BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19764_g2_i1 len=572 path=[1947:0-571]

Length=572
                                                                      Score     E

ref|XP_006347096.1|  PREDICTED: PAP-specific phosphatase HAL2-like      250   1e-77   
ref|XP_009757366.1|  PREDICTED: PAP-specific phosphatase HAL2-like      249   7e-77   
ref|XP_009601571.1|  PREDICTED: PAP-specific phosphatase HAL2-like      244   4e-75   
ref|XP_011027928.1|  PREDICTED: PAP-specific phosphatase HAL2-lik...    239   4e-73   
ref|XP_011027927.1|  PREDICTED: PAP-specific phosphatase HAL2-lik...    239   4e-73   
ref|XP_007213885.1|  hypothetical protein PRUPE_ppa006862mg             236   1e-72   
ref|XP_011043256.1|  PREDICTED: PAP-specific phosphatase HAL2-like      237   2e-72   
ref|XP_002317235.2|  hypothetical protein POPTR_0011s04470g             237   3e-72   Populus trichocarpa [western balsam poplar]
ref|XP_002305006.2|  hypothetical protein POPTR_0004s03660g             236   4e-72   Populus trichocarpa [western balsam poplar]
ref|XP_006449251.1|  hypothetical protein CICLE_v10015112mg             236   1e-71   
emb|CDO99612.1|  unnamed protein product                                235   1e-71   
ref|XP_002266810.2|  PREDICTED: PAP-specific phosphatase HAL2-like      235   2e-71   Vitis vinifera
gb|KDO75791.1|  hypothetical protein CISIN_1g011984mg                   235   2e-71   
ref|XP_006467873.1|  PREDICTED: PAP-specific phosphatase HAL2-like      235   2e-71   
ref|XP_004232820.1|  PREDICTED: PAP-specific phosphatase HAL2-like      234   2e-71   
ref|XP_002521419.1|  diphosphonucleoside phosphohydrolase, putative     232   4e-71   Ricinus communis
ref|XP_004293556.1|  PREDICTED: PAP-specific phosphatase HAL2-like      234   4e-71   
ref|XP_010092615.1|  PAP-specific phosphatase HAL2-like protein         231   1e-70   
ref|XP_008224976.1|  PREDICTED: PAP-specific phosphatase HAL2-like      232   2e-70   
ref|XP_008383803.1|  PREDICTED: PAP-specific phosphatase HAL2-like      231   4e-70   
ref|XP_003545856.1|  PREDICTED: PAP-specific phosphatase HAL2-like      230   2e-69   
gb|KDP20907.1|  hypothetical protein JCGZ_21378                         229   2e-69   
ref|XP_007025749.1|  PAP-specific phosphatase HAL2-like isoform 2       228   2e-69   
ref|XP_011096290.1|  PREDICTED: PAP-specific phosphatase HAL2-like      229   2e-69   
ref|XP_004485721.1|  PREDICTED: PAP-specific phosphatase HAL2-like      229   4e-69   
ref|XP_008345875.1|  PREDICTED: PAP-specific phosphatase HAL2-like      229   4e-69   
gb|KHN08573.1|  PAP-specific phosphatase HAL2-like                      227   5e-69   
ref|XP_004146587.1|  PREDICTED: PAP-specific phosphatase HAL2-like      226   6e-69   
ref|XP_009377836.1|  PREDICTED: PAP-specific phosphatase HAL2-like      228   7e-69   
ref|XP_007025748.1|  PAP-specific phosphatase HAL2-like isoform 1       228   8e-69   
ref|XP_007148225.1|  hypothetical protein PHAVU_006G190400g             228   1e-68   
ref|XP_010065475.1|  PREDICTED: PAP-specific phosphatase HAL2-like      228   1e-68   
ref|XP_003543080.1|  PREDICTED: PAP-specific phosphatase HAL2-like      226   3e-68   
gb|KGN64635.1|  hypothetical protein Csa_1G072460                       226   4e-68   
ref|XP_003593471.1|  PAP-specific phosphatase HAL2-like protein         226   5e-68   
ref|XP_008442099.1|  PREDICTED: PAP-specific phosphatase HAL2-like      225   1e-67   
gb|KHG08289.1|  PAP-specific phosphatase HAL2-like protein              223   8e-67   
ref|XP_008226682.1|  PREDICTED: PAP-specific phosphatase HAL2-like      218   1e-65   
ref|XP_009351317.1|  PREDICTED: PAP-specific phosphatase HAL2-like      215   1e-64   
ref|XP_007211428.1|  hypothetical protein PRUPE_ppa007114mg             214   2e-64   
gb|EYU43398.1|  hypothetical protein MIMGU_mgv1a006221mg                215   5e-64   
ref|XP_002281902.2|  PREDICTED: PAP-specific phosphatase HAL2-like      213   6e-64   Vitis vinifera
ref|XP_008366620.1|  PREDICTED: PAP-specific phosphatase HAL2-like      213   1e-63   
gb|KHG09864.1|  PAP-specific phosphatase HAL2-like protein              214   2e-63   
ref|XP_010931922.1|  PREDICTED: PAP-specific phosphatase HAL2-like      214   2e-63   
ref|XP_009334609.1|  PREDICTED: PAP-specific phosphatase HAL2-like      211   4e-63   
ref|XP_006449252.1|  hypothetical protein CICLE_v10015112mg             210   8e-63   
ref|XP_008349979.1|  PREDICTED: PAP-specific phosphatase HAL2-like      210   1e-62   
gb|KDO75792.1|  hypothetical protein CISIN_1g011984mg                   210   1e-62   
gb|AFK34186.1|  unknown                                                 210   1e-62   
ref|XP_004294514.1|  PREDICTED: PAP-specific phosphatase HAL2-like      208   4e-62   
gb|EMT01678.1|  PAP-specific phosphatase HAL2-like protein              204   5e-61   
ref|XP_010235939.1|  PREDICTED: PAP-specific phosphatase HAL2-like      207   8e-61   
gb|EMS49729.1|  PAP-specific phosphatase HAL2-like protein              204   1e-60   
ref|XP_010696590.1|  PREDICTED: PAP-specific phosphatase HAL2-like      206   1e-60   
ref|XP_006464700.1|  PREDICTED: PAP-specific phosphatase HAL2-lik...    203   1e-60   
ref|XP_002317523.1|  PAP-specific phosphatase HAL2-like family pr...    204   2e-60   Populus trichocarpa [western balsam poplar]
ref|XP_007159267.1|  hypothetical protein PHAVU_002G2236000g            202   2e-60   
gb|KDP38930.1|  hypothetical protein JCGZ_00687                         204   2e-60   
ref|XP_006464699.1|  PREDICTED: PAP-specific phosphatase HAL2-lik...    204   3e-60   
ref|XP_008778819.1|  PREDICTED: PAP-specific phosphatase HAL2-like      205   5e-60   
ref|XP_010921982.1|  PREDICTED: PAP-specific phosphatase HAL2-like      205   5e-60   
ref|XP_007133063.1|  hypothetical protein PHAVU_011G148400g             201   9e-60   
ref|XP_006451955.1|  hypothetical protein CICLE_v10008644mg             202   1e-59   
ref|XP_006648074.1|  PREDICTED: PAP-specific phosphatase HAL2-like      202   1e-59   
gb|KHN07307.1|  PAP-specific phosphatase HAL2-like                      202   2e-59   
ref|XP_006841753.1|  hypothetical protein AMTR_s00003p00261960          201   3e-59   
dbj|BAK02450.1|  predicted protein                                      203   3e-59   
ref|XP_010062895.1|  PREDICTED: PAP-specific phosphatase HAL2-like      201   3e-59   
gb|EAZ25001.1|  hypothetical protein OsJ_08781                          200   3e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010268789.1|  PREDICTED: PAP-specific phosphatase HAL2-like      203   4e-59   
ref|XP_003542776.2|  PREDICTED: PAP-specific phosphatase HAL2-like      202   4e-59   
dbj|BAD19426.1|  putative 3'(2'),5'-bisphosphate nucleotidase           200   4e-59   Oryza sativa Japonica Group [Japonica rice]
gb|EAY85312.1|  hypothetical protein OsI_06689                          199   8e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_009411984.1|  PREDICTED: PAP-specific phosphatase HAL2-like      200   9e-59   
gb|KHN36344.1|  PAP-specific phosphatase HAL2-like                      199   1e-58   
ref|XP_006582834.1|  PREDICTED: uncharacterized protein LOC100306...    201   1e-58   
ref|XP_004504991.1|  PREDICTED: PAP-specific phosphatase HAL2-like      200   3e-58   
gb|KHN10308.1|  PAP-specific phosphatase HAL2-like                      198   6e-58   
ref|NP_001048441.1|  Os02g0805500                                       200   7e-58   Oryza sativa Japonica Group [Japonica rice]
gb|AAK98703.1|AC069158_15  Putative PAP-specific phosphatase            199   1e-57   Oryza sativa [red rice]
ref|XP_007021305.1|  PAP-specific phosphatase HAL2-like                 197   1e-57   
ref|XP_011029420.1|  PREDICTED: PAP-specific phosphatase HAL2-lik...    194   2e-57   
ref|XP_003541114.1|  PREDICTED: PAP-specific phosphatase HAL2-like      196   3e-57   
ref|XP_009385075.1|  PREDICTED: PAP-specific phosphatase HAL2-like      196   3e-57   
ref|XP_002454739.1|  hypothetical protein SORBIDRAFT_04g036470          197   4e-57   Sorghum bicolor [broomcorn]
ref|XP_006582183.1|  PREDICTED: PAP-specific phosphatase HAL2-like      196   4e-57   
ref|XP_011029418.1|  PREDICTED: PAP-specific phosphatase HAL2-lik...    195   5e-57   
gb|ACG46228.1|  PAP-specific phosphatase                                196   6e-57   Zea mays [maize]
ref|NP_001152174.1|  PAP-specific phosphatase                           196   7e-57   Zea mays [maize]
ref|XP_004955266.1|  PREDICTED: PAP-specific phosphatase HAL2-like      196   9e-57   
gb|KEH19580.1|  3'(2'),5'-bisphosphate nucleotidase                     194   1e-56   
ref|XP_004515397.1|  PREDICTED: PAP-specific phosphatase HAL2-like      194   1e-56   
ref|XP_002534510.1|  diphosphonucleoside phosphohydrolase, putative     194   2e-56   Ricinus communis
ref|XP_010278344.1|  PREDICTED: PAP-specific phosphatase HAL2-lik...    191   3e-56   
ref|XP_008454658.1|  PREDICTED: PAP-specific phosphatase HAL2-like      192   6e-56   
gb|KGN59889.1|  hypothetical protein Csa_3G851890                       191   6e-56   
ref|XP_004154816.1|  PREDICTED: PAP-specific phosphatase HAL2-like      192   1e-55   
ref|XP_004150105.1|  PREDICTED: PAP-specific phosphatase HAL2-like      192   1e-55   
ref|XP_010278343.1|  PREDICTED: PAP-specific phosphatase HAL2-lik...    192   3e-55   
ref|XP_011095245.1|  PREDICTED: PAP-specific phosphatase HAL2-like      190   3e-55   
ref|XP_010539644.1|  PREDICTED: PAP-specific phosphatase HAL2-like      190   5e-55   
ref|XP_010537001.1|  PREDICTED: PAP-specific phosphatase HAL2-like      189   1e-54   
ref|XP_010089382.1|  PAP-specific phosphatase HAL2-like protein         188   3e-54   
ref|XP_009795942.1|  PREDICTED: PAP-specific phosphatase HAL2-like      182   3e-52   
ref|XP_010482847.1|  PREDICTED: PAP-specific phosphatase HAL2-like      182   4e-52   
ref|XP_010446867.1|  PREDICTED: PAP-specific phosphatase HAL2-like      182   4e-52   
emb|CBI20356.3|  unnamed protein product                                182   5e-52   
ref|XP_008677401.1|  PREDICTED: PAP-specific phosphatase isoform X2     181   7e-52   
ref|XP_010443016.1|  PREDICTED: PAP-specific phosphatase HAL2-like      181   1e-51   
ref|XP_009629215.1|  PREDICTED: PAP-specific phosphatase HAL2-like      181   2e-51   
emb|CDP05868.1|  unnamed protein product                                179   6e-51   
gb|EYU33413.1|  hypothetical protein MIMGU_mgv1a009035mg                178   9e-51   
emb|CBI18595.3|  unnamed protein product                                176   5e-50   
ref|XP_006349983.1|  PREDICTED: PAP-specific phosphatase HAL2-like      177   7e-50   
gb|EPS62069.1|  hypothetical protein M569_12723                         176   8e-50   
ref|XP_002864328.1|  hypothetical protein ARALYDRAFT_495519             176   9e-50   
emb|CDY18326.1|  BnaC09g30760D                                          176   9e-50   
ref|XP_009127092.1|  PREDICTED: PAP-specific phosphatase HAL2-like      176   1e-49   
gb|AAB94051.1|  PAP-specific phosphatase                                175   3e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48649.1|  BnaCnng16680D                                          175   3e-49   
emb|CDY66135.1|  BnaAnng21580D                                          174   3e-49   
ref|XP_006280648.1|  hypothetical protein CARUB_v10026608mg             174   3e-49   
ref|XP_001773062.1|  predicted protein                                  174   3e-49   
ref|XP_006401578.1|  hypothetical protein EUTSA_v10013845mg             174   4e-49   
ref|NP_200250.1|  PAP-specific phosphatase HAL2-like protein            174   7e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004251846.1|  PREDICTED: PAP-specific phosphatase HAL2-like      174   8e-49   
gb|KEH31136.1|  3'(2'),5'-bisphosphate nucleotidase                     174   2e-48   
ref|XP_009119967.1|  PREDICTED: PAP-specific phosphatase HAL2-like      172   3e-48   
ref|XP_001761209.1|  predicted protein                                  171   9e-48   
emb|CDY42446.1|  BnaA10g08220D                                          171   1e-47   
gb|ACN41030.1|  unknown                                                 169   2e-46   Picea sitchensis
ref|XP_010675597.1|  PREDICTED: PAP-specific phosphatase HAL2-like      166   8e-46   
gb|ACU22731.1|  unknown                                                 152   2e-42   Glycine max [soybeans]
ref|XP_002980155.1|  hypothetical protein SELMODRAFT_111780             157   4e-42   
ref|XP_002992905.1|  hypothetical protein SELMODRAFT_187085             157   5e-42   
ref|XP_006401576.1|  hypothetical protein EUTSA_v10013845mg             149   2e-40   
ref|XP_006280647.1|  hypothetical protein CARUB_v10026608mg             149   3e-40   
gb|ACJ85128.1|  unknown                                                 148   9e-40   Medicago truncatula
gb|AFG71389.1|  hypothetical protein 0_6316_02                          137   4e-37   
gb|AFG71390.1|  hypothetical protein 0_6316_02                          135   2e-36   
gb|KHG03860.1|  PAP-specific phosphatase HAL2-like                      125   6e-32   
gb|KHG03861.1|  PAP-specific phosphatase HAL2-like                      125   1e-31   
ref|XP_007512749.1|  predicted protein                                  109   7e-25   
ref|XP_002501742.1|  predicted protein                                  105   1e-23   Micromonas commoda
emb|CEF97015.1|  Inositol monophosphatase, metal-binding site           101   7e-22   
ref|XP_003078015.1|  Putative PAP-specific phosphatase (ISS)            101   7e-22   
ref|XP_001416867.1|  predicted protein                                  100   1e-21   Ostreococcus lucimarinus CCE9901
ref|WP_008102691.1|  3'(2'),5'-bisphosphate nucleotidase              99.4    2e-21   
ref|XP_003062680.1|  predicted protein                                98.2    8e-21   
ref|XP_001796788.1|  hypothetical protein SNOG_06415                  94.0    1e-19   Parastagonospora nodorum SN15
ref|NP_001236344.1|  uncharacterized protein LOC100306018             92.4    2e-19   
gb|EME49912.1|  hypothetical protein DOTSEDRAFT_68656                 92.4    4e-19   
ref|XP_009112115.1|  PREDICTED: SAL1 phosphatase-like                 92.4    5e-19   
ref|XP_001766343.1|  predicted protein                                92.0    8e-19   
emb|CDY18727.1|  BnaA09g06680D                                        92.0    8e-19   
emb|CDX81209.1|  BnaC09g06200D                                        92.0    8e-19   
emb|CDY43776.1|  BnaA06g23120D                                        91.3    1e-18   
emb|CDX84472.1|  BnaC03g50280D                                        91.7    2e-18   
ref|XP_007294300.1|  3',5'-bisphosphate nucleotidase                  90.5    2e-18   
ref|XP_009150465.1|  PREDICTED: SAL1 phosphatase                      90.9    3e-18   
ref|XP_002984282.1|  hypothetical protein SELMODRAFT_234473           90.1    3e-18   
ref|XP_010930654.1|  PREDICTED: SAL1 phosphatase-like                 90.9    4e-18   
gb|KHG00224.1|  SAL1 phosphatase -like protein                        90.1    4e-18   
gb|AGE13642.1|  3'-phosphoadenosine 5'-phosphatase                    89.7    5e-18   
gb|KDP39401.1|  hypothetical protein JCGZ_03683                       89.4    6e-18   
gb|KEQ87317.1|  3'-phosphoadenosine 5'-phosphatase                    89.4    9e-18   
gb|KEQ61447.1|  3'-phosphoadenosine 5'-phosphatase                    88.6    1e-17   
gb|ABU96741.1|  SAL1-like protein                                     88.2    2e-17   
gb|KFK28088.1|  hypothetical protein AALP_AA8G470800                  89.0    2e-17   
gb|KEQ94175.1|  hypothetical protein AUEXF2481DRAFT_66798             88.2    2e-17   
ref|XP_003299772.1|  hypothetical protein PTT_10831                   87.8    2e-17   
ref|XP_010090832.1|  SAL1 phosphatase                                 87.4    3e-17   
ref|XP_010649361.1|  PREDICTED: SAL1 phosphatase isoform X3           87.4    3e-17   
dbj|BAJ33755.1|  unnamed protein product                              87.4    3e-17   
gb|KEQ74282.1|  3'-phosphoadenosine 5'-phosphatase                    87.4    3e-17   
gb|KHN28944.1|  SAL1 phosphatase                                      87.8    3e-17   
ref|XP_010649362.1|  PREDICTED: SAL1 phosphatase isoform X4           87.0    3e-17   
ref|XP_003531104.1|  PREDICTED: SAL1 phosphatase                      87.8    3e-17   
ref|XP_006580055.1|  PREDICTED: SAL1 phosphatase-like isoform X2      87.0    4e-17   
gb|KGN48346.1|  hypothetical protein Csa_6G483280                     87.4    4e-17   
ref|XP_010649360.1|  PREDICTED: SAL1 phosphatase isoform X2           87.0    4e-17   
ref|XP_004163045.1|  PREDICTED: SAL1 phosphatase-like                 87.4    4e-17   
ref|XP_004148661.1|  PREDICTED: SAL1 phosphatase-like                 87.4    4e-17   
sp|Q42546.1|DPNP1_ARATH  RecName: Full=SAL1 phosphatase; AltName:...  87.0    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002972451.1|  hypothetical protein SELMODRAFT_97708            86.7    5e-17   
ref|XP_001557036.1|  hypothetical protein BC1G_04286                  86.7    5e-17   Botrytis cinerea B05.10
ref|WP_006927780.1|  3'-5'-bisphosphate nucleotidase                  86.3    6e-17   
ref|XP_011022931.1|  PREDICTED: SAL1 phosphatase-like                 86.7    6e-17   
emb|CCD54513.1|  similar to 3'(2'),5'-bisphosphate nucleotidase       86.7    6e-17   
ref|XP_010649359.1|  PREDICTED: SAL1 phosphatase isoform X1           87.0    7e-17   
ref|XP_007689722.1|  hypothetical protein COCMIDRAFT_27802            86.3    7e-17   
ref|XP_005707634.1|  3'(2'), 5'-bisphosphate nucleotidase             86.3    7e-17   
ref|XP_006394218.1|  hypothetical protein EUTSA_v10004312mg           87.0    7e-17   
ref|XP_007711464.1|  hypothetical protein COCCADRAFT_25603            86.3    7e-17   
ref|XP_003843978.1|  similar to 3'(2'),5'-bisphosphate nucleotidase   86.3    8e-17   
emb|CCT64384.1|  probable MET22-protein ser/thr phosphatase           86.3    8e-17   
gb|EUN28018.1|  hypothetical protein COCVIDRAFT_15131                 86.3    8e-17   
ref|XP_007783960.1|  hypothetical protein W97_07901                   88.2    8e-17   
gb|EGU82355.1|  hypothetical protein FOXB_07184                       86.3    9e-17   
ref|XP_001690049.1|  3'(2'),5'-bisphosphate nucleotidase              85.9    9e-17   Chlamydomonas reinhardtii
ref|XP_002864880.1|  hypothetical protein ARALYDRAFT_496591           86.7    1e-16   
ref|XP_008441059.1|  PREDICTED: SAL1 phosphatase-like                 86.7    1e-16   
ref|NP_201203.2|  bifunctional 3'(2'),5'-bisphosphate nucleotidas...  86.7    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004504666.1|  PREDICTED: SAL1 phosphatase-like                 86.3    1e-16   
gb|KHN25913.1|  SAL1 phosphatase                                      86.3    1e-16   
gb|ESZ92017.1|  3',5'-bisphosphate nucleotidase                       85.9    1e-16   
ref|XP_007048420.1|  Inositol monophosphatase family protein isof...  85.9    1e-16   
ref|XP_007048419.1|  Inositol monophosphatase family protein isof...  85.9    1e-16   
ref|XP_001595976.1|  hypothetical protein SS1G_02192                  85.5    2e-16   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_001227165.1|  hypothetical protein CHGG_09238                  85.1    2e-16   Chaetomium globosum CBS 148.51
gb|ENH73919.1|  3'(2'),5'-bisphosphate nucleotidase                   85.1    2e-16   
gb|KEH31396.1|  3'(2'),5'-bisphosphate nucleotidase                   84.3    2e-16   
ref|XP_002309920.1|  hypothetical protein POPTR_0007s04240g           85.1    2e-16   Populus trichocarpa [western balsam poplar]
emb|CDP04674.1|  unnamed protein product                              85.1    2e-16   
gb|EMD93429.1|  hypothetical protein COCHEDRAFT_1020510               85.9    2e-16   
gb|EXM02913.1|  3'(2'),5'-bisphosphate nucleotidase                   85.5    2e-16   
gb|EWG42162.1|  3'(2'),5'-bisphosphate nucleotidase                   85.5    2e-16   
gb|EXA47323.1|  3'(2'),5'-bisphosphate nucleotidase                   85.5    2e-16   
ref|XP_007809069.1|  3'-phosphoadenosine 5'-phosphatase isoform A     84.7    3e-16   
gb|EXL88911.1|  3'(2'),5'-bisphosphate nucleotidase                   85.5    3e-16   
gb|EXK35543.1|  3'(2'),5'-bisphosphate nucleotidase                   85.5    3e-16   
ref|XP_010027647.1|  PREDICTED: SAL1 phosphatase-like                 85.5    3e-16   
gb|EWY95791.1|  3'(2'),5'-bisphosphate nucleotidase                   85.1    3e-16   
gb|EWZ42407.1|  3'(2'),5'-bisphosphate nucleotidase                   85.1    3e-16   
gb|KCW54211.1|  hypothetical protein EUGRSUZ_I00195                   85.5    3e-16   
ref|XP_010521143.1|  PREDICTED: SAL1 phosphatase                      84.7    4e-16   
ref|XP_008020804.1|  hypothetical protein SETTUDRAFT_162324           85.1    4e-16   
ref|XP_010461252.1|  PREDICTED: SAL1 phosphatase-like                 85.1    4e-16   
emb|CAC84117.1|  3'(2'),5'-bisphosphate nucleotidase                  83.2    4e-16   Gossypium hirsutum [American cotton]
ref|XP_009625609.1|  PREDICTED: SAL1 phosphatase-like isoform X2      84.7    4e-16   
ref|XP_007587641.1|  putative 3 -bisphosphate nucleotidase protein    84.3    4e-16   
ref|XP_008044553.1|  3',5'-bisphosphate nucleotidase                  84.3    5e-16   
ref|XP_007695443.1|  hypothetical protein COCSADRAFT_33061            85.1    5e-16   
ref|XP_009625608.1|  PREDICTED: SAL1 phosphatase-like isoform X1      84.7    6e-16   
ref|XP_009338031.1|  PREDICTED: SAL1 phosphatase-like                 84.3    6e-16   
ref|XP_008227630.1|  PREDICTED: SAL1 phosphatase-like                 84.3    6e-16   
ref|XP_007158893.1|  hypothetical protein PHAVU_002G190600g           84.3    6e-16   
gb|KFH71950.1|  3'(2'),5'-bisphosphate nucleotidase                   83.6    7e-16   
ref|XP_003046777.1|  predicted protein                                83.6    7e-16   
ref|XP_008808499.1|  PREDICTED: 3'(2'),5'-bisphosphate nucleotida...  83.2    7e-16   
gb|EPS60422.1|  hypothetical protein M569_14381                       83.6    8e-16   
ref|XP_011031174.1|  PREDICTED: SAL1 phosphatase                      84.0    8e-16   
ref|XP_010446262.1|  PREDICTED: SAL1 phosphatase-like                 83.2    8e-16   
ref|XP_007730658.1|  3'(2'),5'-bisphosphate nucleotidase              83.2    8e-16   
gb|ABF68776.1|  3'-phosphoadenosine 5'-phosphatase                    80.9    1e-15   Aureobasidium pullulans
ref|XP_009334306.1|  PREDICTED: SAL1 phosphatase-like                 84.0    1e-15   
ref|XP_007211513.1|  hypothetical protein PRUPE_ppa008005mg           83.2    1e-15   
ref|XP_007794546.1|  putative 3 -bisphosphate nucleotidase protein    83.2    1e-15   
ref|XP_009800821.1|  PREDICTED: SAL1 phosphatase-like                 83.6    1e-15   
gb|KHG25759.1|  SAL1 phosphatase -like protein                        81.6    1e-15   
ref|XP_006580054.1|  PREDICTED: SAL1 phosphatase-like isoform X1      82.4    2e-15   
ref|XP_007719392.1|  3'(2'),5'-bisphosphate nucleotidase              82.4    2e-15   
ref|XP_006279636.1|  hypothetical protein CARUB_v10026515mg           82.4    2e-15   
ref|XP_006279637.1|  hypothetical protein CARUB_v10026515mg           82.8    2e-15   
ref|XP_004239634.1|  PREDICTED: SAL1 phosphatase                      82.8    2e-15   
ref|XP_002306253.2|  5'-bisphosphate nucleotidase 2 family protein    82.8    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006345757.1|  PREDICTED: SAL1 phosphatase-like                 82.8    3e-15   
emb|CEJ91730.1|  Putative 3'-phosphoadenosine 5'-phosphatase isof...  82.8    3e-15   
ref|XP_007048421.1|  Inositol monophosphatase family protein isof...  81.6    3e-15   
emb|CDO70151.1|  hypothetical protein BN946_scf185009.g2              82.0    3e-15   
ref|XP_007837008.1|  3'(2'),5'-bisphosphate nucleotidase              81.6    3e-15   
ref|XP_007742759.1|  3'(2'),5'-bisphosphate nucleotidase              81.6    4e-15   
ref|XP_389708.1|  hypothetical protein FG09532.1                      81.6    4e-15   Fusarium graminearum PH-1
ref|XP_010270358.1|  PREDICTED: SAL1 phosphatase-like                 82.0    4e-15   
ref|XP_006847222.1|  hypothetical protein AMTR_s00017p00255870        82.0    5e-15   
gb|ELQ41241.1|  3'-phosphoadenosine 5'-phosphatase isoform A          81.3    6e-15   
ref|XP_002144699.1|  3'(2'),5'-bisphosphate nucleotidase              80.9    7e-15   Talaromyces marneffei ATCC 18224
ref|XP_008086979.1|  Carbohydrate phosphatase                         80.9    7e-15   
gb|KFG85007.1|  3'(2'),5'-bisphosphate nucleotidase                   80.9    8e-15   
gb|KEY69169.1|  hypothetical protein S7711_04951                      80.5    1e-14   
ref|XP_009158252.1|  3'(2'),5'-bisphosphate nucleotidase              80.1    1e-14   
ref|XP_003664013.1|  hypothetical protein MYCTH_2306314               80.1    1e-14   
gb|EIE86865.1|  3'(2'),5'-bisphosphate nucleotidase                   79.7    1e-14   
ref|XP_002839133.1|  hypothetical protein                             79.7    2e-14   Tuber melanosporum Mel28
gb|ENH85961.1|  3 (2 ) -bisphosphate nucleotidase                     79.7    2e-14   
gb|KDN71714.1|  putative 3',5'-bisphosphate nucleotidase              79.7    2e-14   
ref|XP_008665369.1|  PREDICTED: uncharacterized protein LOC103643974  81.6    2e-14   
gb|KID93045.1|  3'(2'),5'-bisphosphate nucleotidase                   79.7    2e-14   
ref|XP_003719499.1|  3',5'-bisphosphate nucleotidase                  80.1    2e-14   
ref|XP_010484166.1|  PREDICTED: SAL1 phosphatase                      80.1    2e-14   
gb|EXV05677.1|  inositol monophosphatase family protein               79.7    2e-14   
ref|WP_011404078.1|  3'-5'-bisphosphate nucleotidase                  79.3    2e-14   
tpg|DAA51202.1|  TPA: syntaxin protein KNOLLE                         81.6    2e-14   
gb|KFA61521.1|  hypothetical protein S40285_04530                     80.1    2e-14   
ref|XP_006669267.1|  3'(2'),5'-bisphosphate nucleotidase              80.1    3e-14   
ref|XP_007601335.1|  3',5'-bisphosphate nucleotidase                  80.1    3e-14   
ref|XP_009389517.1|  PREDICTED: 3'(2'),5'-bisphosphate nucleotida...  79.0    3e-14   
gb|KDQ22619.1|  hypothetical protein PLEOSDRAFT_1095023               79.0    3e-14   
gb|KIE03729.1|  3'(2'),5'-bisphosphate nucleotidase                   79.0    4e-14   
gb|EPB81957.1|  3'(2'),5'-bisphosphate nucleotidase                   78.6    4e-14   
gb|KFH45917.1|  Protein of unknown functionlike protein               79.3    4e-14   
ref|XP_003291548.1|  hypothetical protein DICPUDRAFT_82219            78.2    4e-14   
ref|XP_505957.1|  YALI0F27665p                                        78.6    4e-14   
gb|ABF68780.1|  3'-phosphoadenosine 5'-phosphatase                    76.3    4e-14   
ref|XP_007919802.1|  hypothetical protein MYCFIDRAFT_27242            78.6    5e-14   
emb|CEI95145.1|  Putative 3'(2'),5'-bisphosphate nucleotidase         78.2    5e-14   
emb|CEI93897.1|  Putative 3'(2'),5'-bisphosphate nucleotidase         78.2    6e-14   
dbj|GAM34195.1|  hypothetical protein TCE0_015f01612                  78.2    6e-14   
ref|XP_005538474.1|  3'(2'), 5'-bisphosphate nucleotidase             78.6    6e-14   
gb|ACU21418.1|  unknown                                               79.0    6e-14   
gb|KFY00604.1|  hypothetical protein O988_03227                       78.2    6e-14   
gb|KID77929.1|  3'(2'),5'-bisphosphate nucleotidase                   79.0    6e-14   
gb|KFY75024.1|  hypothetical protein V499_04979                       78.2    6e-14   
gb|EKG11810.1|  Inositol monophosphatase                              78.6    7e-14   
gb|KFZ15276.1|  hypothetical protein V501_02790                       78.2    7e-14   
gb|KFY08978.1|  hypothetical protein V492_05733                       77.8    8e-14   
gb|EYU23740.1|  hypothetical protein MIMGU_mgv1a007420mg              77.8    8e-14   
gb|EQB57756.1|  3',5'-bisphosphate nucleotidase                       78.6    9e-14   
ref|XP_011099729.1|  PREDICTED: SAL1 phosphatase-like                 78.6    9e-14   
ref|XP_007339655.1|  3(2),5-bisphosphate nucleotidase HAL2            77.8    9e-14   
emb|CEG67132.1|  Putative 3'(2'),5'-bisphosphate nucleotidase         77.4    9e-14   
ref|XP_007818250.1|  3'(2'),5'-bisphosphate nucleotidase              79.0    1e-13   
ref|XP_003857464.1|  hypothetical protein MYCGRDRAFT_65799            77.8    1e-13   
gb|ABF68774.1|  3'-phosphoadenosine 5'-phosphatase isoform A          77.4    1e-13   
ref|XP_004359624.1|  3'(2'),5'-bisphosphate nucleotidase              77.4    1e-13   
gb|EYU23739.1|  hypothetical protein MIMGU_mgv1a007420mg              78.2    1e-13   
gb|KDN36782.1|  putative MET22-protein ser/thr phosphatase            77.8    1e-13   
gb|KEF51855.1|  3'(2'),5'-bisphosphate nucleotidase                   77.4    1e-13   
emb|CEG76287.1|  Putative 3'(2'),5'-bisphosphate nucleotidase         77.0    1e-13   
ref|XP_008721799.1|  3'(2'),5'-bisphosphate nucleotidase              77.4    1e-13   
dbj|GAD97475.1|  3'(2'),5'-bisphosphate nucleotidase                  77.4    1e-13   
gb|EGN97380.1|  hypothetical protein SERLA73DRAFT_153792              77.4    1e-13   
gb|KFY53083.1|  hypothetical protein V496_07917                       77.0    1e-13   
emb|CCE34428.1|  probable MET22-protein ser/thr phosphatase           78.6    2e-13   
ref|XP_757811.1|  hypothetical protein UM01664.1                      77.4    2e-13   
gb|EHK48233.1|  hypothetical protein TRIATDRAFT_81787                 77.0    2e-13   
ref|XP_004288105.1|  PREDICTED: SAL1 phosphatase-like isoform 2       76.6    2e-13   
emb|CCF35403.1|  3',5'-bisphosphate nucleotidase                      77.0    2e-13   
ref|XP_008718105.1|  3'(2'),5'-bisphosphate nucleotidase              77.0    2e-13   
ref|XP_007752395.1|  3'(2'),5'-bisphosphate nucleotidase              76.6    2e-13   
ref|XP_006967226.1|  hypothetical protein TRIREDRAFT_79933            76.6    2e-13   
ref|XP_003650336.1|  hypothetical protein THITE_2109651               77.4    2e-13   
gb|KHN99104.1|  3'(2'),5'-bisphosphate nucleotidase                   76.6    2e-13   
ref|XP_007802579.1|  hypothetical protein EPUS_01783                  76.6    2e-13   
ref|XP_004288104.1|  PREDICTED: SAL1 phosphatase-like isoform 1       77.0    2e-13   
gb|KFY25703.1|  hypothetical protein V493_04498                       76.6    2e-13   
emb|CCH45647.1|  3'(2'),5'-bisphosphate nucleotidase 2                76.6    3e-13   
emb|CCU98880.1|  unnamed protein product                              76.6    3e-13   
ref|XP_009254729.1|  hypothetical protein FPSE_03335                  76.6    3e-13   
dbj|GAA85972.1|  3'(2'),5'-bisphosphate nucleotidase                  76.3    3e-13   
emb|CAK96979.1|  unnamed protein product                              76.3    3e-13   
ref|WP_020875669.1|  3'(2'),5'-bisphosphate nucleotidase              75.9    3e-13   
gb|KFY19812.1|  hypothetical protein V491_04199                       76.3    3e-13   
gb|ABF68775.1|  3'-phosphoadenosine 5'-phosphatase isoform B          76.3    3e-13   
gb|KFX90656.1|  hypothetical protein V490_06344                       76.3    4e-13   
ref|XP_006465054.1|  PREDICTED: SAL1 phosphatase-like                 76.3    4e-13   
dbj|BAJ98472.1|  predicted protein                                    75.9    4e-13   
ref|XP_010027646.1|  PREDICTED: SAL1 phosphatase-like                 75.9    4e-13   
ref|XP_007400599.1|  hypothetical protein PHACADRAFT_103291           75.9    5e-13   
gb|EST07628.1|  putative MET22-protein ser/thr phosphatase            75.9    5e-13   
gb|EYE92140.1|  3(2),5-bisphosphate nucleotidase HAL2                 75.5    6e-13   
gb|KFY92101.1|  hypothetical protein V500_04321                       75.5    6e-13   
ref|XP_646836.1|  3',5'-bisphosphate nucleotidase                     75.1    6e-13   
ref|XP_001394660.2|  3'(2'),5'-bisphosphate nucleotidase              75.9    7e-13   
ref|XP_003017050.1|  myo-inositol-1(or 4)-monophosphatase             76.3    7e-13   
emb|CDI56959.1|  probable MET22-protein ser/thr phosphatase           75.5    7e-13   
ref|XP_009223820.1|  3',5'-bisphosphate nucleotidase                  75.9    7e-13   
ref|XP_460229.1|  DEHA2E21274p                                        75.5    7e-13   
gb|EGD99212.1|  3',5'-bisphosphate nucleotidase                       75.5    7e-13   
gb|EMT01634.1|  3'(2'),5'-bisphosphate nucleotidase                   75.1    7e-13   
gb|EFA75759.1|  3',5'-bisphosphate nucleotidase                       75.1    7e-13   
dbj|GAC96304.1|  hypothetical protein PHSY_003884                     75.9    7e-13   
emb|CBQ71877.1|  probable MET22-protein ser/thr phosphatase           75.5    8e-13   
gb|EZF34111.1|  3'(2'),5'-bisphosphate nucleotidase                   75.1    8e-13   
ref|XP_003021553.1|  myo-inositol-1(or 4)-monophosphatase             75.9    8e-13   
dbj|GAK50956.1|  3'(2'),5'-bisphosphate nucleotidase                  74.7    9e-13   
gb|EFQ33509.1|  3',5'-bisphosphate nucleotidase                       74.7    1e-12   
ref|XP_006456453.1|  hypothetical protein AGABI2DRAFT_211407          75.5    1e-12   
gb|EPQ67639.1|  Bisphosphate-3'-nucleotidase                          74.7    1e-12   
ref|NP_001105512.1|  diphosphonucleotide phosphatase1                 74.7    1e-12   
ref|XP_003235895.1|  3',5'-bisphosphate nucleotidase                  74.7    1e-12   
ref|XP_007367786.1|  3(2),5-bisphosphate nucleotidase HAL2            74.7    1e-12   
gb|ABF68784.1|  3'-phosphoadenosine 5'-phosphatase                    72.4    1e-12   
gb|ACN33693.1|  unknown                                               75.1    1e-12   
dbj|BAJ85167.1|  predicted protein                                    74.7    1e-12   
ref|XP_001247551.1|  hypothetical protein CIMG_01322                  74.3    1e-12   
dbj|GAK57503.1|  3'(2'),5'-bisphosphate nucleotidase                  74.3    1e-12   
dbj|GAC76616.1|  salt-sensitive 3'-phosphoadenosine-5'-phosphatas...  74.7    2e-12   
gb|EMF17612.1|  3'-phosphoadenosine 5'-phosphatase                    74.3    2e-12   
gb|ETS62880.1|  hypothetical protein PaG_02639                        74.3    2e-12   
emb|CCU82651.1|  3prime-phosphoadenosine 5prime-phosphatase isofo...  73.9    2e-12   
ref|XP_007388319.1|  nucleotidase HAL2                                73.9    2e-12   
ref|NP_001143492.1|  uncharacterized protein LOC100276170             73.9    2e-12   
gb|AFR92474.1|  3'(2'),5'-bisphosphate nucleotidase                   73.9    2e-12   
gb|ACL54461.1|  unknown                                               73.9    2e-12   
gb|ERS95986.1|  3'(2'),5'-bisphosphate nucleotidase                   73.9    2e-12   
emb|CCX31692.1|  Similar to 3' acc. no. Q5BCG1                        73.9    2e-12   
dbj|BAE57091.1|  unnamed protein product                              73.9    2e-12   
gb|KDE05914.1|  3'(2'),5'-bisphosphate nucleotidase                   73.9    2e-12   
ref|XP_007913480.1|  putative 3 -bisphosphate nucleotidase protein    74.3    2e-12   
emb|CCA66445.1|  probable MET22-protein ser/thr phosphatase           73.6    3e-12   
ref|XP_001268064.1|  3'(2'),5'-bisphosphate nucleotidase              73.6    3e-12   
ref|XP_002442944.1|  hypothetical protein SORBIDRAFT_08g005200        73.9    3e-12   
dbj|GAK63498.1|  3(2),5-bisphosphate nucleotidase HAL2                73.6    3e-12   
ref|XP_002847268.1|  3',5'-bisphosphate nucleotidase                  73.6    3e-12   
ref|XP_002442943.1|  hypothetical protein SORBIDRAFT_08g005190        73.2    3e-12   
ref|XP_008599562.1|  3',5'-bisphosphate nucleotidase                  74.7    4e-12   
gb|EXX73053.1|  Met22p                                                72.4    4e-12   
emb|CCF53356.1|  probable MET22-protein ser/thr phosphatase           73.6    4e-12   
gb|KDQ11215.1|  hypothetical protein BOTBODRAFT_57542                 73.2    4e-12   
ref|XP_006288067.1|  hypothetical protein CARUB_v10001300mg           73.2    4e-12   
gb|EFW21705.1|  50S ribosomal protein L6                              73.6    4e-12   
gb|EAS36068.2|  3'(2'),5'-bisphosphate nucleotidase                   73.6    4e-12   
gb|AGC71457.1|  3'-phosphoadenosine 5'-phosphatase                    72.8    4e-12   
ref|XP_002955423.1|  hypothetical protein VOLCADRAFT_65837            73.6    5e-12   
ref|WP_002647289.1|  3'-5'-bisphosphate nucleotidase                  72.4    5e-12   
gb|KIH89585.1|  3'(2'), 5'-bisphosphate nucleotidase                  72.8    5e-12   
gb|KDB18053.1|  3'-phosphoadenosine 5'-phosphatase isoform A          72.8    5e-12   
gb|EMT30220.1|  3'(2'),5'-bisphosphate nucleotidase                   72.4    5e-12   
gb|EXX73052.1|  Met22p                                                72.4    6e-12   
emb|CDS08279.1|  Putative 3'(2'),5'-bisphosphate nucleotidase         72.4    6e-12   
ref|XP_003192121.1|  3'(2'),5'-bisphosphate nucleotidase              72.8    6e-12   
ref|XP_007673123.1|  hypothetical protein BAUCODRAFT_63855            72.8    6e-12   
ref|XP_002382083.1|  3'(2'),5'-bisphosphate nucleotidase              73.2    6e-12   
gb|ESA06920.1|  hypothetical protein GLOINDRAFT_38927                 72.4    6e-12   
ref|XP_007879323.1|  hypothetical protein PFL1_03613                  72.8    6e-12   
ref|XP_001887189.1|  predicted protein                                72.4    7e-12   
ref|XP_007334524.1|  hypothetical protein AGABI1DRAFT_123514          72.8    8e-12   
gb|EHK24938.1|  hypothetical protein TRIVIDRAFT_215714                72.8    8e-12   
ref|XP_006432178.1|  hypothetical protein CICLE_v100014632mg          70.5    8e-12   
ref|XP_006678363.1|  hypothetical protein BATDEDRAFT_11270            72.0    8e-12   
gb|EMT31558.1|  3'(2'),5'-bisphosphate nucleotidase                   72.4    9e-12   
ref|XP_004202246.1|  Piso0_001734                                     72.8    9e-12   
emb|CDH52448.1|  probable met22-protein ser thr phosphatase           72.4    9e-12   
ref|WP_010582294.1|  3'-5'-bisphosphate nucleotidase                  71.6    9e-12   
ref|XP_007868431.1|  3 2 5-bisphosphate nucleotidase HAL2             72.0    1e-11   
ref|XP_010680221.1|  PREDICTED: SAL1 phosphatase-like                 72.4    1e-11   
gb|EEH17385.1|  3'(2'),5'-bisphosphate nucleotidase                   72.0    1e-11   
ref|XP_010763805.1|  3'(2'),5'-bisphosphate nucleotidase              72.0    1e-11   
ref|XP_004977192.1|  PREDICTED: 3'(2'),5'-bisphosphate nucleotida...  72.4    1e-11   
ref|XP_005711121.1|  3'(2'),5'-bisphosphate nucleotidase SAL1         71.6    1e-11   
ref|XP_006432179.1|  hypothetical protein CICLE_v100014632mg          69.7    1e-11   
emb|CCG81689.1|  3'(2'),5'-bisphosphate nucleotidase/inositol-1,4...  71.6    1e-11   
ref|XP_659373.1|  hypothetical protein AN1769.2                       71.6    1e-11   
ref|XP_002541733.1|  3'(2'),5'-bisphosphate nucleotidase              71.6    1e-11   
gb|ABF68783.1|  3'-phosphoadenosine 5'-phosphatase                    69.3    1e-11   
dbj|GAM19362.1|  hypothetical protein SAMD00019534_025370             71.2    1e-11   
gb|KDN44636.1|  hypothetical protein RSAG8_05401                      71.2    2e-11   
gb|KDR73086.1|  hypothetical protein GALMADRAFT_252533                71.2    2e-11   
gb|EMS48512.1|  3'(2'),5'-bisphosphate nucleotidase                   71.2    2e-11   
ref|XP_010547670.1|  PREDICTED: SAL2 phosphatase-like isoform X1      71.2    2e-11   
ref|XP_010547671.1|  PREDICTED: SAL2 phosphatase-like isoform X2      71.2    2e-11   
emb|CDR40036.1|  CYFA0S04e02212g1_1                                   70.9    2e-11   
ref|XP_006399403.1|  hypothetical protein EUTSA_v10013884mg           70.9    2e-11   
ref|XP_002548666.1|  halotolerance protein HAL2                       71.2    2e-11   
ref|XP_001523871.1|  halotolerance protein HAL2                       70.9    3e-11   
ref|XP_001729350.1|  hypothetical protein MGL_3385                    70.9    3e-11   
ref|XP_004202868.1|  Piso0_001734                                     71.2    3e-11   
tpe|CBF85527.1|  TPA: 3'(2'),5'-bisphosphate nucleotidase (EC 3.1...  71.2    3e-11   
gb|ELR06115.1|  3',5'-bisphosphate nucleotidase                       71.2    3e-11   
ref|XP_001906122.1|  hypothetical protein                             70.9    3e-11   
ref|XP_001746029.1|  hypothetical protein                             70.5    3e-11   
ref|XP_010546328.1|  PREDICTED: probable SAL3 phosphatase             70.5    3e-11   
gb|AAR03496.2|  3'(2')5' bisphosphate nucleosidase                    70.9    3e-11   
gb|EMS20119.1|  3'(2'), 5'-bisphosphate nucleotidase                  70.5    3e-11   
ref|XP_006663886.1|  PREDICTED: 3'(2'),5'-bisphosphate nucleotida...  70.5    4e-11   
ref|XP_006690221.1|  hypothetical protein CANTEDRAFT_116112           70.5    4e-11   
ref|XP_009649631.1|  3'-phosphoadenosine 5'-phosphatase isoform B     70.1    5e-11   
ref|XP_009266183.1|  3'(2'),5'-bisphosphate nucleotidase              70.1    5e-11   
ref|XP_002627368.1|  3',5'-bisphosphate nucleotidase                  70.1    5e-11   
ref|XP_003031192.1|  hypothetical protein SCHCODRAFT_56905            69.7    5e-11   
ref|XP_003025862.1|  hypothetical protein SCHCODRAFT_259039           70.1    5e-11   
dbj|GAA98913.1|  hypothetical protein E5Q_05601                       70.1    6e-11   
ref|XP_007003337.1|  hypothetical protein TREMEDRAFT_43141            69.7    6e-11   
ref|XP_007377284.1|  3'5'-bisphosphate nucleotidase                   69.7    6e-11   
ref|XP_002912208.1|  3',5'-bisphosphate nucleotidase                  69.7    6e-11   
gb|KHC34483.1|  3'(2'),5'-bisphosphate nucleotidase 2                 68.9    6e-11   
ref|XP_006694742.1|  hypothetical protein CTHT_0043470                69.7    7e-11   
gb|ABF68777.1|  3'-phosphoadenosine 5'-phosphatase                    67.0    7e-11   
ref|XP_001420651.1|  predicted protein                                69.3    7e-11   
ref|XP_567155.1|  3'(2'),5'-bisphosphate nucleotidase                 69.7    7e-11   
ref|XP_003031191.1|  hypothetical protein SCHCODRAFT_68271            69.3    7e-11   
gb|KHC58229.1|  3'(2'),5'-bisphosphate nucleotidase 2                 69.7    7e-11   
gb|EMD31606.1|  hypothetical protein CERSUDRAFT_88943                 69.3    8e-11   
gb|EQL38454.1|  3'(2'),5'-bisphosphate nucleotidase                   69.7    8e-11   
ref|XP_007400602.1|  hypothetical protein PHACADRAFT_187961           69.3    8e-11   
ref|XP_002789898.1|  3',5'-bisphosphate nucleotidase                  69.3    1e-10   
ref|XP_009854381.1|  hypothetical protein NEUTE1DRAFT_118175          67.8    1e-10   
ref|WP_039725588.1|  3'-5'-bisphosphate nucleotidase                  68.6    1e-10   
ref|NP_588230.1|  3'(2'),5'-bisphosphate nucleotidase/inositol-1,...  68.9    1e-10   
gb|EPS94454.1|  hypothetical protein FOMPIDRAFT_1033350               68.9    1e-10   
gb|EEH09477.1|  3',5'-bisphosphate nucleotidase                       68.9    1e-10   
gb|EGC49328.1|  3',5'-bisphosphate nucleotidase                       68.9    1e-10   
gb|EPS94448.1|  nucleotidase HAL2                                     68.9    1e-10   
gb|EGU11474.1|  hypothetical protein RTG_02637                        68.9    1e-10   
gb|KGQ89795.1|  3'(2'),5'-bisphosphate nucleotidase 2                 68.9    1e-10   
ref|XP_750795.1|  3'(2'),5'-bisphosphate nucleotidase                 69.3    1e-10   
gb|KGU04701.1|  3'(2'),5'-bisphosphate nucleotidase 2                 68.9    1e-10   
ref|NP_974988.1|  putative SAL3 phosphatase                           68.2    1e-10   
ref|XP_001258024.1|  3'(2'),5'-bisphosphate nucleotidase              68.6    1e-10   
gb|EDP49475.1|  3'(2'),5'-bisphosphate nucleotidase                   68.9    1e-10   
gb|KHC64043.1|  3'(2'),5'-bisphosphate nucleotidase 2                 68.6    2e-10   
gb|KEY82450.1|  3'2',5' bisphosphate nucleotidase                     68.9    2e-10   
gb|KGR07330.1|  3'(2'),5'-bisphosphate nucleotidase 1                 67.0    2e-10   
ref|WP_013555151.1|  inositol monophosphatase                         68.6    2e-10   
ref|XP_003578819.1|  PREDICTED: 3'(2'),5'-bisphosphate nucleotida...  68.9    2e-10   
gb|KGQ84092.1|  3'(2'),5'-bisphosphate nucleotidase 1                 68.2    2e-10   
gb|KGU22541.1|  3'(2'),5'-bisphosphate nucleotidase 2                 67.4    2e-10   
gb|EPS33796.1|  hypothetical protein PDE_08758                        68.6    2e-10   



