]
 gb|AEX12489.1| hypothetical protein 2_3808_01 [Pinus taeda]
Length=138

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQP  723
            GLTIYL+ GQGQVVGG+VVGPL+ASGPV+IMAASF NAAY+RLP+ED+E   QP
Sbjct  42   GLTIYLSSGQGQVVGGNVVGPLIASGPVIIMAASFLNAAYDRLPLEDEEPQAQP  95



>ref|XP_006647239.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Oryza 
brachyantha]
Length=323

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 70/105 (67%), Gaps = 2/105 (2%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVG L A+GPV+IMAA F NA YERLP+EDDE  +     +  
Sbjct  208  GLTVYLAGGQGQVVGGSVVGALTAAGPVVIMAAPFANAVYERLPLEDDE--LLAAQGQAD  265

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWG  570
                + + QQ +      + D +  QGLPPNL+ + QLP EA +G
Sbjct  266  SAGLLAAGQQAAQLAGAGAVDPSLFQGLPPNLLGNVQLPPEAAYG  310



>ref|XP_006396802.1| hypothetical protein EUTSA_v10029174mg [Eutrema salsugineum]
 gb|ESQ38255.1| hypothetical protein EUTSA_v10029174mg [Eutrema salsugineum]
Length=342

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 75/125 (60%), Gaps = 14/125 (11%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE--SPVQ-----  726
            GL++YLAGGQGQVVGGSVVGPL+ SGPV++MAASF NAAYERLP+E+DE  +PV      
Sbjct  218  GLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLEEDEMQTPVHGGGGG  277

Query  725  --PPGTEPLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEA-----FWGT  567
                     GG G          Q    +     QGLPPNL+ S QLP +      +W T
Sbjct  278  GGGGSGGGGGGGGGGMGSPPMMGQQQAMAAMAAAQGLPPNLLGSVQLPPQQQNDQPYWST  337

Query  566  PRPPY  552
             RPPY
Sbjct  338  GRPPY  342



>ref|XP_009411479.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=307

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 75/114 (66%), Gaps = 7/114 (6%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL IYLAGGQGQVVGGSVVGPL+ASGPV+I+AASFG AAYERLP+  +E  +Q  GT   
Sbjct  198  GLAIYLAGGQGQVVGGSVVGPLIASGPVIIIAASFGTAAYERLPLAAEEG-LQMQGTL--  254

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF-WGTPR--PPY  552
             G+  +  Q   P  +    +      LPPNL+N+ Q+PA+A  W   R  PPY
Sbjct  255  -GSPDLIGQSPPPQLLPPDPNNLLFHSLPPNLLNNVQVPADAHGWDGSRDPPPY  307



>ref|XP_011070911.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=255

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPG  717
            GLTIYLAGGQGQV+GGSVVG L+ASGPV+IMAASF NAAYERLP+E++E+ +Q  G
Sbjct  179  GLTIYLAGGQGQVLGGSVVGQLLASGPVIIMAASFSNAAYERLPLEEEENAIQVQG  234



>ref|XP_010920512.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=320

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 79/122 (65%), Gaps = 12/122 (10%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPV--QPPGTE  711
            GLT+YLAGGQGQVVGGSVVG L+ASGPVM++AA+F NA +ERLP+ D+E  V   PPG+E
Sbjct  196  GLTVYLAGGQGQVVGGSVVGELVASGPVMVIAATFTNATFERLPLGDEEPEVAAAPPGSE  255

Query  710  PL------GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF--WGT--PR  561
             +      G  G+ SSQQ         S    L  LPPNL+ + QLP + F  W +  PR
Sbjct  256  GMPLQPSPGANGVSSSQQSHGGMGTDPSSMPPLYNLPPNLLPNGQLPHDVFGAWASAAPR  315

Query  560  PP  555
            PP
Sbjct  316  PP  317



>ref|XP_010035901.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW47415.1| hypothetical protein EUGRSUZ_K01211 [Eucalyptus grandis]
Length=249

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 64/110 (58%), Gaps = 15/110 (14%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAG QGQVVGG VVG L+ASGPVMIMAASF N  ++RLP++DDE  V        
Sbjct  148  GLTIYLAGAQGQVVGGGVVGGLIASGPVMIMAASFMNVTFDRLPLDDDEVSVAIQNQHYQ  207

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSC-QLPAEAF-WGTPR  561
             G                 +D + L G+P NL+N+   L  E + WG+ R
Sbjct  208  NG-------------RHQHADISDLYGMPQNLLNNAGSLHTEMYAWGSAR  244



>gb|EEE65050.1| hypothetical protein OsJ_20047 [Oryza sativa Japonica Group]
Length=163

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 47/85 (55%), Gaps = 7/85 (8%)
 Frame = -2

Query  824  PLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPLGGAGivssqqqsppqimvsS  645
            PL+A GPV+IMAASFGNAAYERLP+EDDE P    G       G  SS    P  +    
Sbjct  72   PLIAVGPVVIMAASFGNAAYERLPLEDDEPPQHMAG-------GGQSSPPPPPLPLPPHQ  124

Query  644  DATGLQGLPPNLINSCQLPAEAFWG  570
                   LP NL+N   LP +A +G
Sbjct  125  QPILQDHLPHNLMNGIHLPGDAAYG  149



>ref|XP_006591349.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=289

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 73/112 (65%), Gaps = 8/112 (7%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGG+V G L+ASGPVM++AA+F NA YERLP+ED++      G E +
Sbjct  181  GLTVYLAGGQGQVVGGTVAGSLVASGPVMVIAATFANATYERLPLEDEQ------GEEGM  234

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQ-LPAEAFWGT-PRPP  555
                    QQQ   Q +    +  +  LPPNL+++ Q +P +  WG  PRPP
Sbjct  235  QVQQQQQQQQQQQSQGLGEQVSMPMYNLPPNLLHNGQNMPHDVLWGAPPRPP  286



>ref|XP_007043111.1| AT-hook DNA-binding family protein, putative [Theobroma cacao]
 gb|EOX98942.1| AT-hook DNA-binding family protein, putative [Theobroma cacao]
Length=292

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  881  LTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQ  726
            LTIYLAGGQGQVVGGSV GPLMASGPV++MAASF NA Y+RLP+E++E PVQ
Sbjct  172  LTIYLAGGQGQVVGGSVAGPLMASGPVVLMAASFANAVYDRLPVEEEEPPVQ  223



>ref|XP_010538771.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=307

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 73/116 (63%), Gaps = 14/116 (12%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE--SPVQPPGTE  711
            GL++YL+GGQGQVVGGSVVGPL+ +GPV++MAASF NAAYERLP+E++E  +PV      
Sbjct  201  GLSVYLSGGQGQVVGGSVVGPLVCAGPVVVMAASFSNAAYERLPMEEEEMQTPVH-----  255

