BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19692_g1_i2 len=1127 path=[1105:0-274 1380:275-1126]

Length=1127
                                                                      Score     E

ref|XP_009762142.1|  PREDICTED: BTB/POZ and MATH domain-containin...    392   3e-130   
ref|XP_009606600.1|  PREDICTED: BTB/POZ and MATH domain-containin...    390   1e-129   
emb|CDP09732.1|  unnamed protein product                                383   1e-127   
ref|XP_009771203.1|  PREDICTED: BTB/POZ and MATH domain-containin...    382   1e-126   
ref|XP_009628011.1|  PREDICTED: BTB/POZ and MATH domain-containin...    381   3e-126   
gb|EYU46143.1|  hypothetical protein MIMGU_mgv1a007584mg                380   7e-126   
ref|XP_006362728.1|  PREDICTED: BTB/POZ and MATH domain-containin...    380   1e-125   
gb|ACM67640.1|  BTB-POZ and MATH domain protein                         375   9e-124   Capsicum annuum
ref|XP_004228476.1|  PREDICTED: BTB/POZ and MATH domain-containin...    374   1e-123   
ref|XP_011090255.1|  PREDICTED: BTB/POZ and MATH domain-containin...    368   4e-121   
ref|XP_002277148.1|  PREDICTED: BTB/POZ and MATH domain-containin...    364   1e-119   Vitis vinifera
ref|XP_011006172.1|  PREDICTED: BTB/POZ and MATH domain-containin...    361   2e-118   
ref|XP_006384724.1|  hypothetical protein POPTR_0004s20530g             358   2e-117   
ref|XP_007015536.1|  BTB/POZ and MATH domain-containing protein 4...    355   4e-116   
ref|XP_006470186.1|  PREDICTED: BTB/POZ and MATH domain-containin...    355   5e-116   
gb|EPS71913.1|  hypothetical protein M569_02844                         355   5e-116   
ref|XP_011043823.1|  PREDICTED: BTB/POZ and MATH domain-containin...    354   1e-115   
ref|XP_011016311.1|  PREDICTED: BTB/POZ and MATH domain-containin...    354   1e-115   
ref|XP_011080496.1|  PREDICTED: BTB/POZ and MATH domain-containin...    354   1e-115   
emb|CBI24397.3|  unnamed protein product                                354   1e-115   
ref|XP_003632235.1|  PREDICTED: BTB/POZ and MATH domain-containin...    355   1e-115   
ref|XP_011016310.1|  PREDICTED: BTB/POZ and MATH domain-containin...    354   1e-115   
ref|XP_011043816.1|  PREDICTED: BTB/POZ and MATH domain-containin...    353   1e-115   
gb|KDO47647.1|  hypothetical protein CISIN_1g015782mg                   353   2e-115   
ref|XP_002313624.2|  hypothetical protein POPTR_0009s15830g             351   2e-114   Populus trichocarpa [western balsam poplar]
gb|KDP42915.1|  hypothetical protein JCGZ_23857                         351   2e-114   
ref|XP_004251235.1|  PREDICTED: BTB/POZ and MATH domain-containin...    350   5e-114   
ref|XP_006340346.1|  PREDICTED: BTB/POZ and MATH domain-containin...    350   6e-114   
ref|XP_010266708.1|  PREDICTED: BTB/POZ and MATH domain-containin...    344   1e-111   
ref|XP_007015538.1|  BTB/POZ and MATH domain-containing protein 4...    343   2e-111   
ref|XP_008789435.1|  PREDICTED: BTB/POZ and MATH domain-containin...    338   2e-109   
gb|KHG12366.1|  BTB/POZ and MATH domain-containing 4 -like protein      336   1e-108   
ref|XP_011043808.1|  PREDICTED: BTB/POZ and MATH domain-containin...    335   9e-108   
ref|XP_011016309.1|  PREDICTED: BTB/POZ and MATH domain-containin...    335   1e-107   
ref|XP_008442027.1|  PREDICTED: BTB/POZ and MATH domain-containin...    331   3e-106   
ref|XP_010918008.1|  PREDICTED: BTB/POZ and MATH domain-containin...    330   3e-106   
ref|XP_008811722.1|  PREDICTED: BTB/POZ and MATH domain-containin...    329   7e-106   
gb|KDP39652.1|  hypothetical protein JCGZ_02672                         330   9e-106   
ref|XP_010685504.1|  PREDICTED: BTB/POZ and MATH domain-containin...    328   2e-105   
ref|XP_002525692.1|  BTB and MATH domain-containing protein, puta...    327   2e-105   Ricinus communis
ref|XP_004149104.1|  PREDICTED: BTB/POZ and MATH domain-containin...    329   2e-105   
ref|XP_007029995.1|  BTB-POZ and MATH domain 4 isoform 1                325   8e-104   
ref|XP_006371199.1|  hypothetical protein POPTR_0019s05580g             325   8e-104   
ref|XP_008386876.1|  PREDICTED: BTB/POZ and MATH domain-containin...    323   3e-103   
ref|XP_010921383.1|  PREDICTED: BTB/POZ and MATH domain-containin...    321   7e-103   
ref|XP_011001713.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ...    321   3e-102   
ref|XP_009366506.1|  PREDICTED: BTB/POZ and MATH domain-containin...    320   6e-102   
ref|XP_008391713.1|  PREDICTED: BTB/POZ and MATH domain-containin...    318   3e-101   
gb|KHN38451.1|  BTB/POZ and MATH domain-containing protein 4            312   4e-101   
ref|XP_006479173.1|  PREDICTED: BTB/POZ and MATH domain-containin...    318   5e-101   
ref|XP_006443499.1|  hypothetical protein CICLE_v10020215mg             318   5e-101   
ref|XP_009343027.1|  PREDICTED: BTB/POZ and MATH domain-containin...    317   7e-101   
ref|XP_009353080.1|  PREDICTED: BTB/POZ and MATH domain-containin...    316   2e-100   
gb|KDO66064.1|  hypothetical protein CISIN_1g013880mg                   316   3e-100   
ref|XP_003518460.1|  PREDICTED: BTB/POZ and MATH domain-containin...    313   9e-100   
gb|AFJ68127.1|  BTB protein                                             311   2e-99    
ref|NP_001051524.1|  Os03g0792500                                       313   4e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004491160.1|  PREDICTED: BTB/POZ and MATH domain-containin...    311   4e-99    
gb|EAY92144.1|  hypothetical protein OsI_13855                          312   5e-99    Oryza sativa Indica Group [Indian rice]
ref|XP_009400061.1|  PREDICTED: BTB/POZ and MATH domain-containin...    311   5e-99    
gb|AAO37987.1|  expressed protein                                       312   6e-99    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ28871.1|  hypothetical protein OsJ_12909                          311   6e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004981480.1|  PREDICTED: BTB/POZ and MATH domain-containin...    311   2e-98    
gb|KHM99118.1|  BTB/POZ and MATH domain-containing protein 4            308   3e-98    
ref|XP_006651896.1|  PREDICTED: BTB/POZ and MATH domain-containin...    310   3e-98    
ref|XP_003617061.1|  Speckle-type POZ protein                           309   4e-98    
ref|XP_003545187.1|  PREDICTED: BTB/POZ and MATH domain-containin...    309   4e-98    
ref|XP_007161865.1|  hypothetical protein PHAVU_001G104500g             310   5e-98    
ref|XP_006826332.1|  hypothetical protein AMTR_s00004p00105320          308   6e-98    
ref|XP_010036255.1|  PREDICTED: BTB/POZ and MATH domain-containin...    310   6e-98    
emb|CBI31240.3|  unnamed protein product                                305   5e-97    
ref|XP_002533853.1|  Speckle-type POZ protein, putative                 306   5e-97    Ricinus communis
gb|ABY60297.1|  At3g03740                                               301   8e-97    Arabidopsis thaliana [mouse-ear cress]
gb|ABY60311.1|  At3g03740-like protein                                  301   1e-96    Arabidopsis lyrata [lyrate rockcress]
gb|ABY60306.1|  At3g03740                                               301   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411294.1|  PREDICTED: BTB/POZ and MATH domain-containin...    305   2e-96    
ref|XP_009396476.1|  PREDICTED: BTB/POZ and MATH domain-containin...    304   3e-96    
gb|KCW50987.1|  hypothetical protein EUGRSUZ_J00615                     304   4e-96    
ref|XP_006408271.1|  hypothetical protein EUTSA_v10020746mg             305   5e-96    
ref|XP_008667501.1|  PREDICTED: uncharacterized protein LOC100273...    305   5e-96    
ref|NP_001140637.1|  speckle-type POZ protein                           304   8e-96    Zea mays [maize]
ref|NP_001058976.1|  Os07g0167200                                       304   8e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003554047.1|  PREDICTED: BTB/POZ and MATH domain-containin...    304   8e-96    
ref|XP_006657481.1|  PREDICTED: BTB/POZ and MATH domain-containin...    304   8e-96    
dbj|BAJ90220.1|  predicted protein                                      304   9e-96    
gb|KHN34655.1|  BTB/POZ and MATH domain-containing protein 4            303   9e-96    
dbj|BAJ93826.1|  predicted protein                                      304   1e-95    
gb|AAM60841.1|  unknown                                                 303   3e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884409.1|  hypothetical protein ARALYDRAFT_896389             303   3e-95    
ref|XP_010031623.1|  PREDICTED: BTB/POZ and MATH domain-containin...    305   4e-95    
gb|ACG37150.1|  speckle-type POZ protein                                302   4e-95    Zea mays [maize]
ref|XP_006369190.1|  hypothetical protein POPTR_0001s18490g             296   4e-95    
ref|NP_566212.2|  BTB/POZ and M4 domain-containing protein              303   5e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003548681.2|  PREDICTED: BTB/POZ and MATH domain-containin...    303   1e-94    
ref|XP_002463757.1|  hypothetical protein SORBIDRAFT_01g005590          300   3e-94    Sorghum bicolor [broomcorn]
ref|XP_009411295.1|  PREDICTED: BTB/POZ and MATH domain-containin...    298   6e-94    
ref|XP_004491159.1|  PREDICTED: BTB/POZ and MATH domain-containin...    299   7e-94    
ref|NP_001141107.1|  uncharacterized protein LOC100273191               298   1e-93    Zea mays [maize]
ref|XP_004288385.1|  PREDICTED: BTB/POZ and MATH domain-containin...    298   2e-93    
ref|XP_004493213.1|  PREDICTED: BTB/POZ and MATH domain-containin...    297   5e-93    
ref|XP_010524999.1|  PREDICTED: BTB/POZ and MATH domain-containin...    297   7e-93    
gb|EMS49890.1|  BTB/POZ and MATH domain-containing protein 4            298   8e-93    
ref|XP_010485725.1|  PREDICTED: BTB/POZ and MATH domain-containin...    295   3e-92    
gb|AFD04128.1|  speckle-type POZ                                        295   3e-92    
ref|XP_008244139.1|  PREDICTED: BTB/POZ and MATH domain-containin...    294   5e-92    
ref|XP_007202130.1|  hypothetical protein PRUPE_ppa006091mg             294   6e-92    
emb|CDY29955.1|  BnaC01g40530D                                          294   1e-91    
gb|EMT28882.1|  Speckle-type POZ protein                                299   1e-91    
ref|XP_003557844.2|  PREDICTED: probable zinc metalloprotease EGY...    306   1e-91    
ref|XP_010463833.1|  PREDICTED: BTB/POZ and MATH domain-containin...    292   5e-91    
tpg|DAA51835.1|  TPA: hypothetical protein ZEAMMB73_694112              285   5e-91    
ref|XP_010513722.1|  PREDICTED: BTB/POZ and MATH domain-containin...    291   9e-91    
ref|XP_008451035.1|  PREDICTED: BTB/POZ and MATH domain-containin...    288   1e-89    
gb|KHG25171.1|  BTB/POZ and MATH domain-containing 4 -like protein      289   2e-89    
ref|XP_010520490.1|  PREDICTED: BTB/POZ and MATH domain-containin...    286   3e-89    
ref|XP_006297705.1|  hypothetical protein CARUB_v10013733mg             285   2e-88    
ref|XP_003624698.1|  Speckle-type POZ protein                           285   2e-88    
emb|CDY67137.1|  BnaAnng23640D                                          282   2e-88    
ref|XP_003557540.2|  PREDICTED: BTB/POZ and MATH domain-containin...    288   3e-88    
gb|KGN66383.1|  hypothetical protein Csa_1G600230                       283   5e-88    
ref|XP_010485726.1|  PREDICTED: BTB/POZ and MATH domain-containin...    282   3e-87    
ref|XP_004955562.1|  PREDICTED: BTB/POZ and MATH domain-containin...    281   6e-87    
emb|CDX70957.1|  BnaC03g10410D                                          281   6e-87    
ref|XP_010454419.1|  PREDICTED: BTB/POZ and MATH domain-containin...    280   8e-87    
ref|NP_001150930.1|  LOC100284563                                       280   2e-86    Zea mays [maize]
gb|KFK37801.1|  speckle-type poz protein                                280   2e-86    
ref|XP_009131834.1|  PREDICTED: BTB/POZ and MATH domain-containin...    278   5e-86    
gb|KFK26316.1|  hypothetical protein AALP_AA8G231700                    278   6e-86    
emb|CDX88828.1|  BnaA03g08210D                                          278   7e-86    
ref|XP_006293225.1|  hypothetical protein CARUB_v10019549mg             277   1e-85    
gb|EMT17722.1|  Speckle-type POZ protein                                287   2e-85    
ref|XP_010493218.1|  PREDICTED: BTB/POZ and MATH domain-containin...    276   3e-85    
gb|ABK24368.1|  unknown                                                 276   3e-85    Picea sitchensis
ref|XP_006287859.1|  hypothetical protein CARUB_v10001086mg             276   4e-85    
ref|XP_004144146.1|  PREDICTED: BTB/POZ and MATH domain-containin...    273   7e-85    
gb|AGV54250.1|  BTB/POZ and MATH domain-containing protein 4-like...    276   7e-85    
ref|XP_010535766.1|  PREDICTED: BTB/POZ and MATH domain-containin...    274   2e-84    
ref|XP_002871964.1|  BTB-POZ and math domain 5                          274   2e-84    
ref|XP_004159364.1|  PREDICTED: BTB/POZ and MATH domain-containin...    275   3e-82    
ref|XP_009102074.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ...    270   3e-82    
ref|XP_010549705.1|  PREDICTED: BTB/POZ and MATH domain-containin...    265   3e-81    
ref|XP_006400672.1|  hypothetical protein EUTSA_v10013671mg             262   1e-79    
ref|XP_002325436.2|  speckle-type POZ family protein                    260   1e-79    Populus trichocarpa [western balsam poplar]
ref|NP_197600.1|  BTB-POZ and math domain 5                             261   2e-79    Arabidopsis thaliana [mouse-ear cress]
gb|AAM61175.1|  unknown                                                 261   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875616.1|  BTB-POZ and math domain 6                          261   4e-79    
ref|NP_189956.2|  BTB-POZ and math domain-containing protein            260   5e-79    Arabidopsis thaliana [mouse-ear cress]
emb|CAB83071.1|  putative protein                                       260   7e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002961582.1|  hypothetical protein SELMODRAFT_270271             259   2e-78    
ref|XP_007015537.1|  BTB/POZ and MATH domain-containing protein 4...    252   1e-76    
ref|XP_009126498.1|  PREDICTED: BTB/POZ and MATH domain-containin...    253   2e-76    
ref|XP_010503047.1|  PREDICTED: BTB/POZ and MATH domain-containin...    253   2e-76    
ref|XP_006598960.1|  PREDICTED: BTB/POZ and MATH domain-containin...    248   2e-74    
ref|XP_006842152.1|  hypothetical protein AMTR_s00078p00129860          243   6e-74    
ref|XP_006446682.1|  hypothetical protein CICLE_v10015761mg             243   5e-73    
ref|XP_002976951.1|  hypothetical protein SELMODRAFT_443336             244   6e-73    
ref|XP_001772248.1|  predicted protein                                  242   3e-72    
ref|XP_001783005.1|  predicted protein                                  241   5e-72    
gb|KDO47648.1|  hypothetical protein CISIN_1g015782mg                   239   6e-72    
gb|KHN47485.1|  BTB/POZ and MATH domain-containing protein 4            239   1e-71    
ref|XP_001776409.1|  predicted protein                                  238   1e-70    
ref|XP_003555034.1|  PREDICTED: BTB/POZ and MATH domain-containin...    236   3e-70    
ref|XP_008789447.1|  PREDICTED: BTB/POZ and MATH domain-containin...    235   3e-70    
ref|XP_010918009.1|  PREDICTED: BTB/POZ and MATH domain-containin...    234   8e-70    
ref|XP_010266709.1|  PREDICTED: BTB/POZ and MATH domain-containin...    234   1e-69    
ref|XP_008811723.1|  PREDICTED: BTB/POZ and MATH domain-containin...    234   2e-69    
ref|XP_002970063.1|  hypothetical protein SELMODRAFT_267336             234   5e-69    
ref|XP_006604026.1|  PREDICTED: BTB/POZ and MATH domain-containin...    231   3e-68    
ref|XP_006604020.1|  PREDICTED: BTB/POZ and MATH domain-containin...    230   7e-68    
ref|XP_010921384.1|  PREDICTED: BTB/POZ and MATH domain-containin...    229   1e-67    
ref|XP_010412486.1|  PREDICTED: BTB/POZ and MATH domain-containin...    228   8e-67    
ref|XP_006604027.1|  PREDICTED: BTB/POZ and MATH domain-containin...    227   8e-67    
ref|XP_008442028.1|  PREDICTED: BTB/POZ and MATH domain-containin...    226   1e-66    
gb|AAK68819.1|  Unknown protein                                         228   2e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010653194.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ...    226   3e-66    
ref|XP_007029996.1|  BTB-POZ and MATH domain 4 isoform 2                225   5e-66    
ref|XP_006604030.1|  PREDICTED: BTB/POZ and MATH domain-containin...    225   6e-66    
ref|XP_006479174.1|  PREDICTED: BTB/POZ and MATH domain-containin...    224   1e-65    
gb|KCW47782.1|  hypothetical protein EUGRSUZ_K01525                     223   2e-65    
gb|KDO66065.1|  hypothetical protein CISIN_1g013880mg                   222   4e-65    
ref|XP_009353081.1|  PREDICTED: BTB/POZ and MATH domain-containin...    223   5e-65    
gb|KDO66066.1|  hypothetical protein CISIN_1g013880mg                   221   1e-64    
gb|KEH28339.1|  BTB/POZ/MATH-domain protein                             220   3e-64    
gb|KEH28340.1|  BTB/POZ/MATH-domain protein                             219   3e-64    
ref|XP_009787612.1|  PREDICTED: BTB/POZ and MATH domain-containin...    221   4e-64    
emb|CDP03595.1|  unnamed protein product                                221   5e-64    
ref|XP_010093790.1|  BTB/POZ and MATH domain-containing protein 4       220   9e-64    
ref|XP_009621647.1|  PREDICTED: BTB/POZ and MATH domain-containin...    219   2e-63    
ref|XP_006443497.1|  hypothetical protein CICLE_v10020215mg             217   8e-63    
gb|KEH23724.1|  BTB/POZ/MATH-domain protein                             218   9e-63    
ref|XP_006339418.1|  PREDICTED: BTB/POZ and MATH domain-containin...    217   1e-62    
gb|EYU46623.1|  hypothetical protein MIMGU_mgv1a007354mg                217   2e-62    
gb|EPS58860.1|  hypothetical protein M569_15950                         216   2e-62    
ref|XP_006604419.1|  PREDICTED: BTB/POZ and MATH domain-containin...    216   4e-62    
ref|XP_011079801.1|  PREDICTED: BTB/POZ and MATH domain-containin...    216   4e-62    
ref|XP_004229460.1|  PREDICTED: BTB/POZ and MATH domain-containin...    216   5e-62    
ref|XP_007162393.1|  hypothetical protein PHAVU_001G148400g             216   6e-62    
ref|XP_011082543.1|  PREDICTED: BTB/POZ and MATH domain-containin...    215   9e-62    
emb|CDY71585.1|  BnaCnng73550D                                          207   2e-61    
gb|KDP21503.1|  hypothetical protein JCGZ_21974                         214   2e-61    
ref|XP_006846362.1|  hypothetical protein AMTR_s00012p00261580          213   2e-61    
ref|XP_006444138.1|  hypothetical protein CICLE_v10020406mg             214   3e-61    
ref|XP_010278817.1|  PREDICTED: BTB/POZ and MATH domain-containin...    214   3e-61    
ref|XP_007161863.1|  hypothetical protein PHAVU_001G104300g             213   4e-61    
ref|XP_008681390.1|  PREDICTED: speckle-type POZ protein isoform X1     212   7e-61    
ref|XP_010652109.1|  PREDICTED: BTB/POZ and MATH domain-containin...    212   1e-60    
tpg|DAA51839.1|  TPA: hypothetical protein ZEAMMB73_694112              211   2e-60    
ref|XP_010090357.1|  BTB/POZ and MATH domain-containing protein 2       211   3e-60    
gb|KHG07672.1|  BTB/POZ and MATH domain-containing 2 -like protein      211   4e-60    
ref|XP_006297810.1|  hypothetical protein CARUB_v10013845mg             210   9e-60    
ref|XP_006489244.1|  PREDICTED: BTB/POZ and MATH domain-containin...    209   1e-59    
ref|XP_010038130.1|  PREDICTED: BTB/POZ and MATH domain-containin...    209   1e-59    
gb|KEH23545.1|  BTB/POZ/MATH-domain protein                             207   2e-59    
ref|XP_009599207.1|  PREDICTED: BTB/POZ and MATH domain-containin...    209   2e-59    
ref|XP_006419782.1|  hypothetical protein CICLE_v10005094mg             209   2e-59    
ref|XP_008458543.1|  PREDICTED: BTB/POZ and MATH domain-containin...    209   3e-59    
gb|KHN18899.1|  BTB/POZ and MATH domain-containing protein 2            207   3e-59    
ref|XP_009799864.1|  PREDICTED: BTB/POZ and MATH domain-containin...    208   3e-59    
ref|XP_008438731.1|  PREDICTED: BTB/POZ and MATH domain-containin...    208   4e-59    
ref|XP_010551778.1|  PREDICTED: BTB/POZ and MATH domain-containin...    208   5e-59    
gb|AAO72687.1|  zinc finger POZ domain protein                          201   5e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010255859.1|  PREDICTED: BTB/POZ and MATH domain-containin...    207   1e-58    
gb|ABR16952.1|  unknown                                                 206   2e-58    Picea sitchensis
ref|XP_006407971.1|  hypothetical protein EUTSA_v10020850mg             206   3e-58    
gb|KDP40087.1|  hypothetical protein JCGZ_02085                         206   4e-58    
gb|KHG23818.1|  BTB/POZ and MATH domain-containing 2 -like protein      205   5e-58    
ref|XP_007050686.1|  BTB-POZ and MATH domain 2                          207   6e-58    
ref|XP_009120926.1|  PREDICTED: BTB/POZ and MATH domain-containin...    205   6e-58    
gb|KHG23128.1|  BTB/POZ and MATH domain-containing protein 2            205   7e-58    
ref|XP_008235067.1|  PREDICTED: BTB/POZ and MATH domain-containin...    203   7e-58    
ref|XP_004493645.1|  PREDICTED: BTB/POZ and MATH domain-containin...    207   8e-58    
ref|XP_009134877.1|  PREDICTED: BTB/POZ and MATH domain-containin...    204   8e-58    
ref|XP_002279548.1|  PREDICTED: BTB/POZ and MATH domain-containin...    204   8e-58    Vitis vinifera
emb|CDY08064.1|  BnaC03g34590D                                          204   9e-58    
gb|KHG05413.1|  BTB/POZ and MATH domain-containing 2 -like protein      204   1e-57    
ref|XP_006588617.1|  PREDICTED: BTB/POZ and MATH domain-containin...    204   1e-57    
ref|XP_010905244.1|  PREDICTED: BTB/POZ and MATH domain-containin...    204   2e-57    
ref|XP_006850808.1|  hypothetical protein AMTR_s00025p00114450          203   3e-57    
ref|XP_008808250.1|  PREDICTED: BTB/POZ and MATH domain-containin...    203   3e-57    
ref|XP_011006874.1|  PREDICTED: BTB/POZ and MATH domain-containin...    203   3e-57    
ref|XP_004495233.1|  PREDICTED: BTB/POZ and MATH domain-containin...    202   5e-57    
ref|XP_003590693.1|  Speckle-type POZ protein                           202   8e-57    
gb|KFK38092.1|  hypothetical protein AALP_AA3G068300                    202   9e-57    
ref|XP_010545078.1|  PREDICTED: BTB/POZ and MATH domain-containin...    205   1e-56    
ref|XP_002516797.1|  Speckle-type POZ protein, putative                 201   1e-56    Ricinus communis