>ref|XP_006347096.1| PREDICTED: PAP-specific phosphatase HAL2-like [Solanum tuberosum]
Length=447

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 148/197 (75%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL GP   L  + ++E I+ C LA      S+FW L       G +RGDQYA+AL+
Sbjct  172  APRFGLKGPDTDLDAKAVLEAISRCSLAGA--RGSKFWVLDPVDGTLGFVRGDQYAIALA  229

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG PV+GVLGCPNYP+KKEWLSYQ GY+RILSRLTS+  SE  D+G V+YAR+G G 
Sbjct  230  LIEDGEPVLGVLGCPNYPMKKEWLSYQNGYRRILSRLTSST-SESSDRGSVLYARKGGGK  288

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL G   F WPNS+++I+ SSI++P +ATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  289  AWMQPLLHGENKFVWPNSAREIRVSSIDNPALATFCEPVEKANSSHSFTAGLAHSVGLRN  348

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  349  QPLRVYSMVKYAAIARG  365



>ref|XP_009757366.1| PREDICTED: PAP-specific phosphatase HAL2-like [Nicotiana sylvestris]
Length=459

 Score =   249 bits (635),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 146/197 (74%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL GP   L  + ++  I+ C LA      S+FW L       G +RGDQYA+AL+
Sbjct  184  APRFGLKGPGTDLDAKAVLAAISRCSLAGA--RGSKFWVLDPVDGTLGFVRGDQYAIALA  241

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG PV+GVLGCPNYP+KKEWLSYQ GY+RILSRLTS   S   DKG V+YAR+G G 
Sbjct  242  LIEDGEPVLGVLGCPNYPMKKEWLSYQNGYRRILSRLTSQT-SVSGDKGSVLYARKGGGK  300

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL G K F WPNS+KQIK SSI++P +ATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  301  AWMQPLLYGEKNFVWPNSAKQIKVSSIDNPALATFCEPVEKANSSHSFTAGLAHSVGLRN  360

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  361  QPLRVYSMVKYAAIARG  377



>ref|XP_009601571.1| PREDICTED: PAP-specific phosphatase HAL2-like [Nicotiana tomentosiformis]
Length=461

 Score =   244 bits (623),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 145/197 (74%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL GP   L  + ++  I+ C LA      S+FW L       G +RGDQYA+AL+
Sbjct  186  APRFGLKGPGTDLDAKSVLAAISRCNLAG--VRGSKFWVLDPVDGTLGFVRGDQYAIALA  243

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG PV+GVLGCPNYP+KKEWLSYQ GY+RILSRLTS   S   D+G V+YAR+G G 
Sbjct  244  LIEDGEPVLGVLGCPNYPMKKEWLSYQNGYRRILSRLTSQT-SVSGDRGSVLYARKGGGK  302

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL G K F WPNS+KQIK SSI++P +ATFC  VE A SSHSFTAGL  S+G RN
Sbjct  303  AWMQPLLYGEKNFVWPNSAKQIKVSSIDNPALATFCEPVEIANSSHSFTAGLAHSVGLRN  362

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  363  QPLRVYSMVKYAAIARG  379



>ref|XP_011027928.1| PREDICTED: PAP-specific phosphatase HAL2-like isoform X2 [Populus 
euphratica]
Length=462

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 142/197 (72%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL  P  +L   E++E I+ C    G N   RFWAL       G +RGDQYAVAL+
Sbjct  187  APRFGLKAPGTSLGSSEVLEAISRCNSTGGPNG--RFWALDPVDGTLGFVRGDQYAVALA  244

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP++KEWLSY + Y RI+S+LT   ASE  DKGCV+YARRG G 
Sbjct  245  LIEDGEVVLGVLGCPNYPMRKEWLSYHHRYHRIISKLT-PPASESWDKGCVIYARRGSGE  303

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G K   WPNS+  ++ S+IE+P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  304  AWMQPLIQGHKKLVWPNSATPVRVSTIENPALATFCEPVEKANSSHSFTAGLAHSVGLRK  363

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  364  QPLRVYSMVKYAAIARG  380



>ref|XP_011027927.1| PREDICTED: PAP-specific phosphatase HAL2-like isoform X1 [Populus 
euphratica]
Length=464

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 142/197 (72%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL  P  +L   E++E I+ C    G N   RFWAL       G +RGDQYAVAL+
Sbjct  189  APRFGLKAPGTSLGSSEVLEAISRCNSTGGPNG--RFWALDPVDGTLGFVRGDQYAVALA  246

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP++KEWLSY + Y RI+S+LT   ASE  DKGCV+YARRG G 
Sbjct  247  LIEDGEVVLGVLGCPNYPMRKEWLSYHHRYHRIISKLT-PPASESWDKGCVIYARRGSGE  305

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G K   WPNS+  ++ S+IE+P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  306  AWMQPLIQGHKKLVWPNSATPVRVSTIENPALATFCEPVEKANSSHSFTAGLAHSVGLRK  365

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  366  QPLRVYSMVKYAAIARG  382



>ref|XP_007213885.1| hypothetical protein PRUPE_ppa006862mg [Prunus persica]
 gb|EMJ15084.1| hypothetical protein PRUPE_ppa006862mg [Prunus persica]
Length=392

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 143/197 (73%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APR+GL GP  AL   E++E IN C    G   A RFWAL       G +RGDQYA+AL+
Sbjct  117  APRYGLKGPKMALGTTEVLEAINRCNSIGGP--AGRFWALDPVDGTLGFVRGDQYAIALA  174

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP++KEWL+Y + Y RI+S+LT  + SE  DKGCV+YARRG G 
Sbjct  175  LIEDGEVVLGVLGCPNYPMRKEWLNYHHRYHRIISKLT-PSTSESWDKGCVIYARRGSGE  233

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL   K   WPNS++ ++ SSI++P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  234  AWMQPLLHVNKNLVWPNSARPVRVSSIDNPSLATFCEPVEKANSSHSFTAGLAHSVGLRK  293

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  294  QPLRVYSMVKYAAIARG  310



>ref|XP_011043256.1| PREDICTED: PAP-specific phosphatase HAL2-like [Populus euphratica]
Length=467

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 140/197 (71%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL  P  +L   E++E I+ C    G N   RFWAL       G +RGDQYAVAL+
Sbjct  192  APRFGLKAPGTSLGSSEVLEAISRCNSTGGPNG--RFWALDPVDGTLGFVRGDQYAVALA  249

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP++KEWLSY + Y RI+S+LT    SE  DKGCV+Y RRG G 
Sbjct  250  LIEDGEVVLGVLGCPNYPMRKEWLSYHHRYHRIISKLT-PPTSESWDKGCVIYTRRGSGE  308

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G K   WPNS+  +K S+IE+P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  309  AWMQPLIQGHKKLVWPNSATPVKVSTIENPALATFCEPVEKANSSHSFTAGLAHSVGLRK  368

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  369  QPLRVYSMVKYAAIARG  385



>ref|XP_002317235.2| hypothetical protein POPTR_0011s04470g [Populus trichocarpa]
 gb|EEE97847.2| hypothetical protein POPTR_0011s04470g [Populus trichocarpa]
Length=466

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 140/197 (71%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL  P  +L   E++E I+ C    G N   RFWAL       G +RGDQYAVAL+
Sbjct  191  APRFGLKAPGTSLGSSEVLEAISRCNSTGGPNG--RFWALDPVDGTLGFVRGDQYAVALA  248

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP++KEWLSY + Y RI+S+LT    SE  DKGCV+Y RRG G 
Sbjct  249  LIEDGEVVLGVLGCPNYPMRKEWLSYHHRYHRIISKLT-PPTSESWDKGCVIYTRRGSGE  307

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G K   WPNS+  +K S+IE+P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  308  AWMQPLIQGHKKLVWPNSATPVKVSTIENPALATFCEPVEKANSSHSFTAGLAHSVGLRK  367

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  368  QPLRVYSMVKYAAIARG  384



>ref|XP_002305006.2| hypothetical protein POPTR_0004s03660g [Populus trichocarpa]
 gb|EEE85517.2| hypothetical protein POPTR_0004s03660g [Populus trichocarpa]
Length=462

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 141/197 (72%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL  P   L   E++E I+ C  A G +   RFWAL       G +RGDQYAVAL+
Sbjct  187  APRFGLKAPGTILGSSEVLEAISRCNSAGGPSG--RFWALDPVDGTLGFVRGDQYAVALA  244

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP++KEWLSY + Y RI+S+LT    SE  DKGCV+YARRG G 
Sbjct  245  LIEDGEVVLGVLGCPNYPMRKEWLSYHHRYHRIISKLT-PPTSESWDKGCVIYARRGSGE  303

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G K   WPNS+  ++ S+IE+P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  304  AWMQPLIQGHKKLVWPNSATPVRVSTIENPALATFCEPVEKANSSHSFTAGLAHSVGLRK  363

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  364  QPLRVYSMVKYAAIARG  380



>ref|XP_006449251.1| hypothetical protein CICLE_v10015112mg [Citrus clementina]
 gb|ESR62491.1| hypothetical protein CICLE_v10015112mg [Citrus clementina]
Length=473

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 143/197 (73%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL GPA AL   E++E I+ C  + G     RFWAL       G +RGDQYAVAL+
Sbjct  198  APRFGLQGPAMALGASEVIEAISRCNSSGGPTG--RFWALDPVDGTLGFVRGDQYAVALA  255

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  V+GVLGCPNYP++KEWLSYQ+ Y RI+S+LT    SE  DKGCVMYA +G G 
Sbjct  256  LIENGEAVLGVLGCPNYPMRKEWLSYQHRYHRIISKLT-PPTSESWDKGCVMYAWKGSGE  314

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G K   WPNS++ ++ SSIE+P +ATFC  VEK+ SSHSFTAGL  S+G R 
Sbjct  315  AWMQPLIQGDKKLVWPNSARPVQVSSIENPALATFCEPVEKSNSSHSFTAGLAHSVGLRK  374

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYA IARG
Sbjct  375  QPLRVYSMVKYATIARG  391



>emb|CDO99612.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 141/197 (72%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP  GL  P+  L   E++  I+ C    G   + RFW L       G +RGDQYA+AL+
Sbjct  189  APLLGLEAPSRPLDMREVLNAISRCNSRGG--KSGRFWVLDPVDGTLGFVRGDQYAIALA  246

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG PV+GVLGCPNYP+KK+WLSYQ GY+R+LSRLTS   SE   KG V+YAR+G G 
Sbjct  247  LIEDGEPVIGVLGCPNYPMKKDWLSYQNGYRRLLSRLTSPT-SEAYAKGSVIYARKGSGK  305

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQ LL G K F WPNS++QIK SSI +P MATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  306  AWMQTLLHGDKKFVWPNSARQIKVSSIGNPAMATFCEPVEKANSSHSFTAGLAHSVGMRN  365

Query  522  QQLRVYSSMKYAAIARG  572
            Q LR+YS +KYAAIARG
Sbjct  366  QPLRLYSMVKYAAIARG  382



>ref|XP_002266810.2| PREDICTED: PAP-specific phosphatase HAL2-like [Vitis vinifera]
Length=456

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 140/197 (71%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL GP   L  +E++E I+ C    G     RFW L       G +RGDQYA+AL+
Sbjct  181  APRFGLIGPEMVLGTKEVLEAISRCNSEGG--QTGRFWVLDPVDGTLGFVRGDQYAIALA  238

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKEWLSY + Y RI+S+LT    S+  DKGCV+YARRG G 
Sbjct  239  LIEDGEVVLGVLGCPNYPMKKEWLSYHHRYYRIISKLT-PPTSDSWDKGCVIYARRGSGK  297

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL G K   WPNS++ ++ SSI++P +ATFC  VEKA SSHSFT GL  S+G R 
Sbjct  298  AWMQPLLNGNKKLEWPNSARPVQVSSIDNPALATFCEPVEKANSSHSFTTGLAHSVGLRK  357

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  358  QPLRVYSMVKYAAIARG  374



>gb|KDO75791.1| hypothetical protein CISIN_1g011984mg [Citrus sinensis]
Length=473

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 142/197 (72%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL GPA AL   E++E I  C  + G     RFWAL       G +RGDQYAVAL+
Sbjct  198  APRFGLQGPAMALGASEVIEAIGRCNSSGGPTG--RFWALDPVDGTLGFVRGDQYAVALA  255

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  V+GVLGCPNYP++KEWLSYQ+ Y RI+S+LT    SE  DKGCVMYA +G G 
Sbjct  256  LIENGEAVLGVLGCPNYPMRKEWLSYQHRYHRIISKLT-PPTSESWDKGCVMYAWKGSGE  314

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G K   WPNS++ ++ SSIE+P +ATFC  VEK+ SSHSFTAGL  S+G R 
Sbjct  315  AWMQPLIQGDKKLVWPNSARPVQVSSIENPALATFCEPVEKSNSSHSFTAGLAHSVGLRK  374

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYA IARG
Sbjct  375  QPLRVYSMVKYATIARG  391



>ref|XP_006467873.1| PREDICTED: PAP-specific phosphatase HAL2-like [Citrus sinensis]
Length=473

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 142/197 (72%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL GPA AL   E++E I  C  + G     RFWAL       G +RGDQYAVAL+
Sbjct  198  APRFGLQGPAMALGASEVIEAIGRCNSSGGPTG--RFWALDPVDGTLGFVRGDQYAVALA  255

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  V+GVLGCPNYP++KEWLSYQ+ Y RI+S+LT    SE  DKGCVMYA +G G 
Sbjct  256  LIENGEAVLGVLGCPNYPMRKEWLSYQHRYHRIISKLT-PPTSESWDKGCVMYAWKGSGE  314

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G K   WPNS++ ++ SSIE+P +ATFC  VEK+ SSHSFTAGL  S+G R 
Sbjct  315  AWMQPLIQGDKKLVWPNSARPVQVSSIENPALATFCEPVEKSNSSHSFTAGLAHSVGLRK  374

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYA IARG
Sbjct  375  QPLRVYSMVKYATIARG  391



>ref|XP_004232820.1| PREDICTED: PAP-specific phosphatase HAL2-like [Solanum lycopersicum]
Length=448

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 147/197 (75%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL GP   L  + ++E I+ C LA      S+FW L       G +RGDQYA+AL+
Sbjct  173  APRFGLKGPGTDLDAKAVLEAISRCSLAGA--RGSKFWVLDPVDGTLGFVRGDQYAIALA  230

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG PV+GVLGCPNYP+KKEWLSYQ GY+RILSR  S++ SE  D+G V+YAR+G G 
Sbjct  231  LIEDGEPVLGVLGCPNYPMKKEWLSYQNGYRRILSR-LSSSTSESSDRGSVLYARKGGGR  289

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL G   F WPN++++I+ SSI++P +ATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  290  AWMQPLLRGESKFVWPNAAREIRVSSIDNPALATFCEPVEKANSSHSFTAGLAHSVGLRN  349

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  350  QPLRVYSMVKYAAIARG  366



>ref|XP_002521419.1| diphosphonucleoside phosphohydrolase, putative [Ricinus communis]
 gb|EEF40909.1| diphosphonucleoside phosphohydrolase, putative [Ricinus communis]
Length=392

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 141/197 (72%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWA-------LGSLRGDQYAVALS  161
            APRFG+  P + L   E++E I+ C    G     RFWA       LG +RGDQYAVAL+
Sbjct  117  APRFGVKAPGKFLSNSEVLEAISRCNSTGGPTE--RFWAVDPVDGTLGFVRGDQYAVALA  174

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKEWL+Y + Y RI+S+LT    SE  DKGCV+YAR+G G 
Sbjct  175  LIEDGEVVLGVLGCPNYPMKKEWLNYHHRYHRIISKLTPPT-SESWDKGCVIYARKGSGK  233

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQP+L G K   WPNS++ ++ SSI++P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  234  AWMQPILQGHKKLVWPNSARPVQVSSIDNPALATFCEPVEKANSSHSFTAGLAHSVGLRM  293

Query  522  QQLRVYSSMKYAAIARG  572
            Q LR+YS +KYAAIARG
Sbjct  294  QPLRMYSMVKYAAIARG  310



>ref|XP_004293556.1| PREDICTED: PAP-specific phosphatase HAL2-like [Fragaria vesca 
subsp. vesca]
Length=453

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 141/197 (72%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL GP + L  +E++E I+ C    G     RFWAL       G +RGDQYA+AL+
Sbjct  178  APRFGLQGPKKTLGTKEVLEAISRCNSTGGPTG--RFWALDPVDGTLGFVRGDQYAIALA  235

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+++EWL+Y + Y RI+S+LT    SE  DKGCV+YARRG   
Sbjct  236  LIEDGEVVLGVLGCPNYPMRREWLNYHHRYHRIISKLT-PPTSESWDKGCVLYARRGSSE  294

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL   K F WPNS+K ++ SSI +P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  295  AWMQPLLHVNKKFLWPNSAKLVQVSSINNPSLATFCEPVEKANSSHSFTAGLAHSVGLRK  354

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  355  QPLRVYSMVKYAAIARG  371



>ref|XP_010092615.1| PAP-specific phosphatase HAL2-like protein [Morus notabilis]
 gb|EXB51804.1| PAP-specific phosphatase HAL2-like protein [Morus notabilis]
Length=393

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 139/197 (71%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL  P   L   E++E I+ C    G     RFWAL       G +RGDQYA+AL+
Sbjct  118  APRFGLKAPEIPLGSSEVLEAISRCNSNGGPTG--RFWALDPVDGTLGFVRGDQYAIALA  175

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP++KEWL Y + Y RI+S+LT    SE  DKGCV+YARRG G 
Sbjct  176  LIEDGEVVLGVLGCPNYPMRKEWLGYHHRYHRIVSKLT-PPTSESWDKGCVIYARRGSGK  234

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL   K F WPNS++ ++ SSI++P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  235  AWMQPLLHVNKKFMWPNSARPVQVSSIDNPSLATFCEPVEKANSSHSFTAGLAHSMGLRK  294

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  295  QPLRVYSMVKYAAIARG  311



>ref|XP_008224976.1| PREDICTED: PAP-specific phosphatase HAL2-like [Prunus mume]
Length=462

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 142/197 (72%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APR+GL GP  AL   E++E I+ C    G     RFWAL       G +RGDQYA+AL+
Sbjct  187  APRYGLKGPKMALGTTEVLEAISRCNSIGGPTG--RFWALDPVDGTLGFVRGDQYAIALA  244

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP++KEWL+Y + Y RI+S+LT  + SE  DKGCV+YARRG G 
Sbjct  245  LIEDGEVVLGVLGCPNYPMRKEWLNYHHRYHRIISKLT-PSTSESWDKGCVIYARRGSGE  303

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL   K   WPNS++ ++ SSI++P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  304  AWMQPLLHVNKNLVWPNSARPVRVSSIDNPSLATFCEPVEKANSSHSFTAGLAHSVGLRK  363

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  364  QPLRVYSMVKYAAIARG  380



>ref|XP_008383803.1| PREDICTED: PAP-specific phosphatase HAL2-like [Malus domestica]
Length=441

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 139/197 (71%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL  P  AL   E++E I+ C    G   A RFW L       G +RGDQYA+AL+
Sbjct  166  APRFGLKSPKMALGTTEVLEAISRCNSLGGP--AGRFWTLDPVDGTLGFVRGDQYAIALA  223

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP++KEWL+Y + Y RI+S+LT    SE  DKGCV+YARRG G 
Sbjct  224  LIEDGEVVLGVLGCPNYPMRKEWLNYHHRYHRIISKLT-PPTSESWDKGCVIYARRGSGE  282

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL   K   WPNS+K ++ SSI++P +ATFC  VEK  SSHSFTAGL  S+G R 
Sbjct  283  AWMQPLLHVNKNLVWPNSAKPVRVSSIDNPALATFCEPVEKENSSHSFTAGLAHSVGLRK  342

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  343  QPLRVYSMVKYAAIARG  359



>ref|XP_003545856.1| PREDICTED: PAP-specific phosphatase HAL2-like [Glycine max]
Length=465

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 139/197 (71%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFG+  P  AL   +++E I+ C    G     RFW L       G +RGDQYAVAL+
Sbjct  190  APRFGVQEPKSALRTSDVLEIISRCNSTGGPTG--RFWVLDPVDGTLGFVRGDQYAVALA  247

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG   +GVLGCPNYP++KEWLSY + Y RI+S+LT    SE  +KGCV+YA++G G 
Sbjct  248  LIEDGEVKLGVLGCPNYPMRKEWLSYHHRYHRIISKLT-PPTSETWNKGCVLYAKKGSGK  306

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL   KMF WPN +KQ+  SSI++P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  307  AWMQPLLHVNKMFVWPNHAKQVSVSSIDNPALATFCEPVEKANSSHSFTAGLAHSVGLRK  366

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  367  QPLRVYSMVKYAAIARG  383



>gb|KDP20907.1| hypothetical protein JCGZ_21378 [Jatropha curcas]
Length=456

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 140/197 (71%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL  P  AL   E++E I+ C  + G     RFWAL       G +RGDQYAVAL+
Sbjct  181  APRFGLNAPGVALTTSEVLEAISHCNSSGGP--IGRFWALDPVDGTLGFVRGDQYAVALA  238

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  V+GVLGCPNYP++KEWL+Y + Y RI+S+LT    SE  DKGCV+YA +G G 
Sbjct  239  LIEEGEVVLGVLGCPNYPMRKEWLNYHHRYHRIISKLT-PPTSESWDKGCVIYAGKGSGE  297

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL G K   WPNS++ ++ SSI +P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  298  AWMQPLLQGNKKLVWPNSARPVRVSSINNPALATFCEPVEKANSSHSFTAGLAHSMGLRM  357

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  358  QPLRVYSMVKYAAIARG  374



>ref|XP_007025749.1| PAP-specific phosphatase HAL2-like isoform 2 [Theobroma cacao]
 gb|EOY28371.1| PAP-specific phosphatase HAL2-like isoform 2 [Theobroma cacao]
Length=395

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 139/197 (71%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP FGL GP   L   +++E I+ C    G     RFWAL       G +RGDQYAVAL+
Sbjct  120  APLFGLKGPETPLGSSDVLEAISRCNSNRGPTG--RFWALDPVDGTLGFVRGDQYAVALA  177

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKEWLSY + Y RI+S+LT   ASE  DKGCV+YAR+G G 
Sbjct  178  LIEDGEVVLGVLGCPNYPMKKEWLSYHHRYHRIISKLT-PPASESWDKGCVIYARKGSGE  236

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL    K+  WPNS+  ++ SSI++P +ATFC  VEK+ SSHSFTAGL  S+G R 
Sbjct  237  AWMQPLCQKNKLLAWPNSAIPVRVSSIDNPALATFCEPVEKSNSSHSFTAGLAHSVGLRK  296

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  297  QPLRVYSMVKYAAIARG  313



>ref|XP_011096290.1| PREDICTED: PAP-specific phosphatase HAL2-like [Sesamum indicum]
Length=461

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 143/197 (73%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP FGL+ P+  L   E++E I+ C    G   + RFW L       G +RGDQYA+AL+
Sbjct  186  APCFGLSAPSSGLSASEVLEAISRCNSTGGP--SGRFWVLDPVDGTLGFVRGDQYAIALA  243

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            L+E+G PV+GVLGCPNYP++KEWLSY  GY+R+LS+L S A   P  KGC++YAR+G G 
Sbjct  244  LVENGEPVLGVLGCPNYPMEKEWLSYSNGYRRMLSKLASPALGFP-GKGCIIYARKGSGK  302

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL    K F WPNS+++I+ S+I++P +ATFC  VEKA SSHSFTAG+  S+G RN
Sbjct  303  AWMQPLHQKDKKFIWPNSAREIRVSTIDNPALATFCEPVEKANSSHSFTAGVAHSVGLRN  362

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  363  QPLRVYSMVKYAAIARG  379



>ref|XP_004485721.1| PREDICTED: PAP-specific phosphatase HAL2-like [Cicer arietinum]
Length=472

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 141/197 (72%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFG+  P  +L   E+++ I+ C    G     RFW L       G +RGDQYAVAL+
Sbjct  197  APRFGIQKPKSSLGTSEVLDIISRCNSTGGP--FGRFWVLDPVDGTLGFVRGDQYAVALA  254

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            L+E+G  V+GVLGCPNYP++KEWLSYQ+ Y RI+S+LT   +SE  +KGCV+YA++G G 
Sbjct  255  LVENGEVVLGVLGCPNYPMRKEWLSYQHRYHRIVSKLT-PPSSESWNKGCVLYAKKGSGK  313

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL   KMF WPN +KQ+  SSI+ P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  314  AWMQPLLHVNKMFVWPNHAKQVFVSSIDHPALATFCEPVEKANSSHSFTAGLAHSVGLRK  373

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  374  QPLRVYSMVKYAAIARG  390



>ref|XP_008345875.1| PREDICTED: PAP-specific phosphatase HAL2-like [Malus domestica]
Length=458

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 139/197 (71%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL  P  AL   E++E I+ C    G   A RFW L       G +RGDQYA+AL+
Sbjct  166  APRFGLKSPKMALGTTEVLEAISRCNSLGGP--AGRFWTLDPVDGTLGFVRGDQYAIALA  223

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP++KEWL+Y + Y RI+S+LT    SE  DKGCV+YARRG G 
Sbjct  224  LIEDGEVVLGVLGCPNYPMRKEWLNYHHRYHRIISKLT-PPTSESWDKGCVIYARRGSGE  282

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL   K   WPNS+K ++ S+I++P +ATFC  VEKA SSHSFTAGL  S+  R 
Sbjct  283  AWMQPLLHVNKNLVWPNSAKPVRVSTIDNPSLATFCEPVEKANSSHSFTAGLAHSVXLRK  342

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  343  QPLRVYSMVKYAAIARG  359



>gb|KHN08573.1| PAP-specific phosphatase HAL2-like [Glycine soja]
Length=401

 Score =   227 bits (578),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 138/197 (70%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFG+  P   L   +++E I+ C    G     RFW L       G +RGDQYAVAL+
Sbjct  126  APRFGVQEPKSPLGTSDVLEIISRCNSTGGPTG--RFWVLDPVDGTLGFVRGDQYAVALA  183

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG   +GVLGCPNYP++KEWLSY + Y RI+S+LT  A SE  +KGCV+YA++G   
Sbjct  184  LIEDGEVKLGVLGCPNYPMRKEWLSYHHRYHRIISKLTRPA-SETWNKGCVLYAKKGSEK  242

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL   KMF WPN +KQ+  SSI++P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  243  AWMQPLLHVNKMFVWPNHAKQVSVSSIDNPALATFCEPVEKANSSHSFTAGLAHSVGLRK  302

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  303  QPLRVYSMVKYAAIARG  319



>ref|XP_004146587.1| PREDICTED: PAP-specific phosphatase HAL2-like [Cucumis sativus]
 ref|XP_004158031.1| PREDICTED: PAP-specific phosphatase HAL2-like [Cucumis sativus]
Length=391

 Score =   226 bits (577),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 137/197 (70%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A RFGL GP   LC  E++E I+ C  + G+    RFW L       G +RGDQYAVAL+
Sbjct  116  AYRFGLEGPESTLCTSEVLEAISRCNSSGGSTG--RFWTLDPVDGTLGFIRGDQYAVALA  173

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP++KEWL Y   Y  I+S+L S   SE  DKGCV+YA++G G 
Sbjct  174  LIEDGEVVLGVLGCPNYPMRKEWLCYHPRYHSIISKL-SPTTSESWDKGCVIYAQKGSGE  232

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+   K   WPNS+  I+ SSI+ P +ATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  233  AWMQPLIHVNKKLVWPNSAIPIQVSSIDDPALATFCEPVEKANSSHSFTAGLAHSVGLRN  292

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  293  QPLRVYSMVKYAAIARG  309



>ref|XP_009377836.1| PREDICTED: PAP-specific phosphatase HAL2-like [Pyrus x bretschneideri]
Length=442

 Score =   228 bits (580),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 138/197 (70%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL  P  AL   E++E I+ C    G   A RFW L       G +RGDQYA+AL+
Sbjct  167  APRFGLKSPKMALGTTEVLEAISRCNSLGGP--AGRFWTLDPVDGTLGFVRGDQYAIALA  224

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP++KEWL+Y + Y R++S+LT    SE  DKGCV+YARRG G 
Sbjct  225  LIEDGEVVLGVLGCPNYPMRKEWLNYHHRYHRMISKLT-PPTSESWDKGCVLYARRGSGE  283

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL   K   WPNS+K ++ S+I++P +ATFC  VEKA SSHSFT GL  S+G R 
Sbjct  284  AWMQPLLHVNKNLEWPNSAKPVRVSTIDNPSLATFCEPVEKANSSHSFTEGLAHSVGLRK  343

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KY AIARG
Sbjct  344  QPLRVYSMVKYTAIARG  360



>ref|XP_007025748.1| PAP-specific phosphatase HAL2-like isoform 1 [Theobroma cacao]
 gb|EOY28370.1| PAP-specific phosphatase HAL2-like isoform 1 [Theobroma cacao]
Length=464

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 139/197 (71%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP FGL GP   L   +++E I+ C    G     RFWAL       G +RGDQYAVAL+
Sbjct  189  APLFGLKGPETPLGSSDVLEAISRCNSNRGPTG--RFWALDPVDGTLGFVRGDQYAVALA  246

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKEWLSY + Y RI+S+LT   ASE  DKGCV+YAR+G G 
Sbjct  247  LIEDGEVVLGVLGCPNYPMKKEWLSYHHRYHRIISKLT-PPASESWDKGCVIYARKGSGE  305