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEA---FWGTPRPPY  552
                 G       SPP       A    GLPPNL+ S QLP      +W T RPP+
Sbjct  256  ----GGGAGGPMGSPPHQQQGLAAMAASGLPPNLLGSGQLPPPHDPPYWATGRPPF  307



>gb|KDO42746.1| hypothetical protein CISIN_1g040245mg, partial [Citrus sinensis]
Length=271

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 68/119 (57%), Gaps = 8/119 (7%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVG L+A+GPVM++AA+F NA YERLP+EDDE      G    
Sbjct  152  GLTVYLAGGQGQVVGGSVVGQLVAAGPVMVIAATFANATYERLPLEDDEEVTGTQGQIQS  211

Query  704  GGAGivssqqqsppqimvsSDATGL-------QGLPPNLI-NSCQLPAEAFWGTPRPPY  552
             GA   ++             + GL         LPPNLI N  QL     W   RPPY
Sbjct  212  TGAATNNNNSPPQIGSSGQPPSAGLPDPSSLTYNLPPNLIPNGGQLHEAYAWAHARPPY  270



>ref|XP_006292551.1| hypothetical protein CARUB_v10018786mg [Capsella rubella]
 gb|EOA25449.1| hypothetical protein CARUB_v10018786mg [Capsella rubella]
Length=268

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 71/111 (64%), Gaps = 9/111 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVGPL+ASGP++IMAASFGNAAYERLP+ED+E   +       
Sbjct  166  GLTVYLAGGQGQVVGGSVVGPLVASGPIVIMAASFGNAAYERLPLEDEEETEREID----  221

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPPY  552
               G  +    +  Q  +  DA        +++NS  LP EA+WG  R  +
Sbjct  222  ---GNAARAVGTQTQKELMHDAASFTH--SDVVNSVSLPGEAYWGPQRSCF  267



>dbj|BAK03205.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=309

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 70/107 (65%), Gaps = 8/107 (7%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE---SPVQPPGT  714
            GLT+YLAGG+GQVVGG+VVG L A+GPV+IMAASF NA YERLP+E+DE   +  Q    
Sbjct  194  GLTVYLAGGKGQVVGGTVVGSLTAAGPVVIMAASFANAVYERLPLEEDELLAAQGQADSN  253

Query  713  EPLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFW  573
              L  AG     QQ+        D +  +GLPPNL+ + QLP EA +
Sbjct  254  GMLLAAG-----QQASQMAGGDVDPSLFEGLPPNLLGNVQLPPEAGY  295



>ref|XP_006601994.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=302

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 72/113 (64%), Gaps = 3/113 (3%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGG+V G L+ASGPVM++AA+F NA YERLP+EDD+   +    +  
Sbjct  187  GLTVYLAGGQGQVVGGNVAGSLVASGPVMVIAATFANATYERLPLEDDQGEEEMQVQQQQ  246

Query  704  GGAGivssqqqsppqimvsSDATG-LQGLPPNLINSCQ-LPAEAFWGT-PRPP  555
                    QQQ      +    +  +  LPPNL+++ Q +P + FWG  PRPP
Sbjct  247  QQQQQQQQQQQQQQSQGLGEQVSMPMYNLPPNLLHNGQNMPHDVFWGAPPRPP  299



>ref|XP_006477506.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 ref|XP_006489611.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
Length=350

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 68/119 (57%), Gaps = 8/119 (7%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVG L+A+GPVM++AA+F NA YERLP+EDDE      G    
Sbjct  231  GLTVYLAGGQGQVVGGSVVGQLVAAGPVMVIAATFANATYERLPLEDDEEVTGTQGQIQS  290

Query  704  GGAGivssqqqsppqimvsSDATGL-------QGLPPNLI-NSCQLPAEAFWGTPRPPY  552
             GA   ++             + GL         LPPNLI N  QL     W   RPPY
Sbjct  291  TGAATNNNNSPPQIGSSGQPPSAGLPDPSSLTYNLPPNLIPNGGQLHEAYAWAHARPPY  349



>gb|KEH34733.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=313

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 69/125 (55%), Gaps = 25/125 (20%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSV GPL+ASGPVM++AA+F NA YERLP+ED++      G +  
Sbjct  184  GLTVYLAGGQGQVVGGSVAGPLVASGPVMVIAATFANATYERLPLEDEQG-----GGDQE  238

Query  704  GGAGivssqqqsppqimvsSDATGLQG-------------------LPPNLI-NSCQLPA  585
                 V         +  +  +T  QG                   LPPNL+ N  Q+P 
Sbjct  239  EMQVQVQQSGVDSATVAAAVTSTSSQGLELGEHHQQLQQVSMPMYNLPPNLLHNGTQMPH  298

Query  584  EAFWG  570
            + FWG
Sbjct  299  DVFWG  303



>ref|XP_011029905.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Populus 
euphratica]
Length=292

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 71/116 (61%), Gaps = 5/116 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVG L+A+GPVM++AA+F NA YERLP+EDDE        +  
Sbjct  177  GLTVYLAGGQGQVVGGSVVGSLVAAGPVMVIAATFANATYERLPLEDDEEAGSGGQGQIQ  236

Query  704  GGAGivssqqqsppqimvsSD--ATGLQGLPPNLI--NSCQLPAEAF-WGTPRPPY  552
             GA        S  Q     D  A  +  LPPNLI   + QL  +A+ W   RPPY
Sbjct  237  SGANNSPPAIGSSGQQAGLPDPSAMPIYNLPPNLIPNGAHQLGHDAYAWAHARPPY  292



>ref|XP_010257112.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=395

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 72/110 (65%), Gaps = 1/110 (1%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YL+GGQGQVVGGSVVG L+ASGPVM++AA+F NA YERLPIED+ +       +  
Sbjct  284  GLTVYLSGGQGQVVGGSVVGALVASGPVMVIAATFTNATYERLPIEDEPAGEGIQLQQSS  343

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTPRPP  555
            G     +    S P  +  S +  +  LPPNL+ + Q+P + FW  PRPP
Sbjct  344  GVNSGSTGISASQPHTLPDSSSMPIYNLPPNLLPNGQMPHDVFWA-PRPP  392



>ref|XP_010032377.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 ref|XP_010032378.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 ref|XP_010032379.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW51782.1| hypothetical protein EUGRSUZ_J01233 [Eucalyptus grandis]
Length=345

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 77/128 (60%), Gaps = 19/128 (15%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESP---------  732
            GLT+YL+GGQGQVVGG+ VGPL+ASGPVM++AA+F NA YE+LP+ED+            
Sbjct  216  GLTVYLSGGQGQVVGGTAVGPLVASGPVMVVAATFSNATYEQLPVEDEAEEANVAVGDGG  275