ref|XP_010326625.1|  PREDICTED: BTB/POZ and MATH domain-containin...    202   1e-56    
emb|CDP00137.1|  unnamed protein product                                199   1e-56    
ref|XP_010425835.1|  PREDICTED: BTB/POZ and MATH domain-containin...    200   1e-56    
ref|XP_002315535.1|  speckle-type POZ family protein                    201   1e-56    Populus trichocarpa [western balsam poplar]
ref|XP_010113211.1|  BTB/POZ and MATH domain-containing protein 4       200   2e-56    
ref|XP_009405866.1|  PREDICTED: BTB/POZ and MATH domain-containin...    201   2e-56    
gb|AFK40364.1|  unknown                                                 201   3e-56    
ref|XP_007201051.1|  hypothetical protein PRUPE_ppa006488mg             201   3e-56    
ref|XP_004134158.1|  PREDICTED: BTB/POZ and MATH domain-containin...    200   3e-56    
ref|XP_002884563.1|  ATBPM2                                             200   4e-56    
ref|NP_566275.1|  BTB/POZ and M2 domain-containing protein              200   5e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400454.1|  hypothetical protein EUTSA_v10013699mg             200   5e-56    
ref|XP_009404705.1|  PREDICTED: BTB/POZ and MATH domain-containin...    200   5e-56    
ref|XP_010695310.1|  PREDICTED: BTB/POZ and MATH domain-containin...    200   6e-56    
ref|XP_006358428.1|  PREDICTED: BTB/POZ and MATH domain-containin...    200   6e-56    
ref|NP_197401.2|  BTB-POZ and math domain-containing protein            199   7e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004290680.1|  PREDICTED: BTB/POZ and MATH domain-containin...    199   8e-56    
ref|XP_010436693.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ...    199   1e-55    
ref|XP_007034571.1|  BTB-POZ and MATH domain 2                          199   2e-55    
ref|XP_009124937.1|  PREDICTED: BTB/POZ and MATH domain-containin...    198   2e-55    
gb|ACN26698.1|  unknown                                                 191   2e-55    Zea mays [maize]
ref|XP_007144604.1|  hypothetical protein PHAVU_007G169300g             198   2e-55    
ref|XP_007009287.1|  BTB/POZ/MATH-domains containing protein isof...    198   2e-55    
ref|XP_002871853.1|  BTB-POZ and math domain 1                          198   3e-55    
ref|XP_009131717.1|  PREDICTED: BTB/POZ and MATH domain-containin...    197   4e-55    
ref|XP_011009015.1|  PREDICTED: BTB/POZ and MATH domain-containin...    197   4e-55    
dbj|BAJ97789.1|  predicted protein                                      198   4e-55    
emb|CDY66705.1|  BnaAnng22770D                                          197   5e-55    
ref|XP_010454160.1|  PREDICTED: BTB/POZ and MATH domain-containin...    197   5e-55    
ref|XP_004296996.1|  PREDICTED: BTB/POZ and MATH domain-containin...    197   6e-55    
ref|XP_003562549.1|  PREDICTED: BTB/POZ and MATH domain-containin...    197   7e-55    
ref|XP_002524811.1|  Speckle-type POZ protein, putative                 199   9e-55    Ricinus communis
ref|XP_006287870.1|  hypothetical protein CARUB_v10001097mg             196   1e-54    
gb|EMT06101.1|  Speckle-type POZ protein-like protein                   197   1e-54    
ref|XP_009347696.1|  PREDICTED: BTB/POZ and MATH domain-containin...    196   2e-54    
ref|XP_010496737.1|  PREDICTED: BTB/POZ and MATH domain-containin...    196   2e-54    
ref|XP_006658050.1|  PREDICTED: BTB/POZ and MATH domain-containin...    191   3e-54    
ref|XP_009356740.1|  PREDICTED: BTB/POZ and MATH domain-containin...    195   4e-54    
ref|XP_009356739.1|  PREDICTED: BTB/POZ and MATH domain-containin...    195   4e-54    
gb|KFK26137.1|  hypothetical protein AALP_AA8G208400                    195   4e-54    
ref|XP_010524788.1|  PREDICTED: BTB/POZ and MATH domain-containin...    195   4e-54    
ref|XP_010420683.1|  PREDICTED: BTB/POZ and MATH domain-containin...    194   6e-54    
ref|XP_008368872.1|  PREDICTED: BTB/POZ and MATH domain-containin...    194   6e-54    
ref|XP_010103451.1|  BTB/POZ and MATH domain-containing protein 2       194   6e-54    
ref|XP_010695312.1|  PREDICTED: BTB/POZ and MATH domain-containin...    194   9e-54    
ref|XP_008355456.1|  PREDICTED: BTB/POZ and MATH domain-containin...    194   9e-54    
ref|XP_004153182.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ...    194   9e-54    
emb|CDY09093.1|  BnaA02g05190D                                          192   1e-53    
ref|XP_006380054.1|  hypothetical protein POPTR_0008s20510g             194   1e-53    
ref|XP_002311186.2|  hypothetical protein POPTR_0008s06000g             193   2e-53    
gb|KDO69176.1|  hypothetical protein CISIN_1g015560mg                   192   3e-53    
ref|XP_009339952.1|  PREDICTED: BTB/POZ and MATH domain-containin...    191   3e-53    
ref|XP_010524787.1|  PREDICTED: BTB/POZ and MATH domain-containin...    192   4e-53    
ref|XP_006435614.1|  hypothetical protein CICLE_v10031714mg             192   5e-53    
ref|XP_008651507.1|  PREDICTED: LOC100284563 isoform X1                 191   5e-53    
ref|XP_007222747.1|  hypothetical protein PRUPE_ppa006500mg             192   7e-53    
ref|XP_010937553.1|  PREDICTED: BTB/POZ and MATH domain-containin...    191   9e-53    
ref|XP_008353276.1|  PREDICTED: BTB/POZ and MATH domain-containin...    187   1e-52    
emb|CDY24708.1|  BnaA05g31070D                                          190   2e-52    
ref|XP_011034402.1|  PREDICTED: BTB/POZ and MATH domain-containin...    191   2e-52    
emb|CDY05245.1|  BnaC05g45580D                                          190   2e-52    
ref|XP_008390810.1|  PREDICTED: BTB/POZ and MATH domain-containin...    190   2e-52    
ref|NP_001060495.1|  Os07g0655300                                       190   3e-52    
ref|XP_008223027.1|  PREDICTED: BTB/POZ and MATH domain-containin...    189   4e-52    
emb|CBI31621.3|  unnamed protein product                                187   5e-52    
gb|EEC82594.1|  hypothetical protein OsI_27153                          190   5e-52    
ref|XP_010554622.1|  PREDICTED: BTB/POZ and MATH domain-containin...    189   6e-52    
ref|XP_009129652.1|  PREDICTED: BTB/POZ and MATH domain-containin...    188   1e-51    
ref|XP_009621947.1|  PREDICTED: BTB/POZ and MATH domain-containin...    189   1e-51    
ref|XP_008340895.1|  PREDICTED: BTB/POZ and MATH domain-containin...    188   1e-51    
ref|XP_009797729.1|  PREDICTED: BTB/POZ and MATH domain-containin...    188   1e-51    
gb|EYU19944.1|  hypothetical protein MIMGU_mgv1a007421mg                188   2e-51    
ref|XP_010551779.1|  PREDICTED: BTB/POZ and MATH domain-containin...    189   2e-51    
gb|KHG23447.1|  BTB/POZ and MATH domain-containing 3 -like protein      187   2e-51    
ref|XP_009352133.1|  PREDICTED: BTB/POZ and MATH domain-containin...    187   3e-51    
ref|XP_010923233.1|  PREDICTED: BTB/POZ and MATH domain-containin...    187   4e-51    
emb|CDX92567.1|  BnaA10g16060D                                          187   5e-51    
ref|XP_002282536.1|  PREDICTED: BTB/POZ and MATH domain-containin...    186   6e-51    
ref|XP_002316266.1|  hypothetical protein POPTR_0010s20670g             186   7e-51    
ref|XP_007161862.1|  hypothetical protein PHAVU_001G104200g             186   8e-51    
ref|XP_002463303.1|  hypothetical protein SORBIDRAFT_02g041470          186   9e-51    
ref|XP_006411210.1|  hypothetical protein EUTSA_v10017774mg             186   9e-51    
ref|XP_008785535.1|  PREDICTED: BTB/POZ and MATH domain-containin...    186   9e-51    
ref|XP_002879815.1|  hypothetical protein ARALYDRAFT_903228             186   1e-50    
ref|XP_004958540.1|  PREDICTED: BTB/POZ and MATH domain-containin...    186   1e-50    
gb|ACG38997.1|  speckle-type POZ protein                                186   1e-50    
gb|AAM66127.1|  unknown                                                 185   2e-50    
ref|NP_001130519.1|  speckle-type POZ protein                           186   2e-50    
ref|NP_001140355.1|  hypothetical protein                               185   2e-50    
ref|NP_030522.1|  BTB/POZ and MATH domain-containing protein            185   2e-50    
ref|XP_006604032.1|  PREDICTED: BTB/POZ and MATH domain-containin...    183   2e-50    
ref|XP_009120927.1|  PREDICTED: BTB/POZ and MATH domain-containin...    185   3e-50    
gb|KHG28259.1|  BTB/POZ and MATH domain-containing 3 -like protein      184   3e-50    
ref|XP_003538428.1|  PREDICTED: BTB/POZ and MATH domain-containin...    185   3e-50    
ref|XP_011002614.1|  PREDICTED: BTB/POZ and MATH domain-containin...    184   4e-50    
ref|XP_006294342.1|  hypothetical protein CARUB_v10023357mg             184   4e-50    
emb|CDX70860.1|  BnaC03g09440D                                          185   5e-50    
ref|XP_010067446.1|  PREDICTED: BTB/POZ and MATH domain-containin...    184   5e-50    
emb|CDY16586.1|  BnaC09g36870D                                          177   6e-50    
ref|XP_003552772.1|  PREDICTED: BTB/POZ and MATH domain-containin...    184   7e-50    
emb|CDY61778.1|  BnaC03g72570D                                          184   8e-50    
ref|XP_004307466.1|  PREDICTED: BTB/POZ and MATH domain-containin...    184   8e-50    
ref|XP_010508974.1|  PREDICTED: BTB/POZ and MATH domain-containin...    183   1e-49    
ref|XP_007163464.1|  hypothetical protein PHAVU_001G236400g             183   1e-49    
dbj|BAJ94248.1|  predicted protein                                      182   2e-49    
ref|XP_007161864.1|  hypothetical protein PHAVU_001G104400g             182   2e-49    
emb|CDY07638.1|  BnaA03g18730D                                          182   2e-49    
ref|XP_010517337.1|  PREDICTED: BTB/POZ and MATH domain-containin...    182   3e-49    
ref|XP_007218050.1|  hypothetical protein PRUPE_ppa006151mg             182   3e-49    
ref|XP_009133381.1|  PREDICTED: BTB/POZ and MATH domain-containin...    182   3e-49    
ref|XP_008233485.1|  PREDICTED: BTB/POZ and MATH domain-containin...    182   4e-49    
emb|CDY07031.1|  BnaA04g22840D                                          181   4e-49    
ref|NP_001190334.1|  BTB-POZ and math domain-containing protein         182   4e-49    
ref|XP_006355691.1|  PREDICTED: BTB/POZ and MATH domain-containin...    181   4e-49    
ref|XP_010256804.1|  PREDICTED: BTB/POZ and MATH domain-containin...    182   4e-49    
ref|XP_003557713.1|  PREDICTED: BTB/POZ and MATH domain-containin...    181   8e-49    
ref|XP_004239913.1|  PREDICTED: BTB/POZ and MATH domain-containin...    181   8e-49    
ref|XP_009405868.1|  PREDICTED: BTB/POZ and MATH domain-containin...    179   2e-48    
ref|XP_009131718.1|  PREDICTED: BTB/POZ and MATH domain-containin...    180   2e-48    
ref|XP_002524218.1|  Speckle-type POZ protein, putative                 179   3e-48    
emb|CDY13941.1|  BnaC09g38850D                                          180   3e-48    
ref|XP_004503177.1|  PREDICTED: BTB/POZ and MATH domain-containin...    179   4e-48    
ref|XP_010691271.1|  PREDICTED: BTB/POZ and MATH domain-containin...    179   4e-48    
ref|XP_004495232.1|  PREDICTED: BTB/POZ and MATH domain-containin...    180   4e-48    
emb|CDY18844.1|  BnaAnng03090D                                          179   5e-48    
ref|NP_001058677.1|  Os07g0101400                                       178   7e-48    
ref|XP_010108399.1|  BTB/POZ and MATH domain-containing protein 3       178   7e-48    
ref|XP_006657384.1|  PREDICTED: BTB/POZ and MATH domain-containin...    178   7e-48    
ref|XP_009141835.1|  PREDICTED: BTB/POZ and MATH domain-containin...    177   9e-48    
emb|CDX93238.1|  BnaC04g46580D                                          177   1e-47    
gb|KDP44889.1|  hypothetical protein JCGZ_01389                         176   3e-47    
ref|XP_009785861.1|  PREDICTED: BTB/POZ and MATH domain-containin...    176   4e-47    
ref|XP_011076789.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ...    176   5e-47    
ref|XP_010496738.1|  PREDICTED: BTB/POZ and MATH domain-containin...    177   6e-47    
ref|XP_008803124.1|  PREDICTED: BTB/POZ and MATH domain-containin...    176   7e-47    
ref|XP_010420684.1|  PREDICTED: BTB/POZ and MATH domain-containin...    175   2e-46    
ref|XP_009601988.1|  PREDICTED: BTB/POZ and MATH domain-containin...    174   2e-46    
ref|XP_010691281.1|  PREDICTED: BTB/POZ and MATH domain-containin...    173   9e-46    
ref|XP_007163465.1|  hypothetical protein PHAVU_001G236400g             173   1e-45    
emb|CDY02591.1|  BnaC02g08440D                                          171   2e-45    
gb|AEZ00903.1|  putative protein binding                                169   3e-45    
ref|XP_006293345.1|  hypothetical protein CARUB_v100174340mg            163   6e-45    
ref|XP_002461292.1|  hypothetical protein SORBIDRAFT_02g000320          170   6e-45    
tpg|DAA42640.1|  TPA: Speckle-type POZ protein                          166   1e-44    
ref|XP_004987279.1|  PREDICTED: BTB/POZ and MATH domain-containin...    168   3e-44    
ref|XP_009409034.1|  PREDICTED: BTB/POZ and MATH domain-containin...    168   4e-44    
ref|NP_001142069.1|  uncharacterized protein LOC100274226               166   3e-43    
ref|XP_008372026.1|  PREDICTED: BTB/POZ and MATH domain-containin...    166   4e-43    
ref|XP_008808252.1|  PREDICTED: BTB/POZ and MATH domain-containin...    163   2e-42    
ref|XP_009351410.1|  PREDICTED: BTB/POZ and MATH domain-containin...    164   2e-42    
ref|XP_010905245.1|  PREDICTED: BTB/POZ and MATH domain-containin...    162   3e-42    
ref|XP_009343889.1|  PREDICTED: BTB/POZ and MATH domain-containin...    163   5e-42    
gb|KDO68823.1|  hypothetical protein CISIN_1g015430mg                   161   1e-41    
ref|XP_010067445.1|  PREDICTED: BTB/POZ and MATH domain-containin...    158   7e-41    
ref|XP_010255860.1|  PREDICTED: BTB/POZ and MATH domain-containin...    157   1e-40    
ref|XP_010424207.1|  PREDICTED: BTB/POZ and MATH domain-containin...    154   6e-40    
gb|KDD76145.1|  hypothetical protein H632_c337p0                        149   2e-38    
gb|EMT09732.1|  Speckle-type POZ protein-like protein B                 152   2e-38    
ref|XP_002438822.1|  hypothetical protein SORBIDRAFT_10g026770          150   1e-37    
ref|XP_007009288.1|  BTB/POZ/MATH-domains containing protein isof...    149   1e-37    
gb|KCW50988.1|  hypothetical protein EUGRSUZ_J00615                     146   3e-37    
gb|KHN46737.1|  BTB/POZ and MATH domain-containing protein 4            145   4e-37    
dbj|BAK03621.1|  predicted protein                                      148   4e-37    
ref|NP_001064650.2|  Os10g0427800                                       148   4e-37    
gb|AAP53868.1|  BTB/POZ domain containing protein, expressed            147   8e-37    
ref|XP_003568945.1|  PREDICTED: BTB/POZ and MATH domain-containin...    143   1e-36    
ref|XP_008644842.1|  PREDICTED: BTB/POZ and MATH domain-containin...    147   1e-36    
gb|EMT25921.1|  Speckle-type POZ protein                                146   2e-36    
ref|XP_004979744.1|  PREDICTED: BTB/POZ and MATH domain-containin...    146   2e-36    
dbj|BAJ92438.1|  predicted protein                                      146   2e-36    
ref|XP_010658525.1|  PREDICTED: BTB/POZ and MATH domain-containin...    145   3e-36    
ref|NP_001058318.1|  Os06g0668400                                       146   3e-36    
gb|EAY78546.1|  hypothetical protein OsI_33645                          146   3e-36    
ref|XP_010256807.1|  PREDICTED: BTB/POZ and MATH domain-containin...    145   3e-36    
ref|XP_010256806.1|  PREDICTED: BTB/POZ and MATH domain-containin...    145   4e-36    
ref|XP_009621950.1|  PREDICTED: BTB/POZ and MATH domain-containin...    144   1e-35    
ref|XP_010937554.1|  PREDICTED: BTB/POZ and MATH domain-containin...    144   1e-35    
ref|XP_009797730.1|  PREDICTED: BTB/POZ and MATH domain-containin...    144   1e-35    
ref|XP_009621951.1|  PREDICTED: BTB/POZ and MATH domain-containin...    144   1e-35    
ref|XP_010937555.1|  PREDICTED: BTB/POZ and MATH domain-containin...    144   1e-35    
ref|XP_004978248.1|  PREDICTED: BTB/POZ and MATH domain-containin...    144   1e-35    
gb|EAY73895.1|  hypothetical protein OsI_01779                          144   1e-35    
ref|XP_006355692.1|  PREDICTED: BTB/POZ and MATH domain-containin...    143   2e-35    
gb|EMT12262.1|  Speckle-type POZ protein                                144   2e-35    
gb|EMT25479.1|  Speckle-type POZ protein-like protein                   143   3e-35    
ref|XP_006607117.1|  PREDICTED: BTB/POZ and MATH domain-containin...    137   3e-35    
dbj|BAK06856.1|  predicted protein                                      143   3e-35    
ref|XP_002464299.1|  hypothetical protein SORBIDRAFT_01g015806          143   3e-35    
ref|XP_003571549.1|  PREDICTED: BTB/POZ and MATH domain-containin...    143   3e-35    
ref|XP_010321433.1|  PREDICTED: BTB/POZ and MATH domain-containin...    142   3e-35    
ref|XP_010238645.1|  PREDICTED: BTB/POZ and MATH domain-containin...    143   4e-35    
ref|XP_004966315.1|  PREDICTED: BTB/POZ and MATH domain-containin...    140   5e-35    
ref|XP_002445248.1|  hypothetical protein SORBIDRAFT_07g006850          142   5e-35    
gb|EMT16984.1|  Speckle-type POZ protein-like protein                   142   6e-35    
ref|XP_004967265.1|  PREDICTED: BTB/POZ and MATH domain-containin...    142   6e-35    
gb|EMT29070.1|  Speckle-type POZ protein-like protein                   142   6e-35    
ref|XP_006435615.1|  hypothetical protein CICLE_v10031714mg             141   7e-35    
ref|XP_002461730.1|  hypothetical protein SORBIDRAFT_02g007170          142   9e-35    
gb|AES71006.2|  BTB-POZ and MATH domain protein                         140   1e-34    
ref|NP_001064644.1|  Os10g0426600                                       142   1e-34    
gb|EYU19945.1|  hypothetical protein MIMGU_mgv1a007421mg                140   1e-34    
gb|EMS62743.1|  BTB/POZ and MATH domain-containing protein 3            140   1e-34    
ref|XP_009133382.1|  PREDICTED: BTB/POZ and MATH domain-containin...    140   1e-34    
ref|NP_001064654.1|  Os10g0428500                                       141   2e-34    
ref|XP_002447416.1|  hypothetical protein SORBIDRAFT_06g000740          141   2e-34    
gb|EMT05078.1|  Speckle-type POZ protein-like protein                   141   2e-34    
ref|NP_001057296.1|  Os06g0251200                                       140   2e-34    
gb|EEC81144.1|  hypothetical protein OsI_24051                          144   2e-34    
gb|EEE66186.1|  hypothetical protein OsJ_22301                          144   2e-34    
ref|NP_001176166.1|  Os10g0429500                                       146   2e-34    
gb|EAY78601.1|  hypothetical protein OsI_33697                          142   3e-34    
gb|AAP53877.1|  BTB/POZ domain containing protein, expressed            139   4e-34    
gb|EMT09733.1|  Speckle-type POZ protein-like protein                   144   4e-34    
gb|AAP53884.2|  BTB/POZ domain containing protein, expressed            139   5e-34    
gb|AAP53874.1|  BTB/POZ domain containing protein                       139   5e-34    
gb|EMS67274.1|  BTB/POZ and MATH domain-containing protein 2            139   5e-34    
gb|EAZ16140.1|  hypothetical protein OsJ_31586                          139   6e-34    
emb|CAE04740.1|  OSJNBb0060E08.3                                        139   6e-34    
ref|NP_001064643.1|  Os10g0426500                                       139   6e-34    
gb|EAY78583.1|  hypothetical protein OsI_33680                          139   6e-34    
ref|XP_003577323.2|  PREDICTED: BTB/POZ and MATH domain-containin...    139   7e-34    
gb|EMT18305.1|  Speckle-type POZ protein                                140   7e-34    
gb|EAY93352.1|  hypothetical protein OsI_15151                          139   7e-34    
gb|EMT23984.1|  Speckle-type POZ protein-like protein                   139   7e-34    
ref|NP_001053940.1|  Os04g0625600                                       139   7e-34    
gb|EEE68262.1|  hypothetical protein OsJ_26480                          137   8e-34    
ref|XP_003571556.1|  PREDICTED: BTB/POZ and MATH domain-containin...    139   8e-34    
gb|EMT28091.1|  Speckle-type POZ protein-like protein A                 138   8e-34    
ref|XP_004980762.1|  PREDICTED: BTB/POZ and MATH domain-containin...    139   8e-34    
gb|EMS52041.1|  BTB/POZ and MATH domain-containing protein 2            139   8e-34    
ref|XP_002449879.1|  hypothetical protein SORBIDRAFT_05g024790          139   9e-34    
ref|XP_003560433.1|  PREDICTED: BTB/POZ and MATH domain-containin...    139   9e-34    
ref|XP_010691290.1|  PREDICTED: BTB/POZ and MATH domain-containin...    139   1e-33    
gb|EMT11969.1|  Speckle-type POZ protein-like protein                   136   1e-33    
ref|XP_009601989.1|  PREDICTED: BTB/POZ and MATH domain-containin...    138   1e-33    
gb|EMT12448.1|  Speckle-type POZ protein-like protein                   138   1e-33    
ref|XP_009785862.1|  PREDICTED: BTB/POZ and MATH domain-containin...    138   1e-33    
emb|CAH66829.1|  OSIGBa0148A10.6                                        139   1e-33    
gb|EMT04227.1|  Speckle-type POZ protein-like protein                   138   1e-33    
ref|NP_001061288.1|  Os08g0227400                                       137   1e-33    
ref|XP_006662370.1|  PREDICTED: BTB/POZ and MATH domain-containin...    139   1e-33    
gb|EMS66243.1|  BTB/POZ and MATH domain-containing protein 1            137   1e-33    
dbj|BAK03742.1|  predicted protein                                      138   2e-33    
gb|AFW56402.1|  hypothetical protein ZEAMMB73_159365                    138   2e-33    
gb|EMT16867.1|  Speckle-type POZ protein-like protein                   138   2e-33    
gb|EMT29302.1|  Speckle-type POZ protein-like protein A                 138   2e-33    
ref|XP_002449869.1|  hypothetical protein SORBIDRAFT_05g024660          138   2e-33    
gb|EMT09526.1|  Speckle-type POZ protein-like protein                   138   2e-33    
gb|AAP53828.1|  BTB/POZ domain containing protein                       138   2e-33    
gb|EMT26214.1|  Speckle-type POZ protein                                139   2e-33    
gb|EAZ06057.1|  hypothetical protein OsI_28297                          138   2e-33    
gb|EMS54916.1|  BTB/POZ and MATH domain-containing protein 2            137   2e-33    
ref|XP_010237882.1|  PREDICTED: BTB/POZ and MATH domain-containin...    138   2e-33    
gb|EMT06826.1|  Speckle-type POZ protein-like protein                   138   2e-33    
ref|XP_006591356.1|  PREDICTED: BTB/POZ and MATH domain-containin...    138   2e-33    