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL    K+  WPNS+  ++ SSI++P +ATFC  VEK+ SSHSFTAGL  S+G R 
Sbjct  306  AWMQPLCQKNKLLAWPNSAIPVRVSSIDNPALATFCEPVEKSNSSHSFTAGLAHSVGLRK  365

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  366  QPLRVYSMVKYAAIARG  382



>ref|XP_007148225.1| hypothetical protein PHAVU_006G190400g [Phaseolus vulgaris]
 gb|ESW20219.1| hypothetical protein PHAVU_006G190400g [Phaseolus vulgaris]
Length=464

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 137/197 (70%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFG+  P   L   +++E I  C    G     RFW L       G +RGDQYAVAL+
Sbjct  189  APRFGVEKPKCGLSNSDVLEIIGRCNSTGGPTG--RFWVLDPVDGTLGFVRGDQYAVALA  246

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG   +GVLGCPNYP++KEWLSY + Y RI+S+LT  + SE  +KGCV+YA+RG G 
Sbjct  247  LIEDGEVKLGVLGCPNYPMRKEWLSYHHRYHRIISKLT-PSTSETWNKGCVLYAKRGSGK  305

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL   KMF WPN +KQ+  S I++P +ATFC  VEKA SSHSFTAGL  ++G R 
Sbjct  306  AWMQPLLHVNKMFVWPNHAKQVSVSPIDNPALATFCEPVEKANSSHSFTAGLAHTIGLRK  365

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  366  QPLRVYSMVKYAAIARG  382



>ref|XP_010065475.1| PREDICTED: PAP-specific phosphatase HAL2-like [Eucalyptus grandis]
 gb|KCW62977.1| hypothetical protein EUGRSUZ_G00577 [Eucalyptus grandis]
Length=473

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 139/197 (71%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL  P   L  +E++E I  C  A   N   +FWAL       G +RGDQYAVALS
Sbjct  198  APRFGLMSPQGNLGPKEVLEAIGRCNSAGRLNR--KFWALDPVDGTLGFVRGDQYAVALS  255

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKEWL+Y + Y RI+++LT   ASE  D+GC++YAR G G 
Sbjct  256  LIEDGKVVLGVLGCPNYPMKKEWLNYHHRYHRIITKLT-PPASESWDRGCILYAREGSGE  314

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL   K   WPN++  I+ SSI++P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  315  AWMQPLLHKNKSLEWPNAAVPIRVSSIDNPALATFCEPVEKANSSHSFTAGLAHSVGLRK  374

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  375  QPLRVYSMVKYAAIARG  391



>ref|XP_003543080.1| PREDICTED: PAP-specific phosphatase HAL2-like [Glycine max]
Length=465

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 138/197 (70%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFG+  P   L   +++E I+ C    G     RFW L       G +RGDQYAVAL+
Sbjct  190  APRFGVQEPKSPLGTSDVLEIISRCNSTGGPTG--RFWVLDPVDGTLGFVRGDQYAVALA  247

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG   +GVLGCPNYP++KEWLSY + Y RI+S+LT  A SE  +KGCV+YA++G   
Sbjct  248  LIEDGEVKLGVLGCPNYPMRKEWLSYHHRYHRIISKLTRPA-SETWNKGCVLYAKKGSEK  306

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL   KMF WPN +KQ+  SSI++P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  307  AWMQPLLHVNKMFVWPNHAKQVSVSSIDNPALATFCEPVEKANSSHSFTAGLAHSVGLRK  366

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  367  QPLRVYSMVKYAAIARG  383



>gb|KGN64635.1| hypothetical protein Csa_1G072460 [Cucumis sativus]
Length=454

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 137/197 (70%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A RFGL GP   LC  E++E I+ C  + G+    RFW L       G +RGDQYAVAL+
Sbjct  179  AYRFGLEGPESTLCTSEVLEAISRCNSSGGSTG--RFWTLDPVDGTLGFIRGDQYAVALA  236

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP++KEWL Y   Y  I+S+L S   SE  DKGCV+YA++G G 
Sbjct  237  LIEDGEVVLGVLGCPNYPMRKEWLCYHPRYHSIISKL-SPTTSESWDKGCVIYAQKGSGE  295

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+   K   WPNS+  I+ SSI+ P +ATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  296  AWMQPLIHVNKKLVWPNSAIPIQVSSIDDPALATFCEPVEKANSSHSFTAGLAHSVGLRN  355

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  356  QPLRVYSMVKYAAIARG  372



>ref|XP_003593471.1| PAP-specific phosphatase HAL2-like protein [Medicago truncatula]
 gb|AES63722.1| 3'(2'),5'-bisphosphate nucleotidase [Medicago truncatula]
Length=466

 Score =   226 bits (576),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 139/197 (71%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFG+  P   L   E+++ I+ C    G   + RFW L       G +RGDQYAVAL+
Sbjct  191  APRFGVQKPKSPLGNSEVLDIISRCNSTGGP--SGRFWVLDPVDGTLGFVRGDQYAVALA  248

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            L+EDG  V+GVLGCPNYP++KEWLSYQ+ Y RI+S+LT    SE  +KGCV+YA++G G 
Sbjct  249  LVEDGEVVLGVLGCPNYPMRKEWLSYQHRYHRIVSKLT-PPTSESWNKGCVLYAKKGTGK  307

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL   KMF WPN + QI  S+I++P +ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  308  AWMQPLLHVNKMFVWPNHAIQIFVSNIDNPALATFCEPVEKANSSHSFTAGLAHSVGLRK  367

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAI RG
Sbjct  368  QPLRVYSMVKYAAIGRG  384



>ref|XP_008442099.1| PREDICTED: PAP-specific phosphatase HAL2-like [Cucumis melo]
Length=454

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 137/197 (70%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A RFGL GP   LC  E++E I+ C  + G+    RFW L       G +RGDQYAVAL+
Sbjct  179  AYRFGLEGPECTLCTSEVLEAISRCNSSGGSTG--RFWTLDPVDGTLGFIRGDQYAVALA  236

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP++KEWL Y   Y  I+S+L S   SE  DKGCV+YA++G G 
Sbjct  237  LIEDGEVVLGVLGCPNYPMRKEWLCYHPRYHSIISKL-SPTTSESWDKGCVIYAQKGSGE  295

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+   K   WPNS+  I+ SSI+ P +ATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  296  AWMQPLIHVNKKLVWPNSAIPIQVSSIDDPALATFCEPVEKANSSHSFTAGLAHSVGLRN  355

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  356  QPLRVYSMVKYAAIARG  372



>gb|KHG08289.1| PAP-specific phosphatase HAL2-like protein [Gossypium arboreum]
Length=461

 Score =   223 bits (567),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 135/197 (69%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP FGL GP + L   +I+E I  C    G   +  FWAL       G +RGDQYAVAL+
Sbjct  186  APHFGLKGPEKLLGSSDILEAIGRCNSKGGPTGS--FWALDPVDGTLGFVRGDQYAVALA  243

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP KKEWLSY + Y RI+S+LT    SE  DKGCV+YA +G G 
Sbjct  244  LIEDGEVVLGVLGCPNYPKKKEWLSYHHRYHRIISKLT-PTTSESWDKGCVLYATKGSGE  302

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL    K+  WPNS+  I+ S+I+ P +ATFC  VEK+ SSHSFTAGL  S+G R 
Sbjct  303  AWMQPLRQTNKLLAWPNSAIPIRVSAIDDPALATFCEPVEKSNSSHSFTAGLAHSVGLRK  362

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  363  QPLRVYSMVKYAAIARG  379



>ref|XP_008226682.1| PREDICTED: PAP-specific phosphatase HAL2-like [Prunus mume]
Length=381

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 136/197 (69%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P +AL   +++E I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  APKYGLKSPPKALNTSQVLEAISRCNSVGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            L+EDG  V+GVLGCPNYP+KKE LSY Y Y   +SRL S  + +  ++GCVMYA+RG G 
Sbjct  164  LVEDGKVVIGVLGCPNYPMKKELLSYHYQYHETMSRL-SPPSDDMWERGCVMYAKRGSGE  222

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQP +PG K F WPNS++ ++ SSI+ P +AT C  VEKA S HSFTAGL  S+G RN
Sbjct  223  AWMQPPIPGDKKFVWPNSARLVRVSSIDDPKLATCCEPVEKANSDHSFTAGLAHSVGLRN  282

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  283  QPLRVYSMVKYAAIARG  299



>ref|XP_009351317.1| PREDICTED: PAP-specific phosphatase HAL2-like [Pyrus x bretschneideri]
Length=381

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 137/197 (70%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P ++L   +++E I+ C  A G     + W L       G +RGDQYAVAL+
Sbjct  106  APKYGLKSPPKSLNTSQVLEAISRCNSAGGPKG--KHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+ KE LSY Y Y  ++S+L S  + +  ++GCVMYARRG GN
Sbjct  164  LIEDGKVVIGVLGCPNYPMNKELLSYHYQYHEVMSKL-SPPSEDMWERGCVMYARRGSGN  222

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQP + G K F WPNS++ I+ SSI+ P +AT C  VE+A S HSFTAGL  S+G RN
Sbjct  223  AWMQPPIRGDKKFVWPNSARLIRVSSIDDPALATCCEPVERANSDHSFTAGLAHSVGLRN  282

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  283  QPLRVYSMVKYAAIARG  299



>ref|XP_007211428.1| hypothetical protein PRUPE_ppa007114mg [Prunus persica]
 gb|EMJ12627.1| hypothetical protein PRUPE_ppa007114mg [Prunus persica]
Length=381

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 135/197 (69%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A ++GL  P +AL   +++E I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  ASKYGLKSPPKALNTSQVLEAISRCNSVGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            L+EDG  V+GVLGCPNYP+KKE LSY Y Y   +SRL S  + +  ++GCVMYA+RG G 
Sbjct  164  LVEDGKVVIGVLGCPNYPMKKELLSYHYQYHETMSRL-SPPSDDMWERGCVMYAKRGSGE  222

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQP +PG K F WPNS++ ++ SSI+ P +AT C  VEKA S HSFTAGL  S+G RN
Sbjct  223  AWMQPPIPGDKKFVWPNSARLVRVSSIDDPKLATCCEPVEKANSDHSFTAGLAHSVGLRN  282

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  283  QPLRVYSMVKYAAIARG  299



>gb|EYU43398.1| hypothetical protein MIMGU_mgv1a006221mg [Erythranthe guttata]
Length=452

 Score =   215 bits (548),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 136/198 (69%), Gaps = 17/198 (9%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL  P   L   +++E I+ C    G     RFW L       G +RGDQYA+AL+
Sbjct  182  APRFGLKSPPNPLSTSDVLEAISRCNSIGGPTG--RFWVLDPVDGTLGFVRGDQYAIALA  239

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG PV+GVLGCPNYP+K E LSY   +QR+LS   SA      DKGCV+YAR+G G 
Sbjct  240  LIEDGEPVLGVLGCPNYPMKTELLSY---HQRVLSTQPSAN----WDKGCVIYARKGSGG  292

Query  342  AWMQPLL-PGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHR  518
            AWMQPLL    K F WPNS+ +IK S+I++P +ATFC  VEKA SSHSFTAGL  S+G R
Sbjct  293  AWMQPLLRKEEKKFVWPNSASEIKVSTIDNPALATFCEPVEKANSSHSFTAGLAHSVGVR  352

Query  519  NQQLRVYSSMKYAAIARG  572
            NQ LRVYS +KYAAIARG
Sbjct  353  NQPLRVYSMVKYAAIARG  370



>ref|XP_002281902.2| PREDICTED: PAP-specific phosphatase HAL2-like [Vitis vinifera]
 ref|XP_010644226.1| PREDICTED: PAP-specific phosphatase HAL2-like [Vitis vinifera]
 ref|XP_010644227.1| PREDICTED: PAP-specific phosphatase HAL2-like [Vitis vinifera]
 ref|XP_010644228.1| PREDICTED: PAP-specific phosphatase HAL2-like [Vitis vinifera]
Length=390

 Score =   213 bits (543),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 136/197 (69%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFW-------ALGSLRGDQYAVALS  161
            AP+FGL  P +AL   ++++ I+ C    G     R W        LG +RGDQYAVAL+
Sbjct  115  APKFGLKCPDKALRTSQVLDAISRCNSTGGPKG--RHWILDPVDGTLGFVRGDQYAVALA  172

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+ KEWL+Y   + + +S+  S  AS+  +KGCVMYARRG G 
Sbjct  173  LIEDGKVVIGVLGCPNYPMNKEWLNYHNKFYQAMSK-QSPPASDSWEKGCVMYARRGSGE  231

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQP++ G +   WPNS++ IK SSI++P MATFC  VEKA S+HSFT GL  S+G R 
Sbjct  232  AWMQPMVLGDQKLEWPNSARLIKVSSIDNPAMATFCEPVEKANSNHSFTKGLVHSVGLRK  291

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  292  QPLRVYSMVKYAAIARG  308



>ref|XP_008366620.1| PREDICTED: PAP-specific phosphatase HAL2-like [Malus domestica]
 ref|XP_008366626.1| PREDICTED: PAP-specific phosphatase HAL2-like [Malus domestica]
Length=381

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 135/197 (69%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P ++L   +++E I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  APKYGLKSPPKSLNTAQVLEAISRCNSEGGPKG--RHWVLDPIDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKE LSY Y Y   +SRL S  + +  ++GCVMYARRG G 
Sbjct  164  LIEDGKVVIGVLGCPNYPMKKELLSYHYQYHENMSRL-SPPSDDMWERGCVMYARRGSGE  222

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQP + G K F WPNS++ ++ SSI+ P +AT C  VEKA S HSFTAGL  S+G RN
Sbjct  223  AWMQPPIRGDKKFVWPNSARLVRVSSIDDPSLATSCEPVEKANSDHSFTAGLAHSVGLRN  282

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  283  QPLRVYSMVKYAAIARG  299



>gb|KHG09864.1| PAP-specific phosphatase HAL2-like protein [Gossypium arboreum]
Length=485

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 136/197 (69%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWALGSL-------RGDQYAVALS  161
            AP FGL GP   L   +++E I+ C  + G     RFWALG L       R DQYAVAL+
Sbjct  210  APHFGLKGPETPLRSLDVLEAISRCNSSGGPTG--RFWALGHLDGTFGFVRDDQYAVALA  267

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKEWL+Y + Y RILS+LT    S   DKGCV++AR+G G 
Sbjct  268  LIEDGEVVLGVLGCPNYPMKKEWLTYHHRYHRILSKLT-PPTSNSWDKGCVIHARKGSGE  326

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AW+QP+    K+  W NS+ +++ SSI++P +ATFC  ++K  S+HSFTAGL  S+G R 
Sbjct  327  AWIQPIHQKNKLVPWANSAIRVQVSSIDNPALATFCEPIDKLNSTHSFTAGLAHSVGLRK  386

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  387  QPLRVYSMVKYAAIARG  403



>ref|XP_010931922.1| PREDICTED: PAP-specific phosphatase HAL2-like [Elaeis guineensis]
Length=467

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 136/197 (69%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP FGL GPA+AL  +E++E I+ C    G     +FW L       G +RGDQYAVAL+
Sbjct  192  APTFGLEGPAKALGTQEVLEAISRCNSNGGPKG--KFWVLDPVDGTLGFVRGDQYAVALA  249

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  ++GVLGCPNYP+KK WL+Y   Y R++S L+ AA      KGCVMYAR+G G 
Sbjct  250  LIEDGEVILGVLGCPNYPMKKAWLNYHQRYYRLMSNLSPAAYGSWH-KGCVMYARKGSGE  308

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+     F+W +S+++I+ SSI  P +ATFC  VEK  SSHSFTAGL  S+G R 
Sbjct  309  AWMQPLVHDYGNFDWQSSAQKIQVSSINDPALATFCEPVEKTNSSHSFTAGLAQSVGVRK  368

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  369  QPLRVYSMVKYAAIARG  385



>ref|XP_009334609.1| PREDICTED: PAP-specific phosphatase HAL2-like [Pyrus x bretschneideri]
 ref|XP_009334610.1| PREDICTED: PAP-specific phosphatase HAL2-like [Pyrus x bretschneideri]
Length=390

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 136/205 (66%), Gaps = 17/205 (8%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P ++L   +++E I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  APKYGLKSPPKSLNTAQVLEAISRCNSEGGPKG--RHWVLDPIDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAA--------ASEPRDKGCVM  317
            LIEDG  V+GVLGCPNYP+KKE LSY Y Y   +SRL+  +        + +  ++GCVM
Sbjct  164  LIEDGKVVIGVLGCPNYPMKKELLSYHYQYHETMSRLSPPSEDMWERGPSEDMWERGCVM  223

Query  318  YARRGDGNAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGL  497
            YARRG G AWMQP + G K F WPNS++ ++ SSI+ P +AT C  VEKA S HSFTAGL
Sbjct  224  YARRGSGEAWMQPPIHGDKKFVWPNSARLVRVSSIDDPALATCCEPVEKANSDHSFTAGL  283

Query  498  NSSLGHRNQQLRVYSSMKYAAIARG  572
              S+G RNQ LRVYS +KYAAIARG
Sbjct  284  AHSVGFRNQPLRVYSMVKYAAIARG  308



>ref|XP_006449252.1| hypothetical protein CICLE_v10015112mg [Citrus clementina]
 gb|ESR62492.1| hypothetical protein CICLE_v10015112mg [Citrus clementina]
Length=385

 Score =   210 bits (535),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 129/179 (72%), Gaps = 10/179 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL GPA AL   E++E I+ C  + G     RFWAL       G +RGDQYAVAL+
Sbjct  198  APRFGLQGPAMALGASEVIEAISRCNSSGGPTG--RFWALDPVDGTLGFVRGDQYAVALA  255

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  V+GVLGCPNYP++KEWLSYQ+ Y RI+S+LT    SE  DKGCVMYA +G G 
Sbjct  256  LIENGEAVLGVLGCPNYPMRKEWLSYQHRYHRIISKLT-PPTSESWDKGCVMYAWKGSGE  314

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHR  518
            AWMQPL+ G K   WPNS++ ++ SSIE+P +ATFC  VEK+ SSHSFTAGL  S+G R
Sbjct  315  AWMQPLIQGDKKLVWPNSARPVQVSSIENPALATFCEPVEKSNSSHSFTAGLAHSVGLR  373



>ref|XP_008349979.1| PREDICTED: PAP-specific phosphatase HAL2-like [Malus domestica]
Length=381

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 134/197 (68%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P ++L   +++E I+ C    G     + W L       G +RGDQYAVAL+
Sbjct  106  APKYGLKSPPKSLNTSQVLEAISRCNSVGGPKG--KHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+ KE LSY Y Y   +S+L S  + +  ++GCVMYARRG G 
Sbjct  164  LIEDGKVVIGVLGCPNYPMNKELLSYHYQYHEAMSKL-SPPSEDTWERGCVMYARRGSGK  222

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQP + G K F WPNS++ I+ SSI+ P +AT C  VE+A S HSFTAGL  S+G RN
Sbjct  223  AWMQPPIRGDKKFVWPNSARLIQVSSIDDPTLATCCEPVERANSDHSFTAGLAHSVGLRN  282

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  283  QPLRVYSMVKYAAIARG  299



>gb|KDO75792.1| hypothetical protein CISIN_1g011984mg [Citrus sinensis]
Length=396

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 128/179 (72%), Gaps = 10/179 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL GPA AL   E++E I  C  + G     RFWAL       G +RGDQYAVAL+
Sbjct  198  APRFGLQGPAMALGASEVIEAIGRCNSSGGPTG--RFWALDPVDGTLGFVRGDQYAVALA  255

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  V+GVLGCPNYP++KEWLSYQ+ Y RI+S+LT    SE  DKGCVMYA +G G 
Sbjct  256  LIENGEAVLGVLGCPNYPMRKEWLSYQHRYHRIISKLT-PPTSESWDKGCVMYAWKGSGE  314

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHR  518
            AWMQPL+ G K   WPNS++ ++ SSIE+P +ATFC  VEK+ SSHSFTAGL  S+G R
Sbjct  315  AWMQPLIQGDKKLVWPNSARPVQVSSIENPALATFCEPVEKSNSSHSFTAGLAHSVGLR  373



>gb|AFK34186.1| unknown [Lotus japonicus]
Length=394

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 137/197 (70%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFG+  P   L   E++E I+  K     + + RFWAL       G + GDQYAVALS
Sbjct  119  APRFGVEEPKSPLGTSELLEIIS--KFNTVGSPSGRFWALDPLDGTFGFVGGDQYAVALS  176

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP++K+WLSYQ  YQRI+S+L + + SE  +KGCV+YA+RG+G 
Sbjct  177  LIEDGEVVLGVLGCPNYPMRKDWLSYQSSYQRIMSKL-NPSNSETWNKGCVIYAKRGNGK  235

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AW+QPLL   K F WPNS+K +   S E PV+ATFC T E A S+HSFT GL  S+G  +
Sbjct  236  AWIQPLLHTNKKFMWPNSAKPVSVPSNEDPVLATFCETFENANSNHSFTEGLAHSVGLSD  295

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRV+S +KYAAIA G
Sbjct  296  QPLRVHSMVKYAAIACG  312



>ref|XP_004294514.1| PREDICTED: PAP-specific phosphatase HAL2-like [Fragaria vesca 
subsp. vesca]
Length=381

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 135/197 (69%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P+EAL   +I+E I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  APKYGLKSPSEALTTSQILEAISRCNSVGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKE L+Y Y Y   +S+ +S  + +  ++GCVMYAR+  G+
Sbjct  164  LIEDGKVVIGVLGCPNYPMKKELLNYHYQYHEAMSK-SSPPSPDIWERGCVMYARKDSGH  222

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQP + G K F WPNS+K I+ SSI+ P +AT C  VE+A S+HSFT GL  S+G R 
Sbjct  223  AWMQPHIHGDKKFEWPNSAKLIRVSSIDDPALATSCEPVERANSNHSFTEGLAHSVGLRK  282

Query  522  QQLRVYSSMKYAAIARG  572
            + +RVYS +KYAAIARG
Sbjct  283  KPMRVYSMVKYAAIARG  299



>gb|EMT01678.1| PAP-specific phosphatase HAL2-like protein [Aegilops tauschii]
Length=331

 Score =   204 bits (519),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 134/197 (68%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   ++++ I  C    G     RFW L       G +RGDQYA+AL+
Sbjct  57   APKYGLRSPEKDLGAHDVLQAIRKCSSTGGPKG--RFWVLDPVDGTLGFVRGDQYAIALA  114

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKEWL+Y   Y R++S++ +   S   +KGCVMYA +G G 
Sbjct  115  LIEDGEVVLGVLGCPNYPMKKEWLNYHQRYYRLMSKV-APPTSGTWNKGCVMYAHKGCGQ  173

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+    M +W NS ++++ SS+  PV ATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  174  AWMQPLVHDFGMLSWHNS-REVQVSSVSDPVSATFCEPVEKANSSHSFTAGLAHSVGLRN  232

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  233  QPLRVYSMVKYAAIARG  249



>ref|XP_010235939.1| PREDICTED: PAP-specific phosphatase HAL2-like [Brachypodium distachyon]
Length=462

 Score =   207 bits (527),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 135/197 (69%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   ++++ I  C  A G     RFW L       G +RGDQYA+AL+
Sbjct  188  APKYGLRSPEKDLRASDVLQAIRKCSSAGGPKG--RFWVLDPVDGTLGFVRGDQYAIALA  245

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKEWL+Y   Y R++S++ +  AS   +KGCVMYA +G G 
Sbjct  246  LIEDGEVVLGVLGCPNYPMKKEWLNYHQRYYRLMSKV-APPASGSWNKGCVMYAHKGCGQ  304

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+    M NW N S++I+ SS+  PV ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  305  AWMQPLVHDFGMLNWHN-SREIQVSSVSDPVSATFCEPVEKANSSHSFTAGLAHSVGLRK  363

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  364  QPLRVYSMVKYAAIARG  380



>gb|EMS49729.1| PAP-specific phosphatase HAL2-like protein [Triticum urartu]
Length=355

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 134/197 (68%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   ++++ I  C    G     RFW L       G +RGDQYA+AL+
Sbjct  81   APKYGLRSPEKDLGAHDVLQAIRKCSSTGGPKG--RFWVLDPVDGTLGFVRGDQYAIALA  138

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKEWL+Y   Y R++S++ +   S   +KGCVMYA +G G 
Sbjct  139  LIEDGEVVLGVLGCPNYPMKKEWLNYHQRYYRLMSKV-APPTSGSWNKGCVMYAHKGCGQ  197

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+    M +W NS ++++ SS+  PV ATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  198  AWMQPLVHDFGMLSWHNS-REVQVSSVSDPVSATFCEPVEKANSSHSFTAGLAHSVGLRN  256

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  257  QPLRVYSMVKYAAIARG  273



>ref|XP_010696590.1| PREDICTED: PAP-specific phosphatase HAL2-like [Beta vulgaris 
subsp. vulgaris]
Length=452

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 132/197 (67%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP+FG+ GP   L   E++E I  C    G +   RFW L       G +RGDQYAVAL+
Sbjct  178  APQFGIKGPIIPLKKAEVLEAIRQCNFNGGPSG--RFWVLDPVDGTLGFVRGDQYAVALA  235

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            L+EDG  V+GVLGCPNYPL+KEWLSY + Y RI+S+LT    S   DKG V+YA++G G 
Sbjct  236  LVEDGEVVLGVLGCPNYPLRKEWLSYHHRYYRIISKLT-PPTSISWDKGFVLYAKKGSGK  294

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+P   +  W  S + +  SSIE P  ATFC  VE+A SSHSFTAGL  S+G R 
Sbjct  295  AWMQPLIPSNNLV-WLKSPRPVYVSSIEDPGQATFCEPVERANSSHSFTAGLAHSVGVRK  353

Query  522  QQLRVYSSMKYAAIARG  572
            + LRVYS +KYAA+ARG
Sbjct  354  EPLRVYSMVKYAAVARG  370



>ref|XP_006464700.1| PREDICTED: PAP-specific phosphatase HAL2-like isoform X2 [Citrus 
sinensis]
Length=337

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 132/197 (67%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP+FGL  P  AL   +I+E I+ C    G   A R+W L       G +RGDQYAVAL+
Sbjct  62   APKFGLQSPPGALGTSQILEAISRCSSNGGP--AGRYWVLDPVDGTLGFVRGDQYAVALA  119

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYPLKKE L+Y   Y +  S+ TS + +   +KGCVMYARR  G 
Sbjct  120  LIEDGKVVLGVLGCPNYPLKKELLNYPQNYNQTKSK-TSLSTTATWEKGCVMYARRDGGG  178

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G +M  WPNS+ QI  S I  P +AT C  VE+A S+HSFT+GL  ++G R 
Sbjct  179  AWMQPLIHGDRMLEWPNSATQIWVSPIVDPALATVCEPVERANSNHSFTSGLAETVGLRT  238

Query  522  QQLRVYSSMKYAAIARG  572
            Q +RV+S +KYAAIARG
Sbjct  239  QPMRVHSMVKYAAIARG  255



>ref|XP_002317523.1| PAP-specific phosphatase HAL2-like family protein [Populus trichocarpa]
 gb|EEE98135.1| PAP-specific phosphatase HAL2-like family protein [Populus trichocarpa]
Length=380

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 133/197 (68%), Gaps = 12/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P EAL   +I+E I+ C    G N   R W L       G +RGDQYAVAL+
Sbjct  107  APKYGLQSPKEALGTSQILEAISRCNSTGGRNG--RHWVLDPVDGTLGFVRGDQYAVALA  164

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  V+GVLGCPNYP KKEWL++   YQ   S    +  S+  +KGCV+YA+RG G 
Sbjct  165  LIEEGKVVIGVLGCPNYPRKKEWLNHHQSYQ---SMPKMSDTSDTWEKGCVLYAQRGSGE  221

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G K   W NS+++++ S+I+ P +ATFC  VEKA ++HSFTAG+  S+G   
Sbjct  222  AWMQPLIHGNKKHTWSNSAQRVQVSAIDDPALATFCEPVEKANTNHSFTAGVAHSMGLNK  281

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRV+S +KYAAIARG
Sbjct  282  QPLRVHSMVKYAAIARG  298



>ref|XP_007159267.1| hypothetical protein PHAVU_002G2236000g, partial [Phaseolus vulgaris]
 gb|ESW31261.1| hypothetical protein PHAVU_002G2236000g, partial [Phaseolus vulgaris]
Length=329

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 135/197 (69%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFG+  P  AL   E++E I+  +  +  + + RFWAL       GS  GDQYAV LS
Sbjct  54   APRFGVEEPESALGTSEVLEIIS--RSNSVGSPSGRFWALSPLDGKMGSACGDQYAVGLS  111

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP++KEW SY   YQR++S LT   ASE  +KGC++YA+RG   
Sbjct  112  LIEDGEVVLGVLGCPNYPMRKEWFSYHLSYQRMISMLT-PPASETWNKGCIIYAKRGSRK  170

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AW+QPLL   K + WPN +KQ+  SS+++  +ATFC  +EKA SSH+FT GL  S+G  N
Sbjct  171  AWIQPLLHVNKKYVWPNQAKQVSVSSVDNLGLATFCQPIEKANSSHTFTEGLAQSVGLSN  230

Query  522  QQLRVYSSMKYAAIARG  572
            + LRVY+ M+YAAIA G
Sbjct  231  EPLRVYNMMRYAAIACG  247



>gb|KDP38930.1| hypothetical protein JCGZ_00687 [Jatropha curcas]
Length=383

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 137/198 (69%), Gaps = 11/198 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A ++G   P EAL G +I+E I+ C    G     R W L       G +RGDQYA+AL+
Sbjct  107  ASKYGFQSPKEALGGAQILEAISRCNSTGGPTG--RHWVLDPVDGTLGFVRGDQYAIALA  164

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQY-GYQRILSRLTSAAASEPRDKGCVMYARRGDG  338
            LIE+G  V+GVLGCPNYP+KKE L++ +  Y + +S+L S   S   +KGCVMYA+ G G
Sbjct  165  LIEEGNVVIGVLGCPNYPMKKELLNHHHHKYSQSMSKL-SDPTSHTWEKGCVMYAQSGSG  223

Query  339  NAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHR  518
             AWMQPL+ G K F WPNS+++I+ SSI+ P +ATFC  VEKA S+H+FTAG+  S+G +
Sbjct  224  EAWMQPLIHGNKKFEWPNSAEKIQVSSIDDPELATFCEPVEKANSNHAFTAGVAYSMGVK  283

Query  519  NQQLRVYSSMKYAAIARG  572
            NQ LRV+S +KYAAIARG
Sbjct  284  NQPLRVHSMVKYAAIARG  301



>ref|XP_006464699.1| PREDICTED: PAP-specific phosphatase HAL2-like isoform X1 [Citrus 
sinensis]
 gb|KDO74174.1| hypothetical protein CISIN_1g016861mg [Citrus sinensis]
Length=381

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 132/197 (67%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP+FGL  P  AL   +I+E I+ C    G   A R+W L       G +RGDQYAVAL+
Sbjct  106  APKFGLQSPPGALGTSQILEAISRCSSNGGP--AGRYWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYPLKKE L+Y   Y +  S+ TS + +   +KGCVMYARR  G 
Sbjct  164  LIEDGKVVLGVLGCPNYPLKKELLNYPQNYNQTKSK-TSLSTTATWEKGCVMYARRDGGG  222

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G +M  WPNS+ QI  S I  P +AT C  VE+A S+HSFT+GL  ++G R 
Sbjct  223  AWMQPLIHGDRMLEWPNSATQIWVSPIVDPALATVCEPVERANSNHSFTSGLAETVGLRT  282

Query  522  QQLRVYSSMKYAAIARG  572
            Q +RV+S +KYAAIARG
Sbjct  283  QPMRVHSMVKYAAIARG  299



>ref|XP_008778819.1| PREDICTED: PAP-specific phosphatase HAL2-like [Phoenix dactylifera]
Length=456

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 130/197 (66%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP FGL GP  AL  +E++E I+ C    G     RFW L       G +RGDQYAVAL+
Sbjct  181  APTFGLKGPERALGTKEVLEAISRCNSNGGPKG--RFWVLDPVDGTLGFVRGDQYAVALA  238

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG   +GVLGCPNYP+ K WL+Y   Y R++S+L S   S    KGCVMYA++G G 
Sbjct  239  LIEDGEVNLGVLGCPNYPMNKAWLNYHQHYYRLMSKL-SPPTSGCWHKGCVMYAQKGSGE  297

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+     F+W N +++I+ SS+  P  ATFC  VEK  SSHSFTAGL  S+G R 
Sbjct  298  AWMQPLIHDYGKFDWQNCARKIQVSSVSDPAFATFCEPVEKTNSSHSFTAGLAHSVGVRK  357

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  358  QPLRVYSMVKYAAIARG  374



>ref|XP_010921982.1| PREDICTED: PAP-specific phosphatase HAL2-like [Elaeis guineensis]
Length=458

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 130/197 (66%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP FGL GP +AL  +E++E I  C    G     RFW L       G +RGDQYAVAL+
Sbjct  183  APTFGLEGPEKALGTKEVLEAIIRCNSNGGPKG--RFWVLDPVDGTLGFVRGDQYAVALA  240

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  ++GVLGCPNYP+ K WL+Y   Y R++S+L S   S    KGCVMYA++G G 
Sbjct  241  LIEDGEVILGVLGCPNYPMNKAWLNYHQRYYRLMSKL-SPPTSGSWHKGCVMYAQKGSGE  299

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+     F+W N +++I+ S +  P  ATFC  VEK  SSHSFTAGL  S+G R 
Sbjct  300  AWMQPLIHDYGKFDWQNCARKIQVSFVSDPAFATFCEPVEKTNSSHSFTAGLADSVGVRK  359

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  360  QPLRVYSMVKYAAIARG  376



>ref|XP_007133063.1| hypothetical protein PHAVU_011G148400g, partial [Phaseolus vulgaris]
 gb|ESW05057.1| hypothetical protein PHAVU_011G148400g, partial [Phaseolus vulgaris]
Length=330

 Score =   201 bits (511),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 128/197 (65%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A ++GL  P   L   EI+E I  C    G     R+W L       G +RGDQYAVAL+
Sbjct  55   ASKYGLQSPETTLGSTEILEAIARCNSTGGPRG--RYWVLDPVDGTLGFVRGDQYAVALA  112

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+K EWL+Y Y + +   + +S    +   KGCV+YA+RG G 
Sbjct  113  LIEDGKVVLGVLGCPNYPVKTEWLNYHYQHHQTAPQ-SSVTTPDTGGKGCVLYAKRGSGE  171

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AW+Q L+ G KM  WPN +K I+ SSI+ P +AT C  VE+A S+HSFTAGL  S+G R 
Sbjct  172  AWLQSLIDGEKMLEWPNHAKLIRVSSIDDPALATLCEPVERANSNHSFTAGLAHSVGLRK  231

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRV+S +KYAAIARG
Sbjct  232  QPLRVHSMVKYAAIARG  248



>ref|XP_006451955.1| hypothetical protein CICLE_v10008644mg [Citrus clementina]
 gb|ESR65195.1| hypothetical protein CICLE_v10008644mg [Citrus clementina]
Length=380

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 132/197 (67%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP+FGL  P  AL   +I+E I+ C    G   A R+W L       G +RGDQYAVAL+
Sbjct  106  APKFGLQSPPGALGTSQILEAISRCSSNGGP--AGRYWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYPLKKE L+Y   Y +  S+ + + A+   +KGCVMYARR  G 
Sbjct  164  LIEDGKVVLGVLGCPNYPLKKELLNYPQNYNQTKSKTSLSTAT--WEKGCVMYARRDGGG  221

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G +M  WPNS+ QI  S I  P +AT C  VE+A S+HSFT+GL  ++G R 
Sbjct  222  AWMQPLIHGDRMLEWPNSATQIWVSPIVDPALATVCEPVERANSNHSFTSGLAETVGLRT  281

Query  522  QQLRVYSSMKYAAIARG  572
            Q +RV+S +KYAAIARG
Sbjct  282  QPMRVHSMVKYAAIARG  298



>ref|XP_006648074.1| PREDICTED: PAP-specific phosphatase HAL2-like [Oryza brachyantha]
Length=373

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 130/197 (66%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APR+GL  P + L   +I++ I  C    G     RFW L       G +RGDQYAVAL+
Sbjct  99   APRYGLRSPEKELKAHDILQAIRRCNSTGGPEG--RFWVLDPVDGTLGFVRGDQYAVALA  156

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKEWL+Y   Y R++S++ S   S    KGCVMYA RG G 
Sbjct  157  LIEDGEVVLGVLGCPNYPMKKEWLNYHQRYYRLMSKV-SPPTSGSWHKGCVMYAHRGCGQ  215

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
             WMQPL+      +W N S++++ S++  PV ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  216  TWMQPLVHDVGKLDWRN-SREVRVSTVSDPVSATFCEPVEKANSSHSFTAGLAHSVGLRK  274

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  275  QPLRVYSMVKYAAIARG  291



>gb|KHN07307.1| PAP-specific phosphatase HAL2-like [Glycine soja]
Length=388

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 132/195 (68%), Gaps = 8/195 (4%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-----GSLRGDQYAVALSLI  167
            APRFG+  P   L   E++E I+ C   +  + + RFWAL     GS  GDQ+ VALSLI
Sbjct  115  APRFGVEEPKSTLGTSEVLEIISRCN--SVGDPSGRFWALSPLDGGSSCGDQHVVALSLI  172

Query  168  EDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAW  347
            E+G  V+GVLGCPNYP++K+W SY + Y R++S+L +   S+  +KGCV+YA+RG G AW
Sbjct  173  EEGEVVLGVLGCPNYPMRKDWFSYHHSYLRMISKL-APPTSQTWNKGCVIYAKRGSGKAW  231

Query  348  MQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQ  527
            +QPLL     F WPN +KQ+  SSI++  MATFC  VEKA  SHSF  GL  S+G  NQ 
Sbjct  232  IQPLLHVNDKFVWPNHAKQVSVSSIDNLEMATFCQPVEKANLSHSFAEGLAHSVGFSNQP  291

Query  528  LRVYSSMKYAAIARG  572
            LRVY++MKY AIA G
Sbjct  292  LRVYNTMKYTAIACG  306



>ref|XP_006841753.1| hypothetical protein AMTR_s00003p00261960 [Amborella trichopoda]
 gb|ERN03428.1| hypothetical protein AMTR_s00003p00261960 [Amborella trichopoda]
Length=395

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 133/194 (69%), Gaps = 11/194 (6%)
 Frame = +3

Query  12   FGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIE  170
            FGL GP ++L   E++E I  C    G     R W L       G +RGDQYAVAL+++E
Sbjct  124  FGLKGPKKSLGSSEVLEAIGRCNSNGGPKG--RHWVLDPVDGTLGFVRGDQYAVALAMLE  181

Query  171  DGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWM  350
            +G  V+GVLGCPNYP+KKEWL+Y + Y RI+S+L+S    E   KGCVMYA+RG   AWM
Sbjct  182  EGEVVLGVLGCPNYPMKKEWLNYHHSYYRIMSKLSSPTF-ESWHKGCVMYAQRG-SEAWM  239

Query  351  QPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQL  530
            QPLL   K F++ + ++ I+ SSI+ P +ATFC  VEKA SSHSFTAGL  S+G R + L
Sbjct  240  QPLLCDNKQFSFQSLARSIRVSSIDDPALATFCEPVEKANSSHSFTAGLAHSMGLRKRPL  299

Query  531  RVYSSMKYAAIARG  572
            RVYS +KYAAIARG
Sbjct  300  RVYSMVKYAAIARG  313



>dbj|BAK02450.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86479.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=468

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 134/197 (68%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   ++++ I  C    G     RFW L       G +RGDQYA+AL+
Sbjct  194  APKYGLRSPEKDLGAHDVLQAIRKCSSTGGPKG--RFWVLDPVDGTLGFVRGDQYAIALA  251

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKEWL+Y   Y R++S++ +   S   +KGCVMYA +G G 
Sbjct  252  LIEDGEVVLGVLGCPNYPMKKEWLNYHQRYYRLMSKV-APPTSGSWNKGCVMYAHKGCGQ  310

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+    M +W NS ++++ SS+  PV ATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  311  AWMQPLVHDFGMLSWHNS-REVQVSSVSDPVSATFCEPVEKANSSHSFTAGLAHSVGLRN  369

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  370  QPLRVYSMVKYAAIARG  386