Query  731  ----VQPP--GTEPLGGAGivssqqqsppqimvsSDATG---LQGLPPNLINSCQLPAEA  579
                +QP   G    G +G  +S  QS   +     A+    +  LPPNL+ + Q+  + 
Sbjct  276  ETMQLQPTSAGMSHPGNSGSHNSGSQSSQGLANQHHASSSMPMFTLPPNLMPNGQV-HDM  334

Query  578  FWGTPRPP  555
            FW TPRPP
Sbjct  335  FWATPRPP  342



>ref|XP_008229461.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=266

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 14/109 (13%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAG QGQVVGGSVVG L+ASGPV+IMAASF NA ++RLP+++DE        +  
Sbjct  166  GLTIYLAGAQGQVVGGSVVGALIASGPVVIMAASFMNATFDRLPLDEDEVAAALQNQQYQ  225

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF-WGTPR  561
             G                  D + L GLPPNL+ +  +P E + W + R
Sbjct  226  NG-------------RHHHLDISDLYGLPPNLLTNGNVPPEVYSWASGR  261



>ref|XP_006656611.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Oryza 
brachyantha]
Length=271

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE  738
            GLT+Y++GGQGQVVGG+V GPL+A GPV+IMAASFGNAAYERLP+EDDE
Sbjct  156  GLTVYVSGGQGQVVGGTVAGPLIAVGPVVIMAASFGNAAYERLPLEDDE  204



>ref|NP_001146992.1| DNA binding protein [Zea mays]
 gb|ACG24948.1| DNA binding protein [Zea mays]
 gb|AFW65915.1| DNA binding protein [Zea mays]
Length=320

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 63/105 (60%), Gaps = 5/105 (5%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVG L A+GPV++MAASF NA YERLP+EDD+           
Sbjct  206  GLTVYLAGGQGQVVGGSVVGALTAAGPVVVMAASFANAVYERLPLEDDDLLAAHQAP---  262

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWG  570
                       +      S D T  QGLPPNL+   Q+P E  +G
Sbjct  263  --QAQADGVLAAAQLAAGSVDPTLFQGLPPNLLGDVQMPPEPAYG  305



>ref|XP_003573204.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=312

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 64/101 (63%), Gaps = 15/101 (15%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQ--PPGTE  711
            GLT+YLAGGQGQVVGGSVVG L A+GPV+IMAASF NA YERLP+ED++   Q    G  
Sbjct  202  GLTVYLAGGQGQVVGGSVVGALTAAGPVVIMAASFANAVYERLPLEDEDLLAQGGDSGAG  261

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLP  588
             L GAG                D    QGLPPNL+ + QLP
Sbjct  262  MLPGAG-------------GQMDPNLFQGLPPNLLGNVQLP  289



>ref|XP_008801621.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
 ref|XP_008801622.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
 ref|XP_008801623.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=320

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 76/122 (62%), Gaps = 12/122 (10%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESP--VQPPGTE  711
            GLT+YLAGGQGQVVGGSVVG L+ASGPVM++AA+F NA YERLP+ D+ES     PPG+E
Sbjct  196  GLTVYLAGGQGQVVGGSVVGELVASGPVMVIAATFTNATYERLPLGDEESEAAAAPPGSE  255

Query  710  --PLGGAGivssqqqsppqimvsSDATG----LQGLPPNLINSCQLPAEAF--WGT--PR  561
              PL  +   +    S           G    L  LPPNL+ + QLP + F  W +  PR
Sbjct  256  GMPLQQSPGGNGGSSSQQSHGGMGADPGSMPPLYNLPPNLLPNGQLPHDVFGVWASTAPR  315

Query  560  PP  555
            PP
Sbjct  316  PP  317



>gb|KGN63864.1| hypothetical protein Csa_1G024960 [Cucumis sativus]
Length=119

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 63/107 (59%), Gaps = 12/107 (11%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYL+G QGQVVGG VVG L+ASGPV+IMAA+F NA ++RLP  DDE       ++  
Sbjct  16   GLTIYLSGAQGQVVGGVVVGALIASGPVVIMAATFMNATFDRLP-SDDEEVAATMQSQHY  74

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF-WGT  567
            G  G          +     D + L G+P NLI +  LP E + W T
Sbjct  75   GQNG----------RSHHHLDVSDLYGVPQNLITNSSLPPELYSWAT  111



>gb|EPS65599.1| hypothetical protein M569_09178, partial [Genlisea aurea]
Length=206

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 1/59 (2%)
 Frame = -2

Query  881  LTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES-PVQPPGTEP  708
            LTIYLAGGQGQVVGG+VVG L+ASGPV+I+AASF N AYERLP+E+DE   +QPP +EP
Sbjct  108  LTIYLAGGQGQVVGGNVVGALIASGPVIIIAASFTNVAYERLPLEEDEGIQIQPPVSEP  166



>emb|CDP06170.1| unnamed protein product [Coffea canephora]
Length=270

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 67/107 (63%), Gaps = 10/107 (9%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAG QGQVVGG VVG L+ASGPV+IMAASF NA ++RLP++DDE  V P      
Sbjct  167  GLTIYLAGPQGQVVGGGVVGALIASGPVVIMAASFMNATFDRLPLDDDE--VVP------  218

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTP  564
              A  V SQQ    +     D + + GLP NL+ +  LP E +   P
Sbjct  219  --AAAVQSQQYHNSRQRHHVDCSDIYGLPQNLLTNGTLPTEFYSWAP  263



>ref|XP_004964470.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=328

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESP  732
            GLT+YL+GGQGQ+VGG+V GPL+ASGPV+I+AA FGNAAYERLP++DDE P
Sbjct  206  GLTVYLSGGQGQIVGGAVAGPLVASGPVVIVAACFGNAAYERLPLDDDEPP  256



>ref|XP_002437782.1| hypothetical protein SORBIDRAFT_10g002490 [Sorghum bicolor]
 gb|EER89149.1| hypothetical protein SORBIDRAFT_10g002490 [Sorghum bicolor]
Length=349

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE  738
            GLT+YL+GGQGQVVGG+V GPL+ASGPV+I+AA FGNAAYERLP++DDE
Sbjct  229  GLTVYLSGGQGQVVGGTVAGPLLASGPVVIVAACFGNAAYERLPLDDDE  277



>emb|CBI35166.3| unnamed protein product [Vitis vinifera]
Length=275

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 71/115 (62%), Gaps = 16/115 (14%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQ QVVGGSVVG L+A+GPVM++AA+F NA YERLP+ED+E           
Sbjct  173  GLTIYLAGGQAQVVGGSVVGSLIAAGPVMVIAATFSNATYERLPLEDEEE----------  222

Query  704  GGAGivssqqqsppqimvsSDATGL--QGLPPNLI-NSCQLPAEAF-WGTPRPPY  552
              AG  + +Q +       +D + +    LPPNL+ N  QL  +A+ W   R PY
Sbjct  223  --AGSAAQEQLAGGGGGGMADPSSMPVYNLPPNLLPNGGQLNHDAYGWAHGRQPY  275