>ref|XP_009762142.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Nicotiana sylvestris]
Length=405

 Score =   392 bits (1006),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 201/246 (82%), Positives = 229/246 (93%), Gaps = 0/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVVRSTIDCS +H I +PDSDIG+HFGMLLENMEGSD++F+VA EKFHAHKLVLA
Sbjct  160  INCTVGVVRSTIDCSSLHPIQVPDSDIGSHFGMLLENMEGSDVVFSVADEKFHAHKLVLA  219

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARS +FR+EFFD LE D+QEIV+++ME  VFKAMLHF+Y DSL+E++LE +SSSSIPS++
Sbjct  220  ARSSVFRTEFFDELEGDKQEIVVADMEPTVFKAMLHFIYRDSLVEEELEDTSSSSIPSVT  279

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL AKLL AADRYDL RL+R+CE++LCKDISVNSV++TLALADCYHA ELK VCLRFAA
Sbjct  280  DTLTAKLLAAADRYDLTRLRRVCESHLCKDISVNSVSRTLALADCYHATELKAVCLRFAA  339

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGC+D+CSSGGGKSRSVWAQLSD GDT+GR
Sbjct  340  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCDDDCSSGGGKSRSVWAQLSDGGDTNGR  399

Query  722  RVRQRT  739
            RVRQRT
Sbjct  400  RVRQRT  405



>ref|XP_009606600.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Nicotiana tomentosiformis]
Length=405

 Score =   390 bits (1001),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 200/246 (81%), Positives = 229/246 (93%), Gaps = 0/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVVRSTIDCS +H I +PDSDIG+HFGMLLENMEGSD++F+VAGEKFHAHKLVLA
Sbjct  160  INCTVGVVRSTIDCSSLHPIQVPDSDIGSHFGMLLENMEGSDVVFSVAGEKFHAHKLVLA  219

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+FR+EFFD LE D+QEIV+++ME  VFKA+LHF+Y DSL+E++LE +SSSSIPS++
Sbjct  220  ARSPVFRTEFFDELEGDKQEIVVADMEPTVFKALLHFIYRDSLVEEELEDTSSSSIPSVT  279