>ref|XP_010062895.1| PREDICTED: PAP-specific phosphatase HAL2-like [Eucalyptus grandis]
 ref|XP_010062896.1| PREDICTED: PAP-specific phosphatase HAL2-like [Eucalyptus grandis]
 gb|KCW70038.1| hypothetical protein EUGRSUZ_F03343 [Eucalyptus grandis]
Length=378

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 129/197 (65%), Gaps = 13/197 (7%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP FGL  P + L  +E++E I  C  A G     R+W L       G +RG+QYAVAL+
Sbjct  106  APNFGLHKPDKHLTTQEVLEAIKRCNSAGGPKG--RYWVLDPVDGTLGFVRGNQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  ++GVLGCPNYP+KKEWL+Y + Y +     TSAA  +  +KGC+MYARRG G 
Sbjct  164  LIEDGEVIIGVLGCPNYPMKKEWLNYHHHYYQ----STSAATDDSWEKGCLMYARRGSGK  219

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL G         ++ I+ SS++ P  ATFC  VEKA S+ SFTAGL  S+G R 
Sbjct  220  AWMQPLLHGDVNIESQYEARLIRVSSVDDPAQATFCEPVEKANSNQSFTAGLAHSVGFRK  279

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  280  QPLRVYSMVKYAAIARG  296



>gb|EAZ25001.1| hypothetical protein OsJ_08781 [Oryza sativa Japonica Group]
Length=340

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 131/197 (66%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   +I++ I  C    G     RFW L       G +RGDQYAVAL+
Sbjct  66   APKYGLRSPEKELKAHDILQAIRRCSSIGGPKG--RFWVLDPVDGTLGFVRGDQYAVALA  123

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKEWL+Y   Y R++S++ S   S    KGCVMYA RG G 
Sbjct  124  LIEDGEVVLGVLGCPNYPMKKEWLNYHQRYYRLMSKV-SPPTSGSWHKGCVMYAHRGCGQ  182

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+      +W N S++++ S++  P+ ATFC  VEKA +SHSFTAGL  S+G R 
Sbjct  183  AWMQPLVHDFGKLDWRN-SREVRVSTVSDPISATFCEPVEKANTSHSFTAGLAHSVGLRK  241

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  242  QPLRVYSMVKYAAIARG  258



>ref|XP_010268789.1| PREDICTED: PAP-specific phosphatase HAL2-like [Nelumbo nucifera]
Length=460

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 136/197 (69%), Gaps = 14/197 (7%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL GP  AL   E++E I+ C    G     R+W L       G +RGDQYAVAL+
Sbjct  189  APKYGLIGPTRALGTSEVLEAISRCNSTGGPTG--RYWVLDPVDGTLGFVRGDQYAVALA  246

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  VVGVLGCPNYP+KKEWL+Y + Y RI+S+  S+ +SE  DKGCV+YA+RG G 
Sbjct  247  LIEDGEVVVGVLGCPNYPMKKEWLNYHHRYYRIMSK-LSSPSSESWDKGCVIYAKRGSGE  305

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
             WMQPL+   +      ++K I  SSI+ P +ATFC  VE+A SSHSFTAGL  S+G RN
Sbjct  306  TWMQPLVQENQRL----TAKPICVSSIDDPALATFCEPVERANSSHSFTAGLAHSVGLRN  361

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  362  QPLRVYSMVKYAAIARG  378



>ref|XP_003542776.2| PREDICTED: PAP-specific phosphatase HAL2-like [Glycine max]
Length=452

 Score =   202 bits (515),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 129/196 (66%), Gaps = 11/196 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL------GSLRGDQYAVALSL  164
             PRFG   P  AL   E++E I+ C        + RFW L      GS  GDQ+ VALSL
Sbjct  180  VPRFGFEEPKSALGTSEVLEIISRC----NGGPSGRFWTLSPLDGGGSSCGDQHVVALSL  235

Query  165  IEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNA  344
            IEDG  VVGVLGCPNYP++K+W SY + Y R++S+LT    S+  +KGC++YA+RG G A
Sbjct  236  IEDGEVVVGVLGCPNYPMRKDWFSYDHSYLRMISKLT-PPTSQTWNKGCIIYAKRGSGKA  294

Query  345  WMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQ  524
            W+QPLL       WPN +KQ+  SSI++  MATFC  VEKA SSHSFT GL  S+G  NQ
Sbjct  295  WIQPLLHVNNKSVWPNHAKQVSVSSIDNLAMATFCQPVEKANSSHSFTEGLAHSVGLSNQ  354

Query  525  QLRVYSSMKYAAIARG  572
             +RVY+ MKYAAIA G
Sbjct  355  PVRVYNMMKYAAIACG  370



>dbj|BAD19426.1| putative 3'(2'),5'-bisphosphate nucleotidase [Oryza sativa Japonica 
Group]
Length=375

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 131/197 (66%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   +I++ I  C    G     RFW L       G +RGDQYAVAL+
Sbjct  101  APKYGLRSPEKELKAHDILQAIRRCSSIGGPKG--RFWVLDPVDGTLGFVRGDQYAVALA  158

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKEWL+Y   Y R++S++ S   S    KGCVMYA RG G 
Sbjct  159  LIEDGEVVLGVLGCPNYPMKKEWLNYHQRYYRLMSKV-SPPTSGSWHKGCVMYAHRGCGQ  217

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+      +W N S++++ S++  P+ ATFC  VEKA +SHSFTAGL  S+G R 
Sbjct  218  AWMQPLVHDFGKLDWRN-SREVRVSTVSDPISATFCEPVEKANTSHSFTAGLAHSVGLRK  276

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  277  QPLRVYSMVKYAAIARG  293



>gb|EAY85312.1| hypothetical protein OsI_06689 [Oryza sativa Indica Group]
Length=375

 Score =   199 bits (507),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 131/197 (66%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   +I++ I  C    G     RFW L       G +RGDQYAVAL+
Sbjct  101  APKYGLRFPEKELKAHDILQAIRRCSSIGGPKG--RFWVLDPVDGTLGFVRGDQYAVALA  158

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKEWL+Y   Y R++S++ S   S    KGCVMYA RG G 
Sbjct  159  LIEDGEVVLGVLGCPNYPMKKEWLNYHQRYYRLMSKV-SPPTSGSWHKGCVMYAHRGCGQ  217

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+      +W N S++++ S++  P+ ATFC  VEKA +SHSFTAGL  S+G R 
Sbjct  218  AWMQPLVHDFGKLDWRN-SREVRVSTVSDPISATFCEPVEKANTSHSFTAGLAHSVGLRK  276

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  277  QPLRVYSMVKYAAIARG  293



>ref|XP_009411984.1| PREDICTED: PAP-specific phosphatase HAL2-like [Musa acuminata 
subsp. malaccensis]
Length=380

 Score =   200 bits (508),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 135/197 (69%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L  ++I++ IN+C  + G+    RFW L       G +RGDQYAVAL+
Sbjct  106  APKYGLKCPPKHLGAQDILDAINSCNSSGGSKG--RFWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  ++GVLGCPNYP+KKEWL+Y   Y R+++ L+  + S    KGCVMYA +G G 
Sbjct  164  LIEDGEVILGVLGCPNYPMKKEWLNYHQRYYRLMTTLSPPSGS--WHKGCVMYACKGSGE  221

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+     ++  +S++ I+ SSI  P  ATFC  VEKA SSHSFTAGL  ++G R 
Sbjct  222  AWMQPLVHDFGEYDQQSSARMIRVSSISDPAFATFCEPVEKANSSHSFTAGLAHNVGLRK  281

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRV+S +KYAAIARG
Sbjct  282  QPLRVHSMVKYAAIARG  298



>gb|KHN36344.1| PAP-specific phosphatase HAL2-like [Glycine soja]
Length=382

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 126/197 (64%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A ++G   P   L   E++E I  C    G+    R+W L       G +RGDQYAVAL+
Sbjct  107  ASKYGFQSPETTLGTSEVLEAIARCNSTGGSRG--RYWVLDPVDGTLGFVRGDQYAVALA  164

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+K EWLSY Y + +     +S    +   KGCV+YAR+G G 
Sbjct  165  LIEDGKVVLGVLGCPNYPVKTEWLSYHYQHHQTTPE-SSLTTPDTGGKGCVLYARKGSGE  223

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AW+Q L+ G  M  WPN ++ I+ SSIE P +AT C  VE+A S+HSFTAGL  S+G R 
Sbjct  224  AWLQSLIDGDNMLEWPNCARLIRVSSIEDPALATLCEPVERANSNHSFTAGLAHSVGLRK  283

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRV+S +KYAAIARG
Sbjct  284  QPLRVHSMVKYAAIARG  300



>ref|XP_006582834.1| PREDICTED: uncharacterized protein LOC100306018 isoform X1 [Glycine 
max]
Length=457

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 132/195 (68%), Gaps = 8/195 (4%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-----GSLRGDQYAVALSLI  167
            APRFG+  P   L   E++E I+ C   +  + + RFWAL     GS  GDQ+ VALSLI
Sbjct  184  APRFGVEEPKSTLGTSEVLEIISRCN--SVGDPSGRFWALSPLDGGSSCGDQHVVALSLI  241

Query  168  EDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAW  347
            E+G  V+GVLGCPNYP++K+W SY + Y R++S+L +   S+  +KGCV+YA+RG G AW
Sbjct  242  EEGEVVLGVLGCPNYPMRKDWFSYHHSYLRMISKL-APPTSQTWNKGCVIYAKRGSGKAW  300

Query  348  MQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQ  527
            +QPLL     F WPN +KQ+  SSI++  MATFC  VEKA  SHSF  GL  S+G  NQ 
Sbjct  301  IQPLLHVNDKFVWPNHAKQVSVSSIDNLEMATFCQPVEKANLSHSFAEGLAHSVGFSNQP  360

Query  528  LRVYSSMKYAAIARG  572
            LRVY++MKY AIA G
Sbjct  361  LRVYNTMKYTAIACG  375



>ref|XP_004504991.1| PREDICTED: PAP-specific phosphatase HAL2-like [Cicer arietinum]
Length=445

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 131/190 (69%), Gaps = 6/190 (3%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWALGSLRGDQYAVALSLIEDGAP  182
            AP+FG+  P   L   E++E I+ C    G   + RFWAL     DQYAV+LSLI+DG  
Sbjct  180  APQFGVEAPESPLGTSEVLEIISHCNSLGGP--SGRFWALNC---DQYAVSLSLIKDGEV  234

Query  183  VVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLL  362
            VVGVLGCPNYP++K+WLSYQ  Y RI+S+L   + +   ++GCV+ A++G G AW+QPL+
Sbjct  235  VVGVLGCPNYPMRKDWLSYQQSYHRIMSKLI-PSTNRTLNEGCVICAKKGSGKAWIQPLI  293

Query  363  PGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYS  542
               + F WPN +KQ   SSI++  +ATFC TVEKA SSHSFT GL  S+G  N+ LRVY+
Sbjct  294  HVNEKFVWPNHAKQASVSSIDNLALATFCETVEKANSSHSFTDGLAHSVGLSNKPLRVYN  353

Query  543  SMKYAAIARG  572
             +KYAAIA G
Sbjct  354  MVKYAAIACG  363



>gb|KHN10308.1| PAP-specific phosphatase HAL2-like [Glycine soja]
Length=387

 Score =   198 bits (503),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 127/196 (65%), Gaps = 11/196 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL------GSLRGDQYAVALSL  164
             PRFG   P  AL   E++E I+ C        + RFW L      GS  GDQ+ VALSL
Sbjct  115  VPRFGFEEPKSALGTSEVLEIISRCN----GGPSGRFWTLSPLDGGGSSCGDQHVVALSL  170

Query  165  IEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNA  344
            IEDG  VVGVLGCPNYP++K+W SY + Y R++S+LT    S+  +KGC++YA+RG G A
Sbjct  171  IEDGEVVVGVLGCPNYPMRKDWFSYDHSYLRMISKLT-PPTSQTWNKGCIIYAKRGSGKA  229

Query  345  WMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQ  524
            W+QPLL       WPN +KQ+  SSI++  MATFC  VEKA  SHSF  GL  S+G  NQ
Sbjct  230  WIQPLLHVNNKSVWPNHAKQVSVSSIDNLEMATFCQPVEKANLSHSFAEGLAHSVGFSNQ  289

Query  525  QLRVYSSMKYAAIARG  572
             +RVY+ MKYAAIA G
Sbjct  290  PVRVYNMMKYAAIACG  305



>ref|NP_001048441.1| Os02g0805500 [Oryza sativa Japonica Group]
 dbj|BAF10355.1| Os02g0805500, partial [Oryza sativa Japonica Group]
Length=477

 Score =   200 bits (508),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 131/197 (66%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   +I++ I  C    G     RFW L       G +RGDQYAVAL+
Sbjct  203  APKYGLRSPEKELKAHDILQAIRRCSSIGGPKG--RFWVLDPVDGTLGFVRGDQYAVALA  260

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKEWL+Y   Y R++S++ S   S    KGCVMYA RG G 
Sbjct  261  LIEDGEVVLGVLGCPNYPMKKEWLNYHQRYYRLMSKV-SPPTSGSWHKGCVMYAHRGCGQ  319

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+      +W N S++++ S++  P+ ATFC  VEKA +SHSFTAGL  S+G R 
Sbjct  320  AWMQPLVHDFGKLDWRN-SREVRVSTVSDPISATFCEPVEKANTSHSFTAGLAHSVGLRK  378

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  379  QPLRVYSMVKYAAIARG  395



>gb|AAK98703.1|AC069158_15 Putative PAP-specific phosphatase [Oryza sativa Japonica Group]
Length=463

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 131/197 (66%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   +I++ I  C    G     RFW L       G +RGDQYAVAL+
Sbjct  189  APKYGLRSPEKELKAHDILQAIRRCSSIGGPKG--RFWVLDPVDGTLGFVRGDQYAVALA  246

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKEWL+Y   Y R++S++ S   S    KGCVMYA RG G 
Sbjct  247  LIEDGEVVLGVLGCPNYPMKKEWLNYHQRYYRLMSKV-SPPTSGSWHKGCVMYAHRGCGQ  305

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+      +W N S++++ S++  P+ ATFC  VEKA +SHSFTAGL  S+G R 
Sbjct  306  AWMQPLVHDFGKLDWRN-SREVRVSTVSDPISATFCEPVEKANTSHSFTAGLAHSVGLRK  364

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  365  QPLRVYSMVKYAAIARG  381



>ref|XP_007021305.1| PAP-specific phosphatase HAL2-like [Theobroma cacao]
 gb|EOY12830.1| PAP-specific phosphatase HAL2-like [Theobroma cacao]
Length=381

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 133/197 (68%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P +AL   +I+E I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  107  APKYGLQCPKDALGTSKILEAISRCNSTGGPTG--RHWVLDPVDGTLGFVRGDQYAVALA  164

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  V+GVLGCPNYP+KKE L+Y +  QR  +   S   S+  +KGCVMYARRG G 
Sbjct  165  LIEEGKLVLGVLGCPNYPMKKELLNYNH--QRHQTMPKSLPPSDIWEKGCVMYARRGSGQ  222

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+     F WPNS++ I+ S ++ P +ATFC  VEKA S+HSFTAGL +S+G + 
Sbjct  223  AWMQPLIHRDTKFEWPNSARLIQVSPVDDPSLATFCEPVEKANSNHSFTAGLANSMGLKK  282

Query  522  QQLRVYSSMKYAAIARG  572
            + +RV+S +KYAAIARG
Sbjct  283  KPMRVHSMVKYAAIARG  299



>ref|XP_011029420.1| PREDICTED: PAP-specific phosphatase HAL2-like isoform X2 [Populus 
euphratica]
Length=319

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 135/197 (69%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P EAL   +I+E I+ C    G     R W L       G +RG+QYAVAL+
Sbjct  45   APKYGLQSPKEALGTSQILEAISRCNSTGG--RTGRHWVLDPVDGTLGFVRGEQYAVALA  102

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYP KKEWL++ +   + + +++    S+  +KGCV+YA+RG G 
Sbjct  103  LIEEGKVLIGVLGCPNYPRKKEWLNHHHQSYQSMPKISDT--SDTWEKGCVLYAQRGSGE  160

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G K   W NS+++++ S+I+ P +ATFC  VEKA ++HSF+AG+  S+G + 
Sbjct  161  AWMQPLIHGNKKHTWSNSAQRVQVSAIDDPALATFCEPVEKANTNHSFSAGVAHSMGLKK  220

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRV+S +KYAAIA+G
Sbjct  221  QPLRVHSMVKYAAIAQG  237



>ref|XP_003541114.1| PREDICTED: PAP-specific phosphatase HAL2-like [Glycine max]
 gb|KHN19957.1| PAP-specific phosphatase HAL2-like [Glycine soja]
Length=383

 Score =   196 bits (497),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 127/197 (64%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A ++GL  P   L   E++E I  C    G     R+W L       G +RGDQYAVAL+
Sbjct  108  ASKYGLQCPETTLGTPEVLEAIARCNSTGGPRG--RYWVLDPVDGTLGFVRGDQYAVALA  165

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+K EWL+Y Y + + +   +S    +   KGCV+YAR+G G 
Sbjct  166  LIEDGKVVLGVLGCPNYPVKIEWLNYHYQHHQTMPE-SSLKTPDTGGKGCVLYARKGSGE  224

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AW+Q L+ G  M  WPN ++ I+ SSI+ P +AT C  VE+A S+HSFTAGL  S+G R 
Sbjct  225  AWLQSLIDGDNMLEWPNCARLIRVSSIDDPALATLCEPVERANSNHSFTAGLAHSVGLRK  284

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRV+S +KYAAIARG
Sbjct  285  QPLRVHSMVKYAAIARG  301



>ref|XP_009385075.1| PREDICTED: PAP-specific phosphatase HAL2-like [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 136/197 (69%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL GP++ L  +EI++ I+ C  + G+    +FW L       G +RGDQYA+AL+
Sbjct  117  APKYGLEGPSKPLGAQEILDAIHNCNSSGGSKG--KFWVLDPVDGTLGFVRGDQYAIALA  174

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LI DG  V+GVLGCPNYP++KEWL+Y   Y R+++ L S  A     KGCVMYAR+G G 
Sbjct  175  LIVDGEVVLGVLGCPNYPMRKEWLNYHQRYYRLMTML-SPPAHGSWHKGCVMYARKGSGV  233

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+     F+W +SS+ I+ SSI  P  ATFC  VEKA SSHSFTAGL  S+G R 
Sbjct  234  AWMQPLVHDFAEFDWQSSSRIIRVSSITDPAFATFCEPVEKANSSHSFTAGLAHSVGLRK  293

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  294  QPLRVYSMVKYAAIARG  310



>ref|XP_002454739.1| hypothetical protein SORBIDRAFT_04g036470 [Sorghum bicolor]
 gb|EES07715.1| hypothetical protein SORBIDRAFT_04g036470 [Sorghum bicolor]
Length=447

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 130/197 (66%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP +GL  P + L   ++++ I  C    G     RFW L       G +RGDQYA+AL+
Sbjct  173  APNYGLRSPEKDLGAHDVIQAIRKCSSTGGPKG--RFWVLDPVDGTLGFVRGDQYAIALA  230

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  ++GVLGCPNYP+KKEWL+Y   Y R++S++         +KGCVMYA++G G 
Sbjct  231  LIEDGEVILGVLGCPNYPMKKEWLNYHQKYYRLMSKVAPPPLGS-WNKGCVMYAQKGCGQ  289

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+      NW +  ++I+ SSI  P+ ATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  290  AWMQPLVHDFGKLNW-HHPREIQVSSISDPISATFCEPVEKANSSHSFTAGLAQSVGLRN  348

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  349  QPLRVYSMVKYAAIARG  365



>ref|XP_006582183.1| PREDICTED: PAP-specific phosphatase HAL2-like [Glycine max]
Length=381

 Score =   196 bits (497),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 125/197 (63%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A ++G   P   L   E++E I  C    G+    R+W L       G +RGDQYA+AL+
Sbjct  106  ASKYGFQSPETTLGTSEVLEAIARCNSTGGSRG--RYWVLDPVDGTLGFVRGDQYAIALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+K EWLSY Y + +     +S    +   KGCV+YAR+G G 
Sbjct  164  LIEDGKVVLGVLGCPNYPVKTEWLSYHYQHHQTAPE-SSLTTPDTGGKGCVLYARKGSGE  222

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AW+Q L+ G  M  W N ++ I+ SSIE P +AT C  VE+A S+HSFTAGL  S+G R 
Sbjct  223  AWLQSLIDGDNMLEWSNCARLIRVSSIEDPALATLCEPVERANSNHSFTAGLAHSVGLRK  282

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRV+S +KYAAIARG
Sbjct  283  QPLRVHSMVKYAAIARG  299



>ref|XP_011029418.1| PREDICTED: PAP-specific phosphatase HAL2-like isoform X1 [Populus 
euphratica]
 ref|XP_011029419.1| PREDICTED: PAP-specific phosphatase HAL2-like isoform X1 [Populus 
euphratica]
Length=381

 Score =   195 bits (496),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 135/197 (69%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P EAL   +I+E I+ C    G     R W L       G +RG+QYAVAL+
Sbjct  107  APKYGLQSPKEALGTSQILEAISRCNSTGG--RTGRHWVLDPVDGTLGFVRGEQYAVALA  164

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYP KKEWL++ +   + + +++    S+  +KGCV+YA+RG G 
Sbjct  165  LIEEGKVLIGVLGCPNYPRKKEWLNHHHQSYQSMPKISDT--SDTWEKGCVLYAQRGSGE  222

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G K   W NS+++++ S+I+ P +ATFC  VEKA ++HSF+AG+  S+G + 
Sbjct  223  AWMQPLIHGNKKHTWSNSAQRVQVSAIDDPALATFCEPVEKANTNHSFSAGVAHSMGLKK  282

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRV+S +KYAAIA+G
Sbjct  283  QPLRVHSMVKYAAIAQG  299



>gb|ACG46228.1| PAP-specific phosphatase [Zea mays]
Length=447

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 129/197 (65%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP +GL  P + L   ++++ I  C    G     RFW L       G +RGDQYA+AL+
Sbjct  173  APNYGLRSPEKELRAHDVIQAIRKCSSTGGPKG--RFWVLDPVDGTLGFVRGDQYAIALA  230

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  ++GVLGCPNYP+KKEWL+Y   Y R++S++          KGCVMYA++G G 
Sbjct  231  LIEDGEVILGVLGCPNYPMKKEWLNYHQKYYRLMSKVAPPPLGSWH-KGCVMYAQKGCGQ  289

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+      NW +  ++I+ SSI  P+ ATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  290  AWMQPLVHDFGKLNW-HHPREIQVSSISDPISATFCEPVEKANSSHSFTAGLAQSVGLRN  348

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  349  QPLRVYSMVKYAAIARG  365



>ref|NP_001152174.1| PAP-specific phosphatase [Zea mays]
 ref|XP_008677398.1| PREDICTED: PAP-specific phosphatase isoform X1 [Zea mays]
 ref|XP_008677399.1| PREDICTED: PAP-specific phosphatase isoform X1 [Zea mays]
 ref|XP_008677400.1| PREDICTED: PAP-specific phosphatase isoform X1 [Zea mays]
 gb|ACF82388.1| unknown [Zea mays]
 gb|AFW64093.1| PAP-specific phosphatase isoform 1 [Zea mays]
 gb|AFW64094.1| PAP-specific phosphatase isoform 2 [Zea mays]
 gb|AFW64095.1| PAP-specific phosphatase isoform 3 [Zea mays]
Length=447

 Score =   196 bits (499),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 129/197 (65%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP +GL  P + L   ++++ I  C    G     RFW L       G +RGDQYA+AL+
Sbjct  173  APNYGLRSPEKELRAHDVIQAIRKCSSTGGPKG--RFWVLDPVDGTLGFVRGDQYAIALA  230

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  ++GVLGCPNYP+KKEWL+Y   Y R++S++          KGCVMYA++G G 
Sbjct  231  LIEDGEVILGVLGCPNYPMKKEWLNYHQKYYRLMSKVAPPPLGSWH-KGCVMYAQKGCGQ  289

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+      NW +  ++I+ SSI  P+ ATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  290  AWMQPLVHDFGKLNW-HHPREIQVSSISDPISATFCEPVEKANSSHSFTAGLAQSVGLRN  348

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  349  QPLRVYSMVKYAAIARG  365



>ref|XP_004955266.1| PREDICTED: PAP-specific phosphatase HAL2-like [Setaria italica]
Length=426

 Score =   196 bits (497),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 129/197 (65%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   ++++ I  C    G     RFW L       G +RGDQYA+AL+
Sbjct  152  APKYGLRPPEKELRAHDVIQAIRKCSSTGGPKG--RFWVLDPVDGTLGFVRGDQYAIALA  209

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  ++GVLGCPNYP+KKEWL+Y   Y R++S++          KGCVMYA++G G 
Sbjct  210  LIEDGEVILGVLGCPNYPMKKEWLNYHQKYYRLISKVAPPPLGSWH-KGCVMYAQKGCGQ  268

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+      +W    ++I+ SSI  PV ATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  269  AWMQPLVHDFGKLDW-RHPREIQVSSISDPVSATFCEPVEKANSSHSFTAGLAQSVGLRN  327

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  328  QPLRVYSMVKYAAIARG  344



>gb|KEH19580.1| 3'(2'),5'-bisphosphate nucleotidase [Medicago truncatula]
Length=378

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 128/197 (65%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A  +GL  P   L   E++  I  C    GA+   R W L       G +RGDQYAVAL+
Sbjct  103  ASMYGLQSPDITLGTSEVLAAIGRCSSTGGASG--RHWVLDPVDGTLGFVRGDQYAVALA  160

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+K EWL+YQY Y R  +   ++   +   KGCV+YA+RG G 
Sbjct  161  LIEDGKVVLGVLGCPNYPVKTEWLNYQYQY-RQTTISQTSTTLDACGKGCVLYAKRGSGE  219

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AW+Q L+P  ++  WPN ++ I+ SS++ P +AT C  VE+A S+HSFTAGL  S+G R 
Sbjct  220  AWLQSLIPEDRLLEWPNCARPIRVSSVDDPALATLCEPVERANSNHSFTAGLAHSVGLRK  279

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRV+S +KYAAIARG
Sbjct  280  QPLRVHSMVKYAAIARG  296



>ref|XP_004515397.1| PREDICTED: PAP-specific phosphatase HAL2-like [Cicer arietinum]
Length=378

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 125/197 (63%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A  +GL  P   L   E++E I  C    G +   R W L       G +RGDQYAVAL+
Sbjct  103  ASVYGLQIPEATLGTSEVLEAIGRCNSTGGLSG--RHWVLDPVDGTLGFVRGDQYAVALA  160

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+K EWL+Y Y Y +  ++L S    +   KGCV+YA+RG G 
Sbjct  161  LIEDGKVVLGVLGCPNYPVKTEWLNYHYQYHQTTTQL-SPTTPDAWGKGCVLYAKRGSGE  219

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AW+Q L+P      WPN ++ I+ SS+  P +AT C  VE+A S+HSFTAGL  S+G R 
Sbjct  220  AWLQSLIPENTTLEWPNCARLIRVSSVNDPALATLCEPVERANSNHSFTAGLAHSVGLRK  279

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRV+S +KYAAIARG
Sbjct  280  QPLRVHSMVKYAAIARG  296



>ref|XP_002534510.1| diphosphonucleoside phosphohydrolase, putative [Ricinus communis]
 gb|EEF27873.1| diphosphonucleoside phosphohydrolase, putative [Ricinus communis]
Length=385

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 133/197 (68%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A ++GL  P EAL G +I+E I+ C    G     R W L       G +RGDQYA+AL+
Sbjct  110  ASKYGLQSPTEALGGAQILEAISRCNSTGGP--IGRHWVLDPVDGTLGFVRGDQYAIALA  167

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  V+GVLGCPNYP++KE L++ +   + +S+ +    S+   KGCV+YA+RG G 
Sbjct  168  LIENGKVVIGVLGCPNYPMRKELLNHFHQCYQSISK-SPLPTSDTGQKGCVIYAQRGSGE  226

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G   F WPNS+ +IK SSI+ P +ATFC  VEK+ S+H F+AG+  S+G + 
Sbjct  227  AWMQPLIHGNNKFQWPNSANRIKVSSIDDPELATFCEPVEKSNSNHIFSAGVAHSMGLKK  286

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRV+S +KYAAIARG
Sbjct  287  QPLRVHSMVKYAAIARG  303



>ref|XP_010278344.1| PREDICTED: PAP-specific phosphatase HAL2-like isoform X2 [Nelumbo 
nucifera]
Length=316

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 138/197 (70%), Gaps = 14/197 (7%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP FGL GP  +L   E++E I+ C    G     R+W L       G +RGDQYAVAL+
Sbjct  45   APMFGLRGPVRSLGTSEVLEAISRCNSTGGPTG--RYWVLDPVDGTLGFVRGDQYAVALA  102

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  VVGV+GCPNYP+KKEWL+YQ+ Y RI+S+L+S+A+    DKGCVMYA+RG   
Sbjct  103  LIEDGEVVVGVVGCPNYPMKKEWLNYQHRYYRIVSKLSSSASES-WDKGCVMYAKRGSRK  161

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+   K      +S+ I+ SSI+ P +ATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  162  AWMQPLIYENK----KPTSRIIRVSSIDDPALATFCEPVEKANSSHSFTAGLAHSVGLRN  217

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  218  QPLRVYSMVKYAAIARG  234



>ref|XP_008454658.1| PREDICTED: PAP-specific phosphatase HAL2-like [Cucumis melo]
Length=380

 Score =   192 bits (489),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 126/197 (64%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  PA  L   EI+E I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  APKYGLQSPARELGTWEILEAISRCNSTGGPTG--RHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYPLKKE   + Y Y+    +L     S+  +KGCV+YA++    
Sbjct  164  LIENGKVILGVLGCPNYPLKKE--CFHYHYKVSTPKLLLQPCSDTLEKGCVIYAKKSCNG  221

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G K   WPNS+  I+ SSI+ P  ATFC  VEK  S+HSFTAGL  S+G R 
Sbjct  222  AWMQPLVHGDKKLEWPNSASLIQVSSIDDPAHATFCEPVEKRNSNHSFTAGLAHSVGLRK  281

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  282  QPLRVYSMVKYAAIARG  298



>gb|KGN59889.1| hypothetical protein Csa_3G851890 [Cucumis sativus]
Length=347

 Score =   191 bits (486),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 125/197 (63%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  PA  L   EI+E I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  73   APKYGLQSPARELGTSEILEAISRCNSTGGPTG--RHWVLDPVDGTLGFVRGDQYAVALA  130

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYPLKKE   + Y Y+    +L     S+  +KGCV+YA++    
Sbjct  131  LIENGEVILGVLGCPNYPLKKE--CFHYHYKVSTPKLLLQPCSDTLEKGCVIYAKKSCNG  188

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G K   WPNS+  I+ SSI+ P  A FC  VEK  S+HSFTAGL  S+G R 
Sbjct  189  AWMQPLVHGDKKLEWPNSASLIQVSSIDDPAHAIFCEPVEKRNSNHSFTAGLAHSVGLRK  248

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  249  QPLRVYSMVKYAAIARG  265



>ref|XP_004154816.1| PREDICTED: PAP-specific phosphatase HAL2-like [Cucumis sativus]
Length=380

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 125/197 (63%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  PA  L   EI+E I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  APKYGLQSPARELGTSEILEAISRCNSTGGPTG--RHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYPLKKE   + Y Y+    +L     S+  +KGCV+YA++    
Sbjct  164  LIENGEVILGVLGCPNYPLKKE--CFHYHYKVSTPKLLLQPCSDTLEKGCVIYAKKSCNG  221

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G K   WPNS+  I+ SSI+ P  A FC  VEK  S+HSFTAGL  S+G R 
Sbjct  222  AWMQPLVHGDKKLEWPNSASLIQVSSIDDPAHAIFCEPVEKRNSNHSFTAGLAHSVGLRK  281

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  282  QPLRVYSMVKYAAIARG  298



>ref|XP_004150105.1| PREDICTED: PAP-specific phosphatase HAL2-like [Cucumis sativus]
Length=380

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 125/197 (63%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  PA  L   EI+E I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  APKYGLQSPARELGTSEILEAISRCNSTGGPTG--RHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYPLKKE   + Y Y+    +L     S+  +KGCV+YA++    
Sbjct  164  LIENGEVILGVLGCPNYPLKKE--CFHYHYKVSTPKLLLQPCSDTLEKGCVIYAKKSCNG  221

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G K   WPNS+  I+ SSI+ P  A FC  VEK  S+HSFTAGL  S+G R 
Sbjct  222  AWMQPLVHGDKKLEWPNSASLIQVSSIDDPAHAIFCEPVEKRNSNHSFTAGLAHSVGLRK  281

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  282  QPLRVYSMVKYAAIARG  298



>ref|XP_010278343.1| PREDICTED: PAP-specific phosphatase HAL2-like isoform X1 [Nelumbo 
nucifera]
Length=454

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 138/197 (70%), Gaps = 14/197 (7%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP FGL GP  +L   E++E I+ C    G     R+W L       G +RGDQYAVAL+
Sbjct  183  APMFGLRGPVRSLGTSEVLEAISRCNSTGGPTG--RYWVLDPVDGTLGFVRGDQYAVALA  240

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  VVGV+GCPNYP+KKEWL+YQ+ Y RI+S+  S++ASE  DKGCVMYA+RG   
Sbjct  241  LIEDGEVVVGVVGCPNYPMKKEWLNYQHRYYRIVSK-LSSSASESWDKGCVMYAKRGSRK  299

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+   K      +S+ I+ SSI+ P +ATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  300  AWMQPLIYENK----KPTSRIIRVSSIDDPALATFCEPVEKANSSHSFTAGLAHSVGLRN  355

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  356  QPLRVYSMVKYAAIARG  372



>ref|XP_011095245.1| PREDICTED: PAP-specific phosphatase HAL2-like [Sesamum indicum]
 ref|XP_011095246.1| PREDICTED: PAP-specific phosphatase HAL2-like [Sesamum indicum]
Length=376

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 126/197 (64%), Gaps = 15/197 (8%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL GP + L   +I+E I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  APRFGLQGPEKTLDASQILEAISKCSSTGG--RLGRHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            +I+DG  V+GVLGCPNYP+K + L+       ++SR++S       + GCVMY  +G   
Sbjct  164  MIDDGEVVIGVLGCPNYPVKDDGLNKYSQQNVVMSRISSG------EVGCVMYTSKGSRK  217

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+   K F WPNS+K I+ SSI+ P +AT C  VEK+ S HSF AG+ +++G R 
Sbjct  218  AWMQPLIRSDKRFEWPNSAKLIQVSSIDDPALATLCEPVEKSNSDHSFAAGVANTVGLRK  277

Query  522  QQLRVYSSMKYAAIARG  572
            + LRVYS +KYAAIARG
Sbjct  278  KPLRVYSMVKYAAIARG  294



>ref|XP_010539644.1| PREDICTED: PAP-specific phosphatase HAL2-like [Tarenaya hassleriana]
 ref|XP_010539645.1| PREDICTED: PAP-specific phosphatase HAL2-like [Tarenaya hassleriana]
Length=379

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 130/197 (66%), Gaps = 12/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   EI+E I  C    G     R W L       G +RGDQYAVAL+
Sbjct  106  APKYGLPKPDKPLGPSEILEAIGRCNSTGGPGG--RHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP KKE L+   G ++I+S++   + S+   KGCVMYA+RG G 
Sbjct  164  LIEDGKVVLGVLGCPNYPTKKECLTN--GCRQIMSKM-PGSVSDGSQKGCVMYAKRGSGQ  220

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL GG+   +PNS + +K SS++ P +AT C  VE+A ++H FTAGL  S+G + 
Sbjct  221  AWMQPLLGGGQELRFPNSGRLLKVSSVDDPTLATVCEPVERANTNHLFTAGLTDSMGVKK  280

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIA G
Sbjct  281  QPLRVYSMVKYAAIACG  297



>ref|XP_010537001.1| PREDICTED: PAP-specific phosphatase HAL2-like [Tarenaya hassleriana]
Length=379

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 127/197 (64%), Gaps = 12/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APR+GL  P + L   EI+E I  C    G     R W L       G +RGDQYAVAL+
Sbjct  106  APRYGLPKPDKPLGPTEILEAIGRCNSTGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP KKE LS   G  +I+S+L     S+   KGCVMYA+RG G 
Sbjct  164  LIEDGKIVLGVLGCPNYPTKKECLSN--GCHQIMSKL-PGPVSDRSQKGCVMYAKRGSGQ  220

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AW QPLL G +   +PNS+  +K SS++ P +AT C  VE+A S+H FTAGL +S+G + 
Sbjct  221  AWTQPLLGGDQELVFPNSASLLKVSSVDDPTLATVCEPVERANSNHIFTAGLTNSMGVKK  280

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIA G
Sbjct  281  QPLRVYSMVKYAAIAHG  297



>ref|XP_010089382.1| PAP-specific phosphatase HAL2-like protein [Morus notabilis]
 gb|EXB37726.1| PAP-specific phosphatase HAL2-like protein [Morus notabilis]
Length=382

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 123/197 (62%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  PA+AL   +++E I  C    G     R W L       G +RGDQYAVAL+
Sbjct  107  APKYGLKPPAKALETSQVLEAIGRCNSTGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  164

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V GVLGCPNYP+KKE L+Y Y   + + +  S  A     KGCVMYA +G G 
Sbjct  165  LIEDGKVVTGVLGCPNYPMKKELLNYHYQPHQSMLKF-SPPAMNSWGKGCVMYAVKGSGE  223

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQ L  G     WPNS+  I+ SSI+ P +AT C  VEK  S+HSFT GL  S+G R 
Sbjct  224  AWMQSLTHGANKLEWPNSAMLIRVSSIDDPALATSCEPVEKTNSNHSFTQGLAHSVGLRK  283

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRV+S +KYAAIARG
Sbjct  284  QPLRVHSMVKYAAIARG  300



>ref|XP_009795942.1| PREDICTED: PAP-specific phosphatase HAL2-like [Nicotiana sylvestris]
Length=382

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 130/197 (66%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A ++GL  P EAL   E++E I+ C  + G     R W L       G +RG QYAVAL+
Sbjct  108  ASKYGLKNPEEALGPLEVLEAISRCNSSGGP--LGRHWVLDPVDGTLGFVRGGQYAVALA  165

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LI++G  V+GVLGCPNY +K++ LS Q   Q  ++   S  +S+  + GCVMY R+G G 
Sbjct  166  LIDNGEVVMGVLGCPNYHVKRDRLSNQK--QNHIASDISMHSSDVLEVGCVMYTRKGTGE  223

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AW+QPL+ G + F WPN +KQI  SSI+   +ATFC  VE+A S+HS+TAGL  S+G RN
Sbjct  224  AWVQPLVYGDRKFEWPNFAKQIHVSSIDDAALATFCEPVERANSNHSYTAGLACSVGLRN  283

Query  522  QQLRVYSSMKYAAIARG  572
            + LRVYS +KYAAIA+G
Sbjct  284  KPLRVYSMVKYAAIAQG  300



>ref|XP_010482847.1| PREDICTED: PAP-specific phosphatase HAL2-like [Camelina sativa]
 ref|XP_010482848.1| PREDICTED: PAP-specific phosphatase HAL2-like [Camelina sativa]
Length=373

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 130/197 (66%), Gaps = 18/197 (9%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   EI++ I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  APKYGLPKPVKPLGSSEILKAISRCNSVGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYP+KKE LS   G Q + ++  + + S    KGCVMYA++G G 
Sbjct  164  LIENGKVLLGVLGCPNYPVKKECLS-NGGNQAMKTKAVAGSVS----KGCVMYAKKGSGQ  218

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ GG    +P S+  +K SS++ PV+AT C  VE+A S+H FTAGL +S+G R 
Sbjct  219  AWMQPLIAGG----FPESATLLKVSSVDDPVLATVCEPVERANSNHLFTAGLANSMGVRK  274

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  275  QPLRVYSMVKYAAIARG  291



>ref|XP_010446867.1| PREDICTED: PAP-specific phosphatase HAL2-like [Camelina sativa]
Length=373

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 130/197 (66%), Gaps = 18/197 (9%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   EI++ I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  APKYGLPKPVKPLGSSEILKAISRCNSVGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYP+KKE LS   G Q + ++  + + S    KGCVMYA++G G 
Sbjct  164  LIENGKVLLGVLGCPNYPVKKECLS-NGGNQAMKTKAVAGSVS----KGCVMYAKKGSGQ  218