>ref|XP_002312579.2| hypothetical protein POPTR_0008s16440g, partial [Populus trichocarpa]
 gb|EEE89946.2| hypothetical protein POPTR_0008s16440g, partial [Populus trichocarpa]
Length=291

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 71/116 (61%), Gaps = 5/116 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVG L+A+GPVM++AA+F NA YERLP+EDD+        +  
Sbjct  176  GLTVYLAGGQGQVVGGSVVGSLVAAGPVMVIAATFANATYERLPLEDDDEAGSGGQGQIQ  235

Query  704  GGAGivssqqqsppqimvsSDATGL--QGLPPNLI--NSCQLPAEAF-WGTPRPPY  552
             GA        S  Q     D + +    LPPNLI   + QL  +A+ W   RPPY
Sbjct  236  SGANNSPPAIGSSGQQAGLPDPSAMPIYNLPPNLIPNGAHQLGHDAYAWAHARPPY  291



>ref|XP_011094152.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=250

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 13/107 (12%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL +YLAG QGQVVGGSVVGPL+ASGPV+IMAA+F NA ++RLP++DDE  V        
Sbjct  150  GLAVYLAGPQGQVVGGSVVGPLIASGPVVIMAATFMNATFDRLPLDDDEMVV--------  201

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTP  564
               G      +    + V  D   + G+P NL+ +C LP+E +   P
Sbjct  202  ---GQQYQNNRQRHHVDVCDDQ--VCGIPQNLLTNCTLPSEGYTWAP  243



>ref|XP_007218339.1| hypothetical protein PRUPE_ppa008610mg [Prunus persica]
 gb|EMJ19538.1| hypothetical protein PRUPE_ppa008610mg [Prunus persica]
Length=325

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 69/117 (59%), Gaps = 17/117 (15%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES----------  735
            GLT+YLAGGQGQVVGG+V+G L+ASGPVM++AA+F NA YERLP+ED+++          
Sbjct  203  GLTVYLAGGQGQVVGGTVMGALVASGPVMVVAATFTNATYERLPLEDEQAGEGGMQVQQQ  262

Query  734  --PVQPPGTEPLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWG  570
                Q  G    G  G   SQ            +  +  LPPNL+ + Q+P + FWG
Sbjct  263  QQQQQQSGVNSAGTGGNSGSQGLVEHTS-----SMAIYNLPPNLLPNGQMPPDVFWG  314



>ref|XP_006847733.1| hypothetical protein AMTR_s00149p00093420 [Amborella trichopoda]
 gb|ERN09314.1| hypothetical protein AMTR_s00149p00093420 [Amborella trichopoda]
Length=272

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 73/115 (63%), Gaps = 18/115 (16%)
 Frame = -2

Query  881  LTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESP--VQPPGTEP  708
            LT++LAGGQGQVVGGSVVG L+A+GPV+++AASF N AYERLPIED+E P  +QPP ++ 
Sbjct  171  LTVFLAGGQGQVVGGSVVGALVAAGPVIVIAASFANVAYERLPIEDEEPPLQIQPPVSQ-  229

Query  707  LGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF-W-GTP-RPPY  552
                        S       +       LPPN++N CQLP ++  W G P R P+
Sbjct  230  -----------ASATHFSDPNSGLPFYNLPPNMVN-CQLPVDSHGWAGNPNRQPF  272



>ref|XP_003611214.1| AT-hook DNA-binding protein [Medicago truncatula]
 gb|AES94172.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=325

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE  738
            GLTIYLAGGQGQVVGGSVVG L+ASGPV+IM+ASF NAAYERLP+EDD+
Sbjct  205  GLTIYLAGGQGQVVGGSVVGALIASGPVVIMSASFSNAAYERLPLEDDD  253



>ref|XP_010024974.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
Length=282

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 68/113 (60%), Gaps = 2/113 (2%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAGGQGQVVGGSVVG L+ASGPVM++AA+F NA YERLP+E+DE      G    
Sbjct  169  GLTIYLAGGQGQVVGGSVVGSLVASGPVMVIAATFSNATYERLPLEEDEEAGSGQGQLGS  228

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLI-NSCQLPAEAF-WGTPRPPY  552
            G    +          M    +  +  LPPNL+ N  QL  EA+ W   RP Y
Sbjct  229  GSPPGIGGGGGQQQGGMADPSSMPVYNLPPNLLPNGGQLNHEAYGWTHGRPTY  281



>ref|XP_010320485.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Solanum 
lycopersicum]
Length=243

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 53/60 (88%), Gaps = 1/60 (2%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPI-EDDESPVQPPGTEP  708
            G++I+L+GGQGQVVGGSVVGPL+ASGPV++MAASF NA +ERLP+ EDDE+P   P T+P
Sbjct  133  GISIFLSGGQGQVVGGSVVGPLIASGPVVLMAASFANAVFERLPLEEDDEAPANVPTTQP  192



>ref|XP_008233653.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=326

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 69/118 (58%), Gaps = 18/118 (15%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES----------  735
            GLT+YLAGGQGQVVGG+V+G L+ASGPVM++AA+F NA YERLP+ED+++          
Sbjct  203  GLTVYLAGGQGQVVGGTVMGALVASGPVMVIAATFTNATYERLPLEDEQAGEGGMQVQPQ  262

Query  734  ---PVQPPGTEPLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWG  570
                 Q  G    G  G   SQ            +  +  LPPNL+ + Q+P + FWG
Sbjct  263  QQQHQQQSGVNSAGTGGNSGSQGLGEHTS-----SMAIYNLPPNLLPNGQMPPDVFWG  315



>ref|XP_010090728.1| hypothetical protein L484_013750 [Morus notabilis]
 gb|EXB40447.1| hypothetical protein L484_013750 [Morus notabilis]
Length=288

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 3/63 (5%)
 Frame = -2

Query  881  LTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE---SPVQPPGTE  711
            LTIYL GGQGQVVGGSVVGPL ASGPVM+MAASF NA ++RLP+EDD+   +PVQP  ++
Sbjct  180  LTIYLGGGQGQVVGGSVVGPLTASGPVMLMAASFANAVFDRLPLEDDDGSAAPVQPTTSQ  239

Query  710  PLG  702
              G
Sbjct  240  SSG  242



>gb|KFK31952.1| hypothetical protein AALP_AA6G181300 [Arabis alpina]
Length=335

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 78/119 (66%), Gaps = 9/119 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE--SPVQPPGTE  711
            GL++YLAGGQGQVVGGSVVGPL+ SGPV++MAASF NAAYERLP+E+DE  +PV   G  
Sbjct  218  GLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLEEDEMQTPVHGGGGG  277

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSC------QLPAEAFWGTPRPPY  552
              GG G + S      Q  +++     QGLPPNL+ S       Q   + +W T RPPY
Sbjct  278  GGGGGGGMGSPPMMGQQQAMAA-MAAAQGLPPNLLGSVQLPPPQQQNDQPYWSTGRPPY  335



>emb|CBI31637.3| unnamed protein product [Vitis vinifera]
Length=300

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDD--ESPVQPPGTE  711
            GLT+YLAGGQGQVVGGSVVG LMASGPV+++AA+F NA +ERLP+ED+     +Q P T 
Sbjct  188  GLTVYLAGGQGQVVGGSVVGALMASGPVIVIAATFSNATFERLPLEDEPANEGIQMPQTS  247

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFW  573
              G               +V   +  +  LPPNL+ + Q+P + FW
Sbjct  248  --GVNSGTGGTSAPQSHGLVDPSSMPIYNLPPNLLPNGQMPHDVFW  291



>ref|XP_010102152.1| hypothetical protein L484_021386 [Morus notabilis]
 gb|EXB92402.1| hypothetical protein L484_021386 [Morus notabilis]
Length=267

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 64/110 (58%), Gaps = 14/110 (13%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAG QGQVVGGSVVG L+ASGPV+IMAASF NA ++RLP+++DE           
Sbjct  166  GLTIYLAGAQGQVVGGSVVGTLVASGPVVIMAASFMNATFDRLPLDEDE-----------  214

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF-WGTPRP  558
                     Q          D + L G+P NL+ +  +P E + W + RP
Sbjct  215  --VTAALQNQHYQNARHHPLDVSDLYGMPHNLLTNGNMPPEMYSWASCRP  262



>ref|XP_011085041.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=299

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 66/112 (59%), Gaps = 2/112 (2%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GL +YLAGGQGQVVGG+V G L+ASGPVM++AA+F NA YERLP+ED+ +         L
Sbjct  186  GLAVYLAGGQGQVVGGTVAGALVASGPVMVIAATFTNAVYERLPLEDEAASEGTRLESKL  245

Query  704  G-GAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWG-TPRPP  555
            G  AG   S          S     L  LPPNL+ + + P + FW   P PP
Sbjct  246  GVNAGASPSHGHGLAADHQSKSTAPLYNLPPNLLPNGEGPNDVFWAPQPCPP  297



>emb|CAN75757.1| hypothetical protein VITISV_028561 [Vitis vinifera]
Length=293

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 66/106 (62%), Gaps = 4/106 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDD--ESPVQPPGTE  711
            GLT+YLAGGQGQVVGGSVVG LMASGPV+++AA+F NA +ERLP+ED+     +Q P T 
Sbjct  181  GLTVYLAGGQGQVVGGSVVGALMASGPVIVIAATFSNATFERLPLEDEPANEGIQMPQTS  240

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFW  573
              G               +V   +  +   PPNL+ + Q+P + FW
Sbjct  241  --GVNSGTGGTSAPQSHGLVDPSSMPIYNJPPNLLPNGQMPHDVFW  284



>ref|XP_008380207.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=263

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 62/109 (57%), Gaps = 14/109 (13%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAG QGQV+GG VVG L+ASGPV+IMAASF NA ++RLP +++E           
Sbjct  163  GLTIYLAGAQGQVMGGGVVGALIASGPVVIMAASFMNATFDRLPQDEEEVAAALQNQHHQ  222

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF-WGTPR  561
             G                  D + L GLP NLI +  +P E + WG+ R
Sbjct  223  NG-------------RHHHVDISDLYGLPQNLITNGNVPPEVYSWGSGR  258



>ref|XP_009137280.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=327

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 73/119 (61%), Gaps = 9/119 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE--SPVQPPGTE  711
            GL++YLAGGQGQVVGGSVVGPL+ +GPV++MAASF NAAYERLP+E+DE  +PV   G  
Sbjct  210  GLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEEDEMQTPVHGGGGG  269

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSC------QLPAEAFWGTPRPPY  552
              GG+ + S               +  QGLPPNL+         Q   + +W T RP +
Sbjct  270  GGGGS-MESPPMMGGQMPHQQQAMSAHQGLPPNLLGGSAHQGLPQHDNQPYWSTGRPSF  327



>ref|XP_010658536.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=327

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDD--ESPVQPPGTE  711
            GLT+YLAGGQGQVVGGSVVG LMASGPV+++AA+F NA +ERLP+ED+     +Q P T 
Sbjct  215  GLTVYLAGGQGQVVGGSVVGALMASGPVIVIAATFSNATFERLPLEDEPANEGIQMPQTS  274

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFW  573
              G               +V   +  +  LPPNL+ + Q+P + FW
Sbjct  275  --GVNSGTGGTSAPQSHGLVDPSSMPIYNLPPNLLPNGQMPHDVFW  318



>ref|XP_004305833.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=266

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 63/109 (58%), Gaps = 14/109 (13%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAG QGQVVGG VVG L+ASGPV+IMAASF NA ++RLP+++DE        +  
Sbjct  166  GLTIYLAGAQGQVVGGGVVGALIASGPVVIMAASFMNATFDRLPLDEDEVAAALQNQQYQ  225

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF-WGTPR  561
             G                  D +   GLPPNL+ +  +P E + W + R
Sbjct  226  NG-------------RHHHLDMSDFYGLPPNLLTNGNVPPEVYSWASGR  261



>ref|XP_004137338.1| PREDICTED: uncharacterized protein LOC101219306 [Cucumis sativus]
Length=370

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 63/107 (59%), Gaps = 12/107 (11%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYL+G QGQVVGG VVG L+ASGPV+IMAA+F NA ++RLP  DDE       ++  
Sbjct  173  GLTIYLSGAQGQVVGGVVVGALIASGPVVIMAATFMNATFDRLP-SDDEEVAATMQSQHY  231

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF-WGT  567
            G  G          +     D + L G+P NLI +  LP E + W T
Sbjct  232  GQNG----------RSHHHLDVSDLYGVPQNLITNSSLPPELYSWAT  268



>ref|XP_003536146.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=280

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE  738
            GLTIYLAGGQGQ+VGG VVGPL+A+GPV++MAA+F NA YERLP+EDD+
Sbjct  167  GLTIYLAGGQGQIVGGGVVGPLVAAGPVLVMAATFSNATYERLPLEDDD  215



>emb|CDX94128.1| BnaC07g37620D [Brassica napus]
Length=327

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 73/119 (61%), Gaps = 9/119 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE--SPVQPPGTE  711
            GL++YLAGGQGQVVGGSVVGPL+ +GPV++MAASF NAAYERLP+E+DE  +PV   G  
Sbjct  210  GLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEEDEMQTPVHGGGGG  269