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL AKLL AAD YDL RL+R+CE++LCKDISVNSV++TLALAD YHA ELK VCLRFAA
Sbjct  280  DTLTAKLLAAADLYDLTRLRRVCESHLCKDISVNSVSRTLALADRYHATELKAVCLRFAA  339

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGC+D+CSSGGGKSRSVWAQLSD GDT+GR
Sbjct  340  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCDDDCSSGGGKSRSVWAQLSDGGDTNGR  399

Query  722  RVRQRT  739
            RVRQRT
Sbjct  400  RVRQRT  405



>emb|CDP09732.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 224/246 (91%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +PDSDIGAHFGMLLENMEGSDIIFNV+GE FHAHKLVLA
Sbjct  115  INCTVGVVVSAIDCSRLHSIQVPDSDIGAHFGMLLENMEGSDIIFNVSGEIFHAHKLVLA  174

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSPIFRS+FFDG E + QEI++++ME  VF+AMLHF+Y D+L+ED+L ASSSSS PS S
Sbjct  175  ARSPIFRSDFFDGSEGNLQEIIVTDMEPNVFEAMLHFIYRDTLVEDELVASSSSSNPSDS  234

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
             T  AKLL AADRYDLGRL+RMCE+YLCK+I VNSVAKTLALADCYHA ELK VCLRFAA
Sbjct  235  LT--AKLLAAADRYDLGRLRRMCESYLCKEICVNSVAKTLALADCYHAAELKAVCLRFAA  292

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENLAAVM+SDGFEYLKENCPSLQSE+LKTVAGCE++CSSGGGKSRSVWAQLSD GDT+GR
Sbjct  293  ENLAAVMRSDGFEYLKENCPSLQSEILKTVAGCEEDCSSGGGKSRSVWAQLSDGGDTNGR  352

Query  722  RVRQRT  739
            RVRQRT
Sbjct  353  RVRQRT  358



>ref|XP_009771203.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Nicotiana sylvestris]
Length=409

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 197/247 (80%), Positives = 225/247 (91%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVVRSTIDCS +H+I +PD DIGAHFGMLLENMEGSDI+FNVAGEKFHAHKLVLA
Sbjct  163  INCTVGVVRSTIDCSSLHTIQVPDPDIGAHFGMLLENMEGSDIVFNVAGEKFHAHKLVLA  222

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssips-i  358
            ARSP+FRSE+FD  + DEQEIV+++ME +VFK MLHFVY D+L+E++LEA+S+SS    I
Sbjct  223  ARSPVFRSEYFDRQDVDEQEIVVTDMEPEVFKVMLHFVYKDALVEEELEATSTSSSAPCI  282

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SDT+ AKLL AADRY+L RL+R+CE++LCKDISVNSVA+ LALAD YHA ELK VCLRFA
Sbjct  283  SDTVTAKLLSAADRYNLTRLRRLCESHLCKDISVNSVAQILALADRYHATELKAVCLRFA  342

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENLAAVMQSDGFEYLKE+ PSLQSELLKTVAGCED+CSSGGGKS+SVWAQLSD GDT+G
Sbjct  343  AENLAAVMQSDGFEYLKEHSPSLQSELLKTVAGCEDDCSSGGGKSKSVWAQLSDGGDTNG  402

Query  719  RRVRQRT  739
            RRVRQRT
Sbjct  403  RRVRQRT  409



>ref|XP_009628011.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Nicotiana tomentosiformis]
Length=409

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 197/247 (80%), Positives = 225/247 (91%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVVRSTIDCS +H+I + D DIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA
Sbjct  163  INCTVGVVRSTIDCSSLHTIQVSDPDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  222

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssips-i  358
            ARSP+FR+E+FDG + DEQEIV+++ME +VFK MLHFVY D+L+E++LEA+S+SS    I
Sbjct  223  ARSPVFRTEYFDGQDVDEQEIVVTDMEPEVFKVMLHFVYKDALVEEELEATSTSSSTPCI  282

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SDT+ AKLL AADRY+L RL+R+CE++LCKDISVNSVA+ LALAD YHA ELK VCLRFA
Sbjct  283  SDTVTAKLLSAADRYNLTRLRRLCESHLCKDISVNSVAQILALADRYHATELKAVCLRFA  342

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENLAAVMQSDGFEYLKE+ PSLQSELLKTVAGCED+CSSGGGKS+SVWAQLSD GDT+G
Sbjct  343  AENLAAVMQSDGFEYLKEHSPSLQSELLKTVAGCEDDCSSGGGKSKSVWAQLSDGGDTNG  402

Query  719  RRVRQRT  739
            RRVRQRT
Sbjct  403  RRVRQRT  409



>gb|EYU46143.1| hypothetical protein MIMGU_mgv1a007584mg [Erythranthe guttata]
Length=403

 Score =   380 bits (977),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 200/246 (81%), Positives = 223/246 (91%), Gaps = 0/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +PDSDIGA FG LLENM+G+DI F+VAGEKF AHKLVLA
Sbjct  158  INCTVGVVVSAIDCSRLHSIQVPDSDIGADFGTLLENMDGADISFDVAGEKFQAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSPIFRSEFFD ++SDEQEIV+S+ME KVFKAMLHF+Y D+L+ED+L ASSS S P I+
Sbjct  218  ARSPIFRSEFFDVMDSDEQEIVVSDMEPKVFKAMLHFIYRDALVEDELIASSSCSSPLIT  277

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL AKLL AADRYDLGRL+RMCE++LCKDISVNSVA TLALAD +HA ELK +CLRFAA
Sbjct  278  DTLTAKLLAAADRYDLGRLRRMCESHLCKDISVNSVAHTLALADRFHAAELKAICLRFAA  337

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENLAAVM+SDGFEYLKENCP+LQSELLKTVAGCE++CSSGGGKSRSVWAQLSD GDT GR
Sbjct  338  ENLAAVMRSDGFEYLKENCPALQSELLKTVAGCEEDCSSGGGKSRSVWAQLSDGGDTTGR  397

Query  722  RVRQRT  739
            RVRQRT
Sbjct  398  RVRQRT  403



>ref|XP_006362728.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Solanum tuberosum]
Length=405

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 193/246 (78%), Positives = 224/246 (91%), Gaps = 0/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVVRSTID S +  I +PDSD+G+HFGMLLENMEGSD++F VAGEKFHAHKLVL 
Sbjct  160  INCTVGVVRSTIDISSLQPIQVPDSDMGSHFGMLLENMEGSDVVFIVAGEKFHAHKLVLT  219

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+FR+E FD L  D+QEIV+++ME +VFKAMLHF+Y DSL+++++E +SSSSIPS++
Sbjct  220  ARSPVFRTELFDELMGDKQEIVVTDMEPRVFKAMLHFIYRDSLVDEEIEDTSSSSIPSVT  279

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            +TL AKLL AADRYDL RL+R+CE++LCKDISVNSV++TLALAD YHA ELK VCLRFAA
Sbjct  280  NTLTAKLLAAADRYDLTRLRRVCESHLCKDISVNSVSRTLALADRYHATELKAVCLRFAA  339

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCED+CSSGGGKSRSVWAQLSD GDT+GR
Sbjct  340  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDDCSSGGGKSRSVWAQLSDGGDTNGR  399

Query  722  RVRQRT  739
            RVR RT
Sbjct  400  RVRHRT  405



>gb|ACM67640.1| BTB-POZ and MATH domain protein [Capsicum annuum]
Length=403

 Score =   375 bits (962),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 191/247 (77%), Positives = 219/247 (89%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVVRSTIDCS +H+I +PD DIGAHFGMLLENME SDIIFNVAGEKFHAHKLV+A
Sbjct  157  INCTVGVVRSTIDCSSLHTIQVPDPDIGAHFGMLLENMEASDIIFNVAGEKFHAHKLVMA  216

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+FR+E     + +EQEIV+++ME +VFKAMLHF+Y D+L+E++LEA+S+SS     
Sbjct  217  ARSPVFRTEIVYKQDGNEQEIVVNDMEPEVFKAMLHFIYRDALVEEELEATSTSSSTPRI  276

Query  362  d-tlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              T+ AKLL AADRYDL RL+R+CE++LCKDISVNSVA+ LALAD YHA ELK+VCL FA
Sbjct  277  SDTMTAKLLSAADRYDLTRLRRLCESHLCKDISVNSVAQILALADRYHAAELKSVCLSFA  336

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENLAAVMQSD FEYLKENCPSLQSELLKTVAGCED+CSSGGGKSRSVWAQLSD GDT+G
Sbjct  337  AENLAAVMQSDDFEYLKENCPSLQSELLKTVAGCEDDCSSGGGKSRSVWAQLSDGGDTNG  396

Query  719  RRVRQRT  739
            RRVRQRT
Sbjct  397  RRVRQRT  403



>ref|XP_004228476.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Solanum lycopersicum]
Length=405

 Score =   374 bits (961),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 190/246 (77%), Positives = 224/246 (91%), Gaps = 0/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVVRSTID + +  I +P SD+G+HFGMLLENMEG+D++F+VAGEKFHAHKLVL 
Sbjct  160  INCTVGVVRSTIDIASLQPIQVPGSDMGSHFGMLLENMEGTDVVFSVAGEKFHAHKLVLT  219

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+FR+E FD L  D+QEIV+++ME +VFKAMLHF+Y DSL+++++E +SSSSIPS++
Sbjct  220  ARSPVFRTELFDELMGDKQEIVVTDMEPRVFKAMLHFIYRDSLVDEEIEDTSSSSIPSVT  279

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL AKLL AADRY+L RL+R+CE++LCKDISVNSV++TLALAD YHA ELK VCLRFAA
Sbjct  280  DTLTAKLLAAADRYELTRLRRVCESHLCKDISVNSVSRTLALADRYHATELKAVCLRFAA  339

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCED+CSSGGGKSRSVWAQLSD GDT+GR
Sbjct  340  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDDCSSGGGKSRSVWAQLSDGGDTNGR  399

Query  722  RVRQRT  739
            RVR RT
Sbjct  400  RVRHRT  405



>ref|XP_011090255.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 [Sesamum 
indicum]
Length=403

 Score =   368 bits (945),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 194/246 (79%), Positives = 218/246 (89%), Gaps = 0/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +PDSDIG+H G LLENMEGSDI FNV+GE FHAHKLVLA
Sbjct  158  INCTVGVVVSAIDCSTLHSIQVPDSDIGSHIGTLLENMEGSDITFNVSGENFHAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP FRSEFF+ L++D+QEI++S+ME KVFKAMLHF+Y D+L+ED+L ASSS S P I+
Sbjct  218  ARSPKFRSEFFESLDTDDQEIMVSDMEPKVFKAMLHFIYRDALVEDELIASSSCSAPLIT  277

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL AKLL AADRYDL RL+R+CE+ LCKDISVNSV   LALAD Y+A ELKTVCLRFAA
Sbjct  278  DTLTAKLLAAADRYDLERLRRLCESRLCKDISVNSVTHILALADRYNAAELKTVCLRFAA  337

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENLAAVM+SDGFEYLKEN P+LQSELLKTVAGC+D+CSSGGGKSRSVWAQLSD GDT GR
Sbjct  338  ENLAAVMRSDGFEYLKENYPALQSELLKTVAGCDDDCSSGGGKSRSVWAQLSDGGDTSGR  397

Query  722  RVRQRT  739
            RVRQRT
Sbjct  398  RVRQRT  403



>ref|XP_002277148.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X2 [Vitis vinifera]
Length=411

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/247 (75%), Positives = 217/247 (88%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +PDSDIGAHFG+LLENMEGSD++F+VAGEKFHAHKLVLA
Sbjct  165  INCTVGVVVSAIDCSRLHSIQVPDSDIGAHFGVLLENMEGSDVVFDVAGEKFHAHKLVLA  224

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+FR+EFFD LE D QE+VI+++E KVFKAMLHF+Y D+L+ED    +SSS+  S  
Sbjct  225  ARSPVFRNEFFDRLEEDTQEVVITDLEPKVFKAMLHFIYRDALIEDVEMVASSSTCASSE  284

Query  362  d-tlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              TL  KLL AAD+Y L RL+RMCE+++CKDISV++VAKTLALAD YHA ELK VCLRFA
Sbjct  285  SDTLMEKLLAAADKYGLARLRRMCESHICKDISVHTVAKTLALADRYHATELKAVCLRFA  344

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENLAAVM+S+GF YLKEN P+LQSE+LKTVAGCE++CSSGGGK+RSVWAQLSD GDT+G
Sbjct  345  AENLAAVMRSEGFNYLKENFPALQSEILKTVAGCEEDCSSGGGKTRSVWAQLSDGGDTNG  404

Query  719  RRVRQRT  739
            RRVRQRT
Sbjct  405  RRVRQRT  411



>ref|XP_011006172.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Populus euphratica]
Length=397

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/247 (76%), Positives = 214/247 (87%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S  DCS ++SI +P+SDIGAHFGM+L+NMEGSD+IFNVAGEKFHAHKLVL+
Sbjct  151  INCTVGVVVSATDCSQLNSIQVPESDIGAHFGMMLDNMEGSDVIFNVAGEKFHAHKLVLS  210

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslle-ddleasssssipsi  358
            ARSP FRS+FFDG+E DE+EIVIS++E KVFKAMLHFVY D+L E  ++  SSSS + S 
Sbjct  211  ARSPFFRSKFFDGVEKDEKEIVISDLEPKVFKAMLHFVYRDTLTEDVNMVTSSSSLVSSK  270

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL  KLL AADRY L RLK MC ++LCKDISVNSVA  L +ADC+HA ELKTVCL+FA
Sbjct  271  SETLTTKLLAAADRYGLDRLKLMCGSHLCKDISVNSVASILTMADCHHATELKTVCLKFA  330

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENLAAVM SDGF  LKENCP LQSELLKTVAGCE++CSSGGGKSRSVWAQLSD GDT+G
Sbjct  331  AENLAAVMLSDGFANLKENCPLLQSELLKTVAGCEEDCSSGGGKSRSVWAQLSDGGDTNG  390

Query  719  RRVRQRT  739
            RRVRQRT
Sbjct  391  RRVRQRT  397



>ref|XP_006384724.1| hypothetical protein POPTR_0004s20530g [Populus trichocarpa]
 gb|ERP62521.1| hypothetical protein POPTR_0004s20530g [Populus trichocarpa]
Length=397

 Score =   358 bits (920),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 188/247 (76%), Positives = 214/247 (87%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S  DCS ++SI +P+SDIGAHFGM+L+NMEGSD+IFNVAGEKFHAHKLVL+
Sbjct  151  INCTVGVVVSATDCSQLNSIQVPESDIGAHFGMMLDNMEGSDVIFNVAGEKFHAHKLVLS  210

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslle-ddleasssssipsi  358
            ARSP FRS+FFDG+E DE+EIVIS++E KVFKAMLHFVY D+L E  ++  SSSS + SI
Sbjct  211  ARSPFFRSKFFDGVEKDEKEIVISDLEPKVFKAMLHFVYRDTLTEDVNMVTSSSSLVSSI  270

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL  KLL AADRY L RLK MC ++LCKDISVNSVA  L +ADC+HA ELK VCL+FA
Sbjct  271  SETLTTKLLAAADRYGLDRLKLMCGSHLCKDISVNSVASILTMADCHHATELKAVCLKFA  330

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENLAAVM SDGF  LKENCP LQSELLKTVAGCE++CSSGGGKSRSVWAQLSD GDT+G
Sbjct  331  AENLAAVMLSDGFANLKENCPLLQSELLKTVAGCEEDCSSGGGKSRSVWAQLSDGGDTNG  390

Query  719  RRVRQRT  739
            RRVRQRT
Sbjct  391  RRVRQRT  397



>ref|XP_007015536.1| BTB/POZ and MATH domain-containing protein 4 isoform 1 [Theobroma 
cacao]
 gb|EOY33155.1| BTB/POZ and MATH domain-containing protein 4 isoform 1 [Theobroma 
cacao]
Length=407

 Score =   355 bits (912),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 188/247 (76%), Positives = 212/247 (86%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +P+S+IGAHFGMLLENMEGSDI F+VAGEKFHAHKLVLA
Sbjct  163  INCTVGVVVSAIDCSRLHSIQVPESNIGAHFGMLLENMEGSDITFDVAGEKFHAHKLVLA  222

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            ARSP+FRSEFFDG++ ++QEIVI+N + KVFKA+LHF+Y      + +   S+ SS+ SI
Sbjct  223  ARSPVFRSEFFDGMDEEKQEIVITNFDPKVFKALLHFIYRDTLSEDVESVGSTFSSVSSI  282

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL AKLL AADRY L RLK MCE++LCK+ISVNSVAK LALAD YHA ELK VCLRFA
Sbjct  283  SETLIAKLLAAADRYGLERLKLMCESHLCKNISVNSVAKILALADQYHASELKAVCLRFA  342

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENLAAVM++DGFEYLKENCPSLQSELLKTVAGC DE  S GGKSRSVWAQLSD GDT G
Sbjct  343  AENLAAVMRTDGFEYLKENCPSLQSELLKTVAGC-DEDRSSGGKSRSVWAQLSD-GDTSG  400

Query  719  RRVRQRT  739
            RRVRQRT
Sbjct  401  RRVRQRT  407



>ref|XP_006470186.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Citrus sinensis]
Length=400

 Score =   355 bits (910),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 192/249 (77%), Positives = 215/249 (86%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +P+SDIGAHFGMLL+N E SDI F+VAGEKF AHKLVLA
Sbjct  153  INCTVGVVVSAIDCSRLHSIQVPESDIGAHFGMLLDNAESSDITFDVAGEKFPAHKLVLA  212