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ GG    +P S+  +K SS++ PV+AT C  VE+A S+H FTAGL +S+G R 
Sbjct  219  AWMQPLIAGG----FPESATLLKVSSVDDPVLATVCEPVERANSNHLFTAGLANSMGVRK  274

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  275  QPLRVYSMVKYAAIARG  291



>emb|CBI20356.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 119/197 (60%), Gaps = 31/197 (16%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFW-------ALGSLRGDQYAVALS  161
            AP+FGL  P +AL   ++++ I+ C    G     R W        LG +RGDQYAVAL+
Sbjct  106  APKFGLKCPDKALRTSQVLDAISRCNSTGGPKG--RHWILDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+ KEWL+Y   +                      Y   G G 
Sbjct  164  LIEDGKVVIGVLGCPNYPMNKEWLNYHNKF----------------------YQAIGSGE  201

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQP++ G +   WPNS++ IK SSI++P MATFC  VEKA S+HSFT GL  S+G R 
Sbjct  202  AWMQPMVLGDQKLEWPNSARLIKVSSIDNPAMATFCEPVEKANSNHSFTKGLVHSVGLRK  261

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  262  QPLRVYSMVKYAAIARG  278



>ref|XP_008677401.1| PREDICTED: PAP-specific phosphatase isoform X2 [Zea mays]
Length=362

 Score =   181 bits (460),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 120/187 (64%), Gaps = 11/187 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP +GL  P + L   ++++ I  C    G     RFW L       G +RGDQYA+AL+
Sbjct  173  APNYGLRSPEKELRAHDVIQAIRKCSSTGGPKG--RFWVLDPVDGTLGFVRGDQYAIALA  230

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  ++GVLGCPNYP+KKEWL+Y   Y R++S++          KGCVMYA++G G 
Sbjct  231  LIEDGEVILGVLGCPNYPMKKEWLNYHQKYYRLMSKVAPPPLGS-WHKGCVMYAQKGCGQ  289

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+      NW +  ++I+ SSI  P+ ATFC  VEKA SSHSFTAGL  S+G RN
Sbjct  290  AWMQPLVHDFGKLNW-HHPREIQVSSISDPISATFCEPVEKANSSHSFTAGLAQSVGLRN  348

Query  522  QQLRVYS  542
            Q LRVYS
Sbjct  349  QPLRVYS  355



>ref|XP_010443016.1| PREDICTED: PAP-specific phosphatase HAL2-like [Camelina sativa]
Length=373

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 130/197 (66%), Gaps = 18/197 (9%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   +I++ I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  APKYGLPKPVKPLGSSDILKAISRCNSVGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYP+KKE LS   G Q + ++  + + S    KGCVMYA++G G 
Sbjct  164  LIENGKVLLGVLGCPNYPVKKECLS-NGGNQAMKTKAVAGSVS----KGCVMYAKKGSGQ  218

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ GG    +P S+  +K SS++ PV+AT C  VE+A S+H FTAGL +S+G R 
Sbjct  219  AWMQPLIAGG----FPESATLLKVSSVDDPVLATVCEPVERANSNHLFTAGLANSMGVRK  274

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  275  QPLRVYSMVKYAAIARG  291



>ref|XP_009629215.1| PREDICTED: PAP-specific phosphatase HAL2-like [Nicotiana tomentosiformis]
 ref|XP_009629216.1| PREDICTED: PAP-specific phosphatase HAL2-like [Nicotiana tomentosiformis]
 ref|XP_009629217.1| PREDICTED: PAP-specific phosphatase HAL2-like [Nicotiana tomentosiformis]
Length=382

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 129/197 (65%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A ++GL  P EAL   E++  I+ C  + G     R W L       G +RG QYAVAL+
Sbjct  108  ASKYGLKSPDEALGPSEVLGAISRCSSSGGP--VGRHWVLDPVDGTLGFVRGGQYAVALA  165

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LI++G  V+GVLGCPNY +K++ L+ Q   Q  ++   S  +S+  + GCVMY R+G G 
Sbjct  166  LIDNGEVVMGVLGCPNYHVKRDRLNNQK--QNHIASDISMHSSDVLEVGCVMYTRKGTGE  223

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AW+QPL+ G + F WPN +KQI  SSI+   +ATFC  VE+A S+HSFTAGL  S+G RN
Sbjct  224  AWVQPLVYGDRKFEWPNFAKQIHVSSIDDAALATFCEPVERANSNHSFTAGLACSVGLRN  283

Query  522  QQLRVYSSMKYAAIARG  572
            + LRVYS +KYAAIA+G
Sbjct  284  KPLRVYSMVKYAAIAQG  300



>emb|CDP05868.1| unnamed protein product [Coffea canephora]
Length=382

 Score =   179 bits (455),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 122/197 (62%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP FGL  PA+AL   +++E I  C  A G     + W L       G LRG QYA+AL+
Sbjct  107  APSFGLKSPAQALGPSQVLEAIGRCNAAGGP--LGKHWVLDPIDGTLGFLRGSQYAIALA  164

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LI+    V+GVLGCPNYP K+ WL         +  L S       ++GC++Y RRG   
Sbjct  165  LIDKSEVVIGVLGCPNYPAKRNWLVKHEQQSHAVPDL-SVTNPGIWEEGCILYTRRGSSE  223

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G K   WPNS++ ++ SSI+ P +ATFC  VE+A S+HSFTAGL  ++G R 
Sbjct  224  AWMQPLVQGDKKLVWPNSARLVRVSSIQDPALATFCEPVEEANSNHSFTAGLAQAVGLRK  283

Query  522  QQLRVYSSMKYAAIARG  572
            + LRV+S +KYAAIARG
Sbjct  284  KPLRVHSMVKYAAIARG  300



>gb|EYU33413.1| hypothetical protein MIMGU_mgv1a009035mg [Erythranthe guttata]
Length=355

 Score =   178 bits (452),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 126/197 (64%), Gaps = 18/197 (9%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A RFGL GP + L   +I+E I+ C    G     + W L       G +RGDQYAVAL+
Sbjct  88   ASRFGLQGPEKPLSPSQILEAISQCSSRGGL--LGQHWVLDPVDGTLGFVRGDQYAVALA  145

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LI+DG  V+GVLGCPNY +K   L+ +Y  +   +R+TS       + GCVMY R+G G 
Sbjct  146  LIDDGEVVLGVLGCPNYSVKDNGLN-KYSRE---NRVTSNG-----EVGCVMYTRKGSGK  196

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+   K  +WPNS+K I+ SS++ P +ATFC  VEK+ S HSF AG+ S+ G R 
Sbjct  197  AWMQPLIRFDKRLDWPNSAKLIRVSSVDDPALATFCEPVEKSNSDHSFAAGVASTAGLRK  256

Query  522  QQLRVYSSMKYAAIARG  572
            + LRVYS +KYAAIARG
Sbjct  257  KPLRVYSMVKYAAIARG  273



>emb|CBI18595.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   176 bits (447),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 115/197 (58%), Gaps = 44/197 (22%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL GP   L  +E++E I+ C    G     RFW L       G +RGDQYA+AL+
Sbjct  117  APRFGLIGPEMVLGTKEVLEAISRCNSEGG--QTGRFWVLDPVDGTLGFVRGDQYAIALA  174

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  V+GVLGCPNYP+KKE                           C        G 
Sbjct  175  LIEDGEVVLGVLGCPNYPMKKE---------------------------C--------GK  199

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL G K   WPNS++ ++ SSI++P +ATFC  VEKA SSHSFT GL  S+G R 
Sbjct  200  AWMQPLLNGNKKLEWPNSARPVQVSSIDNPALATFCEPVEKANSSHSFTTGLAHSVGLRK  259

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS +KYAAIARG
Sbjct  260  QPLRVYSMVKYAAIARG  276



>ref|XP_006349983.1| PREDICTED: PAP-specific phosphatase HAL2-like [Solanum tuberosum]
Length=382

 Score =   177 bits (448),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 126/197 (64%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A R+GL GP + L   EI+E I+ C    G     R W L       G +RG QYAVAL+
Sbjct  108  ASRYGLKGPDKTLGPSEILEAISRCNSNGGPRG--RHWVLDPVDGTLGFVRGGQYAVALA  165

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LI++   VVGVLGCPNY +K++  + Q   Q  +S   S  + +  ++GCVMY+++G G 
Sbjct  166  LIDNAEVVVGVLGCPNYHMKRDRHNKQQ--QNHISSEVSVPSPDMLEEGCVMYSKKGTGE  223

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AW+QP + G   + WPN +KQ++ S I+ P +ATFC  VE+  S+HSF AGL SS+G RN
Sbjct  224  AWVQPTVSGDSQYEWPNFAKQVRVSPIDDPALATFCEPVERDNSNHSFAAGLASSVGLRN  283

Query  522  QQLRVYSSMKYAAIARG  572
            + LRVYS +KYAAIA+G
Sbjct  284  KPLRVYSMVKYAAIAQG  300



>gb|EPS62069.1| hypothetical protein M569_12723, partial [Genlisea aurea]
Length=374

 Score =   176 bits (446),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 124/197 (63%), Gaps = 15/197 (8%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFW-------ALGSLRGDQYAVALS  161
            + RFGL  P + L   ++++ I+ C    G     + W        LG + G QYAVALS
Sbjct  104  STRFGLLSPEKELDASQVIDLISGCDSMGGP--VGQHWILDPVDGTLGFVHGGQYAVALS  161

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            +I+DG  V+GVLGCPNYP+K++      G + I SR  S  ++   + GCV+YA RG G 
Sbjct  162  VIDDGEAVLGVLGCPNYPVKED------GLRNICSRKKSLTSTASDEVGCVLYASRGSGK  215

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLL   + F WPN++K ++ SSIE P +ATFC  V++  S+ SF AG+ +S+G R 
Sbjct  216  AWMQPLLHSDENFEWPNAAKLVQVSSIEDPALATFCEPVQRTHSNQSFVAGVVNSVGVRK  275

Query  522  QQLRVYSSMKYAAIARG  572
            Q LR+YS +KYAAIARG
Sbjct  276  QPLRIYSMVKYAAIARG  292



>ref|XP_002864328.1| hypothetical protein ARALYDRAFT_495519 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40587.1| hypothetical protein ARALYDRAFT_495519 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score =   176 bits (446),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 127/197 (64%), Gaps = 18/197 (9%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   EI++ I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  APKYGLPKPDKPLGSTEILKAISRCNSVGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYP+KKE LS     Q + ++    + S    KGCVMYA+RG G 
Sbjct  164  LIENGKVLLGVLGCPNYPVKKECLSNGCN-QAMKTKSVPGSVS----KGCVMYAKRGSGQ  218

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ GG     P S+  +K SS++ PV+AT C  VE+A S+H FTAGL +S+G R 
Sbjct  219  AWMQPLIVGG----IPESATLLKVSSVDDPVLATVCEPVERANSNHLFTAGLANSMGVRK  274

Query  522  QQLRVYSSMKYAAIARG  572
            Q +RVYS +KYAAIARG
Sbjct  275  QPMRVYSMVKYAAIARG  291



>emb|CDY18326.1| BnaC09g30760D [Brassica napus]
Length=375

 Score =   176 bits (446),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 124/197 (63%), Gaps = 23/197 (12%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A ++GLT P E L  ++I++ I  C    G     R W L       G +RGDQYAVAL+
Sbjct  113  ATKYGLTKPDEPLGSDDILKAIGRCNSTGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  170

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  ++GVLGCPNYP+KKE LS             + + +    KGCVMYA+RG G 
Sbjct  171  LIEDGKVLLGVLGCPNYPVKKEGLSNG----------CNQSGAGSVSKGCVMYAKRGSGQ  220

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPLLP G    +P S+  +K S+++ PV+AT C  VE+A S+H FTAGL +S+G R 
Sbjct  221  AWMQPLLPNG----YPESATLLKASTVDDPVLATVCEPVERANSNHLFTAGLANSMGVRK  276

Query  522  QQLRVYSSMKYAAIARG  572
            Q +RVYS +KYAAIA G
Sbjct  277  QPMRVYSMVKYAAIACG  293



>ref|XP_009127092.1| PREDICTED: PAP-specific phosphatase HAL2-like [Brassica rapa]
Length=372

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 123/197 (62%), Gaps = 21/197 (11%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A  +GL  P + L   EI+E I  C    G     R W L       G +RGDQYAVAL+
Sbjct  108  ASTYGLPKPDKPLGTTEILEAIGRCSSVGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  165

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYP+KKE LS     Q        + A+    KGCVMYA+RG G 
Sbjct  166  LIENGKVLLGVLGCPNYPVKKECLSNGCNSQ--------SGAAGSVTKGCVMYAKRGSGQ  217

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+PGG    +P S+  +K SS++ PV+AT C  VE+A S+H FTAGL +S+G R 
Sbjct  218  AWMQPLIPGG----YPESATLLKVSSVDDPVLATVCEPVERANSNHLFTAGLTNSMGVRK  273

Query  522  QQLRVYSSMKYAAIARG  572
            Q +RVYS +KYAAIA G
Sbjct  274  QPMRVYSMVKYAAIACG  290



>gb|AAB94051.1| PAP-specific phosphatase [Arabidopsis thaliana]
Length=373

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 127/197 (64%), Gaps = 18/197 (9%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A ++GL  P + L   EI++ I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  ASKYGLPKPVKPLGSSEILKAISRCNSVGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYP+KKE LS     Q + ++  + + S    KGCVMYA+RG G 
Sbjct  164  LIENGKVLLGVLGCPNYPVKKECLSNGCN-QAMKTKAVAGSVS----KGCVMYAKRGSGQ  218

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ GG     P S+  +K SS++ PV+AT C  VE+A S+H FTAGL +S+G R 
Sbjct  219  AWMQPLIVGG----IPESATLLKVSSVDDPVLATVCEPVERANSNHLFTAGLANSMGVRK  274

Query  522  QQLRVYSSMKYAAIARG  572
            Q +RVYS +KYAAIARG
Sbjct  275  QPMRVYSMVKYAAIARG  291



>emb|CDY48649.1| BnaCnng16680D [Brassica napus]
Length=372

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 123/197 (62%), Gaps = 21/197 (11%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A  +GL  P + L   EI+E I  C    G     R W L       G +RGDQYAVAL+
Sbjct  108  ASTYGLPKPDKPLGTTEILEAIGRCSSVGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  165

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYP+KKE LS     Q        + A+    KGCVMYA+RG G 
Sbjct  166  LIENGKVLLGVLGCPNYPVKKECLSNGCNNQ--------SGAAGSVTKGCVMYAKRGSGQ  217

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+PGG    +P S+  +K SS++ PV+AT C  VE+A S+H FTAGL +S+G R 
Sbjct  218  AWMQPLIPGG----YPESATLLKVSSVDDPVLATVCEPVERANSNHLFTAGLANSMGVRK  273

Query  522  QQLRVYSSMKYAAIARG  572
            Q +RVYS +KYAAIA G
Sbjct  274  QPMRVYSMVKYAAIACG  290



>emb|CDY66135.1| BnaAnng21580D [Brassica napus]
Length=372

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 123/197 (62%), Gaps = 21/197 (11%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A  +GL  P + L   +I+E I  C    G     R W L       G +RGDQYAVAL+
Sbjct  108  ASTYGLPKPDKPLGTTDILEAIGRCSSVGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  165

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYP+KKE LS     Q        + A+    KGCVMYA+RG G 
Sbjct  166  LIENGKVLLGVLGCPNYPVKKECLSNGCNNQ--------SGAAGSVSKGCVMYAKRGSGQ  217

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+PGG    +P S+  +K SS++ PV+AT C  VE+A S+H FTAGL +S+G R 
Sbjct  218  AWMQPLIPGG----YPESATLLKVSSVDDPVLATVCEPVERANSNHLFTAGLTNSMGVRK  273

Query  522  QQLRVYSSMKYAAIARG  572
            Q +RVYS +KYAAIA G
Sbjct  274  QPMRVYSMVKYAAIACG  290



>ref|XP_006280648.1| hypothetical protein CARUB_v10026608mg [Capsella rubella]
 gb|EOA13546.1| hypothetical protein CARUB_v10026608mg [Capsella rubella]
Length=374

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 128/198 (65%), Gaps = 19/198 (10%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   EI++ I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  APKYGLPKPVKQLGSSEILKAISRCNSVGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYP+KKE LS   G  + + + + A +     KGCVMYA++G G 
Sbjct  164  LIENGKVLLGVLGCPNYPVKKECLSN--GCNQAMKKNSVAGSVS---KGCVMYAKKGSGQ  218

Query  342  AWMQPLLPGGKMFNWPNSSKQI-KPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHR  518
            AWMQPL+ GG    +P SS  + K SS++ P +AT C  VE+A S+H FTAGL +S+G R
Sbjct  219  AWMQPLIAGG----FPESSTTLLKVSSVDDPALATVCEPVERANSNHLFTAGLANSMGVR  274

Query  519  NQQLRVYSSMKYAAIARG  572
             Q LRVYS +KYAAIARG
Sbjct  275  KQPLRVYSMVKYAAIARG  292



>ref|XP_001773062.1| predicted protein [Physcomitrella patens]
 gb|EDQ62102.1| predicted protein [Physcomitrella patens]
Length=371

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 123/197 (62%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A   G+  P + L   E+++ IN      G     R W L       G +RGDQYAVAL+
Sbjct  96   ASVVGIAPPKQPLGSYEVLKLINKGTTLGGPTG--RHWVLDPVDGTLGFVRGDQYAVALA  153

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            L++DG  V+GVLGCPN+P++  WL Y + Y R+  ++     S    +GCVM A++G+G 
Sbjct  154  LVDDGEVVLGVLGCPNFPMRPAWLGYHHKYYRMAMKIVPPD-SNHWHRGCVMTAQKGEGR  212

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQP++  G+ FN  ++ +++  SS+  P  ATFC  VEKA SSHSFTAGL  +LG RN
Sbjct  213  AWMQPMIFNGETFNEFHAPREVCVSSVVDPTEATFCEPVEKANSSHSFTAGLADTLGLRN  272

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS  KYAAIARG
Sbjct  273  QPLRVYSMAKYAAIARG  289



>ref|XP_006401578.1| hypothetical protein EUTSA_v10013845mg [Eutrema salsugineum]
 gb|ESQ43031.1| hypothetical protein EUTSA_v10013845mg [Eutrema salsugineum]
Length=376

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 124/197 (63%), Gaps = 18/197 (9%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APR+ L  P + L   EI++ I  C    G     R W L       G +RGDQYAVAL+
Sbjct  109  APRYNLPKPDKPLGSTEILKAIGRCSSVGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  166

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYP+KKE LS           +T+ +A+    KGCVMYA+RG G 
Sbjct  167  LIENGKVLLGVLGCPNYPVKKECLSNGCN-----QTVTTKSAAGSVLKGCVMYAKRGSGQ  221

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ GG     P S+  +K SS++ P +AT C  VE+A S+H FTAGL +S+G R 
Sbjct  222  AWMQPLIAGG----IPESATLLKVSSVDDPALATVCEPVERANSNHLFTAGLANSMGVRK  277

Query  522  QQLRVYSSMKYAAIARG  572
            Q +RVYS +KYAAIARG
Sbjct  278  QPMRVYSMVKYAAIARG  294



>ref|NP_200250.1| PAP-specific phosphatase HAL2-like protein [Arabidopsis thaliana]
 sp|Q38945.1|DPNPH_ARATH RecName: Full=PAP-specific phosphatase HAL2-like; AltName: Full=3'(2'),5'-bisphosphate 
nucleotidase; AltName: Full=3'(2'),5-bisphosphonucleoside 
3'(2')-phosphohydrolase; AltName: Full=DPNPase; 
AltName: Full=Halotolerance protein [Arabidopsis 
thaliana]
 gb|AAB52964.1| HAL2-like protein [Arabidopsis thaliana]
 dbj|BAA97512.1| 3'(2'), 5'-bisphosphate nucleotidase protein-like protein [Arabidopsis 
thaliana]
 gb|AAK76522.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14316.1| unknown protein [Arabidopsis thaliana]
 gb|AAM63490.1| PAP-specific phosphatase [Arabidopsis thaliana]
 gb|AED96491.1| PAP-specific phosphatase HAL2-like protein [Arabidopsis thaliana]
Length=373

 Score =   174 bits (440),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 126/197 (64%), Gaps = 18/197 (9%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A  +GL  P + L   EI++ I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  AQNYGLPKPVKPLGSSEILKAISRCNSVGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYP+KKE LS     Q + ++  + + S    KGCVMYA+RG G 
Sbjct  164  LIENGKVLLGVLGCPNYPVKKECLSNGCN-QAMKTKAVAGSVS----KGCVMYAKRGSGQ  218

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ GG     P S+  +K SS++ PV+AT C  VE+A S+H FTAGL +S+G R 
Sbjct  219  AWMQPLIVGG----IPESATLLKVSSVDDPVLATVCEPVERANSNHLFTAGLANSMGVRK  274

Query  522  QQLRVYSSMKYAAIARG  572
            Q +RVYS +KYAAIARG
Sbjct  275  QPMRVYSMVKYAAIARG  291



>ref|XP_004251846.1| PREDICTED: PAP-specific phosphatase HAL2-like [Solanum lycopersicum]
Length=383

 Score =   174 bits (440),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 126/197 (64%), Gaps = 11/197 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A R+GL GP + L   EI+E I+ C    G     R W L       G +RG QYAVAL+
Sbjct  109  ASRYGLKGPDKILGPSEILEAISRCNSKGGP--LGRHWVLDPVDGTLGFVRGGQYAVALA  166

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LI++   VVGVLGCPNY +K++  + Q   Q  +S      + +  ++GCVMY+++G G 
Sbjct  167  LIDNAEVVVGVLGCPNYHMKRDRHNKQQ--QNHISSEVPVPSPDMLEEGCVMYSKKGTGE  224

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AW+QP + G   + WPN +KQ++ S I+ P +ATFC  VE+A S+HSF AGL SS+G RN
Sbjct  225  AWVQPTVYGDGKYEWPNFAKQVRVSPIDDPALATFCEPVERANSNHSFAAGLASSVGLRN  284

Query  522  QQLRVYSSMKYAAIARG  572
            + LRVYS +KYAAIA+G
Sbjct  285  KPLRVYSMVKYAAIAQG  301



>gb|KEH31136.1| 3'(2'),5'-bisphosphate nucleotidase [Medicago truncatula]
Length=450

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 129/198 (65%), Gaps = 11/198 (6%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP FG   P  AL   E++E I+ C    G  ++ RFWAL       G + GDQYAVALS
Sbjct  174  APLFGAEAPKSALGTSEVLEIISHCNSVGG--HSGRFWALSPLDGKLGFVNGDQYAVALS  231

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            L+EDG  VVGVLGCPNYP++K+WL YQ  Y RI+S+L     SE  ++GCV+YA++  G 
Sbjct  232  LVEDGEVVVGVLGCPNYPMRKDWLGYQQSYHRIMSKLI-PPTSETWNRGCVIYAKKDSGK  290

Query  342  AWMQPLL-PGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHR  518
            AW+QPL+    K F WPN +K +  SS+++  +AT C TVE+A SSHSFT GL  S+G  
Sbjct  291  AWIQPLIHHANKKFVWPNHAKLVSLSSVDNLGLATLCQTVEEANSSHSFTDGLAHSVGFS  350

Query  519  NQQLRVYSSMKYAAIARG  572
            N+ L V S MKY A+A G
Sbjct  351  NKPLGVKSIMKYVALACG  368



>ref|XP_009119967.1| PREDICTED: PAP-specific phosphatase HAL2-like [Brassica rapa]
Length=374

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 125/197 (63%), Gaps = 23/197 (12%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A ++GL  P + L   +I++ I  C    G     R W L       G +RGDQYAVAL+
Sbjct  112  AHKYGLPKPDKPLGSHDILKAIGRCNSTGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  169

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  ++GVLGCPNYP+KKE L  + G  +      S A S    KGCVMYA+RG G 
Sbjct  170  LIEDGKVLLGVLGCPNYPVKKEGL--RNGCNQ------SGAGS--VSKGCVMYAKRGSGQ  219

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+PGG    +P S+  +K S ++ PV+AT C  VE+A S+H FTAGL +S+G RN
Sbjct  220  AWMQPLIPGG----YPESATLLKASKVDDPVLATVCEPVERANSNHLFTAGLANSMGVRN  275

Query  522  QQLRVYSSMKYAAIARG  572
            Q +RVYS +KYAAIA G
Sbjct  276  QPMRVYSMVKYAAIACG  292



>ref|XP_001761209.1| predicted protein [Physcomitrella patens]
 gb|EDQ73931.1| predicted protein [Physcomitrella patens]
Length=371

 Score =   171 bits (432),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 125/197 (63%), Gaps = 10/197 (5%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A   G+  P + L   E+++ IN  K  A      R W L       G +RGDQYAVAL+
Sbjct  96   ASAVGIAPPKQPLRSYEVLKFIN--KGTAPGGPTGRHWVLDPVDGTLGFVRGDQYAVALA  153

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            L++DG  V+GVLGCPN+P++  WL Y + Y R+  ++     S    +GCVM A++G+G 
Sbjct  154  LVDDGQVVLGVLGCPNFPMRPAWLGYHHKYYRMAMKIAPPDPSHWH-RGCVMTAQKGEGR  212

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AW+QP++  G+ FN  ++ +++  SS+  PV ATFC  VE+A SSHSFT+GL  +LG RN
Sbjct  213  AWVQPMIFNGESFNEFHAPREVCVSSVVDPVDATFCEPVERANSSHSFTSGLADTLGLRN  272

Query  522  QQLRVYSSMKYAAIARG  572
            Q LRVYS  KYAA+ARG
Sbjct  273  QPLRVYSMAKYAAVARG  289



>emb|CDY42446.1| BnaA10g08220D [Brassica napus]
Length=374

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 125/197 (63%), Gaps = 23/197 (12%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            A ++GL  P + L   +I++ I  C    G     R W L       G +RGDQYAVAL+
Sbjct  112  AHKYGLPKPDKPLGSHDILKAIGRCNSTGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  169

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIEDG  ++GVLGCPNYP+KKE L  + G  +      S A S    KGCVMYA+RG G 
Sbjct  170  LIEDGKVLLGVLGCPNYPVKKEGL--RNGCNQ------SGAGS--VSKGCVMYAKRGSGQ  219

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+PGG    +P S+  +K S+++ PV+AT C  VE+A S+H FTAGL +S+G R 
Sbjct  220  AWMQPLIPGG----YPESTTLLKASTVDDPVLATVCEPVERANSNHLFTAGLANSMGVRK  275

Query  522  QQLRVYSSMKYAAIARG  572
            Q +RVYS +KYAAIA G
Sbjct  276  QPMRVYSMVKYAAIACG  292



>gb|ACN41030.1| unknown [Picea sitchensis]
Length=483

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 121/194 (62%), Gaps = 10/194 (5%)
 Frame = +3

Query  12   FGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIE  170
            FGL  P E L   ++++ IN  K ++      R W L       G +RGDQYAVAL++IE
Sbjct  211  FGLNPPLEPLGTVDVLKAIN--KGSSKGGPTGRHWVLDPVDGTLGFIRGDQYAVALAMIE  268

Query  171  DGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWM  350
            +G  V+GVLGCPNYPL++EWL+Y Y Y +++ +L S   S    KG V+  ++G G  WM
Sbjct  269  EGEVVLGVLGCPNYPLRREWLNYHYRYYQLMLKL-SPPGSGVWSKGYVLSTQKGSGQVWM  327

Query  351  QPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQL  530
            +PL+         N ++ +  S+I+ P +ATFC  VEKA SSHSFTAGL  SLG  N  L
Sbjct  328  EPLVNDIIKLGLSNVARPVSVSAIDDPALATFCEPVEKANSSHSFTAGLAHSLGLSNHPL  387

Query  531  RVYSSMKYAAIARG  572
            RVYS  KYAAIARG
Sbjct  388  RVYSMAKYAAIARG  401



>ref|XP_010675597.1| PREDICTED: PAP-specific phosphatase HAL2-like [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score =   166 bits (419),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 125/197 (63%), Gaps = 13/197 (7%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFGL      L   +++E +  C  + G     R W L       G +RG+QYAVAL+
Sbjct  104  APRFGLEVSDIPLSPNKVIEAVGRCNSSGGLEG--RHWVLDPVDGTLGFVRGNQYAVALA  161

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  V+GVLGCPNYP+KK  +++ +   + +S ++SA+  +  +KGCVMYA+R  G 
Sbjct  162  LIEEGRVVLGVLGCPNYPVKKGLVNHHH---QQMSEMSSASP-DVWEKGCVMYAKRDTGK  217

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            AWMQPL+ G    +   S+  I+ SSIE P +AT C  VEKA +SHSFT G+  S G R 
Sbjct  218  AWMQPLVDGKLKLDSFESAILIRVSSIEDPALATSCEPVEKANTSHSFTEGVAHSAGLRT  277

Query  522  QQLRVYSSMKYAAIARG  572
            + LRVYS +KYAAIARG
Sbjct  278  KPLRVYSMVKYAAIARG  294



>gb|ACU22731.1| unknown [Glycine max]
Length=200

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +3

Query  216  LKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNWPNS  395
            ++KEWLSY + Y RI+S+LT    SE  +KGCV+YA++G G AWMQPLL   KMF WPN 
Sbjct  1    MRKEWLSYHHRYHRIISKLTPPT-SETWNKGCVLYAKKGSGKAWMQPLLHVNKMFVWPNH  59

Query  396  SKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIARG  572
            +KQ+  SSI++P +ATFC  VEKA SS SFTAGL  S+G R Q LRVYS +KYAAIARG
Sbjct  60   AKQVSVSSIDNPALATFCEPVEKANSSRSFTAGLAHSVGLRKQPLRVYSMVKYAAIARG  118



>ref|XP_002980155.1| hypothetical protein SELMODRAFT_111780 [Selaginella moellendorffii]
 gb|EFJ19025.1| hypothetical protein SELMODRAFT_111780 [Selaginella moellendorffii]
Length=443

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 117/197 (59%), Gaps = 17/197 (9%)
 Frame = +3

Query  12   FGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIE  170
             GLT P+  L   E++  IN          +SR W L       G +RGDQYA+AL +IE
Sbjct  172  VGLTPPSRKLGTIEVLRAINKGNSEV---RSSRSWVLDPVDGTLGFVRGDQYAIALGMIE  228

Query  171  DGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWM  350
            DG  V+GVLGCPNYP++ +WL+Y   Y R+ S++      +   KGCV+ + +G G AWM
Sbjct  229  DGRVVLGVLGCPNYPMRPQWLNYHQKYYRLASKIAPPPPGK-WHKGCVLTSAKGAGQAWM  287

Query  351  QPLL---PGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            +PL+    G  + N P   + +  S ++ P  ATFC  VEKA SSHSFT G+  SLG R 
Sbjct  288  EPLVWNSDGSFLLNPP---RVVAVSPVDDPAQATFCEPVEKANSSHSFTEGVADSLGLRK  344

Query  522  QQLRVYSSMKYAAIARG  572
            + LRVYS  KYAAIARG
Sbjct  345  RPLRVYSMAKYAAIARG  361



>ref|XP_002992905.1| hypothetical protein SELMODRAFT_187085 [Selaginella moellendorffii]
 gb|EFJ05994.1| hypothetical protein SELMODRAFT_187085 [Selaginella moellendorffii]
Length=443

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 117/197 (59%), Gaps = 17/197 (9%)
 Frame = +3

Query  12   FGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIE  170
             GLT P+  L   E++  IN          +SR W L       G +RGDQYA+AL +IE
Sbjct  172  VGLTPPSRKLGTIEVLRAINKGNSEV---RSSRSWVLDPVDGTLGFVRGDQYAIALGMIE  228

Query  171  DGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWM  350
            DG  V+GVLGCPNYP++ +WL+Y   Y R+ S++      +   KGCV+ + +G G AWM
Sbjct  229  DGRVVLGVLGCPNYPMRPQWLNYHQKYYRLASKIAPPPPGK-WHKGCVLTSAKGAGQAWM  287

Query  351  QPLL---PGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRN  521
            +PL+    G  + N P   + +  S ++ P  ATFC  VEKA SSHSFT G+  SLG R 
Sbjct  288  EPLVWNSDGSFLLNPP---RVVAVSPVDDPAQATFCEPVEKANSSHSFTEGVADSLGLRK  344

Query  522  QQLRVYSSMKYAAIARG  572
            + LRVYS  KYAAIARG
Sbjct  345  RPLRVYSMAKYAAIARG  361



>ref|XP_006401576.1| hypothetical protein EUTSA_v10013845mg [Eutrema salsugineum]
 ref|XP_006401577.1| hypothetical protein EUTSA_v10013845mg [Eutrema salsugineum]
 gb|ESQ43029.1| hypothetical protein EUTSA_v10013845mg [Eutrema salsugineum]
 gb|ESQ43030.1| hypothetical protein EUTSA_v10013845mg [Eutrema salsugineum]
Length=276

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 109/179 (61%), Gaps = 18/179 (10%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APR+ L  P + L   EI++ I  C    G     R W L       G +RGDQYAVAL+
Sbjct  109  APRYNLPKPDKPLGSTEILKAIGRCSSVGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  166

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYP+KKE LS           +T+ +A+    KGCVMYA+RG G 
Sbjct  167  LIENGKVLLGVLGCPNYPVKKECLSNGCNQT-----VTTKSAAGSVLKGCVMYAKRGSGQ  221

Query  342  AWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHR  518
            AWMQPL+ GG     P S+  +K SS++ P +AT C  VE+A S+H FTAGL +S+G R
Sbjct  222  AWMQPLIAGG----IPESATLLKVSSVDDPALATVCEPVERANSNHLFTAGLANSMGVR  276



>ref|XP_006280647.1| hypothetical protein CARUB_v10026608mg [Capsella rubella]
 gb|EOA13545.1| hypothetical protein CARUB_v10026608mg [Capsella rubella]
Length=274

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 113/180 (63%), Gaps = 19/180 (11%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            AP++GL  P + L   EI++ I+ C    G     R W L       G +RGDQYAVAL+
Sbjct  106  APKYGLPKPVKQLGSSEILKAISRCNSVGGPKG--RHWVLDPVDGTLGFVRGDQYAVALA  163

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            LIE+G  ++GVLGCPNYP+KKE LS   G  + + + + A +     KGCVMYA++G G 
Sbjct  164  LIENGKVLLGVLGCPNYPVKKECLS--NGCNQAMKKNSVAGSVS---KGCVMYAKKGSGQ  218

Query  342  AWMQPLLPGGKMFNWPNSSKQ-IKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHR  518
            AWMQPL+ GG    +P SS   +K SS++ P +AT C  VE+A S+H FTAGL +S+G R
Sbjct  219  AWMQPLIAGG----FPESSTTLLKVSSVDDPALATVCEPVERANSNHLFTAGLANSMGVR  274



>gb|ACJ85128.1| unknown [Medicago truncatula]
Length=310

 Score =   148 bits (374),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 91/133 (68%), Gaps = 10/133 (8%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALS  161
            APRFG+  P   L   E+++ I+ C    G   + RFW L       G +RGDQYAVAL+
Sbjct  169  APRFGVQKPKSPLGNSEVLDIISRCNSTGGP--SGRFWVLDPVDGTLGFVRGDQYAVALA  226

Query  162  LIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGN  341
            L+EDG  V+GVLGCPNYP++KEWLSYQ+ Y RI+S+LT    SE  +KGCV+YA++G G 
Sbjct  227  LVEDGEVVLGVLGCPNYPMRKEWLSYQHRYHRIVSKLT-PPTSESWNKGCVLYAKKGTGK  285

Query  342  AWMQPLLPGGKMF  380
            AWMQPLL   KMF
Sbjct  286  AWMQPLLHVNKMF  298



>gb|AFG71389.1| hypothetical protein 0_6316_02, partial [Pinus taeda]
Length=145

 Score =   137 bits (344),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  120  LGSLRGDQYAVALSLIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPR  299
            LG +RGDQYAVAL++IE+G  V+GVLGCPNYPL+KEWL+Y Y Y +++ +L +   S   
Sbjct  14   LGFVRGDQYAVALAMIEEGEVVLGVLGCPNYPLRKEWLNYHYRYYQLMLKL-APPGSGVW  72

Query  300  DKGCVMYARRGDGNAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSH  479
             KG V+  ++G G  WM+PL+         N ++ +  S+I+ P +ATFC  VEKA SSH
Sbjct  73   SKGYVLSTQKGSGQVWMEPLVNDIIKLGLSNVARPVSVSAIDDPALATFCEPVEKANSSH  132

Query  480  SFTAGLNSSLGHR  518
            SFTAGL  SLG R
Sbjct  133  SFTAGLAHSLGLR  145



>gb|AFG71390.1| hypothetical protein 0_6316_02, partial [Pinus taeda]
Length=145

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  120  LGSLRGDQYAVALSLIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPR  299
            LG +RGDQYAVAL++IE+G  V+GVLGCPNYPL+KEWL+Y + Y +++ +L +   S   
Sbjct  14   LGFVRGDQYAVALAMIEEGEVVLGVLGCPNYPLRKEWLNYHHRYYQLMLKL-APPGSGVW  72

Query  300  DKGCVMYARRGDGNAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSH  479
             KG V+  ++G G  WM+PL+         N ++ +  S+I+ P +ATFC  VEKA SSH
Sbjct  73   SKGYVLSTQKGSGQVWMEPLVNDIIKLGLSNVARPVSVSAIDDPALATFCEPVEKANSSH  132

Query  480  SFTAGLNSSLGHR  518
            SFTAGL  SLG R
Sbjct  133  SFTAGLAHSLGLR  145



>gb|KHG03860.1| PAP-specific phosphatase HAL2-like [Gossypium arboreum]
Length=199

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 84/119 (71%), Gaps = 2/119 (2%)
 Frame = +3

Query  216  LKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNWPNS  395
            ++KE L+Y +   +I  + TS  +S+   KGCVMYARRG G AWMQPL+ G   F WPNS
Sbjct  1    MRKELLNYNHQCNQI--KPTSPPSSDIWQKGCVMYARRGTGQAWMQPLIHGDTKFEWPNS  58

Query  396  SKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIARG  572
            +  ++ S ++ P +ATFC  VEKA S+H FT GL +S+G +N+ +RV+S +KYAAIARG
Sbjct  59   ATLLQASPVDDPSLATFCEPVEKANSNHLFTEGLVNSIGLKNRPMRVHSMVKYAAIARG  117



>gb|KHG03861.1| PAP-specific phosphatase HAL2-like [Gossypium arboreum]
Length=219

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 84/119 (71%), Gaps = 2/119 (2%)
 Frame = +3

Query  216  LKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNWPNS  395
            ++KE L+Y +   +I  + TS  +S+   KGCVMYARRG G AWMQPL+ G   F WPNS
Sbjct  1    MRKELLNYNHQCNQI--KPTSPPSSDIWQKGCVMYARRGTGQAWMQPLIHGDTKFEWPNS  58

Query  396  SKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIARG  572
            +  ++ S ++ P +ATFC  VEKA S+H FT GL +S+G +N+ +RV+S +KYAAIARG
Sbjct  59   ATLLQASPVDDPSLATFCEPVEKANSNHLFTEGLVNSIGLKNRPMRVHSMVKYAAIARG  117



>ref|XP_007512749.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17349.1| predicted protein [Bathycoccus prasinos]
Length=456

 Score =   109 bits (273),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 92/157 (59%), Gaps = 13/157 (8%)
 Frame = +3

Query  120  LGSLRGDQYAVALSLIEDGAPVVGVLGCPNYPLKKEWL----SYQYGYQ-RILSRLTSAA  284
            LG +RGDQYA+AL+L++ G  V+G +GCPN P   + L    +Y YG+  R +S++ +  
Sbjct  225  LGFVRGDQYAIALALMDQGKLVLGAMGCPNMPKSGDVLEFNDAYSYGFSPRTVSKMLAGG  284

Query  285  ASEPRD--KGCVMYARRGDGNAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTV  458
            +S   D  KGCV  A RG+G  WM P  P  K+     S  ++  SS   P  A FC  V
Sbjct  285  SSAKTDWYKGCVFTAVRGNG-CWMWPTSPDVKV-----SPTKVHVSSAFDPRKARFCEPV  338