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSC------QLPAEAFWGTPRPPY  552
              GG+ + S               +  QGLPPNL+         Q   + +W T RP +
Sbjct  270  GGGGS-MESPPMMGGQLPHQQQAMSAHQGLPPNLLGGSAHQGLPQHDNQPYWSTGRPSF  327



>ref|XP_009775204.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=265

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 78/126 (62%), Gaps = 20/126 (16%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPI--------EDDESPV  729
            GLT+YLAGGQGQVVGGSVVGPL+++GPVMI+AA+F NA YERLP+           +SPV
Sbjct  145  GLTVYLAGGQGQVVGGSVVGPLVSAGPVMIIAATFSNATYERLPLEEEDGGGDGCGQSPV  204

Query  728  QPPGTEP--LGGAGivssqqqsppqimvsSDATGL--QGLPPNLI-NSCQLPAEAF--WG  570
             P G  P  LG +G    ++Q   Q     D T L      PNL+ N  QL  +A+  W 
Sbjct  205  -PAGNSPPALGSSG----ERQQQQQQHELPDPTSLPIYNFTPNLLPNGGQLNHDAYANWA  259

Query  569  TPRPPY  552
            TPRPPY
Sbjct  260  TPRPPY  265



>emb|CDX98771.1| BnaA03g45560D [Brassica napus]
Length=317

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 73/119 (61%), Gaps = 9/119 (8%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE--SPVQPPGTE  711
            GL++YLAGGQGQVVGGSVVGPL+ +GPV++MAASF NAAYERLP+E+DE  +PV   G  
Sbjct  200  GLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPLEEDEMQTPVHGGGGG  259

Query  710  PLGGAGivssqqqsppqimvsSDATGLQGLPPNLINSC------QLPAEAFWGTPRPPY  552
              GG+ + S               +  QGLPPNL+         Q   + +W T RP +
Sbjct  260  GGGGS-MESPPMMGGQMPHQQQAMSAHQGLPPNLLGGSAHQGLPQHDNQPYWSTGRPSF  317



>ref|XP_003556450.2| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=277

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE  738
            GLTIYLAGGQG VVGG VVGPL+A+GPV++MAA+F NA YERLP+EDD+
Sbjct  166  GLTIYLAGGQGHVVGGGVVGPLLAAGPVLLMAATFSNATYERLPLEDDD  214



>ref|XP_004160444.1| PREDICTED: LOW QUALITY PROTEIN: putative DNA-binding protein 
ESCAROLA-like [Cucumis sativus]
Length=276

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 63/107 (59%), Gaps = 12/107 (11%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYL+G QGQVVGG VVG L+ASGPV+IMAA+F NA ++RLP  DDE       ++  
Sbjct  173  GLTIYLSGAQGQVVGGVVVGALIASGPVVIMAATFMNATFDRLP-SDDEEVAATMQSQHY  231

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF-WGT  567
            G  G          +     D + L G+P NLI +  LP E + W T
Sbjct  232  GQNG----------RSHHHLDVSDLYGVPQNLITNSSLPPELYSWAT  268



>ref|XP_008453469.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=279

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 63/107 (59%), Gaps = 12/107 (11%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYL+G QGQVVGG VVG L+ASGPV+IMAA+F NA ++RLP  DDE       ++  
Sbjct  176  GLTIYLSGAQGQVVGGVVVGALIASGPVVIMAATFMNATFDRLP-SDDEEVAATMQSQHY  234

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF-WGT  567
            G  G          +     D + L G+P NLI +  LP E + W T
Sbjct  235  GQNG----------RSHHHLDVSDLYGVPQNLITNSSLPPELYTWAT  271



>gb|AFW75435.1| hypothetical protein ZEAMMB73_958269 [Zea mays]
Length=485

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YL+ GQGQVVGG+V GPL+ASGPV+I+AA FGNAA++RLP+EDDE   QP   + L
Sbjct  370  GLTVYLSAGQGQVVGGAVAGPLVASGPVVIVAACFGNAAFDRLPLEDDEPLPQPQQNQHL  429



>gb|KDP42477.1| hypothetical protein JCGZ_00274 [Jatropha curcas]
Length=1065

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE  738
            G T+YLAG +G+VVGGSV+GPL+A+GPV+++AA+F NAAYERLP+EDDE
Sbjct  186  GFTVYLAGRKGKVVGGSVMGPLIAAGPVIVIAATFTNAAYERLPLEDDE  234



>ref|XP_009391843.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=313

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 78/114 (68%), Gaps = 6/114 (5%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            G+TIYL+GGQGQVVGGSVVGPL+A GP++IMAASFG+AAYERLP+ ++E  +Q  G  PL
Sbjct  203  GMTIYLSGGQGQVVGGSVVGPLIALGPIIIMAASFGSAAYERLPLPEEEG-LQAQG--PL  259

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF-WGT--PRPPY  552
            G    V    Q+  Q++   +      L P+L+N+ Q PA+A+ WG    RP Y
Sbjct  260  GSPDFVGQSPQAQQQLLPDPNNPLFHNLSPSLLNNMQSPADAYGWGAGGVRPAY  313



>ref|XP_007035040.1| AT-hook motif nuclear localized protein 20 [Theobroma cacao]
 gb|EOY05966.1| AT-hook motif nuclear localized protein 20 [Theobroma cacao]
Length=273

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 71/127 (56%), Gaps = 27/127 (21%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPV--------  729
            GLT+YLAGGQGQVVGGSVVG L+A+GPVM++AA+F NA YERLPIEDDE           
Sbjct  158  GLTVYLAGGQGQVVGGSVVGSLIAAGPVMVIAATFANATYERLPIEDDEEAGSGGHGGQI  217

Query  728  ------QPPGTEPLGGAGivssqqqsppqimvsSDATGLQGLPPNLI-NSCQLPAEAF-W  573
                   PP    +G +G  +                 +  LPPNL+ N  QL  EA+ W
Sbjct  218  QGGAGNSPPA---IGSSGPQTGLPDPSSLP--------IYNLPPNLLANGGQLGHEAYAW  266

Query  572  GTPRPPY  552
               RPPY
Sbjct  267  AHGRPPY  273



>ref|XP_011030530.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Populus 
euphratica]
Length=289

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 72/126 (57%), Gaps = 25/126 (20%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVG L+A+GPVM++AA+F NA YERLP+EDDE           
Sbjct  174  GLTVYLAGGQGQVVGGSVVGSLIAAGPVMVIAATFANATYERLPLEDDEE----------  223

Query  704  GGAGivssqqqsppqimvsSDATGLQG-----------LPPNLINS--CQLPAEAF-WG-  570
             G+G     Q        +  ++G Q            LPPNL+ S   QL  EA+ W  
Sbjct  224  AGSGGQGHLQSGANNSPPAIGSSGQQSGLPDPSSMPVYLPPNLMQSGAQQLGHEAYAWAH  283