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslle---ddleasssssip  352
            ARSPIFRS+FFD LE D+QEI+IS++E KVFKAMLHF+Y D+L E    D+   SSS + 
Sbjct  213  ARSPIFRSKFFDELEEDKQEIIISDLEPKVFKAMLHFIYRDTLTEDVDVDVATPSSSCMS  272

Query  353  sisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLR  532
            S+SDTL AKLL AADRY L RL+ MC ++LCKDISVNSVAK LALAD +HA ELK VCLR
Sbjct  273  SVSDTLTAKLLAAADRYGLERLRLMCGSHLCKDISVNSVAKILALADEHHATELKAVCLR  332

Query  533  FAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            FAAENLAAVM+SDGFEYLKENCPSLQSELLKTVAGCE++CSS GGKSRSVWAQLSD GDT
Sbjct  333  FAAENLAAVMRSDGFEYLKENCPSLQSELLKTVAGCEEDCSS-GGKSRSVWAQLSDGGDT  391

Query  713  DGRRVRQRT  739
            +GRRVRQRT
Sbjct  392  NGRRVRQRT  400



>gb|EPS71913.1| hypothetical protein M569_02844, partial [Genlisea aurea]
Length=407

 Score =   355 bits (911),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 197/249 (79%), Positives = 222/249 (89%), Gaps = 3/249 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +PDSDIG+H GMLLENMEGSDI+FNV+GEKFHAHKLVLA
Sbjct  159  INCTVGVVVSAIDCSRLHSIQVPDSDIGSHIGMLLENMEGSDIVFNVSGEKFHAHKLVLA  218

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP FRSEFFD  +SDEQEIV+S++E  VFKAMLHF+Y D+LLED+L ASSSSS PS++
Sbjct  219  ARSPKFRSEFFDKCDSDEQEIVLSDLEPDVFKAMLHFIYRDALLEDELTASSSSSAPSVT  278

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DT+ AKLL AADRYDLGRL+RMCE++LCK+ISV+SVA  LALAD  HA ELK VCLRFAA
Sbjct  279  DTVAAKLLAAADRYDLGRLRRMCESHLCKEISVSSVALILALADSCHAAELKAVCLRFAA  338

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSS---GGGKSRSVWAQLSDSGDT  712
            ENLAAVM+SDGFEYLKENCP LQSELLKTVAGC+++CSS   GGGKSRSVWAQLSD GDT
Sbjct  339  ENLAAVMRSDGFEYLKENCPDLQSELLKTVAGCDEDCSSGGGGGGKSRSVWAQLSDGGDT  398

Query  713  DGRRVRQRT  739
             GRRVRQ+T
Sbjct  399  VGRRVRQKT  407



>ref|XP_011043823.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X3 [Populus euphratica]
Length=397

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 215/248 (87%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S  +CS ++SI +P+SDIGAHFGMLL+NMEGSD+IFNVAGEKFHAHKLVL+
Sbjct  150  INCTVGVVVSATNCSQLNSIQVPESDIGAHFGMLLDNMEGSDVIFNVAGEKFHAHKLVLS  209

Query  182  ARSPIFRSEFFD-GLESDEQEIVISNMESKVFKAMLHFVYtdslledd-leasssssips  355
            ARSP FRS+FFD G+E DEQEIVIS++E  VFKAMLHF+Y D+L ED  +  SSSSS  S
Sbjct  210  ARSPFFRSKFFDDGVEEDEQEIVISDLEPMVFKAMLHFIYRDTLTEDVDMATSSSSSDCS  269

Query  356  isdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
            +S+TL  KLL AADRY L RL+ MCE++LCKDISVNSV+  LALADC+HA ELK VCL+F
Sbjct  270  VSETLTTKLLAAADRYGLDRLRLMCESHLCKDISVNSVSSILALADCHHATELKAVCLKF  329

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTD  715
            AAENLAAVM+SDGF YLKENCPSLQSELLKTVAGCE++CSS GGKSRSVWAQLSD  DT 
Sbjct  330  AAENLAAVMRSDGFTYLKENCPSLQSELLKTVAGCEEDCSSEGGKSRSVWAQLSDGCDTT  389

Query  716  GRRVRQRT  739
            GRRVRQRT
Sbjct  390  GRRVRQRT  397



>ref|XP_011016311.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X3 [Populus euphratica]
Length=397

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 215/248 (87%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S  +CS ++SI +P+SDIGAHFGMLL+NMEGSD+IFNVAGEKFHAHKLVL+
Sbjct  150  INCTVGVVVSATNCSQLNSIQVPESDIGAHFGMLLDNMEGSDVIFNVAGEKFHAHKLVLS  209

Query  182  ARSPIFRSEFFD-GLESDEQEIVISNMESKVFKAMLHFVYtdslledd-leasssssips  355
            ARSP FRS+FFD G+E DEQEIVIS++E  VFKAMLHF+Y D+L ED  +  SSSSS  S
Sbjct  210  ARSPFFRSKFFDDGVEEDEQEIVISDLEPMVFKAMLHFIYRDTLTEDVDMATSSSSSDCS  269

Query  356  isdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
            +S+TL  KLL AADRY L RL+ MCE++LCKDISVNSV+  LALADC+HA ELK VCL+F
Sbjct  270  VSETLTTKLLAAADRYGLDRLRLMCESHLCKDISVNSVSSILALADCHHATELKAVCLKF  329

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTD  715
            AAENLAAVM+SDGF YLKENCPSLQSELLKTVAGCE++CSS GGKSRSVWAQLSD  DT 
Sbjct  330  AAENLAAVMRSDGFTYLKENCPSLQSELLKTVAGCEEDCSSEGGKSRSVWAQLSDGCDTT  389

Query  716  GRRVRQRT  739
            GRRVRQRT
Sbjct  390  GRRVRQRT  397



>ref|XP_011080496.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Sesamum indicum]
Length=402

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 191/246 (78%), Positives = 219/246 (89%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +PDSDIG+ FG LLENMEGSDIIFNVAGEKFHAHKLVLA
Sbjct  158  INCTVGVVVSAIDCSRLHSIQVPDSDIGSDFGTLLENMEGSDIIFNVAGEKFHAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARS IF SE F+GL+SDEQEI++ +ME KVF+AMLHF+Y D+L+ED+L ASSSSS P I+
Sbjct  218  ARSSIFLSELFEGLDSDEQEIMVPDMEPKVFEAMLHFIYRDALVEDELVASSSSSSPLIT  277

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL AKLL AADRYDL RL+R+CE+ LCK ISVNSVA+TLALA+ +HA ELK +CLRFAA
Sbjct  278  DTLTAKLLAAADRYDLARLRRVCESRLCKYISVNSVAQTLALAERFHAAELKAICLRFAA  337

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENLAAVM+SDGFEYLKE+CP+LQSE+LKTVAGC+++CSS G KSRSVWAQLSD GDT GR
Sbjct  338  ENLAAVMRSDGFEYLKESCPALQSEILKTVAGCDEDCSS-GSKSRSVWAQLSDGGDTGGR  396

Query  722  RVRQRT  739
            RVRQRT
Sbjct  397  RVRQRT  402



>emb|CBI24397.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 184/259 (71%), Positives = 217/259 (84%), Gaps = 13/259 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +PDSDIGAHFG+LLENMEGSD++F+VAGEKFHAHKLVLA
Sbjct  147  INCTVGVVVSAIDCSRLHSIQVPDSDIGAHFGVLLENMEGSDVVFDVAGEKFHAHKLVLA  206

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            ARSP+FR+EFFD LE D QE+VI+++E KVFKAMLHF+Y    + + ++ ASSS+   S 
Sbjct  207  ARSPVFRNEFFDRLEEDTQEVVITDLEPKVFKAMLHFIYRDALIEDVEMVASSSTCASSE  266

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SDTL  KLL AAD+Y L RL+RMCE+++CKDISV++VAKTLALAD YHA ELK VCLRFA
Sbjct  267  SDTLMEKLLAAADKYGLARLRRMCESHICKDISVHTVAKTLALADRYHATELKAVCLRFA  326

Query  539  AENLA------------AVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSV  682
            AENLA            AVM+S+GF YLKEN P+LQSE+LKTVAGCE++CSSGGGK+RSV
Sbjct  327  AENLAAEPSLFACFWHLAVMRSEGFNYLKENFPALQSEILKTVAGCEEDCSSGGGKTRSV  386

Query  683  WAQLSDSGDTDGRRVRQRT  739
            WAQLSD GDT+GRRVRQRT
Sbjct  387  WAQLSDGGDTNGRRVRQRT  405



>ref|XP_003632235.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X1 [Vitis vinifera]
Length=423

 Score =   355 bits (910),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 184/259 (71%), Positives = 217/259 (84%), Gaps = 13/259 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +PDSDIGAHFG+LLENMEGSD++F+VAGEKFHAHKLVLA
Sbjct  165  INCTVGVVVSAIDCSRLHSIQVPDSDIGAHFGVLLENMEGSDVVFDVAGEKFHAHKLVLA  224

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            ARSP+FR+EFFD LE D QE+VI+++E KVFKAMLHF+Y    + + ++ ASSS+   S 
Sbjct  225  ARSPVFRNEFFDRLEEDTQEVVITDLEPKVFKAMLHFIYRDALIEDVEMVASSSTCASSE  284

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SDTL  KLL AAD+Y L RL+RMCE+++CKDISV++VAKTLALAD YHA ELK VCLRFA
Sbjct  285  SDTLMEKLLAAADKYGLARLRRMCESHICKDISVHTVAKTLALADRYHATELKAVCLRFA  344

Query  539  AENLA------------AVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSV  682
            AENLA            AVM+S+GF YLKEN P+LQSE+LKTVAGCE++CSSGGGK+RSV
Sbjct  345  AENLAAEPSLFACFWHLAVMRSEGFNYLKENFPALQSEILKTVAGCEEDCSSGGGKTRSV  404

Query  683  WAQLSDSGDTDGRRVRQRT  739
            WAQLSD GDT+GRRVRQRT
Sbjct  405  WAQLSDGGDTNGRRVRQRT  423



>ref|XP_011016310.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=398

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 215/248 (87%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S  +CS ++SI +P+SDIGAHFGMLL+NMEGSD+IFNVAGEKFHAHKLVL+
Sbjct  151  INCTVGVVVSATNCSQLNSIQVPESDIGAHFGMLLDNMEGSDVIFNVAGEKFHAHKLVLS  210

Query  182  ARSPIFRSEFFD-GLESDEQEIVISNMESKVFKAMLHFVYtdslledd-leasssssips  355
            ARSP FRS+FFD G+E DEQEIVIS++E  VFKAMLHF+Y D+L ED  +  SSSSS  S
Sbjct  211  ARSPFFRSKFFDDGVEEDEQEIVISDLEPMVFKAMLHFIYRDTLTEDVDMATSSSSSDCS  270

Query  356  isdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
            +S+TL  KLL AADRY L RL+ MCE++LCKDISVNSV+  LALADC+HA ELK VCL+F
Sbjct  271  VSETLTTKLLAAADRYGLDRLRLMCESHLCKDISVNSVSSILALADCHHATELKAVCLKF  330

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTD  715
            AAENLAAVM+SDGF YLKENCPSLQSELLKTVAGCE++CSS GGKSRSVWAQLSD  DT 
Sbjct  331  AAENLAAVMRSDGFTYLKENCPSLQSELLKTVAGCEEDCSSEGGKSRSVWAQLSDGCDTT  390

Query  716  GRRVRQRT  739
            GRRVRQRT
Sbjct  391  GRRVRQRT  398



>ref|XP_011043816.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X2 [Populus euphratica]
Length=398

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 215/248 (87%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S  +CS ++SI +P+SDIGAHFGMLL+NMEGSD+IFNVAGEKFHAHKLVL+
Sbjct  151  INCTVGVVVSATNCSQLNSIQVPESDIGAHFGMLLDNMEGSDVIFNVAGEKFHAHKLVLS  210

Query  182  ARSPIFRSEFFD-GLESDEQEIVISNMESKVFKAMLHFVYtdslledd-leasssssips  355
            ARSP FRS+FFD G+E DEQEIVIS++E  VFKAMLHF+Y D+L ED  +  SSSSS  S
Sbjct  211  ARSPFFRSKFFDDGVEEDEQEIVISDLEPMVFKAMLHFIYRDTLTEDVDMATSSSSSDCS  270

Query  356  isdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
            +S+TL  KLL AADRY L RL+ MCE++LCKDISVNSV+  LALADC+HA ELK VCL+F
Sbjct  271  VSETLTTKLLAAADRYGLDRLRLMCESHLCKDISVNSVSSILALADCHHATELKAVCLKF  330

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTD  715
            AAENLAAVM+SDGF YLKENCPSLQSELLKTVAGCE++CSS GGKSRSVWAQLSD  DT 
Sbjct  331  AAENLAAVMRSDGFTYLKENCPSLQSELLKTVAGCEEDCSSEGGKSRSVWAQLSDGCDTT  390

Query  716  GRRVRQRT  739
            GRRVRQRT
Sbjct  391  GRRVRQRT  398



>gb|KDO47647.1| hypothetical protein CISIN_1g015782mg [Citrus sinensis]
Length=400

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 191/249 (77%), Positives = 215/249 (86%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +P+SDIGAHFGMLL+N E SDI F+VAGEKF AHKLVLA
Sbjct  153  INCTVGVVVSAIDCSRLHSIQVPESDIGAHFGMLLDNAESSDITFDVAGEKFPAHKLVLA  212

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslle---ddleasssssip  352
            ARSPIFRS+FFD LE D+QEI+IS++E KVFKAMLHF+Y D+L E    D+   SSS + 
Sbjct  213  ARSPIFRSKFFDELEEDKQEIIISDLEPKVFKAMLHFIYRDTLTEDVDVDVATPSSSCMS  272

Query  353  sisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLR  532
            S+SDTL AKLL AADRY L RL+ MC ++LCKDISVNSVAK L+LAD +HA ELK VCLR
Sbjct  273  SVSDTLTAKLLAAADRYGLERLRLMCGSHLCKDISVNSVAKILSLADEHHATELKAVCLR  332

Query  533  FAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            FAAENLAAVM+SDGFEYLKENCPSLQSELLKTVAGCE++CSS GGKSRSVWAQLSD GDT
Sbjct  333  FAAENLAAVMRSDGFEYLKENCPSLQSELLKTVAGCEEDCSS-GGKSRSVWAQLSDGGDT  391

Query  713  DGRRVRQRT  739
            +GRRVRQRT
Sbjct  392  NGRRVRQRT  400



>ref|XP_002313624.2| hypothetical protein POPTR_0009s15830g [Populus trichocarpa]
 gb|EEE87579.2| hypothetical protein POPTR_0009s15830g [Populus trichocarpa]
Length=398

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 187/248 (75%), Positives = 215/248 (87%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S  + S ++SI +P+SDIGAHFGMLL+NMEGSD+IFNVAGEKFHAHKLVL+
Sbjct  151  INCTVGVVVSATNSSQLNSIQVPESDIGAHFGMLLDNMEGSDVIFNVAGEKFHAHKLVLS  210

Query  182  ARSPIFRSEFFD-GLESDEQEIVISNMESKVFKAMLHFVYtdslledd-leasssssips  355
            ARSP FRS+FFD G+E DEQEIVIS++E  VFKAMLHF+Y D+L ED  +  SSSS + S
Sbjct  211  ARSPFFRSKFFDDGVEEDEQEIVISDLEPVVFKAMLHFIYRDTLTEDVDMATSSSSPVCS  270

Query  356  isdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
            +S+TL  KLL AADRY L RL+ MCE++LCKDISVNSV+  LALADC+HA ELK VCL+F
Sbjct  271  VSETLTTKLLAAADRYGLDRLRLMCESHLCKDISVNSVSSILALADCHHATELKAVCLKF  330

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTD  715
            AAENLAAVM+SDGF YLKENCPSLQSELLKTVAGCE++CSS GGKSRSVWAQLSD  DT+
Sbjct  331  AAENLAAVMRSDGFTYLKENCPSLQSELLKTVAGCEEDCSSEGGKSRSVWAQLSDGCDTN  390

Query  716  GRRVRQRT  739
            GRRVRQRT
Sbjct  391  GRRVRQRT  398



>gb|KDP42915.1| hypothetical protein JCGZ_23857 [Jatropha curcas]
Length=403

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 186/247 (75%), Positives = 216/247 (87%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSI +P+SDIGAHFGMLLENMEGSD+ FNVAGEK HAHKLVLA
Sbjct  158  INCTVGVVVSAIDCPRLHSIQVPESDIGAHFGMLLENMEGSDVTFNVAGEKIHAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslledd-leasssssipsi  358
            ARSP+FRS+FFDG E ++QE+ I+++E KVFKAMLHF+Y D+L ED  +E SSSS + S+
Sbjct  218  ARSPLFRSKFFDG-EEEKQEVDITDLEPKVFKAMLHFIYRDTLTEDVDMETSSSSCLSSV  276

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL AKLL AADRY L RL+ MCE++LCKDISV+SVA  LALAD +HA ELK VCL+FA
Sbjct  277  SETLTAKLLAAADRYGLDRLRLMCESHLCKDISVDSVASILALADSHHATELKAVCLKFA  336