Query  459  EKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIAR  569
             KA SS  FTA +  +LG  ++ LR+YS +KY ++AR
Sbjct  339  MKANSSQGFTASVADNLGIESKPLRIYSQVKYGSVAR  375



>ref|XP_002501742.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63000.1| predicted protein [Micromonas sp. RCC299]
Length=414

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 106/198 (54%), Gaps = 26/198 (13%)
 Frame = +3

Query  15   GLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIED  173
            G+  P   L   E+++ IN      GA    R W L       G +RGDQYA+AL+++ED
Sbjct  148  GMDAPE--LTSTEVVDLINK---GGGAGGKGRHWVLDPVDGTLGFVRGDQYAIALAMMED  202

Query  174  GAPVVGVLGCPNYPLKKEWL----SYQYGYQ-RILSRLTSAAASEPRDKGCVMYARRGDG  338
            G   VGV+GCPN P   E L    SY YG+  R++S++  A  S    KGC+  A +G G
Sbjct  203  GDLKVGVMGCPNMPKIGEVLEYDSSYTYGFSPRLVSKML-AGESLGWYKGCIFTAVKG-G  260

Query  339  NAWMQPLLPGGKMFNWPNS-SKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGH  515
             A+M P  P  K    P + SK+  P +      A FC  V KA SS  FTA +  +LG 
Sbjct  261  GAYMLPCDPAIKADPLPVAVSKEFDPQA------AKFCEPVMKANSSQGFTASVADNLGI  314

Query  516  RNQQLRVYSSMKYAAIAR  569
             ++ LRVYS +KY ++AR
Sbjct  315  ESKPLRVYSQVKYGSVAR  332



>emb|CEF97015.1| Inositol monophosphatase, metal-binding site [Ostreococcus tauri]
Length=425

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 101/192 (53%), Gaps = 21/192 (11%)
 Frame = +3

Query  30   AEALCGEEIMETINTCKLAAGANNASRFW-------ALGSLRGDQYAVALSLIEDGAPVV  188
            A  L  +++++ IN  +   G     + W        LG +RGDQYA+AL+L++DG   V
Sbjct  161  APTLSSQDVVDAINRGQSTGGPTG--KHWILDPVDGTLGFVRGDQYAIALALMDDGDLKV  218

Query  189  GVLGCPNYPLKKEWL----SYQYGYQ-RILSRLTSAAASEPRDKGCVMYARRGDGNAWMQ  353
            GV+GCPN P   E L    SY YG+  R++S++  A  S    KGC+  A RG G A+M 
Sbjct  219  GVMGCPNMPKTGEVLEFQESYAYGFSPRLVSKML-AGDSLGWYKGCIFTAVRGKG-AYMF  276

Query  354  PLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLR  533
            P  P  K         ++  S    P  A F   V KA SS  FTA + ++LG   + LR
Sbjct  277  PTDPTLKF-----EPVKVSVSEAFDPRKAKFTEPVMKANSSQGFTAAVATNLGIECKPLR  331

Query  534  VYSSMKYAAIAR  569
            +YS +KY ++AR
Sbjct  332  IYSQVKYGSVAR  343



>ref|XP_003078015.1| Putative PAP-specific phosphatase (ISS) [Ostreococcus tauri]
Length=427

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 101/192 (53%), Gaps = 21/192 (11%)
 Frame = +3

Query  30   AEALCGEEIMETINTCKLAAGANNASRFW-------ALGSLRGDQYAVALSLIEDGAPVV  188
            A  L  +++++ IN  +   G     + W        LG +RGDQYA+AL+L++DG   V
Sbjct  163  APTLSSQDVVDAINRGQSTGGPTG--KHWILDPVDGTLGFVRGDQYAIALALMDDGDLKV  220

Query  189  GVLGCPNYPLKKEWL----SYQYGYQ-RILSRLTSAAASEPRDKGCVMYARRGDGNAWMQ  353
            GV+GCPN P   E L    SY YG+  R++S++  A  S    KGC+  A RG G A+M 
Sbjct  221  GVMGCPNMPKTGEVLEFQESYAYGFSPRLVSKML-AGDSLGWYKGCIFTAVRGKG-AYMF  278

Query  354  PLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLR  533
            P  P  K         ++  S    P  A F   V KA SS  FTA + ++LG   + LR
Sbjct  279  PTDPTLKF-----EPVKVSVSEAFDPRKAKFTEPVMKANSSQGFTAAVATNLGIECKPLR  333

Query  534  VYSSMKYAAIAR  569
            +YS +KY ++AR
Sbjct  334  IYSQVKYGSVAR  345



>ref|XP_001416867.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO95160.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=366

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 102/189 (54%), Gaps = 21/189 (11%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFW-------ALGSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++  IN  K   GA    + W        LG +RGDQYA+AL+L+++G   VGV+
Sbjct  105  LSSQDVVSAINKGKSTGGAKG--KHWILDPVDGTLGFVRGDQYAIALALMDEGDLKVGVM  162

Query  198  GCPNYPLKKEWL----SYQYGYQ-RILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLL  362
            GCPN P + + L    SY YG+  R++S++  A  S    KGC+  A RG G+     + 
Sbjct  163  GCPNMPKQGDVLEFETSYSYGFSPRLVSKML-AGDSLGWYKGCIFTAVRGHGSY----MF  217

Query  363  PGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYS  542
            P  +  N+  S  ++  S    P  A F   V KA SS  FTA + ++LG   + LR+YS
Sbjct  218  PVDEELNFEPS--KVTVSGAFDPQKAKFTEPVMKANSSQGFTAAVATNLGIECKPLRIYS  275

Query  543  SMKYAAIAR  569
             +KY ++AR
Sbjct  276  QVKYGSVAR  284



>ref|WP_008102691.1| 3'(2'),5'-bisphosphate nucleotidase [Verrucomicrobiae bacterium 
DG1235]
 gb|EDY83959.1| 3'(2'),5'-bisphosphate nucleotidase [Verrucomicrobiae bacterium 
DG1235]
Length=329

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 93/186 (50%), Gaps = 37/186 (20%)
 Frame = +3

Query  36   ALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGV  194
            AL  + I+  I+    + GA    RFW L       G LRG+QYAVAL+LIE G  V+GV
Sbjct  97   ALDADSILAAIDRGNHSGGAQG--RFWTLDPIDGTKGFLRGEQYAVALALIEKGEVVLGV  154

Query  195  LGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGK  374
            LGCPN P+                       S   +KGC++YA +G G A+  PL     
Sbjct  155  LGCPNLPVDPR--------------------SPDSEKGCILYAVKGQG-AFQAPL-----  188

Query  375  MFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKY  554
              +  +++  I   S+  P  A FC +VE   ++H  +A + S+LG   +  R+ S  KY
Sbjct  189  --SDISAAIAISTDSVTDPDKAVFCESVESGHTAHGRSAAITSALGTSVEPFRMDSQCKY  246

Query  555  AAIARG  572
            AA++RG
Sbjct  247  AAVSRG  252



>ref|XP_003062680.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53499.1| predicted protein [Micromonas pusilla CCMP1545]
Length=418

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 93/191 (49%), Gaps = 20/191 (10%)
 Frame = +3

Query  30   AEALCGEEIMETINTCKLAAGANNASRFW-------ALGSLRGDQYAVALSLIEDGAPVV  188
            A  L   EI+  IN      G     R W        LG +RGDQYA+AL+L+EDG   V
Sbjct  155  APTLSSTEIVAAINK---GGGKGGKGRHWILDPVDGTLGFVRGDQYAIALALMEDGDLKV  211

Query  189  GVLGCPNYPLKKEWL----SYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQP  356
            GV+GCPN P   E L    SY YG+   +     A  S    KGC+  A +G G   ++P
Sbjct  212  GVMGCPNMPKTGEVLEYDSSYTYGFSPSMVTKMLAGESVGWYKGCIFAAVKGRGCT-VEP  270

Query  357  LLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRV  536
                 K    P     +  S    PV A FC  V KA SS  FTA +  +LG  ++ LRV
Sbjct  271  CDARIKAAPTP-----VTVSDAFDPVSAKFCEPVMKANSSQGFTASVADNLGIASKPLRV  325

Query  537  YSSMKYAAIAR  569
            YS +KY ++AR
Sbjct  326  YSQVKYGSVAR  336



>ref|XP_001796788.1| hypothetical protein SNOG_06415 [Phaeosphaeria nodorum SN15]
 gb|EAT86246.1| hypothetical protein SNOG_06415 [Phaeosphaeria nodorum SN15]
Length=354

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 80/162 (49%), Gaps = 22/162 (14%)
 Frame = +3

Query  108  RFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILS  266
            R WAL       G LRG QYAV L+L+ DG P VGV+GCPN P+           Q  L 
Sbjct  128  RIWALDPIDGTKGFLRGGQYAVCLALMVDGVPTVGVIGCPNLPIDD---------QAPLD  178

Query  267  RLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATF  446
                A A +   KG +  A +G+G A  +PL  G         S++I   ++     ATF
Sbjct  179  SSIGADADDKEGKGVLFAAVKGEG-ATSRPLSKGA-----LQESRKISMKAVPDVSQATF  232

Query  447  CHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIARG  572
            C +VE   SSH   A + S LG   Q +R+ S  KY +IARG
Sbjct  233  CESVEAGHSSHGDNAAIASKLGITKQSVRMDSQAKYCSIARG  274



>ref|NP_001236344.1| uncharacterized protein LOC100306018 [Glycine max]
 gb|ACU13993.1| unknown [Glycine max]
Length=202

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 59/90 (66%), Gaps = 7/90 (8%)
 Frame = +3

Query  3    APRFGLTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-----GSLRGDQYAVALSLI  167
            APRFG+  P   L   E++E I+ C   +  + + RFWAL     GS  GDQ+ VALSLI
Sbjct  115  APRFGVEEPKSTLGTSEVLEIISRCN--SVGDPSGRFWALSPLDGGSSCGDQHVVALSLI  172

Query  168  EDGAPVVGVLGCPNYPLKKEWLSYQYGYQR  257
            E+G  V+GVLGCPNYP++K+W SY + Y R
Sbjct  173  EEGEVVLGVLGCPNYPMRKDWFSYHHSYLR  202



>gb|EME49912.1| hypothetical protein DOTSEDRAFT_68656 [Dothistroma septosporum 
NZE10]
Length=356

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 97/192 (51%), Gaps = 26/192 (14%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP E+   E++++TI+      G+  + R WA+       G LRG QYAV L L+ DG
Sbjct  104  LGGPVES--AEKMLDTIDKGDSKGGS--SGRIWAIDPIDGTKGFLRGGQYAVCLGLMVDG  159

Query  177  APVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQP  356
               VGVLGCPN P+    L         L     A AS+   KG +  A +G+G A+ +P
Sbjct  160  DVKVGVLGCPNLPVSDSEL---------LKENIGADASDEEGKGVLFSAVQGEG-AYSRP  209

Query  357  LLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRV  536
            L  G        ++K+I+   I +   ATFC +VE A S+ S +  +   LG     +R+
Sbjct  210  LQKGS-----LEAAKKIQMKPISNIADATFCESVEAAHSNQSDSGKIAEKLGITKPSVRM  264

Query  537  YSSMKYAAIARG  572
             S  KY +IARG
Sbjct  265  DSQAKYGSIARG  276



>ref|XP_009112115.1| PREDICTED: SAL1 phosphatase-like [Brassica rapa]
Length=358

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 95/185 (51%), Gaps = 27/185 (15%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++I+  I+ C  + G  N  R W L       G LRGDQYAVAL L+E+G  V+GVL
Sbjct  110  LSTDDILRAID-CGTSEGGPNG-RHWVLDPIDGTKGFLRGDQYAVALGLLEEGKVVLGVL  167

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN P     L+   G         +  +S   +KGC+ YA  G G  +MQPL      
Sbjct  168  ACPNLP-----LASIAGNDN-----KNKNSSSSEEKGCLFYATIGSGT-YMQPL------  210

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
             +  +   ++  SS+E+P  A+F  + E A S H  ++ + + LG +   +R+ S  KY 
Sbjct  211  -DSKSEPVKVHVSSVENPEDASFFESFEGAHSLHDLSSSIANKLGVKAPPVRIDSQAKYG  269

Query  558  AIARG  572
            A++RG
Sbjct  270  ALSRG  274



>ref|XP_001766343.1| predicted protein [Physcomitrella patens]
 gb|EDQ68975.1| predicted protein [Physcomitrella patens]
Length=353

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 92/185 (50%), Gaps = 31/185 (17%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  E+++E I+      G+N   R W L       G +RGDQYA+AL L+++G  V GVL
Sbjct  109  LSKEDVLEAIDWGNSEGGSNG--RHWVLDPIDGTRGFVRGDQYAIALGLLDNGKVVAGVL  166

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
            GCPN P+              ++    A +SEP   GC+  A  G G   ++PL   G+ 
Sbjct  167  GCPNLPMGS------------IANGIPANSSEP--VGCLFVASLGAGTT-VEPLDGSGE-  210

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
                   K++  S +E   +ATFC + E A +    TA +  +LG +   +R+ S  KY 
Sbjct  211  ------PKRVHVSDVEDTAIATFCESYESAHTMQDLTANIAGTLGVKAPPVRIDSQAKYG  264

Query  558  AIARG  572
            A+ARG
Sbjct  265  AMARG  269



>emb|CDY18727.1| BnaA09g06680D [Brassica napus]
Length=358

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 95/185 (51%), Gaps = 27/185 (15%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++I+  I+ C  + G  N  R W L       G LRGDQYAVAL L+E+G  V+GVL
Sbjct  110  LSTDDILRAID-CGTSEGGPNG-RHWVLDPIDGTKGFLRGDQYAVALGLLEEGKVVLGVL  167

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN P     L+   G         +  +S   +KGC+ YA  G G  +MQPL      
Sbjct  168  ACPNLP-----LASIAGNDN-----KNKNSSSSEEKGCLFYATIGSGT-YMQPL------  210

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
             +  +   ++  SS+E+P  A+F  + E A S H  ++ + + LG +   +R+ S  KY 
Sbjct  211  -DSRSEPVKVHVSSVENPEDASFFESFEGAHSLHDLSSSIANKLGVKAPPVRIDSQAKYG  269

Query  558  AIARG  572
            A++RG
Sbjct  270  ALSRG  274



>emb|CDX81209.1| BnaC09g06200D [Brassica napus]
Length=358

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 93/186 (50%), Gaps = 29/186 (16%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++I+  I+ C  + G  N  R W L       G LRGDQYAVAL L+E+G  V+GVL
Sbjct  110  LSTDDILRAID-CGTSEGGPNG-RHWVLDPIDGTKGFLRGDQYAVALGLLEEGKVVLGVL  167

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRD-KGCVMYARRGDGNAWMQPLLPGGK  374
             CPN PL             I     +   S   D KGC+ YA  G G  +MQPL     
Sbjct  168  ACPNLPLAS-----------IAGDKKNKKNSSSSDEKGCLFYATIGSGT-YMQPL-----  210

Query  375  MFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKY  554
              +  +   ++  SS+E+P  A+F  + E A S H  ++ + + LG +   +R+ S  KY
Sbjct  211  --DSKSEPVKVHVSSVENPADASFFESFEGAHSLHDLSSSIANKLGVKAPPVRIDSQAKY  268

Query  555  AAIARG  572
             A++RG
Sbjct  269  GALSRG  274



>emb|CDY43776.1| BnaA06g23120D [Brassica napus]
Length=355

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 94/185 (51%), Gaps = 31/185 (17%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++  I+ C  + G  N  R W L       G LRGDQYAVAL L+E+G  V+GVL
Sbjct  110  LTTDDLLRAID-CGTSEGGPNG-RHWVLDPIDGTKGFLRGDQYAVALGLLEEGKVVLGVL  167

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL             I     S+++ E    GC+ +A  G G  +MQPL      
Sbjct  168  ACPNLPLTS-----------IAGNKNSSSSDEI---GCLFFATIGSGT-YMQPL------  206

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
             +  +   ++  SS+E+P  A+F  + E A S H  ++ + S LG +   +R+ S  KY 
Sbjct  207  -DSKSEPVKVHVSSVENPEEASFFESFEGAHSLHDLSSSIASKLGVKAPPVRIDSQAKYG  265

Query  558  AIARG  572
            A++RG
Sbjct  266  ALSRG  270



>emb|CDX84472.1| BnaC03g50280D [Brassica napus]
Length=407

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 94/185 (51%), Gaps = 29/185 (16%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++  I+ C  + G  N  R W L       G LRGDQYAVAL L+E+G  V+GVL
Sbjct  160  LTTDDLLRAID-CGTSEGGPNG-RHWVLDPIDGTKGFLRGDQYAVALGLLEEGKVVLGVL  217

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL              ++   +  +S   + GC+ YA  G G  +MQPL      
Sbjct  218  ACPNLPLTS------------IAGNKNKNSSSSEETGCLFYATIGSGT-YMQPL------  258

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
             +  +   ++  SS+E+P  A+F  + E A S H  ++ + + LG +   +R+ S  KY 
Sbjct  259  -DSKSEPVKVHVSSVENPEEASFFESFEGAHSLHDLSSSIANKLGVKAPPVRIDSQAKYG  317

Query  558  AIARG  572
            A++RG
Sbjct  318  ALSRG  322



>ref|XP_007294300.1| 3',5'-bisphosphate nucleotidase [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD15195.1| 3',5'-bisphosphate nucleotidase [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=354

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 95/193 (49%), Gaps = 28/193 (15%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP E+L  + +++ I+    A G  N  R WAL       G LRG QYAV L+L+ DG
Sbjct  103  LGGPIESL--DAMLDAIDAGNSAGG--NKGRIWALDPIDGTKGFLRGGQYAVCLALMVDG  158

Query  177  APVVGVLGCPNYPLKKEW-LSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQ  353
               VGVLGCPN P+     L+ + G  +          ++   KG +  A +G G A  +
Sbjct  159  DVKVGVLGCPNLPIDDAAPLTAESGVDQ----------TDAEGKGVLFAAVKGQG-AISR  207

Query  354  PLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLR  533
            PL   G        S+ I+   ++    ATFC +VE   SSH     + + LG   Q +R
Sbjct  208  PLGAAG-----LGRSQAIQMKPVQDLEQATFCESVEAGHSSHGDQFAIATKLGVTKQSVR  262

Query  534  VYSSMKYAAIARG  572
            + S  KYA+IARG
Sbjct  263  MDSQAKYASIARG  275



>ref|XP_009150465.1| PREDICTED: SAL1 phosphatase [Brassica rapa]
Length=405

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 92/185 (50%), Gaps = 31/185 (17%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++   + C  + G  N  R W L       G LRGDQYAVAL L+E+G  V+GVL
Sbjct  160  LTTDDLLRATD-CGTSEGGPNG-RHWVLDPIDGTKGFLRGDQYAVALGLLEEGKVVLGVL  217

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL               S   +  +S   + GC+ YA  G G  +MQPL      
Sbjct  218  ACPNLPLT--------------SIAGNKNSSSSEETGCLFYATIGSGT-YMQPL------  256

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
             +  +   ++  SS+E+P  A+F  + E A S H  ++ + S LG +   +R+ S  KY 
Sbjct  257  -DSKSDPVKVHVSSVENPEEASFFESFEGAHSLHDLSSSIASKLGVKAPPVRIDSQAKYG  315

Query  558  AIARG  572
            A++RG
Sbjct  316  ALSRG  320



>ref|XP_002984282.1| hypothetical protein SELMODRAFT_234473 [Selaginella moellendorffii]
 gb|EFJ14792.1| hypothetical protein SELMODRAFT_234473 [Selaginella moellendorffii]
Length=330

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 88/185 (48%), Gaps = 35/185 (19%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  E+++  I+  K   GA    R W L       G LRG+QYA+AL+L++ G+ V+GVL
Sbjct  93   LSSEDVLCAIDRGKAEGGAQG--RHWVLDPIDGTKGFLRGEQYAIALALLDQGSVVLGVL  150

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
            GCPN PL                   S   S P   GC+  A RG G   + P+      
Sbjct  151  GCPNLPLSG----------------LSDDGSSP--VGCLFTAVRGAGTT-LHPI------  185

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
             +     ++++ S +  P +A FC + E A S H  T+G+   LG     +R+ S  KY 
Sbjct  186  -DGSLQPRKVRVSDLSDPALAAFCESYESAHSKHDLTSGIAKMLGVTASPIRMDSQAKYG  244

Query  558  AIARG  572
            A+ARG
Sbjct  245  AMARG  249



>ref|XP_010930654.1| PREDICTED: SAL1 phosphatase-like [Elaeis guineensis]
Length=427

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 94/185 (51%), Gaps = 32/185 (17%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  E+++  I++ K   G N   R W L       G LRGDQYA+AL+L+++G  V+GVL
Sbjct  183  LSEEDVLVAIDSGKSEGGRNG--RHWVLDPIDGTKGFLRGDQYAIALALLDEGRVVLGVL  240

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL    +  ++              S  +  GC+  A+ GDG A+MQ L      
Sbjct  241  ACPNLPLTSIAIPDEH--------------SSHKQVGCLFSAKIGDG-AFMQSL------  279

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
                +SS +I  S+IE+   A+F  + E A S H  ++ +   LG +   +R+ S  KY 
Sbjct  280  --NGSSSAKIHVSAIENSKDASFFESFEAAHSMHDLSSVIAEKLGVQAPPVRIDSQAKYG  337

Query  558  AIARG  572
            A+ARG
Sbjct  338  ALARG  342



>gb|KHG00224.1| SAL1 phosphatase -like protein [Gossypium arboreum]
Length=385

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 95/186 (51%), Gaps = 34/186 (18%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  E +++ I+  +   G+    R W L       G LRGDQYA+AL+L+E G  V+GVL
Sbjct  144  LSTEGVLKAIDNGRSEGGSQG--RHWVLDPIDGTKGFLRGDQYAIALALLEGGKVVLGVL  201

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDK-GCVMYARRGDGNAWMQPLLPGGK  374
             CPN P               L+ L+ A    P +K GC+ +A  G G  +MQPL     
Sbjct  202  ACPNLP---------------LTSLSDAGQHSPNNKVGCLFFAVVG-GGTYMQPL-----  240

Query  375  MFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKY  554
                 +S+ +++ S++E+P  A+F  + E A S H  ++ +   LG +   +R+ S  KY
Sbjct  241  ---DGSSAVKVQVSAVENPEEASFFESYEAAHSMHDLSSLIAQKLGVKAPPVRIDSQAKY  297

Query  555  AAIARG  572
             A++RG
Sbjct  298  GALSRG  303



>gb|AGE13642.1| 3'-phosphoadenosine 5'-phosphatase [Aureobasidium pullulans]
Length=356

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 94/193 (49%), Gaps = 28/193 (15%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP E+   + ++E ++      G  N  R WAL       G LRG QYAV L+L+ DG
Sbjct  104  LGGPIES--DDRMLEVLDQGNSQGG--NKGRIWALDPIDGTKGFLRGGQYAVCLALMVDG  159

Query  177  APVVGVLGCPNYPLKK-EWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQ  353
               VGVLGCPN P+   E L+   G          A AS+   KG +M A  G G A  +
Sbjct  160  DVKVGVLGCPNLPIDDSEPLTEDLG----------ANASDAEGKGVLMSAILGKG-ADSR  208

Query  354  PLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLR  533
            PL  G        ++  I    ++    ATFC +VE A S+H   A + S LG     +R
Sbjct  209  PLTRGA-----LKNATTISMKRVDDISSATFCESVEAAHSAHGDQAQIASKLGITKPSVR  263

Query  534  VYSSMKYAAIARG  572
            + S  KYA+IARG
Sbjct  264  MDSQAKYASIARG  276



>gb|KDP39401.1| hypothetical protein JCGZ_03683 [Jatropha curcas]
Length=349

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 96/186 (52%), Gaps = 34/186 (18%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  E++++ I++ K   G++   R W L       G LRGDQYA+AL L+E+G  V+G L
Sbjct  108  LSTEDVLKAIDSGKSEGGSHG--RHWVLDPIDGTKGFLRGDQYAIALGLLEEGKVVLGAL  165

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPR-DKGCVMYARRGDGNAWMQPLLPGGK  374
             CPN P               LS + SA  S    + GC+ +A  G G  +MQPL     
Sbjct  166  ACPNLP---------------LSSIGSANQSPLHGEIGCLFFAEVGTGT-YMQPL-----  204

Query  375  MFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKY  554
              N  ++ K ++ S+I++P  A+F  + E A S H  ++ +   LG +   +R+ S  KY
Sbjct  205  --NGASAVK-VQVSAIDNPEEASFFESYEAAHSMHDLSSSIAKKLGVKAPPVRIDSQAKY  261

Query  555  AAIARG  572
             A+ARG
Sbjct  262  GALARG  267



>gb|KEQ87317.1| 3'-phosphoadenosine 5'-phosphatase [Aureobasidium pullulans EXF-150]
Length=407

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 94/193 (49%), Gaps = 28/193 (15%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP E+   + ++E ++      G  N  R WAL       G LRG QYAV L+L+ DG
Sbjct  155  LGGPIES--DDRMLEVLDQGNSQGG--NKGRIWALDPIDGTKGFLRGGQYAVCLALMVDG  210

Query  177  APVVGVLGCPNYPLKK-EWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQ  353
               VGVLGCPN P+   E L+   G          A AS+   KG +M A  G G A  +
Sbjct  211  DVKVGVLGCPNLPIDDSEPLTEDLG----------ANASDAEGKGVLMSAILGKG-ADSR  259

Query  354  PLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLR  533
            PL  G        ++  I    ++    ATFC +VE A S+H   A + S LG     +R
Sbjct  260  PLTRGAL-----KNATTISMKRVDDISSATFCESVEAAHSAHGDQAQIASKLGITKPSVR  314

Query  534  VYSSMKYAAIARG  572
            + S  KYA+IARG
Sbjct  315  MDSQAKYASIARG  327



>gb|KEQ61447.1| 3'-phosphoadenosine 5'-phosphatase [Aureobasidium melanogenum 
CBS 110374]
Length=356

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 94/193 (49%), Gaps = 28/193 (15%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP E+   + +++ ++    A+   N  R WAL       G LRG QYAV L+L+ DG
Sbjct  104  LGGPIES--DDRMLDVLDMG--ASQGGNKGRIWALDPIDGTKGFLRGGQYAVCLALMVDG  159

Query  177  APVVGVLGCPNYPLKKEW-LSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQ  353
               VGVLGCPN P+     L+   G          A A++   KG +M A  G G A  +
Sbjct  160  DVKVGVLGCPNLPIDDSAPLTEDLG----------ANATDAEGKGVLMSAILGKG-ADSR  208

Query  354  PLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLR  533
            PL  G      P S K +   S      ATFC +VE A S+H   A + S LG     +R
Sbjct  209  PLTRGALKSATPISMKTVDQLS-----NATFCESVEAAHSAHGDQAQIASKLGITKPSVR  263

Query  534  VYSSMKYAAIARG  572
            + S  KYA+IARG
Sbjct  264  MDSQAKYASIARG  276



>gb|ABU96741.1| SAL1-like protein [Glycine max]
Length=349

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 93/185 (50%), Gaps = 32/185 (17%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++  I+  K   G+    R W L       G +RGDQYA+AL+L+++G  V+GVL
Sbjct  108  LTTDDVLAAIDGGKSEGGS--VGRHWVLDPIDGTKGFVRGDQYAIALALLDEGKVVLGVL  165

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL     + Q               S   + GC+ +A+ GDG  +MQ L  GG  
Sbjct  166  ACPNLPLASIGSNQQL--------------SSSNEVGCLFFAKVGDGT-YMQAL--GG--  206

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
                ++  ++    I++P  A+F  + E A SSH  ++ +   LG +   +R+ S  KY 
Sbjct  207  ----STQTRVHVCDIDNPEEASFFESFEAAHSSHDLSSSIAEKLGVKAPPVRIDSQAKYG  262

Query  558  AIARG  572
            A++RG
Sbjct  263  ALSRG  267



>gb|KFK28088.1| hypothetical protein AALP_AA8G470800 [Arabis alpina]
Length=400

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 92/185 (50%), Gaps = 32/185 (17%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++ TI+      G N   R W L       G LRGDQYAVAL L+E+G  V+GVL
Sbjct  157  LSTDDLLRTIDYGSSEGGPNG--RHWVLDPIDGTKGFLRGDQYAVALGLLEEGKVVLGVL  214

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN P               L+ +    +S   + GC+ +A  G G  +MQ       +
Sbjct  215  ACPNLP---------------LASIAGNKSSSSDEMGCLFFATIGSGT-YMQ-------L  251

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
             +  +   +++ SS+E+P  A+F  + E A S H  ++ + + LG +   +R+ S  KY 
Sbjct  252  LDSKSPPAKVQVSSVENPEEASFFESFEGAHSLHDLSSSIANKLGVKAPPVRIDSQAKYG  311

Query  558  AIARG  572
            A++RG
Sbjct  312  ALSRG  316



>gb|KEQ94175.1| hypothetical protein AUEXF2481DRAFT_66798 [Aureobasidium subglaciale 
EXF-2481]
Length=356

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 95/193 (49%), Gaps = 28/193 (15%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP E+   + ++E ++    A+   N  R WAL       G LRG QYAV L+L+ DG
Sbjct  104  LGGPIES--DDRMLEVLDMG--ASQGGNKGRIWALDPIDGTKGFLRGGQYAVCLALMVDG  159

Query  177  APVVGVLGCPNYPLKKEW-LSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQ  353
               VGVLGCPN P+     L+   G          A A++   KG +M A  G G A  +
Sbjct  160  DVKVGVLGCPNLPIDDSAPLTEDLG----------ANANDSEGKGVLMSAILGKG-ADSR  208

Query  354  PLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLR  533
            PL  G        ++  I   +++    ATFC +VE A S+H   A + S LG     +R
Sbjct  209  PLTAGA-----LKNATSISMKTVDDLSSATFCESVEAAHSAHGDQAQIASKLGITKPSVR  263

Query  534  VYSSMKYAAIARG  572
            + S  KYA+IARG
Sbjct  264  MDSQAKYASIARG  276



>ref|XP_003299772.1| hypothetical protein PTT_10831 [Pyrenophora teres f. teres 0-1]
 gb|EFQ92130.1| hypothetical protein PTT_10831 [Pyrenophora teres f. teres 0-1]
Length=354

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 76/162 (47%), Gaps = 22/162 (14%)
 Frame = +3

Query  108  RFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILS  266
            R WAL       G LRG QYAV L L+ DG P VGV+GCPN P+           Q  L 
Sbjct  128  RIWALDPIDGTKGFLRGGQYAVCLGLLVDGIPTVGVIGCPNLPVDD---------QAPLD  178

Query  267  RLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATF  446
              T   A +   KG +  A +G G A  +PL  GG     P + K +   S      ATF
Sbjct  179  ATTGQDADDKEGKGVLFGAVKGQG-ATSRPLSKGGLQTPKPITMKPLPDVS-----QATF  232

Query  447  CHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIARG  572
            C +VE   SS    A + S LG     +R+ S  KY +IARG
Sbjct  233  CESVEAGHSSQGDNAAIASKLGITKPSVRMDSQAKYGSIARG  274



>ref|XP_010090832.1| SAL1 phosphatase [Morus notabilis]
 gb|EXB40957.1| SAL1 phosphatase [Morus notabilis]
Length=356

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 97/188 (52%), Gaps = 29/188 (15%)
 Frame = +3

Query  30   AEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVV  188
            A AL  E+++  I++    +   ++ R W L       G LRGDQYA+AL+L+++G  V+
Sbjct  109  AAALSTEDVLRAIDSG--KSEGGSSGRHWVLDPIDGTKGFLRGDQYAIALALLDEGKVVL  166

Query  189  GVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPG  368
            GVL CPN PL     + Q+  +    ++           GC+ +A+ G+G  +MQ L   
Sbjct  167  GVLACPNLPLTSFGANKQHSSESSNDKI-----------GCLFFAKVGEGT-YMQSL---  211

Query  369  GKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSM  548
                   +S  ++  S+IE+P  A+F  + E A S H  ++ +   LG +   +R+ S  
Sbjct  212  -----DGSSPIKVHISAIENPEEASFFESFEAAHSLHDLSSAIAKKLGVKAPPVRIDSQA  266

Query  549  KYAAIARG  572
            KY A++RG
Sbjct  267  KYGALSRG  274



>ref|XP_010649361.1| PREDICTED: SAL1 phosphatase isoform X3 [Vitis vinifera]
Length=349

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 91/182 (50%), Gaps = 32/182 (18%)
 Frame = +3

Query  48   EEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCP  206
            E+++  I++ K   G+N   + W L       G LRGDQYA+AL+L+++G  V+GVL CP
Sbjct  111  EDVLTAIDSGKSEGGSNG--QHWVLDPIDGTKGFLRGDQYAIALALLDEGKVVLGVLACP  168

Query  207  NYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNW  386
            N PL       Q+     +              GC+  A+ G+G   MQPL         
Sbjct  169  NLPLASIGGQDQHSLHNQI--------------GCLFSAKIGEGTD-MQPL--------D  205

Query  387  PNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIA  566
             +S  ++  S+IE+P  A+F  + E A S H  ++ +   LG +   +R+ S  KY A++
Sbjct  206  GSSPIKVHVSAIENPEEASFFESFEAAHSKHDLSSSIAKKLGVKAPPVRIDSQAKYGALS  265

Query  567  RG  572
            RG
Sbjct  266  RG  267



>dbj|BAJ33755.1| unnamed protein product [Thellungiella halophila]
Length=363

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 95/188 (51%), Gaps = 29/188 (15%)
 Frame = +3

Query  30   AEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVV  188
            A  L  ++++  I+ C  + G     R W L       G LRGDQYAVAL L+E+G  V+
Sbjct  114  APTLSTDDLLRAID-CGTSEGGPTG-RHWVLDPIDGTKGFLRGDQYAVALGLLEEGKVVL  171

Query  189  GVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPG  368
            GVL CPN PL              ++   +  +S   + GC+ +A  G G  +MQPL   
Sbjct  172  GVLACPNLPLAS------------IAGNNNNKSSSSDEIGCLFFATIGSGT-YMQPL---  215

Query  369  GKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSM  548
                +  +   +++ SS+E+P  A+F  + E A S H  ++ + + LG +   +R+ S  
Sbjct  216  ----DSKSDPVKVQVSSVENPEEASFFESFEGAHSLHDLSSSIANKLGVKAPPVRIDSQA  271

Query  549  KYAAIARG  572
            KY A++RG
Sbjct  272  KYGALSRG  279



>gb|KEQ74282.1| 3'-phosphoadenosine 5'-phosphatase [Aureobasidium pullulans var. 
namibiae CBS 147.97]
Length=356

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 94/193 (49%), Gaps = 28/193 (15%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP E+   + +++ ++    A+   N  R WAL       G LRG QYAV L+L+ DG
Sbjct  104  LGGPIES--DDRMLDVLDMG--ASQGGNKGRIWALDPIDGTKGFLRGGQYAVCLALMVDG  159

Query  177  APVVGVLGCPNYPLKKEW-LSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQ  353
               VGVLGCPN P+     L+   G          A A++   KG +M A  G G A  +
Sbjct  160  DVKVGVLGCPNLPIDDSAPLTEDLG----------ANATDSEGKGVLMSAILGKG-ADSR  208

Query  354  PLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLR  533
            PL  G         +  I   +++    ATFC +VE A S+H   A + S LG     +R
Sbjct  209  PLTRGA-----LKDATTISMKTVDDISSATFCESVEAAHSAHGDQAQIASKLGITKPSVR  263

Query  534  VYSSMKYAAIARG  572
            + S  KYA+IARG
Sbjct  264  MDSQAKYASIARG  276



>gb|KHN28944.1| SAL1 phosphatase [Glycine soja]
Length=404

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 93/185 (50%), Gaps = 32/185 (17%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++  I+  K   G+    R W L       G +RGDQYA+AL+L+ +G  V+GVL
Sbjct  163  LTTDDVLAAIDGGKSEGGS--VGRHWVLDPIDGTKGFVRGDQYAIALALLHEGKIVLGVL  220

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL     + Q+              S   + GC+ +A+ GDG  +MQ L  GG  
Sbjct  221  ACPNLPLASIGSNQQH--------------SSSNEVGCLFFAKVGDGT-YMQAL--GG--  261

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
                ++  ++    I++P  A+F  + E A SSH  ++ +   LG +   +R+ S  KY 
Sbjct  262  ----STQTRVHVCDIDNPEEASFFESFEAAHSSHDLSSSIAEKLGVKAPPVRIDSQAKYG  317

Query  558  AIARG  572
            A++RG
Sbjct  318  ALSRG  322



>ref|XP_010649362.1| PREDICTED: SAL1 phosphatase isoform X4 [Vitis vinifera]
 emb|CBI37525.3| unnamed protein product [Vitis vinifera]
Length=339

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 91/182 (50%), Gaps = 32/182 (18%)
 Frame = +3

Query  48   EEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCP  206
            E+++  I++ K   G+N   + W L       G LRGDQYA+AL+L+++G  V+GVL CP
Sbjct  101  EDVLTAIDSGKSEGGSNG--QHWVLDPIDGTKGFLRGDQYAIALALLDEGKVVLGVLACP  158

Query  207  NYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNW  386
            N PL       Q+     +              GC+  A+ G+G   MQPL         
Sbjct  159  NLPLASIGGQDQHSLHNQI--------------GCLFSAKIGEGTD-MQPL--------D  195

Query  387  PNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIA  566
             +S  ++  S+IE+P  A+F  + E A S H  ++ +   LG +   +R+ S  KY A++
Sbjct  196  GSSPIKVHVSAIENPEEASFFESFEAAHSKHDLSSSIAKKLGVKAPPVRIDSQAKYGALS  255

Query  567  RG  572
            RG
Sbjct  256  RG  257



>ref|XP_003531104.1| PREDICTED: SAL1 phosphatase [Glycine max]
Length=404

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 93/185 (50%), Gaps = 32/185 (17%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++  I+  K   G+    R W L       G +RGDQYA+AL+L+++G  V+GVL
Sbjct  163  LTTDDVLAAIDGGKSEGGS--VGRHWVLDPIDGTKGFVRGDQYAIALALLDEGKVVLGVL  220

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL     + Q               S   + GC+ +A+ GDG  +MQ L  GG  
Sbjct  221  ACPNLPLASIGSNQQL--------------SSSNEVGCLFFAKVGDGT-YMQAL--GG--  261

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
                ++  ++    I++P  A+F  + E A SSH  ++ +   LG +   +R+ S  KY 
Sbjct  262  ----STQTRVHVCDIDNPEEASFFESFEAAHSSHDLSSSIAEKLGVKAPPVRIDSQAKYG  317

Query  558  AIARG  572
            A++RG
Sbjct  318  ALSRG  322



>ref|XP_006580055.1| PREDICTED: SAL1 phosphatase-like isoform X2 [Glycine max]
Length=349

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 93/185 (50%), Gaps = 32/185 (17%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++  I++ K   G+    R W L       G +RGDQYA+AL+L+ +G  V+GVL
Sbjct  108  LTTDDVLVAIDSGKSEGGS--VGRHWVLDPIDGTKGFVRGDQYAIALALLHEGKIVLGVL  165

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL     + Q+              S   + GC+ +A+ GDG  +MQ L  GG  
Sbjct  166  ACPNLPLASIGSNQQH--------------SSSNEVGCLFFAKVGDGT-YMQAL--GG--  206

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
                ++  ++    I++P  A+F  + E A S H  ++ +   LG +   +R+ S  KY 
Sbjct  207  ----STQTRVHVCDIDNPEEASFFESFEAAHSLHDLSSSIAEKLGVKAPPVRIDSQAKYG  262

Query  558  AIARG  572
            A++RG
Sbjct  263  ALSRG  267



>gb|KGN48346.1| hypothetical protein Csa_6G483280 [Cucumis sativus]
Length=396

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 92/188 (49%), Gaps = 32/188 (17%)
 Frame = +3

Query  30   AEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVV  188
            A  L  E+++  I++ K   G     R W L       G LRGDQYA+AL+L++DG  V+
Sbjct  151  ASTLTAEDVLRAIDSGKSEGGPTG--RHWVLDPIDGTKGFLRGDQYAIALALLDDGKVVL  208

Query  189  GVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPG  368
            GVL CPN PL     S Q+              S   D GC+ ++  G G  +MQ  L G
Sbjct  209  GVLACPNLPLGPINSSNQH--------------SLLGDVGCLFFSTIGAGT-YMQS-LTG  252