Query  569  TPRPPY  552
              RPPY
Sbjct  284  AARPPY  289



>ref|XP_007048865.1| AT-hook DNA-binding family protein [Theobroma cacao]
 gb|EOX93022.1| AT-hook DNA-binding family protein [Theobroma cacao]
Length=257

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 60/107 (56%), Gaps = 13/107 (12%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAG QGQVVGG VVG L+ASGPV++MAASF NA ++RLP++DDE     P     
Sbjct  157  GLTIYLAGAQGQVVGGGVVGALIASGPVLVMAASFMNATFDRLPLDDDEVAAAMPNQ---  213

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAFWGTP  564
                                D + L G+P NLI +  +P E +   P
Sbjct  214  ----------YHQNARHHHLDISDLYGMPQNLITNGTMPPEIYSWAP  250



>ref|XP_009356620.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=263

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 62/109 (57%), Gaps = 14/109 (13%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLTIYLAG QGQV+GG VVG L+ASGPV+IMAASF N  ++RLP++++E        +  
Sbjct  163  GLTIYLAGAQGQVMGGGVVGALIASGPVVIMAASFMNVTFDRLPLDEEEVAAALQNQQHQ  222

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINSCQLPAEAF-WGTPR  561
             G                  D + L GLP NLI +  +P E + W + R
Sbjct  223  NG-------------RHHHLDISDLYGLPQNLITNGNVPPEVYSWASGR  258



>ref|XP_009139154.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
 ref|XP_009139155.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
 ref|XP_009139156.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
 emb|CDX76085.1| BnaA04g03490D [Brassica napus]
Length=307

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE  738
            GLT+YLAG QGQV+GG V GPL ASGPV+++AA+F NA YERLPIEDD+
Sbjct  192  GLTVYLAGAQGQVLGGGVAGPLTASGPVIVIAATFSNATYERLPIEDDQ  240



>ref|XP_002314642.2| hypothetical protein POPTR_0010s08500g [Populus trichocarpa]
 gb|EEF00813.2| hypothetical protein POPTR_0010s08500g [Populus trichocarpa]
Length=289

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 71/115 (62%), Gaps = 17/115 (15%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVG L+A+GPVM++AA+F NA YERLP+EDDE      G+  +
Sbjct  188  GLTVYLAGGQGQVVGGSVVGSLIAAGPVMVIAATFANATYERLPLEDDEE----AGSGAI  243

Query  704  GGAGivssqqqsppqimvsSDATGLQGLPPNLINS--CQLPAEAF-WG-TPRPPY  552
            G +G  +         +          LPPNL+ S   QL  +A+ W    RPPY
Sbjct  244  GSSGQQAGLPDPSSMPVY---------LPPNLMQSGAQQLGHDAYAWAHAARPPY  289



>ref|XP_007144002.1| hypothetical protein PHAVU_007G120900g [Phaseolus vulgaris]
 gb|ESW15996.1| hypothetical protein PHAVU_007G120900g [Phaseolus vulgaris]
Length=278

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE  738
            GLTIYLAGGQGQ+VGG VVGPL+A+GPV+IMAA+F NA YERLP+E+D+
Sbjct  168  GLTIYLAGGQGQIVGGGVVGPLVAAGPVLIMAATFSNATYERLPLEEDD  216



>ref|XP_010554616.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
 ref|XP_010554617.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
 ref|XP_010554618.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
 ref|XP_010554619.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
 ref|XP_010554620.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
 ref|XP_010554621.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=331

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIED  744
            GLTIYLAGGQGQVVGG V GPL+ASGPV++MAA+F NA YERLP+ED
Sbjct  206  GLTIYLAGGQGQVVGGCVAGPLVASGPVIVMAATFSNATYERLPVED  252



>ref|XP_010940763.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=355

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVGPL+A+G VM++A++F NA+YERLP+E++E P Q PG   L
Sbjct  259  GLTVYLAGGQGQVVGGSVVGPLIAAGSVMVVASTFANASYERLPLEEEEGPGQLPGGSAL  318



>ref|XP_008799138.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=307

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTE  711
            GLT++LAGGQGQVVGGSVVGPL+A+GPV++MAASF NA YERLPIE +E    PP  +
Sbjct  187  GLTVFLAGGQGQVVGGSVVGPLVAAGPVVLMAASFANAVYERLPIEGEEEAAPPPAVQ  244



>ref|XP_007009270.1| AT-hook protein of GA feedback 2 [Theobroma cacao]
 gb|EOY18080.1| AT-hook protein of GA feedback 2 [Theobroma cacao]
Length=339

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 67/121 (55%), Gaps = 16/121 (13%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE-----------  738
            GLT+YLAGGQGQVVGGSV+G L+ASGPVM++AA+F NA YERLPIED+            
Sbjct  210  GLTVYLAGGQGQVVGGSVIGALIASGPVMVIAATFTNAVYERLPIEDENGGEEGGGGGGE  269

Query  737  -SPVQPPGTEPLGGAGivssqqqsppqimvsSDATG----LQGLPPNLINSCQLPAEAFW  573
               VQ          G       S     +  +  G    L  LPPNL+ + Q+P + FW
Sbjct  270  GIGVQQQVNHSNNNGGGGGGNSGSSQSQGLGHEQEGGSIPLYNLPPNLLPNGQMPPDVFW  329

Query  572  G  570
            G
Sbjct  330  G  330



>ref|XP_010262258.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=255

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 72/117 (62%), Gaps = 6/117 (5%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPI--EDDESPVQPPGTE  711
            GLT+YLAGGQGQVVGGSVVG L+A+GPVM++AA+F NA YERLP+  E+DE+     G  
Sbjct  139  GLTVYLAGGQGQVVGGSVVGTLVAAGPVMVIAATFANATYERLPLEEEEDEAGSGGQGQL  198

Query  710  PLGGAGivssqqqsppqimvsSDATGL--QGLPPNLI-NSCQLPAEAF-WGTPRPPY  552
              G      +   S  Q     D + L    LPPNLI N  QL  +AF W   RPP+
Sbjct  199  AGGAGSSPPAIGSSAQQQSGLPDPSSLPIYNLPPNLIPNGGQLNHDAFAWAHARPPF  255



>ref|XP_004238464.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Solanum 
lycopersicum]
Length=245

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 1/59 (2%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPI-EDDESPVQPPGTE  711
            G++I+L+GGQGQVVGGSVVGPL+ASGPV++MAASF NA +ERLP+ EDDE+P   P T+
Sbjct  133  GISIFLSGGQGQVVGGSVVGPLIASGPVVLMAASFANAVFERLPLEEDDEAPANVPTTQ  191



>ref|XP_008796249.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=305

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  881  LTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPP  720
            LT++LAGGQGQVVGGSVVGPL+A+GPV++MAASF NA YERLPIE DE    PP
Sbjct  184  LTVFLAGGQGQVVGGSVVGPLVAAGPVVLMAASFANAVYERLPIEGDEEAAAPP  237