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENLAAVM+SD FE+L+ENCPSLQSELLK VAGCE++CSSGGGKSRSVWAQLSD GDT+G
Sbjct  337  AENLAAVMRSDSFEHLRENCPSLQSELLKAVAGCEEDCSSGGGKSRSVWAQLSDGGDTNG  396

Query  719  RRVRQRT  739
            RRVRQRT
Sbjct  397  RRVRQRT  403



>ref|XP_004251235.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 [Solanum 
lycopersicum]
Length=408

 Score =   350 bits (898),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 187/246 (76%), Positives = 221/246 (90%), Gaps = 0/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVVRSTI+CS +H+I +PDSD+G HFGMLLENME SD+IFNV+GE FHAHKLVLA
Sbjct  163  INCTVGVVRSTIECSSLHTIQVPDSDMGTHFGMLLENMEASDVIFNVSGEMFHAHKLVLA  222

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+F +EF  G E D QEIV+++ME KVFKAMLHF+Y D+L+E++LEA+ +S+ P IS
Sbjct  223  ARSPVFHTEFLCGHEGDAQEIVVNDMEPKVFKAMLHFIYKDALVEEELEATRTSTTPCIS  282

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL AKLL AADRYDL RL+R+CE++LCKDIS+NSVA+ LALAD YHA ELK+VCL FAA
Sbjct  283  DTLTAKLLSAADRYDLTRLRRLCESHLCKDISINSVAQILALADRYHAAELKSVCLSFAA  342

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENL+AVMQSDGFEYLKENCP+LQSELLKTVAGCED+ SSGGGKS+SVWAQLSD GDT+GR
Sbjct  343  ENLSAVMQSDGFEYLKENCPALQSELLKTVAGCEDDSSSGGGKSKSVWAQLSDGGDTNGR  402

Query  722  RVRQRT  739
            R+RQ+T
Sbjct  403  RIRQKT  408



>ref|XP_006340346.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Solanum tuberosum]
Length=408

 Score =   350 bits (897),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 187/246 (76%), Positives = 221/246 (90%), Gaps = 0/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVVRSTI+CS +H+I +PD D+GAHFGMLLENME SD+IFNVAGE FHAHKLVLA
Sbjct  163  INCTVGVVRSTIECSNLHTIQVPDQDMGAHFGMLLENMEASDVIFNVAGEMFHAHKLVLA  222

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+F +EF  G E D QEIV+++ME +VFKAMLHF+Y D+L+E++LEA+ +S+ P IS
Sbjct  223  ARSPVFHTEFLCGHEGDAQEIVVNDMEPEVFKAMLHFIYKDALVEEELEATRTSTTPCIS  282

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL AKLL AADRYDL RL+R+CE++LCKDIS+NSVA+ LALAD YHA ELK+VCL F+A
Sbjct  283  DTLTAKLLSAADRYDLTRLRRLCESHLCKDISINSVAQILALADRYHAAELKSVCLSFSA  342

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENL+AVMQSDGFEYLKENCP+LQSELLKTVAGCED+ SSGGGKS+SVWAQLSD GDT+GR
Sbjct  343  ENLSAVMQSDGFEYLKENCPALQSELLKTVAGCEDDSSSGGGKSKSVWAQLSDGGDTNGR  402

Query  722  RVRQRT  739
            R+RQRT
Sbjct  403  RIRQRT  408



>ref|XP_010266708.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X1 [Nelumbo nucifera]
Length=407

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 187/253 (74%), Positives = 216/253 (85%), Gaps = 8/253 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +PDSDIG HFG LLEN EGSDI+FNV G+KF+AHKLVLA
Sbjct  156  INCTVGVVVSAIDCSRLHSIQVPDSDIGDHFGTLLENQEGSDIVFNVDGDKFYAHKLVLA  215

Query  182  ARSPIFRSEFFDGLES-DEQEIVISNMESKVFKAMLHFVYtdsl------leddleasss  340
            ARSP+FR+EFFDGLE  D+ EI+I++ME KVFKA+LHF+Y D+L      +  +   SSS
Sbjct  216  ARSPVFRAEFFDGLEEEDKHEIIITDMEPKVFKALLHFIYRDTLIDDEELVPSNSSTSSS  275

Query  341  ssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKT  520
            S +  +S+TL AKLL AAD+Y L RL+ MCE+YLCKDISVNSVAKTLALAD YHAMELK 
Sbjct  276  SCVSPVSETLAAKLLAAADKYGLARLRLMCESYLCKDISVNSVAKTLALADRYHAMELKA  335

Query  521  VCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSD  700
            VCL+FAAENL AV++SDGFEYLKENCP+LQSE+LKTVAGCE+ECSS GGKSRSVWAQLSD
Sbjct  336  VCLKFAAENLGAVVRSDGFEYLKENCPALQSEILKTVAGCEEECSS-GGKSRSVWAQLSD  394

Query  701  SGDTDGRRVRQRT  739
             GDT+GRRVRQRT
Sbjct  395  GGDTNGRRVRQRT  407



>ref|XP_007015538.1| BTB/POZ and MATH domain-containing protein 4 isoform 3 [Theobroma 
cacao]
 gb|EOY33157.1| BTB/POZ and MATH domain-containing protein 4 isoform 3 [Theobroma 
cacao]
Length=402

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 185/247 (75%), Positives = 207/247 (84%), Gaps = 8/247 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +P+S+IGAHFGMLLENMEGSDI F+VAGEKFHAHKLVLA
Sbjct  163  INCTVGVVVSAIDCSRLHSIQVPESNIGAHFGMLLENMEGSDITFDVAGEKFHAHKLVLA  222

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            ARSP+FRSEFFDG++ ++QEIVI+N + KVFKA+LHF+Y      + +   S+ SS+ SI
Sbjct  223  ARSPVFRSEFFDGMDEEKQEIVITNFDPKVFKALLHFIYRDTLSEDVESVGSTFSSVSSI  282

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL AKLL AADRY L RLK MCE++LCK+ISVNSVAK LALAD YHA ELK VCLRFA
Sbjct  283  SETLIAKLLAAADRYGLERLKLMCESHLCKNISVNSVAKILALADQYHASELKAVCLRFA  342

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENLA     DGFEYLKENCPSLQSELLKTVAGC DE  S GGKSRSVWAQLSD GDT G
Sbjct  343  AENLA-----DGFEYLKENCPSLQSELLKTVAGC-DEDRSSGGKSRSVWAQLSD-GDTSG  395

Query  719  RRVRQRT  739
            RRVRQRT
Sbjct  396  RRVRQRT  402



>ref|XP_008789435.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Phoenix dactylifera]
Length=402

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/246 (71%), Positives = 212/246 (86%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +D   +HSI +P+SDIG HFGMLL+  EGSD++F+VAGEKFHAHKLVLA
Sbjct  158  INCTVGVVLSVMDSPRLHSIQVPESDIGMHFGMLLDKQEGSDVVFDVAGEKFHAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+FR++FFD L+ ++ EIV+++ME KVF+AMLHF+Y D+ +EDD   +SSS   S+S
Sbjct  218  ARSPVFRAQFFDELDCEKNEIVVTDMEPKVFEAMLHFIYRDTFVEDDALMASSSPASSVS  277

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTLP KLL AAD+Y L RL+ MCE+YLCKDISVNSVA TLALAD +HAMELK  CL+FAA
Sbjct  278  DTLPGKLLAAADKYGLERLQLMCESYLCKDISVNSVASTLALADQHHAMELKAACLKFAA  337

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENLAAVM+S+GF+YL++NCPSLQSELLK +AGCE+ECSS GGKSRSVWAQLSD GD++GR
Sbjct  338  ENLAAVMRSNGFQYLQDNCPSLQSELLKIIAGCEEECSS-GGKSRSVWAQLSDDGDSNGR  396

Query  722  RVRQRT  739
            RVR RT
Sbjct  397  RVRPRT  402



>gb|KHG12366.1| BTB/POZ and MATH domain-containing 4 -like protein [Gossypium 
arboreum]
Length=410

 Score =   336 bits (862),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 210/248 (85%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +P SDIGAHFGMLLENMEGSDI F+VAGEKF +HKLVLA
Sbjct  164  INCTVGVVVSAIDCSRLHSIQVPVSDIGAHFGMLLENMEGSDITFDVAGEKFRSHKLVLA  223

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            ARSP+FRSE FDG++  ++E+VI+++E +VFKA+LHF+Y      + +   SSS+S+ S+
Sbjct  224  ARSPVFRSEIFDGVDEQKKEMVITDLEPRVFKALLHFIYRDTLSEDAESVESSSASLSSV  283

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL AKLL AADRY L RLK MCE+ LCK+ISVNSVAK LALAD YHA ELK VCLRFA
Sbjct  284  SETLIAKLLAAADRYCLERLKLMCESRLCKNISVNSVAKILALADEYHATELKAVCLRFA  343

Query  539  AENL-AAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTD  715
            AENL AAVM+SDGFEYLK+NCP LQSELLKT+AGCE++ SS GGKSRSVWAQLSD  DT+
Sbjct  344  AENLAAAVMRSDGFEYLKDNCPLLQSELLKTIAGCEEDYSS-GGKSRSVWAQLSDGTDTN  402

Query  716  GRRVRQRT  739
            GRRVRQRT
Sbjct  403  GRRVRQRT  410



>ref|XP_011043808.1| PREDICTED: BTB/POZ and MATH domain-containing protein 5 isoform 
X1 [Populus euphratica]
Length=434

 Score =   335 bits (859),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 189/284 (67%), Positives = 215/284 (76%), Gaps = 38/284 (13%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S  +CS ++SI +P+SDIGAHFGMLL+NMEGSD+IFNVAGEKFHAHKLVL+
Sbjct  151  INCTVGVVVSATNCSQLNSIQVPESDIGAHFGMLLDNMEGSDVIFNVAGEKFHAHKLVLS  210

Query  182  ARSPIFRSEFFD-GLESDEQEIVISNMESKVFK---------------------------  277
            ARSP FRS+FFD G+E DEQEIVIS++E  VFK                           
Sbjct  211  ARSPFFRSKFFDDGVEEDEQEIVISDLEPMVFKVIFIPIRSNLLKAYWVRICVLVGFLCL  270

Query  278  ---------AMLHFVYtdslledd-leasssssipsisdtlpAKLLEAADRYDLGRLKRM  427
                     AMLHF+Y D+L ED  +  SSSSS  S+S+TL  KLL AADRY L RL+ M
Sbjct  271  FISLCDSLQAMLHFIYRDTLTEDVDMATSSSSSDCSVSETLTTKLLAAADRYGLDRLRLM  330

Query  428  CEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAAENLAAVMQSDGFEYLKENCPSL  607
            CE++LCKDISVNSV+  LALADC+HA ELK VCL+FAAENLAAVM+SDGF YLKENCPSL
Sbjct  331  CESHLCKDISVNSVSSILALADCHHATELKAVCLKFAAENLAAVMRSDGFTYLKENCPSL  390

Query  608  QSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGRRVRQRT  739
            QSELLKTVAGCE++CSS GGKSRSVWAQLSD  DT GRRVRQRT
Sbjct  391  QSELLKTVAGCEEDCSSEGGKSRSVWAQLSDGCDTTGRRVRQRT  434



>ref|XP_011016309.1| PREDICTED: BTB/POZ and MATH domain-containing protein 5-like 
isoform X1 [Populus euphratica]
Length=434

 Score =   335 bits (858),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 189/284 (67%), Positives = 215/284 (76%), Gaps = 38/284 (13%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S  +CS ++SI +P+SDIGAHFGMLL+NMEGSD+IFNVAGEKFHAHKLVL+
Sbjct  151  INCTVGVVVSATNCSQLNSIQVPESDIGAHFGMLLDNMEGSDVIFNVAGEKFHAHKLVLS  210

Query  182  ARSPIFRSEFFD-GLESDEQEIVISNMESKVFK---------------------------  277
            ARSP FRS+FFD G+E DEQEIVIS++E  VFK                           
Sbjct  211  ARSPFFRSKFFDDGVEEDEQEIVISDLEPMVFKVIFIPIRSNLLKAYWVRICVLVGFLCL  270

Query  278  ---------AMLHFVYtdslledd-leasssssipsisdtlpAKLLEAADRYDLGRLKRM  427
                     AMLHF+Y D+L ED  +  SSSSS  S+S+TL  KLL AADRY L RL+ M
Sbjct  271  FISLCDSLQAMLHFIYRDTLTEDVDMATSSSSSDCSVSETLTTKLLAAADRYGLDRLRLM  330

Query  428  CEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAAENLAAVMQSDGFEYLKENCPSL  607
            CE++LCKDISVNSV+  LALADC+HA ELK VCL+FAAENLAAVM+SDGF YLKENCPSL
Sbjct  331  CESHLCKDISVNSVSSILALADCHHATELKAVCLKFAAENLAAVMRSDGFTYLKENCPSL  390

Query  608  QSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGRRVRQRT  739
            QSELLKTVAGCE++CSS GGKSRSVWAQLSD  DT GRRVRQRT
Sbjct  391  QSELLKTVAGCEEDCSSEGGKSRSVWAQLSDGCDTTGRRVRQRT  434



>ref|XP_008442027.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X1 [Cucumis melo]
Length=428

 Score =   331 bits (848),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 178/247 (72%), Positives = 207/247 (84%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S ID S +HSIH+P+SDIGAHFG LLEN EGSDI FNV+GEKF AHKLVLA
Sbjct  153  INCTVGVVVSGIDSSRLHSIHVPESDIGAHFGTLLENEEGSDITFNVSGEKFRAHKLVLA  212

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddl-easssssipsi  358
            ARSP+F ++F + +E D  EI+I+ ME +VFKA+LHF+Y D+L EDD    +SSSS+PS+
Sbjct  213  ARSPVFENDFVNMMEEDNDEILITEMEPRVFKALLHFIYRDTLPEDDEFLEASSSSVPSL  272

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
             D+LPAKLL AAD+YDL RL+ MCE+ LCKDISVNSV+  LALAD YHA +LK+VCL+F 
Sbjct  273  PDSLPAKLLAAADKYDLPRLRLMCESVLCKDISVNSVSHILALADLYHAADLKSVCLKFT  332

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVMQSDGFE+LKENCP LQSELLKTVAGCEDE  SGGGKSRSVWAQ SD GDT+ 
Sbjct  333  AENLVAVMQSDGFEFLKENCPLLQSELLKTVAGCEDEELSGGGKSRSVWAQFSDGGDTND  392

Query  719  RRVRQRT  739
            R VRQ+T
Sbjct  393  RSVRQQT  399



>ref|XP_010918008.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
Length=415

 Score =   330 bits (847),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 208/242 (86%), Gaps = 1/242 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +D   +HSI +P+SDIG HFGMLL+  EGSD++F+VAGEKFHAHKLVLA
Sbjct  158  INCTVGVVVSVMDSPRLHSIQVPESDIGMHFGMLLDKQEGSDVVFDVAGEKFHAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+FR++FFD L+ ++ EIV+++ME KVF+AMLHF+Y D+ +EDD   +SSS + S+S
Sbjct  218  ARSPVFRAQFFDELDCEKNEIVVTDMEPKVFEAMLHFIYRDTFVEDDALIASSSPVSSVS  277

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL  KLL AAD+Y L RL+ MCE+YLCKDISVNSVA TLALAD +HAMELK  CL+FAA
Sbjct  278  DTLAGKLLAAADKYGLERLQLMCESYLCKDISVNSVASTLALADRHHAMELKAACLKFAA  337

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENLAAVM+S+GF+YLK+NCPSLQSELLK +AGCE+ECSS GGKSRSVWAQLSD GD++GR
Sbjct  338  ENLAAVMRSNGFQYLKDNCPSLQSELLKIIAGCEEECSS-GGKSRSVWAQLSDGGDSNGR  396

Query  722  RV  727
            R 
Sbjct  397  RT  398



>ref|XP_008811722.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X1 [Phoenix dactylifera]
Length=402

 Score =   329 bits (843),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 171/246 (70%), Positives = 207/246 (84%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +D   +HSI +P+SDIG HFGMLL+  EGSD++F+VAGEKFHAHKLVLA
Sbjct  158  INCTVGVVVSVMDSPRLHSIQVPESDIGMHFGMLLDKQEGSDVVFDVAGEKFHAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+FR++FFD L+ +E EIV+++ME KVF+AMLHF+Y D+ +EDD   +SSS   S+S
Sbjct  218  ARSPMFRAQFFDELDCEESEIVVTDMEPKVFEAMLHFIYRDTFIEDDALVASSSPESSMS  277

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL  KLL AAD+Y L RL+ MCE+YLCKD+SV+SVA TL+LAD YHAMELK  CL+FAA
Sbjct  278  DTLAGKLLAAADKYGLERLRLMCESYLCKDMSVDSVASTLSLADRYHAMELKAACLKFAA  337

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENL AVM+S+GF+ LK+NCPSLQSELLK +AGCE+ECSS GGKSRSVWAQLSD  D+ GR
Sbjct  338  ENLPAVMRSNGFQCLKDNCPSLQSELLKIIAGCEEECSS-GGKSRSVWAQLSDGADSSGR  396

Query  722  RVRQRT  739
            RVR RT
Sbjct  397  RVRPRT  402



>gb|KDP39652.1| hypothetical protein JCGZ_02672 [Jatropha curcas]
Length=424

 Score =   330 bits (845),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 177/246 (72%), Positives = 206/246 (84%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I+CTVGVV S IDCS +HSI++P+SDIG+HFG LLEN E SDI FNV GEKFHAHKLVLA
Sbjct  152  IHCTVGVVISAIDCSRLHSINVPESDIGSHFGALLENEECSDITFNVHGEKFHAHKLVLA  211