Query  369  GKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSM  548
              +        ++  S+ E+P  A+F  + E A S H  T+ +  +LG +   +R+ S  
Sbjct  253  STL-------TKVSVSATENPEEASFFESYEAAHSLHDLTSSIAQNLGVKAPPVRIDSQA  305

Query  549  KYAAIARG  572
            KY A++RG
Sbjct  306  KYGALSRG  313



>ref|XP_010649360.1| PREDICTED: SAL1 phosphatase isoform X2 [Vitis vinifera]
Length=367

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 91/182 (50%), Gaps = 32/182 (18%)
 Frame = +3

Query  48   EEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCP  206
            E+++  I++ K   G+N   + W L       G LRGDQYA+AL+L+++G  V+GVL CP
Sbjct  129  EDVLTAIDSGKSEGGSNG--QHWVLDPIDGTKGFLRGDQYAIALALLDEGKVVLGVLACP  186

Query  207  NYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNW  386
            N PL       Q+     +              GC+  A+ G+G   MQPL         
Sbjct  187  NLPLASIGGQDQHSLHNQI--------------GCLFSAKIGEGTD-MQPL--------D  223

Query  387  PNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIA  566
             +S  ++  S+IE+P  A+F  + E A S H  ++ +   LG +   +R+ S  KY A++
Sbjct  224  GSSPIKVHVSAIENPEEASFFESFEAAHSKHDLSSSIAKKLGVKAPPVRIDSQAKYGALS  283

Query  567  RG  572
            RG
Sbjct  284  RG  285



>ref|XP_004163045.1| PREDICTED: SAL1 phosphatase-like [Cucumis sativus]
Length=396

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 92/188 (49%), Gaps = 32/188 (17%)
 Frame = +3

Query  30   AEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVV  188
            A  L  E+++  I++ K   G     R W L       G LRGDQYA+AL+L++DG  V+
Sbjct  151  ASTLTAEDVLRAIDSGKSEGGPTG--RHWVLDPIDGTKGFLRGDQYAIALALLDDGKVVL  208

Query  189  GVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPG  368
            GVL CPN PL     S Q+              S   D GC+ ++  G G  +MQ  L G
Sbjct  209  GVLACPNLPLGPINSSNQH--------------SLLGDVGCLFFSTIGAGT-YMQS-LTG  252

Query  369  GKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSM  548
              +        ++  S+ E+P  A+F  + E A S H  T+ +  +LG +   +R+ S  
Sbjct  253  STL-------TKVSVSATENPEEASFFESYEAAHSLHDLTSSIAQNLGVKAPPVRIDSQA  305

Query  549  KYAAIARG  572
            KY A++RG
Sbjct  306  KYGALSRG  313



>ref|XP_004148661.1| PREDICTED: SAL1 phosphatase-like [Cucumis sativus]
Length=396

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 92/188 (49%), Gaps = 32/188 (17%)
 Frame = +3

Query  30   AEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVV  188
            A  L  E+++  I++ K   G     R W L       G LRGDQYA+AL+L++DG  V+
Sbjct  151  ASTLTAEDVLRAIDSGKSEGGPTG--RHWVLDPIDGTKGFLRGDQYAIALALLDDGKVVL  208

Query  189  GVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPG  368
            GVL CPN PL     S Q+              S   D GC+ ++  G G  +MQ  L G
Sbjct  209  GVLACPNLPLGPINSSNQH--------------SLLGDVGCLFFSTIGAGT-YMQS-LTG  252

Query  369  GKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSM  548
              +        ++  S+ E+P  A+F  + E A S H  T+ +  +LG +   +R+ S  
Sbjct  253  STL-------TKVSVSATENPEEASFFESYEAAHSLHDLTSSIAQNLGVKAPPVRIDSQA  305

Query  549  KYAAIARG  572
            KY A++RG
Sbjct  306  KYGALSRG  313



>sp|Q42546.1|DPNP1_ARATH RecName: Full=SAL1 phosphatase; AltName: Full=3'(2'),5'-bisphosphate 
nucleotidase 1; AltName: Full=3'(2'),5'-bisphosphonucleoside 
3'(2')-phosphohydrolase 1; AltName: Full=DPNPase 1; 
AltName: Full=Inositol polyphosphate 1-phosphatase 1; Short=IPPase 
1; AltName: Full=Inositol-1,4-bisphosphate 1-phosphatase 
1; AltName: Full=Protein FIERY 1 [Arabidopsis thaliana]
 gb|AAC49263.1| 3'(2'),5'-bisphosphate nucleotidase [Arabidopsis thaliana]
 dbj|BAA96901.1| 3'(2'),5'-bisphosphate nucleotidase [Arabidopsis thaliana]
 gb|AAK58887.1| inositol polyphosphate 1-phosphatase FIERY1 [Arabidopsis thaliana]
 gb|AAO64928.1| At5g63980 [Arabidopsis thaliana]
 dbj|BAE99463.1| 3'(2'),5'-bisphosphate nucleotidase [Arabidopsis thaliana]
Length=353

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 96/185 (52%), Gaps = 30/185 (16%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++  I+ C  + G  N  R W L       G LRGDQYAVAL L+E+G  V+GVL
Sbjct  108  LSTDDLLRAID-CGTSEGGPNG-RHWVLDPIDGTKGFLRGDQYAVALGLLEEGKVVLGVL  165

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL             I     + ++S+  + GC+ +A  G G  +MQ       +
Sbjct  166  ACPNLPLAS-----------IAGNNKNKSSSD--EIGCLFFATIGSGT-YMQ-------L  204

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
             +  +S  +++ SS+E+P  A+F  + E A S H  ++ + + LG +   +R+ S  KY 
Sbjct  205  LDSKSSPVKVQVSSVENPEEASFFESFEGAHSLHDLSSSIANKLGVKAPPVRIDSQAKYG  264

Query  558  AIARG  572
            A++RG
Sbjct  265  ALSRG  269



>ref|XP_002972451.1| hypothetical protein SELMODRAFT_97708 [Selaginella moellendorffii]
 gb|EFJ26537.1| hypothetical protein SELMODRAFT_97708 [Selaginella moellendorffii]
Length=334

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 84/185 (45%), Gaps = 35/185 (19%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  E+++  I+  K   G     R W L       G LRG+QYA+AL+L++ G+ V+GVL
Sbjct  97   LSSEDVLCAIDRGKAEGGVQG--RHWVLDPIDGTKGFLRGEQYAIALALLDRGSVVLGVL  154

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
            GCPN PL                   S   S P   GC+  A RG G             
Sbjct  155  GCPNLPLSG----------------LSDDGSSP--VGCLFTAVRGAGTTV--------HA  188

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
             +     ++++ S +  P +A FC + E A S H  T+G+   LG     +R+ S  KY 
Sbjct  189  IDRSVQPRKVRVSDLSDPALAAFCESYESAHSKHDLTSGIAKMLGVTASPIRMDSQAKYG  248

Query  558  AIARG  572
            A+ARG
Sbjct  249  AMARG  253



>ref|XP_001557036.1| hypothetical protein BC1G_04286 [Botrytis cinerea B05.10]
Length=332

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 93/195 (48%), Gaps = 32/195 (16%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP E++  + +++ I+    A GA    R WAL       G LRG QYAV L+L+ DG
Sbjct  103  LGGPVESV--DAMLDAIDAGNSAGGAKG--RIWALDPIDGTKGFLRGGQYAVCLALMVDG  158

Query  177  APVVGVLGCPNYPLKKEW-LSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQ  353
               VGVLGCPN P+     LS   G            AS+   KG +  A  G G A  +
Sbjct  159  DVKVGVLGCPNLPVDDSAPLSADAGKD----------ASDDEGKGVLFSAVLGQG-ATSR  207

Query  354  PLLPG--GKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQ  527
            PL  G  GK       S Q+KP  +     ATFC +VE   SSH     + + LG     
Sbjct  208  PLGTGALGK-----GQSIQMKP--VTDLTQATFCESVEAGHSSHGDQHAIATKLGVTKAS  260

Query  528  LRVYSSMKYAAIARG  572
            +R+ S  KY +IARG
Sbjct  261  VRMDSQAKYGSIARG  275



>ref|WP_006927780.1| 3'-5'-bisphosphate nucleotidase [Caldithrix abyssi]
 gb|EHO40749.1| 3'(2'),5'-bisphosphate nucleotidase [Caldithrix abyssi DSM 13497]
Length=317

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 59/181 (33%), Positives = 88/181 (49%), Gaps = 43/181 (24%)
 Frame = +3

Query  48   EEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCP  206
            ++I+++I+      GA     FW L       G LR DQYA+AL+L++DG PV+GVLGCP
Sbjct  95   DQILDSIDLGNGEPGA----LFWTLDPIDGTKGFLRKDQYAIALALLKDGQPVLGVLGCP  150

Query  207  NYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNW  386
            N P   +                        D+G +MYA +G+G A+  PL  GG     
Sbjct  151  NLPFNGQ-----------------------ADRGTLMYAIKGEG-AFTLPL--GG-----  179

Query  387  PNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIA  566
               +KQ+  S  +   +  F  +VE   ++HS    L +  G R + +R  S +KYA +A
Sbjct  180  -GEAKQVHVSDNDPEDVVRFLESVEAGHANHSLQGRLMAHFGDRAKAVRFDSQVKYAVLA  238

Query  567  R  569
            R
Sbjct  239  R  239



>ref|XP_011022931.1| PREDICTED: SAL1 phosphatase-like [Populus euphratica]
Length=349

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 94/185 (51%), Gaps = 32/185 (17%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  E+I++ I+  K   G+    R W L       G LRGDQYA+AL+L+++G  V+G+L
Sbjct  108  LSTEDIVKAIDCGKSEGGSRG--RHWVLDPIDGTKGFLRGDQYAIALALLDEGKVVLGIL  165

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL     S   G Q  L          P + GC+ ++  G G  +MQPL      
Sbjct  166  ACPNLPLT----SIAGGSQHSL----------PGEVGCLFFSVVG-GGTYMQPL------  204

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
                +S+ +++ +S ++P  A+   + E A S H  ++ +   LG +   +R+ S  KY 
Sbjct  205  --DSSSAVKVQVNSTDNPEQASLFESYEAAHSMHDLSSSIVKKLGVKAPPVRIDSQAKYG  262

Query  558  AIARG  572
            A++RG
Sbjct  263  ALSRG  267



>emb|CCD54513.1| similar to 3'(2'),5'-bisphosphate nucleotidase [Botrytis cinerea 
T4]
 gb|EMR81218.1| putative 3 -bisphosphate nucleotidase protein [Botrytis cinerea 
BcDW1]
Length=355

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 93/195 (48%), Gaps = 32/195 (16%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP E++  + +++ I+    A GA    R WAL       G LRG QYAV L+L+ DG
Sbjct  103  LGGPVESV--DAMLDAIDAGNSAGGAKG--RIWALDPIDGTKGFLRGGQYAVCLALMVDG  158

Query  177  APVVGVLGCPNYPLKKEW-LSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQ  353
               VGVLGCPN P+     LS   G            AS+   KG +  A  G G A  +
Sbjct  159  DVKVGVLGCPNLPVDDSAPLSADAGKD----------ASDDEGKGVLFSAVLGQG-ATSR  207

Query  354  PLLPG--GKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQ  527
            PL  G  GK       S Q+KP  +     ATFC +VE   SSH     + + LG     
Sbjct  208  PLGTGALGK-----GQSIQMKP--VTDLTQATFCESVEAGHSSHGDQHAIATKLGVTKAS  260

Query  528  LRVYSSMKYAAIARG  572
            +R+ S  KY +IARG
Sbjct  261  VRMDSQAKYGSIARG  275



>ref|XP_010649359.1| PREDICTED: SAL1 phosphatase isoform X1 [Vitis vinifera]
Length=394

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 91/182 (50%), Gaps = 32/182 (18%)
 Frame = +3

Query  48   EEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCP  206
            E+++  I++ K   G+N   + W L       G LRGDQYA+AL+L+++G  V+GVL CP
Sbjct  156  EDVLTAIDSGKSEGGSNG--QHWVLDPIDGTKGFLRGDQYAIALALLDEGKVVLGVLACP  213

Query  207  NYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNW  386
            N PL       Q+     +              GC+  A+ G+G   MQPL         
Sbjct  214  NLPLASIGGQDQHSLHNQI--------------GCLFSAKIGEGTD-MQPL--------D  250

Query  387  PNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIA  566
             +S  ++  S+IE+P  A+F  + E A S H  ++ +   LG +   +R+ S  KY A++
Sbjct  251  GSSPIKVHVSAIENPEEASFFESFEAAHSKHDLSSSIAKKLGVKAPPVRIDSQAKYGALS  310

Query  567  RG  572
            RG
Sbjct  311  RG  312



>ref|XP_007689722.1| hypothetical protein COCMIDRAFT_27802 [Bipolaris oryzae ATCC 
44560]
 gb|EUC43740.1| hypothetical protein COCMIDRAFT_27802 [Bipolaris oryzae ATCC 
44560]
Length=354

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 75/162 (46%), Gaps = 22/162 (14%)
 Frame = +3

Query  108  RFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILS  266
            R WAL       G LRG QYAV L L+ DG P +GV+GCPN P+           Q  L 
Sbjct  128  RIWALDPIDGTKGFLRGGQYAVCLGLLVDGVPTLGVIGCPNLPVDD---------QAPLD  178

Query  267  RLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATF  446
              T   A +   KG +  A +G G A  +PL  G      P   K IK   +     ATF
Sbjct  179  VTTGQDADDKEGKGVLFAAVKGQG-ATSRPLSKG--TLQEP---KSIKMKPLSDVTQATF  232

Query  447  CHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIARG  572
            C +VE   SS    A + S LG     +R+ S  KY +IARG
Sbjct  233  CESVEAGHSSQGDNAAIASKLGITKPSVRMDSQAKYCSIARG  274



>ref|XP_005707634.1| 3'(2'), 5'-bisphosphate nucleotidase [Galdieria sulphuraria]
 gb|EME31114.1| 3'(2'), 5'-bisphosphate nucleotidase [Galdieria sulphuraria]
Length=336

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 86/187 (46%), Gaps = 36/187 (19%)
 Frame = +3

Query  33   EALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVG  191
            E L   E+ + ++      G N   R W L       G LRGDQY +AL+L++DGA  VG
Sbjct  126  EQLTDSEVCDLLDLGNRHMGTNE--RTWLLDPIDGTKGFLRGDQYCIALALLKDGAIRVG  183

Query  192  VLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGG  371
            +LGCPN PL                   ++        GC+ +A +G G A++Q +  G 
Sbjct  184  ILGCPNLPL-------------------ASVPPNSHKVGCIFHAAQGVG-AFVQEIERGA  223

Query  372  KMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMK  551
            +       S  I+ S +  P  ATFC + E   SSH  +  +   LG  N  +R+ S  K
Sbjct  224  E-------SYPIRVSDVSDPAWATFCESWEPGHSSHELSLEIAKILGVNNPSVRMDSQCK  276

Query  552  YAAIARG  572
            Y  +ARG
Sbjct  277  YGVVARG  283



>ref|XP_006394218.1| hypothetical protein EUTSA_v10004312mg [Eutrema salsugineum]
 gb|ESQ31504.1| hypothetical protein EUTSA_v10004312mg [Eutrema salsugineum]
Length=412

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 95/188 (51%), Gaps = 29/188 (15%)
 Frame = +3

Query  30   AEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVV  188
            A  L  ++++  I+ C  + G     R W L       G LRGDQYAVAL L+E+G  V+
Sbjct  163  APTLSTDDLLRAID-CGTSEGGPTG-RHWVLDPIDGTKGFLRGDQYAVALGLLEEGKVVL  220

Query  189  GVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPG  368
            GVL CPN PL              ++   +  +S   + GC+ +A  G G  +MQPL   
Sbjct  221  GVLACPNLPLAS------------IAGNNNNKSSSSDEIGCLFFATIGSGT-YMQPL---  264

Query  369  GKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSM  548
                +  +   +++ SS+E+P  A+F  + E A S H  ++ + + LG +   +R+ S  
Sbjct  265  ----DSKSDPVKVQVSSVENPEEASFFESFEGAHSLHDLSSSIANKLGVKAPPVRIDSQA  320

Query  549  KYAAIARG  572
            KY A++RG
Sbjct  321  KYGALSRG  328



>ref|XP_007711464.1| hypothetical protein COCCADRAFT_25603 [Bipolaris zeicola 26-R-13]
 gb|EUC34214.1| hypothetical protein COCCADRAFT_25603 [Bipolaris zeicola 26-R-13]
Length=354

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 77/162 (48%), Gaps = 22/162 (14%)
 Frame = +3

Query  108  RFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILS  266
            R WAL       G LRG QYAV L L+ DG P +GV+GCPN P+           Q  L 
Sbjct  128  RIWALDPIDGTKGFLRGGQYAVCLGLLVDGVPTLGVIGCPNLPVDD---------QAPLD  178

Query  267  RLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATF  446
              T   A +   KG +  A +G G A  +PL  G      P S K +KP  +     ATF
Sbjct  179  VTTGQDADDKEGKGVLFAAVKGQG-ATSRPLSKGA--LQEPKSIK-MKP--LSDVTQATF  232

Query  447  CHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIARG  572
            C +VE   SS    A + S LG     +R+ S  KY +IARG
Sbjct  233  CESVEAGHSSQGDNAAIASKLGITKPSVRMDSQAKYCSIARG  274



>ref|XP_003843978.1| similar to 3'(2'),5'-bisphosphate nucleotidase [Leptosphaeria 
maculans JN3]
 emb|CBY00499.1| similar to 3'(2'),5'-bisphosphate nucleotidase [Leptosphaeria 
maculans JN3]
Length=354

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 83/182 (46%), Gaps = 24/182 (13%)
 Frame = +3

Query  48   EEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCP  206
            +E++  +++     G  N  R WAL       G LRG QYAV L L+ DG P VGV+GCP
Sbjct  110  DEMLTALDSGNSEGG--NKGRIWALDPIDGTKGFLRGGQYAVCLGLLVDGVPTVGVIGCP  167

Query  207  NYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNW  386
            N P+           Q  +   T   A +   KG +  A +G G A  +PL         
Sbjct  168  NLPVDD---------QAPIDATTGQDADDKEGKGVLFSAVKGQG-ATSRPLTKASL----  213

Query  387  PNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIA  566
               SK+I    +     ATFC +VE   SS    A + S LG     +R+ S  KY +IA
Sbjct  214  -EGSKKISMKPLPDISQATFCESVEAGHSSQGDNAAIASKLGITKPSVRMDSQAKYGSIA  272

Query  567  RG  572
            RG
Sbjct  273  RG  274



>emb|CCT64384.1| probable MET22-protein ser/thr phosphatase [Fusarium fujikuroi 
IMI 58289]
Length=357

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 67/192 (35%), Positives = 96/192 (50%), Gaps = 27/192 (14%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP + +  ++++E I+  +  +   ++ R WA+       G LRG QYAV L L+ DG
Sbjct  105  LGGPIKDV--DDMLELID--RGGSQGGSSGRIWAIDPIDGTKGFLRGGQYAVCLGLMVDG  160

Query  177  APVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQP  356
               VGVLGCPN P+            R+ S + S A  E R  G V  A +G G A  +P
Sbjct  161  DVKVGVLGCPNLPVDDS--------ARLTSDIGSNATDEGR--GVVFSAVQGHG-ANSRP  209

Query  357  LLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRV  536
            L  G       ++ K I   SI+    ATFC +VE   S+H   A ++  LG   + +R+
Sbjct  210  LTSGA-----LSAEKPISMRSIDDLSKATFCESVEAGHSAHDDQALISKKLGITQESVRM  264

Query  537  YSSMKYAAIARG  572
             S  KY +IARG
Sbjct  265  DSQAKYGSIARG  276



>gb|EUN28018.1| hypothetical protein COCVIDRAFT_15131 [Bipolaris victoriae FI3]
Length=354

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 77/162 (48%), Gaps = 22/162 (14%)
 Frame = +3

Query  108  RFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILS  266
            R WAL       G LRG QYAV L L+ DG P +GV+GCPN P+           Q  L 
Sbjct  128  RIWALDPIDGTKGFLRGGQYAVCLGLLVDGVPTLGVIGCPNLPVDD---------QAPLD  178

Query  267  RLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATF  446
              T   A +   KG +  A +G G A  +PL  G      P S K +KP  +     ATF
Sbjct  179  VTTGQDADDKEGKGVLFAAVKGQG-ATSRPLSKGA--LQEPKSIK-MKP--LSDVTQATF  232

Query  447  CHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIARG  572
            C +VE   SS    A + S LG     +R+ S  KY +IARG
Sbjct  233  CESVEAGHSSQGDNAAIASKLGITKPSVRMDSQAKYCSIARG  274



>ref|XP_007783960.1| hypothetical protein W97_07901 [Coniosporium apollinis CBS 100218]
 gb|EON68643.1| hypothetical protein W97_07901 [Coniosporium apollinis CBS 100218]
Length=553

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 67/193 (35%), Positives = 92/193 (48%), Gaps = 29/193 (15%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP ++   +E+++ I+  + A GA    R WAL       G LRG QYAV L+L+ DG
Sbjct  303  LGGPVKS--EKEMLDMIDEGRSAGGAKG--RIWALDPIDGTKGFLRGGQYAVCLALMVDG  358

Query  177  APVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKG-CVMYARRGDGNAWMQ  353
               VGVLGCPN P+               ++L   A  +  D+G  V+++      A  +
Sbjct  359  DVKVGVLGCPNLPIDDS------------AQLDEKAGEDATDEGNGVLFSAVAGEGATSR  406

Query  354  PLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLR  533
            PL  GG         K I    IE    ATFC +VE A SSH     +   LG   + +R
Sbjct  407  PLTRGGLA-----EGKAIHMRKIEDITQATFCESVEAAHSSHGDQFEIAKKLGISKKSVR  461

Query  534  VYSSMKYAAIARG  572
            + S  KY +IARG
Sbjct  462  MDSQAKYGSIARG  474



>gb|EGU82355.1| hypothetical protein FOXB_07184 [Fusarium oxysporum Fo5176]
Length=357

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 67/192 (35%), Positives = 95/192 (49%), Gaps = 27/192 (14%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP + +  ++++E I+  +  +   ++ R WA+       G LRG QYAV L L+ DG
Sbjct  105  LGGPIKDV--DDMLELID--RGGSQGGSSGRIWAIDPIDGTKGFLRGGQYAVCLGLMVDG  160

Query  177  APVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQP  356
               VGVLGCPN P+            R+ S + S A  E R  G V  A +G G A  +P
Sbjct  161  DVKVGVLGCPNLPVDDS--------ARLTSDIGSNATDEGR--GVVFSAVQGHG-ANSRP  209

Query  357  LLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRV  536
            L  G      P S +     SI+    ATFC +VE   S+H   A ++  LG   + +R+
Sbjct  210  LTSGALAAEKPISMR-----SIDDLSKATFCESVEAGHSAHDDQALISKKLGITQESVRM  264

Query  537  YSSMKYAAIARG  572
             S  KY +IARG
Sbjct  265  DSQAKYGSIARG  276



>ref|XP_001690049.1| 3'(2'),5'-bisphosphate nucleotidase [Chlamydomonas reinhardtii]
 gb|EDP09787.1| 3'(2'),5'-bisphosphate nucleotidase [Chlamydomonas reinhardtii]
Length=347

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 90/189 (48%), Gaps = 22/189 (12%)
 Frame = +3

Query  27   PAEALCGEEIMETINTCKLAAGANNASRFWALGSLRGD-------QYAVALSLIEDGAPV  185
            P E L  E++++ I+      G +   R W L  + G        QY+V L +++DG  V
Sbjct  96   PGEVLSPEQVLDIIDLGASQGGPSG--RHWVLDPIDGTRGFVGMRQYSVCLGMLQDGEVV  153

Query  186  VGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLP  365
            +GVLGCPN P  +  +    G      RL+  A     D GC+ ++ RG G AW++PL  
Sbjct  154  LGVLGCPNLP--QGPVGDDDGATGSAQRLSGDA-----DVGCLFFSERGQG-AWVEPLQN  205

Query  366  GGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSS  545
             G       +  Q++ + +     A F  +VE   SSHS  A L   LG     LR+ S 
Sbjct  206  AGDA-----APAQVRVAEVTEGAEARFMESVESRHSSHSINAALARELGVVRPPLRMDSQ  260

Query  546  MKYAAIARG  572
            +KY  ++RG
Sbjct  261  VKYGLLSRG  269



>ref|XP_002864880.1| hypothetical protein ARALYDRAFT_496591 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41139.1| hypothetical protein ARALYDRAFT_496591 [Arabidopsis lyrata subsp. 
lyrata]
Length=406

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 93/185 (50%), Gaps = 29/185 (16%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++  I+ C  + G  N  R W L       G LRGDQYAVAL L+E+G  V+GVL
Sbjct  160  LSTDDLLRAID-CGTSEGGPNG-RHWVLDPIDGTKGFLRGDQYAVALGLLEEGKVVLGVL  217

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL              ++       S   + GC+ +A  G G  +MQ       +
Sbjct  218  ACPNLPLAS------------IAGNNKNNKSSSDEIGCLFFATIGSGT-YMQ-------L  257

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
             +  +S  +++ SS+E+P  A+F  + E A S H  ++ + + LG +   +R+ S  KY 
Sbjct  258  LDSKSSPVKVQVSSVENPEEASFFESFEGAHSLHDLSSSIANKLGVKAPPVRIDSQAKYG  317

Query  558  AIARG  572
            A++RG
Sbjct  318  ALSRG  322



>ref|XP_008441059.1| PREDICTED: SAL1 phosphatase-like [Cucumis melo]
Length=396

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 91/188 (48%), Gaps = 32/188 (17%)
 Frame = +3

Query  30   AEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVV  188
            A  L  E+++  I+  K   G     R W L       G LRGDQYA+AL+L++DG  V+
Sbjct  151  ASTLTAEDVLRAIDNGKSEGGP--IGRHWVLDPIDGTKGFLRGDQYAIALALLDDGKVVL  208

Query  189  GVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPG  368
            GVL CPN PL     S Q+              S   D GC+ ++  G G  +MQ L   
Sbjct  209  GVLACPNLPLGPINSSNQH--------------SLLGDVGCLFFSTVGAGT-YMQSL---  250

Query  369  GKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSM  548
                   ++  ++  S+ E+P  A+F  + E A S H  T+ +  +LG +   +R+ S  
Sbjct  251  -----TGSTLTKVSVSATENPEEASFFESYEAAHSLHDLTSAIAQNLGVKAPPVRIDSQA  305

Query  549  KYAAIARG  572
            KY A++RG
Sbjct  306  KYGALSRG  313



>ref|NP_201203.2| bifunctional 3'(2'),5'-bisphosphate nucleotidase and inositol 
polyphosphate 1-phosphatase [Arabidopsis thaliana]
 gb|AED97825.1| bifunctional 3'(2'),5'-bisphosphate nucleotidase and inositol 
polyphosphate 1-phosphatase [Arabidopsis thaliana]
Length=407

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 96/185 (52%), Gaps = 30/185 (16%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++  I+ C  + G  N  R W L       G LRGDQYAVAL L+E+G  V+GVL
Sbjct  162  LSTDDLLRAID-CGTSEGGPNG-RHWVLDPIDGTKGFLRGDQYAVALGLLEEGKVVLGVL  219

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL             I     + ++S+  + GC+ +A  G G  +MQ       +
Sbjct  220  ACPNLPLAS-----------IAGNNKNKSSSD--EIGCLFFATIGSGT-YMQ-------L  258

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
             +  +S  +++ SS+E+P  A+F  + E A S H  ++ + + LG +   +R+ S  KY 
Sbjct  259  LDSKSSPVKVQVSSVENPEEASFFESFEGAHSLHDLSSSIANKLGVKAPPVRIDSQAKYG  318

Query  558  AIARG  572
            A++RG
Sbjct  319  ALSRG  323



>ref|XP_004504666.1| PREDICTED: SAL1 phosphatase-like [Cicer arietinum]
Length=400

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 92/185 (50%), Gaps = 32/185 (17%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  +++++ I+  K   G     R W L       G +RGDQYA+AL+L+ +G  V+GVL
Sbjct  159  LTTDDVLKAIDNGKSEGGP--VGRHWVLDPIDGTKGFVRGDQYAIALALLHEGKVVLGVL  216

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL     + Q               S   + GCV +A+ GDG  +MQ L      
Sbjct  217  ACPNLPLATIGRNQQ--------------NSSSNEVGCVFFAKVGDGT-YMQAL------  255

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
                ++  ++  S++++P  A+F  + E A SSH  ++ +   LG +   +R+ S  KY 
Sbjct  256  --DGSTQTRVNVSAVDNPEEASFFESYEAAHSSHDLSSTIAEKLGVKAPPVRIDSQAKYG  313

Query  558  AIARG  572
            A++RG
Sbjct  314  ALSRG  318



>gb|KHN25913.1| SAL1 phosphatase [Glycine soja]
Length=393

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 93/185 (50%), Gaps = 32/185 (17%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++  I++ K   G+    R W L       G +RGDQYA+AL+L+ +G  V+GVL
Sbjct  152  LTTDDVLVAIDSGKSEGGS--VGRHWVLDPIDGTKGFVRGDQYAIALALLHEGKIVLGVL  209

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL     + Q+              S   + GC+ +A+ GDG  +MQ L  GG  
Sbjct  210  ACPNLPLASIGSNQQH--------------SSSNEVGCLFFAKVGDGT-YMQAL--GG--  250

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
                ++  ++    I++P  A+F  + E A S H  ++ +   LG +   +R+ S  KY 
Sbjct  251  ----STQTRVHVCDIDNPEEASFFESFEAAHSLHDLSSSIAEKLGVKAPPVRIDSQAKYG  306

Query  558  AIARG  572
            A++RG
Sbjct  307  ALSRG  311



>gb|ESZ92017.1| 3',5'-bisphosphate nucleotidase [Sclerotinia borealis F-4157]
Length=355

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 91/193 (47%), Gaps = 28/193 (15%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP E++  + +++ I+    A GA    R WAL       G LRG QYAV L+L+ DG
Sbjct  103  LGGPIESV--DAMLDAIDAGNSAGGAKG--RIWALDPIDGTKGFLRGGQYAVCLALMVDG  158

Query  177  APVVGVLGCPNYPLKKEW-LSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQ  353
               VGVLGCPN P+     LS   G            AS+   KG +  A  G G A  +
Sbjct  159  DVKVGVLGCPNLPVDDSAPLSADAGKD----------ASDDEGKGVLFSAVLGQG-ATSR  207

Query  354  PLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLR  533
            PL  G         S Q+KP  +     ATFC +VE   SSH     + + LG     +R
Sbjct  208  PLGTGAL---EKGQSIQMKP--VTDLTQATFCESVEAGHSSHGDQHAIATKLGVSKASVR  262

Query  534  VYSSMKYAAIARG  572
            + S  KY +IARG
Sbjct  263  MDSQAKYGSIARG  275



>ref|XP_007048420.1| Inositol monophosphatase family protein isoform 2 [Theobroma 
cacao]
 gb|EOX92577.1| Inositol monophosphatase family protein isoform 2 [Theobroma 
cacao]
Length=383

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 96/185 (52%), Gaps = 34/185 (18%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  E++++ I++ K   G+    R W L       G LRG QYA+AL+L++ G  V+GVL
Sbjct  145  LSTEDVLKAIDSGKSEGGSQG--RHWVLDPIDGTKGFLRGGQYAIALALLDRGKVVLGVL  202

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL    ++ Q+              S   + GC+ +A  G G ++MQPL      
Sbjct  203  ACPNLPLTP--INDQH--------------SPNNEVGCLFFAEVG-GGSYMQPL------  239

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
                +S+ +++ S IE+P  A+F  + E A S H  ++ +   LG +   +R+ S +KY 
Sbjct  240  --DSSSTVKVQVSGIENPEEASFFESYEAAHSMHDLSSLIAQKLGVKAPPVRIDSQVKYG  297

Query  558  AIARG  572
            A++RG
Sbjct  298  ALSRG  302



>ref|XP_007048419.1| Inositol monophosphatase family protein isoform 1 [Theobroma 
cacao]
 gb|EOX92576.1| Inositol monophosphatase family protein isoform 1 [Theobroma 
cacao]
Length=384

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 96/185 (52%), Gaps = 34/185 (18%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  E++++ I++ K   G+    R W L       G LRG QYA+AL+L++ G  V+GVL
Sbjct  145  LSTEDVLKAIDSGKSEGGSQG--RHWVLDPIDGTKGFLRGGQYAIALALLDRGKVVLGVL  202

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL    ++ Q+              S   + GC+ +A  G G ++MQPL      
Sbjct  203  ACPNLPLTP--INDQH--------------SPNNEVGCLFFAEVG-GGSYMQPL------  239

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
                +S+ +++ S IE+P  A+F  + E A S H  ++ +   LG +   +R+ S +KY 
Sbjct  240  --DSSSTVKVQVSGIENPEEASFFESYEAAHSMHDLSSLIAQKLGVKAPPVRIDSQVKYG  297

Query  558  AIARG  572
            A++RG
Sbjct  298  ALSRG  302



>ref|XP_001595976.1| hypothetical protein SS1G_02192 [Sclerotinia sclerotiorum 1980]
 gb|EDN99338.1| hypothetical protein SS1G_02192 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=355

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 92/193 (48%), Gaps = 28/193 (15%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP E++  + +++ I+    A GA    R WAL       G LRG QYAV L+L+ DG
Sbjct  103  LGGPVESV--DAMLDAIDAGNSAGGATG--RIWALDPIDGTKGFLRGGQYAVCLALMVDG  158

Query  177  APVVGVLGCPNYPLKKEW-LSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQ  353
               VGVLGCPN P+     LS   G            AS+   KG +  A  G G A  +
Sbjct  159  DVKVGVLGCPNLPVDDSAPLSADAGKD----------ASDDEGKGVLFSAVLGQG-ATSR  207

Query  354  PLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLR  533
            PL  G         S Q+KP +  S   ATFC +VE   SSH     + + LG     +R
Sbjct  208  PLGTGALA---KGQSIQMKPVTDLS--QATFCESVEAGHSSHGDQHAIATKLGVTKASVR  262

Query  534  VYSSMKYAAIARG  572
            + S  KY +IARG
Sbjct  263  MDSQAKYGSIARG  275



>ref|XP_001227165.1| hypothetical protein CHGG_09238 [Chaetomium globosum CBS 148.51]
 gb|EAQ85224.1| hypothetical protein CHGG_09238 [Chaetomium globosum CBS 148.51]
Length=355

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 91/195 (47%), Gaps = 32/195 (16%)
 Frame = +3

Query  30   AEALCG------EEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIE  170
            AE L G      ++++E ++  + A G     R W L       G LRG QYA+AL+L+E
Sbjct  100  AEGLLGGGVRDVDDLLEVVDLGRSAGG--REGRVWTLDPIDGTKGFLRGGQYALALALLE  157

Query  171  DGAPVVGVLGCPNYPLKKEW-LSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAW  347
            DG   VGVLGCPN P+     L+   G          A  S+   +G +  A  G G A 
Sbjct  158  DGEVKVGVLGCPNLPVDDAAPLTVDIG----------ANQSDDEGRGVIFSAVIGQG-AT  206

Query  348  MQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQ  527
             +PL  GG         K IK   +     A+FC +VE   S+ S +A +   LG     
Sbjct  207  SRPLSTGG-----LTEGKSIKMKEVTEMASASFCESVEAGHSNQSESAQIAQKLGITKPS  261

Query  528  LRVYSSMKYAAIARG  572
            +R+ S  KY +IARG
Sbjct  262  VRMDSQAKYGSIARG  276



>gb|ENH73919.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium oxysporum f. sp. 
cubense race 1]
Length=357

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 79/162 (49%), Gaps = 23/162 (14%)
 Frame = +3

Query  108  RFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILS  266
            R WA+       G LRG QYAV L L+ DG   VGVLGCPN P+            R+ S
Sbjct  131  RIWAIDPIDGTKGFLRGGQYAVCLGLMVDGDVKVGVLGCPNLPVDDS--------ARLTS  182

Query  267  RLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATF  446
             + S A  E R  G V  A +G G A  +PL  G      P S +     SI+    ATF
Sbjct  183  DIGSNATDEGR--GVVFSAVQGHG-ANSRPLTSGALAAEKPISMR-----SIDDLSKATF  234

Query  447  CHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIARG  572
            C +VE   S+H   A ++  LG   + +R+ S  KY +IARG
Sbjct  235  CESVEAGHSAHDDQALISKKLGITQESVRMDSQAKYGSIARG  276



>gb|KEH31396.1| 3'(2'),5'-bisphosphate nucleotidase [Medicago truncatula]
Length=270

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 93/186 (50%), Gaps = 32/186 (17%)
 Frame = +3

Query  36   ALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGV  194
            AL  ++++  I+  K   G+    R W L       G +RGDQYA+AL+L+++G  V+GV
Sbjct  52   ALTTDDVLNAIDNGKSEGGS--IGRHWVLDPIDGTKGFVRGDQYAIALALLDEGKVVLGV  109

Query  195  LGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGK  374
            L CPN PL     +  +              S   + GC+ +A+ G+G  +MQ L     
Sbjct  110  LACPNLPLGTIGPNQPH--------------SSSNEVGCLFFAKVGNG-TYMQAL-----  149

Query  375  MFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKY  554
                  +  ++  S++++P  A+F  + E A SSH  ++ +   LG +   +R+ S  KY
Sbjct  150  ---DGTTQTKVNVSTVDNPEEASFFESYEAAHSSHDLSSTIAVKLGVKAPPVRIDSQAKY  206

Query  555  AAIARG  572
             A++RG
Sbjct  207  GALSRG  212



>ref|XP_002309920.1| hypothetical protein POPTR_0007s04240g [Populus trichocarpa]
 gb|EEE90370.1| hypothetical protein POPTR_0007s04240g [Populus trichocarpa]
Length=349

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 94/185 (51%), Gaps = 32/185 (17%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  E+I++ I+  K   G+    R W L       G LRGDQYA+AL+L+++G  V+GVL
Sbjct  108  LSTEDIVKAIDCGKSEGGSRG--RHWVLDPIDGTKGFLRGDQYAIALALLDEGTVVLGVL  165

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL     S   G Q  L          P + GC+ ++  G G  +MQPL      
Sbjct  166  ACPNLPLP----SIAGGSQHSL----------PGEVGCLFFSVVG-GGTYMQPL------  204

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
                +S+ +++ ++ ++P  A+   + E A S H  ++ +   LG +   +R+ S  KY 
Sbjct  205  --DSSSAVKVQVNATDNPEEASLFESYEAAHSMHDLSSSIVKKLGVKAPPVRIDSQAKYG  262

Query  558  AIARG  572
            A++RG
Sbjct  263  ALSRG  267



>emb|CDP04674.1| unnamed protein product [Coffea canephora]
Length=347

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 92/190 (48%), Gaps = 32/190 (17%)
 Frame = +3

Query  24   GPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAP  182
            G A  L  ++++  I++ K   G  +  + W L       G LRGDQYA+AL L+++G  
Sbjct  101  GTASPLSDQDVLAAIDSGKSEGG--SLGQHWVLDPIDGTKGFLRGDQYAIALGLLDEGKV  158

Query  183  VVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLL  362
            V+GVL CPN PL+      Q+  Q                 GC+ +A+ G G  +MQ L 
Sbjct  159  VLGVLACPNLPLQSLACHDQHTIQ--------------GKAGCLFFAQVGTGT-YMQSL-  202

Query  363  PGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYS  542
                     +  +++  SS E+P  A+F  + E A S H  T+ +   LG +   +R+ S
Sbjct  203  -------DGSEPRKVHVSSTENPEEASFFESYEAAHSMHDLTSLIAKKLGVKAPPVRIDS  255

Query  543  SMKYAAIARG  572
              KY A++RG
Sbjct  256  QAKYGALSRG  265



>gb|EMD93429.1| hypothetical protein COCHEDRAFT_1020510 [Bipolaris maydis C5]
 gb|ENI07122.1| hypothetical protein COCC4DRAFT_31193 [Bipolaris maydis ATCC 
48331]
Length=416

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 77/162 (48%), Gaps = 22/162 (14%)
 Frame = +3