>ref|XP_010918771.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
 ref|XP_010918772.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=248

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 73/114 (64%), Gaps = 7/114 (6%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGTEPL  705
            GLT+YLAGGQGQVVGGSVVG L+A+GPVM++AA+F NA YERLP+E++E   + PG    
Sbjct  139  GLTVYLAGGQGQVVGGSVVGSLVAAGPVMVVAATFANATYERLPLEEEEEEEEGPG----  194

Query  704  GGAGiv-ssqqqsppqimvsSDATGLQGLPPNLI-NSCQLPAEAF-WGTPRPPY  552
            G AG +      +         +  +  LPPNL+ N  QL  +AF W   RPPY
Sbjct  195  GSAGHLPCRSPAAMGTGFPDPSSLSIYNLPPNLLPNGAQLVHDAFAWAHARPPY  248



>gb|EYU41285.1| hypothetical protein MIMGU_mgv1a025243mg [Erythranthe guttata]
Length=293

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  881  LTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPP  720
            LTIYLAGGQGQVVGG+VVG L+ASGPV+I+AASF N AYERLP++++E+P  PP
Sbjct  183  LTIYLAGGQGQVVGGNVVGALIASGPVIIVAASFTNVAYERLPLDEEEAPQMPP  236



>ref|XP_006435633.1| hypothetical protein CICLE_v10032034mg [Citrus clementina]
 ref|XP_006486403.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|ESR48873.1| hypothetical protein CICLE_v10032034mg [Citrus clementina]
Length=338

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE  738
            GLT+YLAGGQGQVVGG+V+G LMASGPVM++AA+F NA YERLP+ED+E
Sbjct  209  GLTVYLAGGQGQVVGGTVMGALMASGPVMVIAATFTNATYERLPMEDEE  257



>emb|CDP00129.1| unnamed protein product [Coffea canephora]
Length=310

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDD  741
            GLT+YLAGGQGQVVGG+VVGPLMASGPVM++AA+F NA YERLP+E++
Sbjct  227  GLTVYLAGGQGQVVGGTVVGPLMASGPVMVIAATFTNATYERLPLEEE  274



>ref|XP_007144108.1| hypothetical protein PHAVU_007G129400g, partial [Phaseolus vulgaris]
 gb|ESW16102.1| hypothetical protein PHAVU_007G129400g, partial [Phaseolus vulgaris]
Length=310

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 1/52 (2%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPI-EDDESP  732
            GLT+YLAGGQGQV+GGSVVGPL+A+GPVM++AA+F NA YERLP+ EDDE P
Sbjct  196  GLTVYLAGGQGQVLGGSVVGPLVATGPVMVIAATFANATYERLPLDEDDEGP  247



>ref|XP_010694781.1| PREDICTED: putative DNA-binding protein ESCAROLA [Beta vulgaris 
subsp. vulgaris]
Length=301

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 2/55 (4%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIED--DESPVQ  726
            GLT+YLAGGQGQVVGGSVVGPL+A+GPVM++AA+F NA YERLP+ED  DE P Q
Sbjct  173  GLTVYLAGGQGQVVGGSVVGPLIAAGPVMVIAATFSNATYERLPLEDQEDEQPGQ  227



>ref|XP_010266286.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=280

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQ  726
            GLTI+LAGGQGQVVGGSVVG L+ASGPVM+MA SF NA +ERLP+ ++ESPVQ
Sbjct  172  GLTIFLAGGQGQVVGGSVVGSLIASGPVMLMATSFANAMFERLPLGEEESPVQ  224



>ref|XP_008780228.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=268

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPG  717
            GLT+YLAGGQGQVVGGSVVG L+A+GPVM++A++F NA YERLP+E++E P Q PG
Sbjct  172  GLTVYLAGGQGQVVGGSVVGSLIAAGPVMVVASTFANATYERLPLEEEEGPGQLPG  227



>gb|AGC22550.1| male sterility related AT-hook DNA binding protein [Brassica 
oleracea]
Length=260

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES  735
            GLTIYLAG QGQVVGG VVG L+ASGPV+IMAASF NA ++RLP++DDES
Sbjct  161  GLTIYLAGHQGQVVGGGVVGGLIASGPVVIMAASFMNAVFDRLPLDDDES  210



>ref|XP_011038532.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=284

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE  738
            GLTIYLAGGQGQVVGGSVVG L+ASGPVMI+AA+F NA YERLP+ED+E
Sbjct  177  GLTIYLAGGQGQVVGGSVVGSLVASGPVMIIAATFSNATYERLPLEDEE  225



>ref|XP_010524099.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=252

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQ  726
            GLTIYLAG QGQVVGG VVG L+ASGPV++MA+SF NA ++RLP++DDES +Q
Sbjct  154  GLTIYLAGHQGQVVGGGVVGGLIASGPVVLMASSFMNAVFDRLPLDDDESAIQ  206



>ref|XP_006408178.1| hypothetical protein EUTSA_v10021166mg [Eutrema salsugineum]
 gb|ESQ49631.1| hypothetical protein EUTSA_v10021166mg [Eutrema salsugineum]
Length=315

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES  735
            GLTIYLAGGQGQVVGGSVVGPLMA+GPVM++AA+F NA YERLP+E++++
Sbjct  192  GLTIYLAGGQGQVVGGSVVGPLMAAGPVMLIAATFSNATYERLPLEEEDA  241



>emb|CDX83510.1| BnaA03g19960D [Brassica napus]
Length=510

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDES  735
            GLTIYLAG QG+VVGG VVG L+ASGPV+IMAASF NA ++RLP++DDES
Sbjct  411  GLTIYLAGHQGRVVGGGVVGGLIASGPVVIMAASFMNAVFDRLPLDDDES  460



>gb|ABL63119.1| AT-hook DNA-binding protein, partial [Catharanthus roseus]
Length=256

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDESPVQPPGT  714
            GLT+YLAGGQGQVVGGSVVG L+A+GPV+I+AA+F NA YERLP+EDDE     P T
Sbjct  130  GLTVYLAGGQGQVVGGSVVGSLVAAGPVLIIAATFANATYERLPLEDDEEDQVSPAT  186



>gb|KCW61537.1| hypothetical protein EUGRSUZ_H04257, partial [Eucalyptus grandis]
Length=272

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -2

Query  884  GLTIYLAggqgqvvggsvvGPLMASGPVMIMAASFGNAAYERLPIEDDE  738
            GLTIYLAGGQGQVVGGSVVG L+ASGPVM++AA+F NA YERLP+E+DE
Sbjct  169  GLTIYLAGGQGQVVGGSVVGSLVASGPVMVIAATFSNATYERLPLEEDE  217



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1832417718138