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+F +EFFD LE D +EIV+S+ME KVFKA+LHF+Y D+L+ED+  + SSSS  S  
Sbjct  212  ARSPVFENEFFDLLEEDNREIVVSDMEPKVFKALLHFIYKDTLVEDEELSMSSSSCISSV  271

Query  362  d-tlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              TL +KLL AAD+YDL RL+ MCE+ LCKDISVNSVAK LALAD YHAM+LK+VCL+F 
Sbjct  272  SDTLVSKLLAAADKYDLPRLRLMCESVLCKDISVNSVAKILALADRYHAMDLKSVCLKFT  331

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVM+SDGFEYLKENCP LQSELLKTVAGCE++C SGGGKSRSVW Q SD  DT+ 
Sbjct  332  AENLVAVMRSDGFEYLKENCPLLQSELLKTVAGCEEDC-SGGGKSRSVWGQFSDGDDTND  390

Query  719  RRVRQR  736
            R VRQ+
Sbjct  391  RSVRQQ  396



>ref|XP_010685504.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 [Beta 
vulgaris subsp. vulgaris]
Length=398

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 174/247 (70%), Positives = 208/247 (84%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S+++C  +H I +P+SD+G HFGMLLEN EGSDI+F VAGEKFHAHKLVLA
Sbjct  152  INCTVGVVVSSVECPRLHPIRVPESDMGMHFGMLLENTEGSDIVFVVAGEKFHAHKLVLA  211

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssss-ipsi  358
            ARSPIFRSEF + LE  ++EI++++ME KVF+AMLHF+Y D L+E+   A  SSS    I
Sbjct  212  ARSPIFRSEFLEKLEEGKEEIIVNDMEPKVFQAMLHFIYRDDLVEEADLAQLSSSCESHI  271

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            +D L  KLL AAD+Y LGRL+++CE+ LCK ISV++V + LALADC++A ELK VCLRFA
Sbjct  272  ADLLIGKLLAAADKYGLGRLRQLCESSLCKGISVHTVGEILALADCHNATELKAVCLRFA  331

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENLAAVM+SDGFEYLKE+CPSLQSELLKTVAGCED+CSS GGKSRSVWAQLSD GDT+ 
Sbjct  332  AENLAAVMRSDGFEYLKEHCPSLQSELLKTVAGCEDDCSSAGGKSRSVWAQLSDGGDTND  391

Query  719  RRVRQRT  739
            RRVR RT
Sbjct  392  RRVRPRT  398



>ref|XP_002525692.1| BTB and MATH domain-containing protein, putative [Ricinus communis]
 gb|EEF36675.1| BTB and MATH domain-containing protein, putative [Ricinus communis]
Length=367

 Score =   327 bits (838),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 178/246 (72%), Positives = 206/246 (84%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I+CTVGVV S IDCS +HSI +P+SDIGAHFGMLL+N E SDI FNV GEKFHAHKLVLA
Sbjct  95   IHCTVGVVVSAIDCSRLHSIKVPESDIGAHFGMLLDNEECSDITFNVHGEKFHAHKLVLA  154

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+F SEFFD LE D  E+V++++E KVFKA+LHF+Y D+L+ED+  + SSSS  S +
Sbjct  155  ARSPVFESEFFDALEEDIHEVVVTDIEPKVFKALLHFIYKDTLVEDEELSVSSSSSMSST  214

Query  362  d-tlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              TL AKLL AADRYDL RL+ MCE+ LCKDISVNSVAK LALAD Y+A +LK+VCL+FA
Sbjct  215  SDTLIAKLLAAADRYDLPRLRLMCESVLCKDISVNSVAKILALADRYNATDLKSVCLKFA  274

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVM+SDGFEYLKENCP LQSELLKTVAGCE+E  SGGGKSRSVWAQ SD  DT+ 
Sbjct  275  AENLIAVMRSDGFEYLKENCPLLQSELLKTVAGCEEEF-SGGGKSRSVWAQFSDGDDTND  333

Query  719  RRVRQR  736
            R VRQ+
Sbjct  334  RSVRQQ  339



>ref|XP_004149104.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Cucumis sativus]
 ref|XP_004163287.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Cucumis sativus]
 gb|KGN53904.1| hypothetical protein Csa_4G187830 [Cucumis sativus]
Length=428

 Score =   329 bits (843),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 177/247 (72%), Positives = 206/247 (83%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S ID S +HSIH+P+SDIGAHFG LLEN EGSDI FNV+GEK  AHKLVLA
Sbjct  153  INCTVGVVVSGIDSSRLHSIHVPESDIGAHFGTLLENEEGSDITFNVSGEKLRAHKLVLA  212

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddl-easssssipsi  358
            ARSP+F ++F + +E D  EI+I+ ME +VFKA+LHF+Y D+L EDD    +SSSS+PS+
Sbjct  213  ARSPVFENDFVNMMEEDNDEILITEMEPRVFKALLHFIYRDTLPEDDEFLEASSSSVPSL  272

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
             D+LPAKLL AAD+YDL RL+ MCE+ LCKDISVNSV+  LALAD YHA +LK+VCL+F 
Sbjct  273  PDSLPAKLLAAADKYDLPRLRLMCESVLCKDISVNSVSHILALADLYHAADLKSVCLKFT  332

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVMQSDGFE+LKENCP LQSELLKTVAGCEDE  SGGGKSRSVWAQ SD GDT+ 
Sbjct  333  AENLVAVMQSDGFEFLKENCPLLQSELLKTVAGCEDEELSGGGKSRSVWAQFSDGGDTND  392

Query  719  RRVRQRT  739
            R VRQ+T
Sbjct  393  RSVRQQT  399



>ref|XP_007029995.1| BTB-POZ and MATH domain 4 isoform 1 [Theobroma cacao]
 gb|EOY10497.1| BTB-POZ and MATH domain 4 isoform 1 [Theobroma cacao]
Length=423

 Score =   325 bits (832),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 179/247 (72%), Positives = 208/247 (84%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +H I +P+SDIGAHFGMLLEN EGSDI FNV GEKFHAHKLVLA
Sbjct  149  INCTVGVVVSEIDCPRLHPIQVPESDIGAHFGMLLENEEGSDITFNVFGEKFHAHKLVLA  208

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssss-ipsi  358
            +RSP+F +EF D +E D  EIV+++ME KVFKA+LHF+Y D+L++D+    +SSS +PS+
Sbjct  209  SRSPVFEAEFSDRMEEDNNEIVVTDMEPKVFKALLHFIYRDTLIDDEEFLGTSSSCMPSV  268

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SD L +KLL AAD+YDL RL+ MCE+ LCKDISVNSVA  LALAD YHAM+LK+VCL+FA
Sbjct  269  SDALASKLLAAADKYDLPRLRLMCESVLCKDISVNSVANILALADRYHAMDLKSVCLKFA  328

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVM+SDGFEYLKENCPSLQSELLKTVAGCE+E  SGGGKSRSVWAQ SD GDT  
Sbjct  329  AENLVAVMRSDGFEYLKENCPSLQSELLKTVAGCEEEF-SGGGKSRSVWAQFSDGGDTID  387

Query  719  RRVRQRT  739
            R VRQ+T
Sbjct  388  RSVRQQT  394



>ref|XP_006371199.1| hypothetical protein POPTR_0019s05580g [Populus trichocarpa]
 gb|ERP48996.1| hypothetical protein POPTR_0019s05580g [Populus trichocarpa]
Length=426

 Score =   325 bits (832),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 174/245 (71%), Positives = 203/245 (83%), Gaps = 2/245 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I+CTVGVV S  DCS +HSI +P+SDIG HFGMLLEN + SDIIF+V G+KFHAHKLVL 
Sbjct  155  IHCTVGVVVSATDCSRLHSIKVPESDIGDHFGMLLENEDCSDIIFSVQGQKFHAHKLVLV  214

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+F +E  D +E D  EIVIS++E KVFKA+LHF+Y D L+ED+  ++SSS+     
Sbjct  215  ARSPVFENELLDAMEEDNSEIVISDIEPKVFKALLHFIYKDDLIEDEELSASSSTSVISV  274

Query  362  -dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
             DTL AKLLEAADRYDL RL+ MCEA LCKDISV+SVAK LALAD YHAM+LK+VCL+F+
Sbjct  275  FDTLTAKLLEAADRYDLPRLRLMCEAVLCKDISVSSVAKILALADRYHAMDLKSVCLKFS  334

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AV+QSDGFEYLKENCP LQSELLKTVAGCE++  SGGGKSRSVWAQ SD GDT+ 
Sbjct  335  AENLVAVVQSDGFEYLKENCPLLQSELLKTVAGCEEDV-SGGGKSRSVWAQFSDGGDTND  393

Query  719  RRVRQ  733
            R VRQ
Sbjct  394  RSVRQ  398



>ref|XP_008386876.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Malus domestica]
Length=435

 Score =   323 bits (829),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 173/247 (70%), Positives = 206/247 (83%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S ID S +HSIH+PDSDIG HFGMLLEN EGSD+ FNV GE+FHAHKLVLA
Sbjct  156  INCTVGVVVSAIDSSRLHSIHVPDSDIGDHFGMLLENEEGSDVTFNVCGERFHAHKLVLA  215

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssss-ipsi  358
            ARSP+F  EFFDG E +  +IV+++M+ KVFKA+LHF+YTD+L+ED+  + +SS  + S+
Sbjct  216  ARSPLFEKEFFDGTEEENHDIVVTDMDPKVFKALLHFIYTDNLVEDEELSDASSLCMSSL  275

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SD L AKLL A+D+Y L RL+ MCE+ LCK +SVNSVA  LALAD Y AM+LK+VCL+FA
Sbjct  276  SDGLAAKLLAASDKYCLPRLRLMCESVLCKIMSVNSVAIILALADRYRAMDLKSVCLKFA  335

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVM+SDGFEYLKENCP LQSELLKTVAGC++E  SGGGK+RSVWAQ SD GDT+ 
Sbjct  336  AENLVAVMESDGFEYLKENCPLLQSELLKTVAGCDEEL-SGGGKTRSVWAQFSDGGDTND  394

Query  719  RRVRQRT  739
            R VRQRT
Sbjct  395  RSVRQRT  401



>ref|XP_010921383.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
Length=402

 Score =   321 bits (823),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 167/245 (68%), Positives = 207/245 (84%), Gaps = 1/245 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +D   +HSI +P+SDIG HFGMLL+  EGSD++F+VAGEKFHAHKLVLA
Sbjct  158  INCTVGVVVSVMDSPRLHSIQVPESDIGMHFGMLLDKQEGSDVVFDVAGEKFHAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARS +FR++FFD L+ ++ EIV+++ME KVF+AMLHF+Y D+ +EDD+  +SSS + S+S
Sbjct  218  ARSAVFRAQFFDELDCEKSEIVVTDMEPKVFEAMLHFIYRDTFIEDDVLVASSSPVSSMS  277

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL  KLL AAD+Y L RL+ MCE+YLCKD+SV+SVA TL+LAD YHA+ELK  CL+FAA
Sbjct  278  DTLAGKLLAAADKYGLERLRLMCESYLCKDMSVDSVASTLSLADRYHALELKAACLKFAA  337

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENLAAVM+S+GF+YLK+ CPSLQSELLK +AGCE+ECSS G KSRSVWAQLSD  D+ GR
Sbjct  338  ENLAAVMRSNGFQYLKDTCPSLQSELLKIIAGCEEECSS-GEKSRSVWAQLSDGADSSGR  396

Query  722  RVRQR  736
            RVR R
Sbjct  397  RVRPR  401



>ref|XP_011001713.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and MATH domain-containing 
protein 4 [Populus euphratica]
Length=433

 Score =   321 bits (822),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 171/245 (70%), Positives = 202/245 (82%), Gaps = 2/245 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I+CTVGVV S  DCS +HSI +P+SDIG HFGMLLEN + SDIIFNV G+KFHAHKLVL 
Sbjct  162  IHCTVGVVVSATDCSRLHSIKVPESDIGDHFGMLLENEDCSDIIFNVQGQKFHAHKLVLV  221

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+F +E  D +E D  EIVIS++E KVFKA+LHF+Y D L+ED+  ++SSS+  +  
Sbjct  222  ARSPVFENELLDAMEEDNSEIVISDIEPKVFKALLHFIYKDDLIEDEELSASSSTSVTSV  281

Query  362  -dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
             DTL AKLLEAADRYDL RL+ MCEA LCKDISV+SVAK LALAD YHAM+LK+VCL+F+
Sbjct  282  FDTLTAKLLEAADRYDLPRLRLMCEAVLCKDISVSSVAKILALADRYHAMDLKSVCLKFS  341

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AV+QSDGFEYLKENCP LQSELLKTVAGCE++  SGGGK+ SVW Q SD GDT+ 
Sbjct  342  AENLVAVVQSDGFEYLKENCPLLQSELLKTVAGCEEDV-SGGGKNPSVWGQFSDGGDTND  400

Query  719  RRVRQ  733
            R +RQ
Sbjct  401  RSIRQ  405



>ref|XP_009366506.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=435

 Score =   320 bits (820),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 171/247 (69%), Positives = 204/247 (83%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S ID S +HSI +PDSDIG HFGMLLEN EGSD+ FNV GE+FHAHKLVLA
Sbjct  156  INCTVGVVVSAIDSSRLHSIQVPDSDIGDHFGMLLENEEGSDVTFNVCGERFHAHKLVLA  215

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssss-ipsi  358
            ARSP+F  EFFDG E +  +IV+++M+ KVFKA+LHF+YTD+L+ED+  + +SS  + S+
Sbjct  216  ARSPLFEKEFFDGTEEENHDIVVTDMDPKVFKALLHFIYTDNLIEDEELSDASSLCMSSL  275

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SD L AKLL A+D+Y L RL+ MCE+ LCK +SVNSVA  LALAD Y AM+LK+VCL+FA
Sbjct  276  SDGLAAKLLAASDKYGLPRLRLMCESVLCKIMSVNSVAIILALADRYRAMDLKSVCLKFA  335

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVM+SDGFEYLKENCP LQSELLKTVAGC++E  SGG K+RSVWAQ SD GDT+ 
Sbjct  336  AENLVAVMESDGFEYLKENCPLLQSELLKTVAGCDEEL-SGGAKTRSVWAQFSDGGDTND  394

Query  719  RRVRQRT  739
            R VRQRT
Sbjct  395  RSVRQRT  401



>ref|XP_008391713.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 [Malus 
domestica]
Length=435

 Score =   318 bits (816),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 169/247 (68%), Positives = 203/247 (82%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S ID S +HSIH+PDSDIG HFGMLLEN EGSD+ FNV GE+FHAHKLVLA
Sbjct  156  INCTVGVVVSAIDSSRLHSIHVPDSDIGDHFGMLLENEEGSDVTFNVCGERFHAHKLVLA  215

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssss-ipsi  358
            ARSP+F  EFFDG+E +  ++V+++ + KVFKA+LHF+YTD+L+ED+    +SS  + S+
Sbjct  216  ARSPLFEKEFFDGMEEENHDVVVTDTDPKVFKALLHFIYTDNLIEDEELQDASSLCMSSL  275

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SD L AKLL A+D+Y L RL+ MCE+ LCK +SVNSVA  LALAD Y AM+LK+VCL+FA
Sbjct  276  SDRLAAKLLAASDKYGLPRLRLMCESVLCKIMSVNSVAIILALADRYRAMDLKSVCLKFA  335

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVM+SDGFEYLKENCP LQSELLKTVAGC++E  SGG K+RSVW Q SD GDT+ 
Sbjct  336  AENLVAVMESDGFEYLKENCPLLQSELLKTVAGCDEEL-SGGEKTRSVWGQFSDGGDTND  394

Query  719  RRVRQRT  739
            R VRQRT
Sbjct  395  RSVRQRT  401



>gb|KHN38451.1| BTB/POZ and MATH domain-containing protein 4 [Glycine soja]
Length=272

 Score =   312 bits (800),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 162/246 (66%), Positives = 200/246 (81%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSI+IP+SDIG+HFG LL+NMEGSDI F+VAG+KF AHKLVLA
Sbjct  26   INCTVGVVVSAIDCPQLHSINIPESDIGSHFGALLDNMEGSDITFDVAGDKFPAHKLVLA  85

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssip-si  358
            ARSP FRS+FF+GL+ ++ EI+++++E KVFKAMLHF+Y D+L E+    SS+++    +
Sbjct  86   ARSPEFRSKFFNGLDEEKNEIIVTDLEPKVFKAMLHFIYKDTLTEEVDTVSSTTTSDFPV  145

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+ L AKLL AAD+YDLGRL+ MCE+ LCKDI VNSVA  L LAD  HA ELK VCL+FA
Sbjct  146  SEILTAKLLAAADKYDLGRLRLMCESRLCKDICVNSVANILTLADHCHATELKAVCLKFA  205

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            A+NLAAVM+SDGFE++KE  P LQSE+LKT+AGCE +  S   KS+SVW QLSD GD +G
Sbjct  206  AQNLAAVMRSDGFEHMKEKGPWLQSEILKTIAGCEGDGCSAVEKSQSVWGQLSDGGDMNG  265

Query  719  RRVRQR  736
            RRVRQR
Sbjct  266  RRVRQR  271



>ref|XP_006479173.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Citrus sinensis]
Length=434