Query  108  RFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILS  266
            R WAL       G LRG QYAV L L+ DG P +GV+GCPN P+           Q  L 
Sbjct  190  RIWALDPIDGTKGFLRGGQYAVCLGLLVDGVPTLGVIGCPNLPVDD---------QAPLD  240

Query  267  RLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATF  446
              T   A +   KG +  A +G G A  +PL  G      P S K +KP  +     ATF
Sbjct  241  VTTGQDADDKEGKGVLFAAVKGQG-ATSRPLSKGA--LQEPKSIK-MKP--LSDVTQATF  294

Query  447  CHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIARG  572
            C +VE   SS    A + S LG     +R+ S  KY +IARG
Sbjct  295  CESVEAGHSSQGDNAAIASKLGITKPSVRMDSQAKYCSIARG  336



>gb|EXM02913.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium oxysporum f. sp. 
cubense tropical race 4 54006]
Length=408

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 95/194 (49%), Gaps = 31/194 (16%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP + +  ++++E I+  +  +   ++ R WA+       G LRG QYAV L L+ DG
Sbjct  156  LGGPIKDV--DDMLELID--RGGSQGGSSGRIWAIDPIDGTKGFLRGGQYAVCLGLMVDG  211

Query  177  APVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRD--KGCVMYARRGDGNAWM  350
               VGVLGCPN P+               +RLTS   S   D  +G V  A +G G A  
Sbjct  212  DVKVGVLGCPNLPVDDS------------ARLTSDIGSNATDEGRGVVFSAVQGHG-ANS  258

Query  351  QPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQL  530
            +PL  G      P S +     SI+    ATFC +VE   S+H   A ++  LG   + +
Sbjct  259  RPLTSGALAAEKPISMR-----SIDDLSKATFCESVEAGHSAHDDQALISKKLGITQESV  313

Query  531  RVYSSMKYAAIARG  572
            R+ S  KY +IARG
Sbjct  314  RMDSQAKYGSIARG  327



>gb|EWG42162.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium verticillioides 
7600]
 gb|EWG42163.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium verticillioides 
7600]
 gb|EWG42164.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium verticillioides 
7600]
 gb|EWG42165.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium verticillioides 
7600]
 gb|EWG42166.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium verticillioides 
7600]
 gb|EWG42167.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium verticillioides 
7600]
Length=408

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 95/194 (49%), Gaps = 31/194 (16%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP + +  ++++E I+  +  +   ++ R WA+       G LRG QYAV L L+ DG
Sbjct  156  LGGPIKDV--DDMLELID--RGGSQGGSSGRIWAIDPIDGTKGFLRGGQYAVCLGLMVDG  211

Query  177  APVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRD--KGCVMYARRGDGNAWM  350
               VGVLGCPN P+               +RLTS   S   D  +G V  A +G G A  
Sbjct  212  DVKVGVLGCPNLPVDDS------------ARLTSDIGSNATDEGRGVVFSAVQGHG-ANS  258

Query  351  QPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQL  530
            +PL  G      P S +     SI+    ATFC +VE   S+H   A ++  LG   + +
Sbjct  259  RPLTSGALAAEKPISMR-----SIDDLSKATFCESVEAGHSAHDDQALISKKLGITQESV  313

Query  531  RVYSSMKYAAIARG  572
            R+ S  KY +IARG
Sbjct  314  RMDSQAKYGSIARG  327



>gb|EXA47323.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium oxysporum f. sp. 
pisi HDV247]
 gb|EXK94362.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium oxysporum f. sp. 
raphani 54005]
 gb|EXM31906.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium oxysporum f. sp. 
vasinfectum 25433]
Length=408

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 95/194 (49%), Gaps = 31/194 (16%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP + +  ++++E I+  +  +   ++ R WA+       G LRG QYAV L L+ DG
Sbjct  156  LGGPIKDV--DDMLELID--RGGSQGGSSGRIWAIDPIDGTKGFLRGGQYAVCLGLMVDG  211

Query  177  APVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRD--KGCVMYARRGDGNAWM  350
               VGVLGCPN P+               +RLTS   S   D  +G V  A +G G A  
Sbjct  212  DVKVGVLGCPNLPVDDS------------ARLTSDIGSNATDEGRGVVFSAVQGHG-ANS  258

Query  351  QPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQL  530
            +PL  G      P S +     SI+    ATFC +VE   S+H   A ++  LG   + +
Sbjct  259  RPLTSGALAAEKPISMR-----SIDDLSKATFCESVEAGHSAHDDQALISKKLGITQESV  313

Query  531  RVYSSMKYAAIARG  572
            R+ S  KY +IARG
Sbjct  314  RMDSQAKYGSIARG  327



>ref|XP_007809069.1| 3'-phosphoadenosine 5'-phosphatase isoform A [Metarhizium acridum 
CQMa 102]
 gb|EFY91302.1| 3'-phosphoadenosine 5'-phosphatase isoform A [Metarhizium acridum 
CQMa 102]
Length=358

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 84/182 (46%), Gaps = 24/182 (13%)
 Frame = +3

Query  48   EEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCP  206
            + ++E I+      G+    R W +       G LRG QYAV L L+ DG   VGVLGCP
Sbjct  114  DSMLELIDLGNSPGGSKG--RIWTIDPIDGTKGFLRGGQYAVCLGLMVDGEVRVGVLGCP  171

Query  207  NYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNW  386
            N P+            R+ + + S A  E R  G + YA    G A  +PL  GG     
Sbjct  172  NLPVDDS--------ARLTADIGSNATDEGR--GVIFYAVEHKG-AGSRPLTTGG----L  216

Query  387  PNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIA  566
               SK I    IE    ATFC +VE   SSH   A ++  LG     +R+ S  KY +IA
Sbjct  217  SPDSKHIGMRPIEDLSRATFCESVEAGHSSHDDQAIISQKLGITEPSVRMDSQAKYGSIA  276

Query  567  RG  572
            RG
Sbjct  277  RG  278



>gb|EXL88911.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium oxysporum f. sp. 
conglutinans race 2 54008]
Length=408

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 95/194 (49%), Gaps = 31/194 (16%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP + +  ++++E I+  +  +   ++ R WA+       G LRG QYAV L L+ DG
Sbjct  156  LGGPIKDV--DDMLELID--RGGSQGGSSGRIWAIDPIDGTKGFLRGGQYAVCLGLMVDG  211

Query  177  APVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRD--KGCVMYARRGDGNAWM  350
               VGVLGCPN P+               +RLTS   S   D  +G V  A +G G A  
Sbjct  212  DVKVGVLGCPNLPVDDS------------ARLTSDIGSNATDEGRGVVFSAVQGHG-ANS  258

Query  351  QPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQL  530
            +PL  G      P S +     SI+    ATFC +VE   S+H   A ++  LG   + +
Sbjct  259  RPLTSGALAAEKPISMR-----SIDDLSKATFCESVEAGHSAHDDQALISKKLGITQESV  313

Query  531  RVYSSMKYAAIARG  572
            R+ S  KY +IARG
Sbjct  314  RMDSQAKYGSIARG  327



>gb|EXK35543.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium oxysporum f. sp. 
melonis 26406]
Length=408

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 95/194 (49%), Gaps = 31/194 (16%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP + +  ++++E I+  +  +   ++ R WA+       G LRG QYAV L L+ DG
Sbjct  156  LGGPIKDV--DDMLELID--RGGSQGGSSGRIWAIDPIDGTKGFLRGGQYAVCLGLMVDG  211

Query  177  APVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRD--KGCVMYARRGDGNAWM  350
               VGVLGCPN P+               +RLTS   S   D  +G V  A +G G A  
Sbjct  212  DVKVGVLGCPNLPVDDS------------ARLTSDIGSNATDEGRGVVFSAVQGRG-ANS  258

Query  351  QPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQL  530
            +PL  G      P S +     SI+    ATFC +VE   S+H   A ++  LG   + +
Sbjct  259  RPLTSGALAAEKPISMR-----SIDDLSKATFCESVEAGHSAHDDQALISKKLGITQESV  313

Query  531  RVYSSMKYAAIARG  572
            R+ S  KY +IARG
Sbjct  314  RMDSQAKYGSIARG  327



>ref|XP_010027647.1| PREDICTED: SAL1 phosphatase-like [Eucalyptus grandis]
 gb|KCW54212.1| hypothetical protein EUGRSUZ_I00195 [Eucalyptus grandis]
Length=419

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 91/188 (48%), Gaps = 34/188 (18%)
 Frame = +3

Query  30   AEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVV  188
            A  L  E+++  I+T K   G+    R W L       G LRGDQYAVAL+L++DG  V+
Sbjct  177  ASPLSPEDVLRAIDTGKSEGGSFG--RHWVLDPIDGTKGFLRGDQYAVALALLDDGKVVL  234

Query  189  GVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPG  368
            GVL CPN PL             I   +TS  A      GC+ YA+ G G  +MQ L   
Sbjct  235  GVLACPNLPLAS-----------IAGNVTSENAV-----GCLFYAKVGSGT-FMQSL---  274

Query  369  GKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSM  548
                   +S  ++  S I +   A+F  + EKA S    T+ +   LG +   +R+ S  
Sbjct  275  -----DGSSPVKVHVSDIGNSEDASFFESYEKAHSMQDLTSSIARKLGVKAPPVRIDSQA  329

Query  549  KYAAIARG  572
            KY A++RG
Sbjct  330  KYGALSRG  337



>gb|EWY95791.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium oxysporum FOSC 
3-a]
Length=408

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 95/194 (49%), Gaps = 31/194 (16%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP + +  ++++E I+  +  +   ++ R WA+       G LRG QYAV L L+ DG
Sbjct  156  LGGPIKDV--DDMLELID--RGGSQGGSSGRIWAIDPIDGTKGFLRGGQYAVCLGLMVDG  211

Query  177  APVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRD--KGCVMYARRGDGNAWM  350
               VGVLGCPN P+               +RLTS   S   D  +G V  A +G G A  
Sbjct  212  DVKVGVLGCPNLPVDDS------------ARLTSDIGSNATDEGRGVVFSAVQGRG-ANS  258

Query  351  QPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQL  530
            +PL  G      P S +     SI+    ATFC +VE   S+H   A ++  LG   + +
Sbjct  259  RPLTSGALAAEKPISMR-----SIDDLSKATFCESVEAGHSAHDDQALISKKLGITQESV  313

Query  531  RVYSSMKYAAIARG  572
            R+ S  KY +IARG
Sbjct  314  RMDSQAKYGSIARG  327



>gb|EWZ42407.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium oxysporum Fo47]
 gb|EXA00495.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium oxysporum f. sp. 
lycopersici MN25]
 gb|EXL59175.1| 3'(2'),5'-bisphosphate nucleotidase [Fusarium oxysporum f. sp. 
radicis-lycopersici 26381]
Length=408

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 95/194 (49%), Gaps = 31/194 (16%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP + +  ++++E I+  +  +   ++ R WA+       G LRG QYAV L L+ DG
Sbjct  156  LGGPIKDV--DDMLELID--RGGSQGGSSGRIWAIDPIDGTKGFLRGGQYAVCLGLMVDG  211

Query  177  APVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRD--KGCVMYARRGDGNAWM  350
               VGVLGCPN P+               +RLTS   S   D  +G V  A +G G A  
Sbjct  212  DVKVGVLGCPNLPVDDS------------ARLTSDIGSNATDEGRGVVFSAVQGRG-ANS  258

Query  351  QPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQL  530
            +PL  G      P S +     SI+    ATFC +VE   S+H   A ++  LG   + +
Sbjct  259  RPLTSGALAAEKPISMR-----SIDDLSKATFCESVEAGHSAHDDQALISKKLGITQESV  313

Query  531  RVYSSMKYAAIARG  572
            R+ S  KY +IARG
Sbjct  314  RMDSQAKYGSIARG  327



>gb|KCW54211.1| hypothetical protein EUGRSUZ_I00195 [Eucalyptus grandis]
Length=419

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 91/188 (48%), Gaps = 34/188 (18%)
 Frame = +3

Query  30   AEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVV  188
            A  L  E+++  I+T K   G+    R W L       G LRGDQYAVAL+L++DG  V+
Sbjct  177  ASPLSPEDVLRAIDTGKSEGGSFG--RHWVLDPIDGTKGFLRGDQYAVALALLDDGKVVL  234

Query  189  GVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPG  368
            GVL CPN PL             I   +TS  A      GC+ YA+ G G  +MQ L   
Sbjct  235  GVLACPNLPLAS-----------IAGNVTSENAV-----GCLFYAKVGSGT-FMQSL---  274

Query  369  GKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSM  548
                   +S  ++  S I +   A+F  + EKA S    T+ +   LG +   +R+ S  
Sbjct  275  -----DGSSPVKVHVSDIGNSEDASFFESYEKAHSMQDLTSSIARKLGVKAPPVRIDSQA  329

Query  549  KYAAIARG  572
            KY A++RG
Sbjct  330  KYGALSRG  337



>ref|XP_010521143.1| PREDICTED: SAL1 phosphatase [Tarenaya hassleriana]
Length=395

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 95/185 (51%), Gaps = 30/185 (16%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  E+++  I+ C  + G  N  R W L       G LRGDQYA+AL+L+E+G  V+GVL
Sbjct  153  LSTEDLLRIID-CGSSEGGPNG-RHWVLDPIDGTKGFLRGDQYAIALALLEEGKVVLGVL  210

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL             I       ++S+    GC+ +A  G G  +MQ       +
Sbjct  211  ACPNLPLAS-----------IAGDNNKNSSSD--QTGCLFFATVGSGT-YMQ-------L  249

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
             +  +S  +++ ++IE+P  A+F  + E A S H  ++ + + LG +   +R+ S  KY 
Sbjct  250  LDAESSPVKVQVTAIENPEEASFFESYEAAHSLHGLSSSIANKLGVKAPPVRIDSQAKYG  309

Query  558  AIARG  572
            A++RG
Sbjct  310  ALSRG  314



>ref|XP_008020804.1| hypothetical protein SETTUDRAFT_162324 [Setosphaeria turcica 
Et28A]
 gb|EOA91708.1| hypothetical protein SETTUDRAFT_162324 [Setosphaeria turcica 
Et28A]
Length=419

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 76/162 (47%), Gaps = 22/162 (14%)
 Frame = +3

Query  108  RFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILS  266
            R WAL       G LRG QYAV L L+ DG P +GV+GCPN P+           Q  L+
Sbjct  193  RIWALDPIDGTKGFLRGGQYAVCLGLLVDGVPTLGVIGCPNLPVDD---------QAPLT  243

Query  267  RLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATF  446
              T   A +   KG +  A +G G A  +PL  G      P   K IK   +     ATF
Sbjct  244  VTTGQDADDKEGKGVLFAAVKGQG-ATSRPLSQGA--LQEP---KTIKMKPLSDVTQATF  297

Query  447  CHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIARG  572
            C +VE   SS    A + + LG     +R+ S  KY +IARG
Sbjct  298  CESVEAGHSSQGDNAAIAAKLGITKPSVRMDSQAKYCSIARG  339



>ref|XP_010461252.1| PREDICTED: SAL1 phosphatase-like [Camelina sativa]
Length=405

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 92/185 (50%), Gaps = 30/185 (16%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++ TI+      G N   R W L       G LRGDQYAVAL L+E+G  V+GVL
Sbjct  160  LSTDDLLRTIDYGSSEGGPNG--RHWVLDPIDGTKGFLRGDQYAVALGLLEEGKVVLGVL  217

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL                  T++  S   + GC+ +A  G G  +MQ       +
Sbjct  218  ACPNLPLAS-------------IAGTNSNNSSSNEIGCLFFATIGSGT-YMQ-------L  256

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
             +  +S  +++ S +E+P  A+F  + E A S H  ++ + + LG +   +R+ S  KY 
Sbjct  257  LDSKSSPVKVQVSKVENPEEASFFESFEGAHSLHGLSSSIANKLGVKAPPVRIDSQAKYG  316

Query  558  AIARG  572
            A++RG
Sbjct  317  ALSRG  321



>emb|CAC84117.1| 3'(2'),5'-bisphosphate nucleotidase, partial [Gossypium hirsutum]
Length=216

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 81/151 (54%), Gaps = 25/151 (17%)
 Frame = +3

Query  123  GSLRGDQYAVALSLIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRD  302
            G LRGDQYA+AL+L++ G  V+GVL C N P               L+ L+ A    P +
Sbjct  9    GFLRGDQYAIALALLDGGKVVLGVLACQNLP---------------LTSLSDAGQHSPNN  53

Query  303  K-GCVMYARRGDGNAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSH  479
            K GC+ +A  G G  +MQPL          +S+ +++ S++E+P  A+F  + E A S H
Sbjct  54   KVGCLFFAVVG-GGTYMQPL--------DGSSAVKVQVSAVENPEEASFFESYEAAHSMH  104

Query  480  SFTAGLNSSLGHRNQQLRVYSSMKYAAIARG  572
              ++ +   LG +   +R+ S  KY A++RG
Sbjct  105  DLSSLIAQKLGVKAPPVRIDSQAKYGALSRG  135



>ref|XP_009625609.1| PREDICTED: SAL1 phosphatase-like isoform X2 [Nicotiana tomentosiformis]
Length=398

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 94/188 (50%), Gaps = 38/188 (20%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  E+++  I++ +   G +   + W L       G +RGDQYA+AL+L+++G  V+GVL
Sbjct  157  LSEEDVLAAIDSGRSVGGPSG--QHWVLDPIDGTKGFVRGDQYAIALALLDEGKAVLGVL  214

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDK-GCVMYARRGDGNAWMQPLLPGGK  374
             CPN P               LS + S    +P++K GC+ YA+ G G  +MQ L     
Sbjct  215  ACPNLP---------------LSSVASHNPQDPQEKVGCLFYAQVGSGT-YMQSL-----  253

Query  375  MFNWPNSSKQIK--PSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSM  548
                 + S  IK   + +++P  A F  + E A S H  ++ +   LG R   +R+ S  
Sbjct  254  -----DGSTPIKVHVTDLDNPEEAAFFESFEAAHSLHDLSSSIAKKLGVRAPPVRIDSQA  308

Query  549  KYAAIARG  572
            KY A++RG
Sbjct  309  KYGALSRG  316



>ref|XP_007587641.1| putative 3 -bisphosphate nucleotidase protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD44889.1| putative 3 -bisphosphate nucleotidase protein [Neofusicoccum 
parvum UCRNP2]
Length=354

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 90/194 (46%), Gaps = 31/194 (16%)
 Frame = +3

Query  18   LTGPAEALCGEEIM-ETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIED  173
            L GP   L  E+ M + I+  + A GA    R WAL       G LRG QYAV L+L+ D
Sbjct  102  LGGP---LASEDAMCDAIDLGRSAGGAKG--RIWALDPIDGTKGFLRGGQYAVCLALMVD  156

Query  174  GAPVVGVLGCPNYPLKKEW-LSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWM  350
            G   VGVLGCPN P+     L    G  +          SE R  G +  A  G G A  
Sbjct  157  GQVKVGVLGCPNLPVDDSAPLDAGIGEDQ---------TSEGR--GVLFSAIEGQG-AIS  204

Query  351  QPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQL  530
            +PL  G        SS+ I    I     ATFC +VE   SSH   A +   LG   + +
Sbjct  205  RPLGDG-----TLQSSRSISMKPISDITQATFCESVEAGHSSHGDQAQIAQKLGITKESV  259

Query  531  RVYSSMKYAAIARG  572
            R+ S  KYA+IARG
Sbjct  260  RMDSQAKYASIARG  273



>ref|XP_008044553.1| 3',5'-bisphosphate nucleotidase [Trametes versicolor FP-101664 
SS1]
 gb|EIW53050.1| 3',5'-bisphosphate nucleotidase [Trametes versicolor FP-101664 
SS1]
Length=357

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 88/190 (46%), Gaps = 36/190 (19%)
 Frame = +3

Query  24   GPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAP  182
            GP +A   E++++ I+      G     RFW L       G LRG+QYAV L+L+ D  P
Sbjct  113  GPNQAQTAEQLLDAIDRGNYEGG--RTGRFWTLDPIDGTKGFLRGEQYAVCLALVVDSRP  170

Query  183  VVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLL  362
             +GV+GCPN P                  +++A  S PR  GC+  A RG G   +    
Sbjct  171  ELGVIGCPNLP------------------VSAADPSGPR--GCIFVAVRGQGAYQLALDN  210

Query  363  PGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYS  542
            P    F+ P +   I PS+ E+     F  +VEKA +  SF   +   LG      R+ S
Sbjct  211  P----FSAPATKLTIPPSTGET---LNFLESVEKAHAKLSFNERVGQVLGITRAPTRMDS  263

Query  543  SMKYAAIARG  572
              KY A+ARG
Sbjct  264  QAKYCALARG  273



>ref|XP_007695443.1| hypothetical protein COCSADRAFT_33061 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD68099.1| hypothetical protein COCSADRAFT_33061 [Bipolaris sorokiniana 
ND90Pr]
Length=416

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 75/162 (46%), Gaps = 22/162 (14%)
 Frame = +3

Query  108  RFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILS  266
            R WAL       G LRG QYAV L L+ DG P +GV+GCPN P+           Q  L 
Sbjct  190  RIWALDPIDGTKGFLRGGQYAVCLGLLVDGVPTLGVIGCPNLPVDD---------QAPLD  240

Query  267  RLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATF  446
              T   A +   KG +  A +G G A  +PL  G      P   K IK   +     ATF
Sbjct  241  ATTGQDADDKEGKGVLFAAVKGQG-ATSRPLSKGA--LQEP---KGIKMKPLSDVTQATF  294

Query  447  CHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIARG  572
            C +VE   SS    A + S LG     +R+ S  KY +IARG
Sbjct  295  CESVEAGHSSQGENAAIASKLGITKPSVRMDSQAKYCSIARG  336



>ref|XP_009625608.1| PREDICTED: SAL1 phosphatase-like isoform X1 [Nicotiana tomentosiformis]
Length=411

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 94/188 (50%), Gaps = 38/188 (20%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  E+++  I++ +   G +   + W L       G +RGDQYA+AL+L+++G  V+GVL
Sbjct  170  LSEEDVLAAIDSGRSVGGPSG--QHWVLDPIDGTKGFVRGDQYAIALALLDEGKAVLGVL  227

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDK-GCVMYARRGDGNAWMQPLLPGGK  374
             CPN P               LS + S    +P++K GC+ YA+ G G  +MQ L     
Sbjct  228  ACPNLP---------------LSSVASHNPQDPQEKVGCLFYAQVGSGT-YMQSL-----  266

Query  375  MFNWPNSSKQIK--PSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSM  548
                 + S  IK   + +++P  A F  + E A S H  ++ +   LG R   +R+ S  
Sbjct  267  -----DGSTPIKVHVTDLDNPEEAAFFESFEAAHSLHDLSSSIAKKLGVRAPPVRIDSQA  321

Query  549  KYAAIARG  572
            KY A++RG
Sbjct  322  KYGALSRG  329



>ref|XP_009338031.1| PREDICTED: SAL1 phosphatase-like [Pyrus x bretschneideri]
Length=401

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 92/186 (49%), Gaps = 34/186 (18%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  E+++  I+  K   G++   + W L       G +RGDQYA+AL L+++G  V+GVL
Sbjct  160  LTTEDVLRAIDNGKSEGGSSG--QHWVLDPIDGTKGFVRGDQYAIALGLLDEGKVVLGVL  217

Query  198  GCPNYPLKKEWLSYQY-GYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGK  374
             CPN PL     + Q+  Y ++               GC+ +A  G G  +MQP L G  
Sbjct  218  ACPNLPLTSISGNNQHSSYDKV---------------GCLFFATVGTGT-YMQP-LDGSS  260

Query  375  MFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKY  554
            +        ++  S+ E+P  A+F  + E A S H  ++ +   LG +   +R+ S  KY
Sbjct  261  LI-------KVHVSTTENPEEASFFESFEAAHSLHDLSSSIAQKLGVKAPPVRIDSQAKY  313

Query  555  AAIARG  572
             A++RG
Sbjct  314  GALSRG  319



>ref|XP_008227630.1| PREDICTED: SAL1 phosphatase-like [Prunus mume]
Length=397

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 92/186 (49%), Gaps = 34/186 (18%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++  I+  K   G+    + W L       G LRGDQYA+AL+L+++G  V+GVL
Sbjct  156  LTTDDVLRAIDNGKSEGGSRG--QHWVLDPIDGTKGFLRGDQYAIALALLDEGKVVLGVL  213

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDK-GCVMYARRGDGNAWMQPLLPGGK  374
             CPN P               L+ ++       +DK GC+ +A  G G  +MQP L G  
Sbjct  214  ACPNLP---------------LTSISGENQQSSQDKVGCLFFATVGTGT-YMQP-LDGSS  256

Query  375  MFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKY  554
            +        ++  S+ E+P  A+F  + E A S H  ++ +   LG +   +R+ S  KY
Sbjct  257  LL-------KVHVSATENPEEASFFESFEAAHSLHDLSSTIAKKLGVKAPPVRIDSQAKY  309

Query  555  AAIARG  572
             A++RG
Sbjct  310  GALSRG  315



>ref|XP_007158893.1| hypothetical protein PHAVU_002G190600g [Phaseolus vulgaris]
 gb|ESW30887.1| hypothetical protein PHAVU_002G190600g [Phaseolus vulgaris]
Length=416

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 90/186 (48%), Gaps = 33/186 (18%)
 Frame = +3

Query  36   ALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGV  194
            +L  +E++  I+  K   G+    + W L       G +RGDQYA+AL L+ +G  V+GV
Sbjct  175  SLTTDEVLAAIDNGKSEGGS--VGKHWVLDPIDGTKGFVRGDQYAIALGLLHEGKVVLGV  232

Query  195  LGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGK  374
            L CPN PL     + Q+    +               GC+ +A+ GDG  +MQ L  GG 
Sbjct  233  LACPNLPLASIGSNQQHSSNEV---------------GCLFFAKVGDGT-YMQAL--GG-  273

Query  375  MFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKY  554
                 ++  ++    I++P  A+   + E A SSH  +  +   LG +   +R+ S  KY
Sbjct  274  -----STQTRVHVWDIDNPEQASLFESFEAAHSSHDLSGSIAEKLGVKAPPVRIDSQAKY  328

Query  555  AAIARG  572
             A++RG
Sbjct  329  GALSRG  334



>gb|KFH71950.1| 3'(2'),5'-bisphosphate nucleotidase [Mortierella verticillata 
NRRL 6337]
Length=337

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 96/192 (50%), Gaps = 40/192 (21%)
 Frame = +3

Query  21   TGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGA  179
            +G  +AL  + ++ETI+    A G+    R WAL       G LRG+Q+AV L+LI DG 
Sbjct  96   SGLEKALNEDSLLETIDRGTFAGGSKG--RMWALDPIDGTKGFLRGEQFAVCLALIVDGQ  153

Query  180  PVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPL  359
              +GV+GCPN P+                     AA++  +KGC+    +G G A+ +  
Sbjct  154  VQLGVMGCPNLPID--------------------AANQDGEKGCLFITVKGQG-AFQR--  190

Query  360  LPGGKMFNWPNSSKQ-IKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRV  536
                   N+ +S +  I+  SI+S   A+FC +VE   S+ S +A +   LG     +R+
Sbjct  191  -------NFSSSKETPIEMGSIQSLADASFCESVESGHSNQSESAKIAQLLGITKAPVRM  243

Query  537  YSSMKYAAIARG  572
             S  KY +I+RG
Sbjct  244  DSQCKYCSISRG  255



>ref|XP_003046777.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU41064.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=356

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 91/192 (47%), Gaps = 27/192 (14%)
 Frame = +3

Query  18   LTGPAEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDG  176
            L GP + +  ++++E I+      G  N+ R WA+       G LRG QYAV L L+ DG
Sbjct  105  LGGPIKDV--DDMLELIDRGNSKGG--NSGRIWAIDPIDGTKGFLRGGQYAVCLGLMVDG  160

Query  177  APVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQP  356
               VGVLGCPN P+            R+ S + S A  E R  G V  A +  G A  +P
Sbjct  161  DVKVGVLGCPNLPVDDS--------ARLTSDIGSNATDEGR--GVVFSAVQVHG-ANSRP  209

Query  357  LLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRV  536
            L  G          K I   SI+    ATFC +VE   S+H   A ++  LG     +R+
Sbjct  210  LTAGALA-----PEKSISMRSIDDLAKATFCESVEAGHSAHDDQALISQKLGITAPSVRM  264

Query  537  YSSMKYAAIARG  572
             S  KY +IARG
Sbjct  265  DSQAKYGSIARG  276



>ref|XP_008808499.1| PREDICTED: 3'(2'),5'-bisphosphate nucleotidase-like [Phoenix 
dactylifera]
Length=304

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 82/155 (53%), Gaps = 26/155 (17%)
 Frame = +3

Query  108  RFWALGSLRGDQYAVALSLIEDGAPVVGVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAA  287
            +FW L   RGDQYA+AL+L++ G  V+GVL CPN PL    +  ++  Q+ +        
Sbjct  91   KFWFL---RGDQYAIALALLDGGRVVLGVLACPNLPLTSIAIPDEHSLQKQV--------  139

Query  288  SEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKA  467
                  GC+  A+ GDG A+MQ L   G      +S  +I  S+IE+   A+F  + E A
Sbjct  140  ------GCLFSAKIGDG-AFMQSL--NG------SSPTKIHVSAIENSEDASFFESFEAA  184

Query  468  KSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIARG  572
             S H  ++ +   LG R   +R+ S  KY A+ARG
Sbjct  185  HSMHDLSSVIAEKLGVRAPPVRIDSQAKYGALARG  219



>gb|EPS60422.1| hypothetical protein M569_14381, partial [Genlisea aurea]
Length=354

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 95/193 (49%), Gaps = 39/193 (20%)
 Frame = +3

Query  30   AEALCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVV  188
            A  L   +++E I++ K   G+    + W L       G LRGDQYA+AL+L++ G  V+
Sbjct  105  AAPLSENDVLEAIDSGKSEGGSEG--QHWVLDPIDGTKGFLRGDQYAIALALLDQGKVVL  162

Query  189  GVLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPR---DK--GCVMYARRGDGNAWMQ  353
            GVL CPN PL                   S + ++PR   D+  GC+  AR GDG  +MQ
Sbjct  163  GVLACPNLPLSS----------------PSVSKNDPRPPPDEKLGCLFSARLGDGT-YMQ  205

Query  354  PLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLR  533
                 G +        +++ S I++   A+F  + E A SSH  +  +   LG + + +R
Sbjct  206  SF--DGSLLT------KVRVSRIDNAEDASFFESFEAAHSSHELSGLIAKKLGVKAKPVR  257

Query  534  VYSSMKYAAIARG  572
            + S  KY A++RG
Sbjct  258  MDSQAKYGALSRG  270



>ref|XP_011031174.1| PREDICTED: SAL1 phosphatase [Populus euphratica]
Length=395

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 94/185 (51%), Gaps = 32/185 (17%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  +++++ I+  K   G+    R W L       G LRGDQYA+AL+L+++G  V+GVL
Sbjct  154  LSTDDVVKAIDCGKSEGGSRG--RHWVLDPIDGTKGFLRGDQYAIALALLDEGTVVLGVL  211

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL     S   G Q  L          P + GC+ ++  G G  ++  L      
Sbjct  212  ACPNLPLT----SIAGGSQHSL----------PGEVGCLFFSVVG-GGTYVHSL------  250

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
                +S+ +++ SSI++P  A+F  + E A S H  ++ +   LG +   +R+ S  KY 
Sbjct  251  --DSSSAVKVQVSSIDNPEEASFFESYEAAHSMHDLSSSIAKKLGVKAPPVRIDSQAKYG  308

Query  558  AIARG  572
            A++RG
Sbjct  309  ALSRG  313



>ref|XP_010446262.1| PREDICTED: SAL1 phosphatase-like [Camelina sativa]
Length=349

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 93/185 (50%), Gaps = 29/185 (16%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++ TI+ C  + G  N  R W L       G LRGDQYAVA  L+E+G  V+GVL
Sbjct  103  LSTDDLLRTID-CGSSEGGPNG-RHWVLDPIDGTKGFLRGDQYAVARGLLEEGKVVLGVL  160

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKM  377
             CPN PL              ++   +   S   + GC+ +A  G G  +MQ       +
Sbjct  161  ACPNLPLAS------------IAGANNNNNSSSIEIGCLFFATIGSGT-YMQ-------L  200

Query  378  FNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYA  557
             +  +S  +++ S +E+P  A+F  + E A S H  ++ + + LG +   +R+ S  KY 
Sbjct  201  LDSKSSPVKVQVSKVENPEEASFFESFEGAHSLHGLSSSIANKLGVKAPPVRIDSQAKYG  260

Query  558  AIARG  572
            A++RG
Sbjct  261  ALSRG  265



>ref|XP_007730658.1| 3'(2'),5'-bisphosphate nucleotidase [Capronia epimyces CBS 606.96]
 gb|EXJ89261.1| 3'(2'),5'-bisphosphate nucleotidase [Capronia epimyces CBS 606.96]
Length=353

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 87/181 (48%), Gaps = 24/181 (13%)
 Frame = +3

Query  51   EIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVLGCPN  209
            E+++ I+    A G  +  R WAL       G LRG QYAV L+LI DG   VGVLGCPN
Sbjct  111  EMLDAIDMGNSAGG--DKGRIWALDPIDGTKGFLRGGQYAVCLALIVDGDVKVGVLGCPN  168

Query  210  YPLKKEWLSYQYGYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGKMFNWP  389
             P+           + +L+    AAA++   KG +  A +G G A  QPL  G      P
Sbjct  169  LPVDD---------RELLTEGIGAAATDAEGKGVLFAAVQGQG-ATSQPLTRGAVTPGHP  218

Query  390  NSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKYAAIAR  569
                QI  S +   VM   C +VE   SS    A +   LG   + +++ S  KY ++AR
Sbjct  219  IHVSQI--SDVSEAVM---CESVEPGHSSKGDNALIAQKLGISRKPVQMDSQAKYGSVAR  273

Query  570  G  572
            G
Sbjct  274  G  274



>gb|ABF68776.1| 3'-phosphoadenosine 5'-phosphatase, partial [Aureobasidium pullulans]
Length=155

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 76/149 (51%), Gaps = 17/149 (11%)
 Frame = +3

Query  129  LRGDQYAVALSLIEDGAPVVGVLGCPNYPLKK-EWLSYQYGYQRILSRLTSAAASEPRDK  305
            LRG QYAV L+L+ DG   VGVLGCPN P+   E L+   G          A AS+   K
Sbjct  2    LRGGQYAVCLALMVDGDVKVGVLGCPNLPIDDSEPLTEDLG----------ANASDAEGK  51

Query  306  GCVMYARRGDGNAWMQPLLPGGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSF  485
            G +M A  G G A  +PL  G        S K++   S      ATFC +VE A S+H  
Sbjct  52   GVLMSAILGKG-ADSRPLTRGALKNATTISMKRVDDIS-----SATFCESVEAAHSAHGD  105

Query  486  TAGLNSSLGHRNQQLRVYSSMKYAAIARG  572
             A + S LG     +R+ S  KYA+IARG
Sbjct  106  QAQIASKLGISKPSVRMDSQAKYASIARG  134



>ref|XP_009334306.1| PREDICTED: SAL1 phosphatase-like [Pyrus x bretschneideri]
Length=401

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 92/186 (49%), Gaps = 34/186 (18%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  E+++  I+  K   G++   + W L       G +RGDQYA+AL L+++G  V+GVL
Sbjct  160  LTTEDVLRAIDNGKSEGGSSG--QHWVLDPIDGTKGFVRGDQYAIALGLLDEGRVVLGVL  217

Query  198  GCPNYPLKKEWLSYQY-GYQRILSRLTSAAASEPRDKGCVMYARRGDGNAWMQPLLPGGK  374
             CPN PL     + Q+  Y ++               GC+ +A  G G  +MQP L G  
Sbjct  218  ACPNLPLTSISGNNQHSSYDKV---------------GCLFFATVGTGT-YMQP-LDGSS  260

Query  375  MFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKY  554
            +        ++  S+ E+P  A+F  + E A S H  ++ +   LG +   +R+ S  KY
Sbjct  261  LI-------KVHVSATENPEEASFFESFEAAHSLHDLSSSIAQKLGVKAPPVRIDSQAKY  313

Query  555  AAIARG  572
             A++RG
Sbjct  314  GALSRG  319



>ref|XP_007211513.1| hypothetical protein PRUPE_ppa008005mg [Prunus persica]
 gb|EMJ12712.1| hypothetical protein PRUPE_ppa008005mg [Prunus persica]
Length=349

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 91/186 (49%), Gaps = 34/186 (18%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  ++++  I+  K   G+    + W L       G LRGDQYA+AL+L+++G  V+GVL
Sbjct  108  LTTDDVLRAIDNGKSEGGSRG--QHWVLDPIDGTKGFLRGDQYAIALALLDEGKVVLGVL  165

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDK-GCVMYARRGDGNAWMQPLLPGGK  374
             CPN P               L+ ++       +DK GC+ +A  G G  +MQP L G  
Sbjct  166  ACPNLP---------------LTSISGENQQSSQDKLGCLFFATVGTGT-YMQP-LDGSS  208

Query  375  MFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSMKY  554
            +        ++  S+ E+P  A+   + E A S H  ++ +   LG +   +R+ S  KY
Sbjct  209  LL-------KVHVSATENPEEASLFESFEAAHSLHDLSSTIAKKLGFKAPPVRIDSQAKY  261

Query  555  AAIARG  572
             A++RG
Sbjct  262  GALSRG  267



>ref|XP_007794546.1| putative 3 -bisphosphate nucleotidase protein [Eutypa lata UCREL1]
 gb|EMR66350.1| putative 3 -bisphosphate nucleotidase protein [Eutypa lata UCREL1]
Length=355

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 91/189 (48%), Gaps = 29/189 (15%)
 Frame = +3

Query  36   ALCGEEIMET-INTCKLAAGANNASRFWA-------LGSLRGDQYAVALSLIEDGAPVVG  191
            A+  EE M T I+      GA+   R WA       LG LRG QYAV L+LI DG   VG
Sbjct  106  AIADEESMLTMIDYGNSKGGASG--RIWAIDPIDGTLGFLRGGQYAVCLALIVDGQVKVG  163

Query  192  VLGCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDKG--CVMYARRGDGNAWMQPLLP  365
            VLGCPN P+               + LT    S   D+G   V++A      A  +PL  
Sbjct  164  VLGCPNLPVDDS------------APLTGNLESGQSDEGGSGVLFAAIFGEGATSRPLTT  211

Query  366  GGKMFNWPNSSKQIKPSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSS  545
            GG     P  S  ++P +  S   ATFC +VE + S+H   A +   LG  N  +R+ S 
Sbjct  212  GGLA---PKKSISMRPLTDMSA--ATFCESVEASHSAHGDQAQIAQKLGITNPSVRLDSQ  266

Query  546  MKYAAIARG  572
             KYA+IARG
Sbjct  267  AKYASIARG  275



>ref|XP_009800821.1| PREDICTED: SAL1 phosphatase-like [Nicotiana sylvestris]
Length=398

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 95/188 (51%), Gaps = 38/188 (20%)
 Frame = +3

Query  39   LCGEEIMETINTCKLAAGANNASRFWAL-------GSLRGDQYAVALSLIEDGAPVVGVL  197
            L  E+++  I++ +   G +   + W L       G +RGDQYA+AL+L+++G  V+GVL
Sbjct  157  LSEEDVLAAIDSGRSEGGPSG--QHWVLDPIDGTKGFVRGDQYAIALALLDEGKAVLGVL  214

Query  198  GCPNYPLKKEWLSYQYGYQRILSRLTSAAASEPRDK-GCVMYARRGDGNAWMQPLLPGGK  374
             CPN P               LS + S    +P++K GC+ YA+ G G  +MQ L     
Sbjct  215  ACPNLP---------------LSSVASHNPQDPQEKVGCLFYAQVGSGT-YMQSL-----  253

Query  375  MFNWPNSSKQIK--PSSIESPVMATFCHTVEKAKSSHSFTAGLNSSLGHRNQQLRVYSSM  548
                 + S  IK   + +++P  A+F  + E A S H  ++ +   LG +   +R+ S  
Sbjct  254  -----DGSTPIKVHVTDLDNPEDASFFESFEAAHSLHDLSSSIAKKLGVKAPPVRIDSQA  308

Query  549  KYAAIARG  572
            KY A++RG
Sbjct  309  KYGALSRG  316



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 632043024200