 Score =   318 bits (814),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 177/247 (72%), Positives = 207/247 (84%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +P+SDIG HFGMLLEN E SDI FNVAGEKFHAHKLVLA
Sbjct  160  INCTVGVVVSAIDCSRLHSIQVPESDIGDHFGMLLENEESSDITFNVAGEKFHAHKLVLA  219

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslled-dleasssssipsi  358
            ARSP+F +EF D +E D  EIV+++ME KVFKA+LHF+Y D+L+ED +  ASSSS +PS+
Sbjct  220  ARSPVFETEFLDAMEEDNHEIVVTDMEPKVFKALLHFIYKDTLIEDGECSASSSSCVPSV  279

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SDTL AKLL AA++Y L RL+ MCE+ LCK ISVNSVA TLALAD + AM+LK+VCL+FA
Sbjct  280  SDTLEAKLLAAAEKYVLPRLRLMCESVLCKVISVNSVAHTLALADRHCAMDLKSVCLKFA  339

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVM+SDGF+YLKENCP LQSELLKTVAGC++E  SG GKSRSVWAQ SD  DT+ 
Sbjct  340  AENLVAVMRSDGFQYLKENCPLLQSELLKTVAGCDEEV-SGWGKSRSVWAQFSDGDDTND  398

Query  719  RRVRQRT  739
            R VRQ+T
Sbjct  399  RSVRQQT  405



>ref|XP_006443499.1| hypothetical protein CICLE_v10020215mg [Citrus clementina]
 ref|XP_006479172.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Citrus sinensis]
 gb|ESR56739.1| hypothetical protein CICLE_v10020215mg [Citrus clementina]
Length=434

 Score =   318 bits (814),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 177/247 (72%), Positives = 207/247 (84%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +P+SDIG HFGMLLEN E SDI FNVAGEKFHAHKLVLA
Sbjct  160  INCTVGVVVSAIDCSRLHSIQVPESDIGDHFGMLLENEESSDITFNVAGEKFHAHKLVLA  219

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslled-dleasssssipsi  358
            ARSP+F +EF D +E D  EIV+++ME KVFKA+LHF+Y D+L+ED +  ASSSS +PS+
Sbjct  220  ARSPVFETEFLDAMEEDNHEIVVTDMEPKVFKALLHFIYKDTLIEDGECSASSSSCVPSV  279

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SDTL AKLL AA++Y L RL+ MCE+ LCK ISVNSVA TLALAD + AM+LK+VCL+FA
Sbjct  280  SDTLEAKLLAAAEKYVLPRLRLMCESVLCKVISVNSVAHTLALADRHCAMDLKSVCLKFA  339

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVM+SDGF+YLKENCP LQSELLKTVAGC++E  SG GKSRSVWAQ SD  DT+ 
Sbjct  340  AENLVAVMRSDGFQYLKENCPLLQSELLKTVAGCDEEV-SGWGKSRSVWAQFSDGDDTND  398

Query  719  RRVRQRT  739
            R VRQ+T
Sbjct  399  RSVRQQT  405



>ref|XP_009343027.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=435

 Score =   317 bits (813),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 170/247 (69%), Positives = 204/247 (83%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S ID S +HSIH+PDSDIG HFGMLLEN EGSD+ FNV GE+F AHKLVLA
Sbjct  156  INCTVGVVVSAIDSSRLHSIHVPDSDIGDHFGMLLENEEGSDVTFNVCGERFRAHKLVLA  215

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssss-ipsi  358
            ARSP+F  EFFDG E +  +IV+++M+ KVFKA+LHF+YTD+L+ED+  + +SS  + S+
Sbjct  216  ARSPLFEKEFFDGKEEENHDIVVTDMDPKVFKALLHFIYTDNLIEDEELSDASSLCMSSL  275

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SD L AKLL A+D+Y L RL+ MCE+ LCK +SVNSVA  LALAD Y AM+LK+VCL+FA
Sbjct  276  SDGLAAKLLAASDKYGLPRLRLMCESVLCKIMSVNSVAIILALADRYRAMDLKSVCLKFA  335

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVM+SDGFEYLKENCP LQSELLKTVAGC++E  SGG K+RSVWAQ SD G+T+ 
Sbjct  336  AENLVAVMESDGFEYLKENCPLLQSELLKTVAGCDEEL-SGGAKTRSVWAQFSDGGETND  394

Query  719  RRVRQRT  739
            R VRQRT
Sbjct  395  RSVRQRT  401



>ref|XP_009353080.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Pyrus x bretschneideri]
Length=435

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 168/247 (68%), Positives = 204/247 (83%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S ID S +HSIH+PDSDIG HFGMLLEN EGSD+ FNV GE+FHAHKLVLA
Sbjct  156  INCTVGVVVSAIDSSRLHSIHVPDSDIGDHFGMLLENEEGSDVTFNVCGERFHAHKLVLA  215

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssss-ipsi  358
            ARSP+F  EFFDG++ +  ++V+++ + KVFKA+LHF+YTD+L+ED+  + +SS  + S+
Sbjct  216  ARSPLFEKEFFDGMKEENHDVVVTDTDPKVFKALLHFIYTDNLIEDEELSDASSLCMSSL  275

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SD L AKLL A+D+Y L RL+ MCE+ LCK +SVNSVA  LALAD Y AM+LK+VCL+FA
Sbjct  276  SDGLAAKLLAASDKYGLPRLRLMCESVLCKIMSVNSVAIILALADRYRAMDLKSVCLKFA  335

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVM+SDGFEYLKENCP LQSELLKTVAGC++E  SGG K+RSVW Q SD GDT+ 
Sbjct  336  AENLVAVMESDGFEYLKENCPLLQSELLKTVAGCDEEL-SGGEKTRSVWGQFSDGGDTND  394

Query  719  RRVRQRT  739
            R VRQRT
Sbjct  395  RSVRQRT  401



>gb|KDO66064.1| hypothetical protein CISIN_1g013880mg [Citrus sinensis]
Length=434

 Score =   316 bits (809),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 176/247 (71%), Positives = 206/247 (83%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +P+SDIG HFGMLLEN E SDI FNV GEKFHAHKLVLA
Sbjct  160  INCTVGVVVSAIDCSRLHSIQVPESDIGDHFGMLLENEESSDITFNVVGEKFHAHKLVLA  219

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslled-dleasssssipsi  358
            ARSP+F +EF D +E D  EIV+++ME KVFKA+LHF+Y D+L+ED +  ASSSS +PS+
Sbjct  220  ARSPVFETEFLDAMEEDNHEIVVTDMEPKVFKALLHFIYKDTLIEDGECSASSSSCVPSV  279

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SDTL AKLL AA++Y L RL+ MCE+ LCK ISVNSVA TLALAD + AM+LK+VCL+FA
Sbjct  280  SDTLEAKLLAAAEKYVLPRLRLMCESVLCKVISVNSVAHTLALADRHCAMDLKSVCLKFA  339

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVM+SDGF+YLKENCP LQSELLKTVAGC++E  SG GKSRSVWAQ SD  DT+ 
Sbjct  340  AENLVAVMRSDGFQYLKENCPLLQSELLKTVAGCDEEV-SGWGKSRSVWAQFSDGDDTND  398

Query  719  RRVRQRT  739
            R VRQ+T
Sbjct  399  RSVRQQT  405



>ref|XP_003518460.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Glycine max]
Length=396

 Score =   313 bits (802),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 162/246 (66%), Positives = 200/246 (81%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSI+IP+SDIG+HFG LL+NMEGSDI F+VAG+KF AHKLVLA
Sbjct  150  INCTVGVVVSAIDCPQLHSINIPESDIGSHFGALLDNMEGSDITFDVAGDKFPAHKLVLA  209

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssip-si  358
            ARSP FRS+FF+GL+ ++ EI+++++E KVFKAMLHF+Y D+L E+    SS+++    +
Sbjct  210  ARSPEFRSKFFNGLDEEKNEIIVTDLEPKVFKAMLHFIYKDTLTEEVDTVSSTTTSDFPV  269

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+ L AKLL AAD+YDLGRL+ MCE+ LCKDI VNSVA  L LAD  HA ELK VCL+FA
Sbjct  270  SEILTAKLLAAADKYDLGRLRLMCESRLCKDICVNSVANILTLADHCHATELKAVCLKFA  329

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            A+NLAAVM+SDGFE++KE  P LQSE+LKT+AGCE +  S   KS+SVW QLSD GD +G
Sbjct  330  AQNLAAVMRSDGFEHMKEKGPWLQSEILKTIAGCEGDGCSAVEKSQSVWGQLSDGGDMNG  389

Query  719  RRVRQR  736
            RRVRQR
Sbjct  390  RRVRQR  395



>gb|AFJ68127.1| BTB protein, partial [Musa acuminata AAA Group]
Length=366

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 198/245 (81%), Gaps = 1/245 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +D   +HSI +PDSDIG HFG LL+N EGSD+I +V+GEKFHAHKLVLA
Sbjct  122  INCTVGVVVSVMDSPRLHSIQVPDSDIGMHFGALLDNQEGSDVIVHVSGEKFHAHKLVLA  181

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+FR++FFD  +  + +IV+++ME +VF+AMLHF+Y D+ +EDD+  +SSS     S
Sbjct  182  ARSPVFRAQFFDDSDGQKSDIVVADMEPRVFEAMLHFIYRDTFIEDDVLTTSSSPESFAS  241

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL AKLL A+D+Y L RL+ +CEA+LCKDISV+SVA  L+LADCYHA ELK  CL+F+A
Sbjct  242  DTLAAKLLAASDKYGLERLRLLCEAHLCKDISVDSVASILSLADCYHATELKAACLKFSA  301

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENL AVM+S GF +LKENCPSLQSELLK +AG  DE SS GGK RSVWAQLSD GD+ GR
Sbjct  302  ENLGAVMRSSGFWHLKENCPSLQSELLKIIAGAGDE-SSDGGKDRSVWAQLSDGGDSSGR  360

Query  722  RVRQR  736
            RVR R
Sbjct  361  RVRPR  365



>ref|NP_001051524.1| Os03g0792500 [Oryza sativa Japonica Group]
 gb|ABF99301.1| BTB/POZ domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13438.1| Os03g0792500 [Oryza sativa Japonica Group]
 dbj|BAG91122.1| unnamed protein product [Oryza sativa Japonica Group]
Length=431

 Score =   313 bits (801),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 170/256 (66%), Positives = 203/256 (79%), Gaps = 14/256 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV ST+D S  HSIH+P+SDIG HFG LL+N EG D+I NVAGEKFHAH+LVLA
Sbjct  178  INCTVGVVVSTMDYSKPHSIHVPESDIGYHFGTLLDNQEGVDVICNVAGEKFHAHQLVLA  237

Query  182  ARSPIFRSEFFDGLESDEQ-----------EIVISNMESKVFKAMLHFVYtdslleddle  328
            ARS  FRSE F+  ESDE+           EIVI +ME KVFKA+LHF+Y D+L+ DD  
Sbjct  238  ARSSFFRSELFEH-ESDEEKNEVDTSNEIKEIVIDDMEPKVFKAVLHFMYRDNLVGDDEL  296

Query  329  asssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAM  508
            ++SSS           KLL AADRY+L RL+ +CE+YLCK ISVNSVA TLALAD +HAM
Sbjct  297  SASSSDCSIFDTLA-GKLLAAADRYELPRLRLLCESYLCKHISVNSVATTLALADRHHAM  355

Query  509  ELKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWA  688
            ELK+VCL+FAAENL+AV+++DGF+YLK+NCP+LQSE+L+TVAGCE+ECSS GGKS+SVW 
Sbjct  356  ELKSVCLKFAAENLSAVIRTDGFDYLKDNCPALQSEILRTVAGCEEECSS-GGKSQSVWG  414

Query  689  QLSDSGDTDGRRVRQR  736
            QLSD GDT GRRVR R
Sbjct  415  QLSDGGDTSGRRVRPR  430



>ref|XP_004491160.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=399

 Score =   311 bits (798),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 165/246 (67%), Positives = 198/246 (80%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  + SIH+P+SDIG+HFG LL+NMEGSD+ F+VAGEK  AHKLVLA
Sbjct  153  INCTVGVVVSAIDCPQLQSIHVPESDIGSHFGTLLDNMEGSDVTFDVAGEKCPAHKLVLA  212

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssi-psi  358
             RSP FRS FF+ ++ D+QEIVI+++E KVFKAMLHF+YTD+L ED    SS ++    +
Sbjct  213  TRSPEFRSTFFNSMDIDKQEIVITDLEPKVFKAMLHFIYTDTLTEDADMVSSITASDFLV  272

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL AKLL AAD+Y L RL+ MCE+ LCK I V+SVA  L LAD  HA ELK VCL+FA
Sbjct  273  SETLIAKLLAAADKYGLARLRLMCESRLCKYICVSSVANILTLADHCHATELKAVCLKFA  332

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            A+NLAAVM+SDGFEY+KE CP LQSE+LKT+AGCE +  S G KS+SVWAQLSD GDT+G
Sbjct  333  AQNLAAVMRSDGFEYMKEKCPWLQSEILKTIAGCEGDSCSPGEKSQSVWAQLSDGGDTNG  392

Query  719  RRVRQR  736
            RRVRQR
Sbjct  393  RRVRQR  398



>gb|EAY92144.1| hypothetical protein OsI_13855 [Oryza sativa Indica Group]
Length=430

 Score =   312 bits (800),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 170/256 (66%), Positives = 203/256 (79%), Gaps = 14/256 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV ST+D S  HSIH+P+SDIG HFG LL+N EG D+I NVAGEKFHAH+LVLA
Sbjct  177  INCTVGVVVSTMDYSKPHSIHVPESDIGYHFGTLLDNQEGVDVICNVAGEKFHAHQLVLA  236

Query  182  ARSPIFRSEFFDGLESDEQ-----------EIVISNMESKVFKAMLHFVYtdslleddle  328
            ARS  FRSE F+  ESDE+           EIVI +ME KVFKA+LHF+Y D+L+ DD  
Sbjct  237  ARSSFFRSELFEH-ESDEEKNEVDTSNEIKEIVIDDMEPKVFKAVLHFMYRDNLVGDDEL  295

Query  329  asssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAM  508
            ++SSS           KLL AADRY+L RL+ +CE+YLCK ISVNSVA TLALAD +HAM
Sbjct  296  SASSSDCSIFDTLA-GKLLAAADRYELPRLRLLCESYLCKHISVNSVATTLALADRHHAM  354

Query  509  ELKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWA  688
            ELK+VCL+FAAENL+AV+++DGF+YLK+NCP+LQSE+L+TVAGCE+ECSS GGKS+SVW 
Sbjct  355  ELKSVCLKFAAENLSAVIRTDGFDYLKDNCPALQSEILRTVAGCEEECSS-GGKSQSVWG  413

Query  689  QLSDSGDTDGRRVRQR  736
            QLSD GDT GRRVR R
Sbjct  414  QLSDGGDTSGRRVRPR  429



>ref|XP_009400061.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Musa acuminata subsp. malaccensis]
Length=402

 Score =   311 bits (797),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 198/245 (81%), Gaps = 1/245 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +D   +HSI +PDSDIG HFG LL+N EGSD+I +V+GEKFHAHKLVLA
Sbjct  158  INCTVGVVVSVMDSPRLHSIQVPDSDIGMHFGALLDNQEGSDVIVHVSGEKFHAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+FR++FFD  +  + +IV+++ME +VF+AMLHF+Y D+ +EDD+  +SSS     S
Sbjct  218  ARSPVFRAQFFDDSDGQKSDIVVADMEPRVFEAMLHFIYRDTFIEDDVLTTSSSPESFAS  277

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL AKLL A+D+Y L RL+ +CEA+LCKDISV+SVA  L+LADCYHA ELK  CL+F+A
Sbjct  278  DTLAAKLLAASDKYGLERLRLLCEAHLCKDISVDSVACILSLADCYHATELKAACLKFSA  337

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENL AVM+S GF +LKENCPSLQSELLK +AG  DE SS GGK RSVWAQLSD GD+ GR
Sbjct  338  ENLGAVMRSSGFRHLKENCPSLQSELLKIIAGAGDE-SSDGGKDRSVWAQLSDGGDSSGR  396

Query  722  RVRQR  736
            RVR R
Sbjct  397  RVRPR  401



>gb|AAO37987.1| expressed protein [Oryza sativa Japonica Group]
Length=430

 Score =   312 bits (800),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 170/256 (66%), Positives = 203/256 (79%), Gaps = 14/256 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV ST+D S  HSIH+P+SDIG HFG LL+N EG D+I NVAGEKFHAH+LVLA
Sbjct  177  INCTVGVVVSTMDYSKPHSIHVPESDIGYHFGTLLDNQEGVDVICNVAGEKFHAHQLVLA  236

Query  182  ARSPIFRSEFFDGLESDEQ-----------EIVISNMESKVFKAMLHFVYtdslleddle  328
            ARS  FRSE F+  ESDE+           EIVI +ME KVFKA+LHF+Y D+L+ DD  
Sbjct  237  ARSSFFRSELFEH-ESDEEKNEVDTSNEIKEIVIDDMEPKVFKAVLHFMYRDNLVGDDEL  295

Query  329  asssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAM  508
            ++SSS           KLL AADRY+L RL+ +CE+YLCK ISVNSVA TLALAD +HAM
Sbjct  296  SASSSDCSIFDTLA-GKLLAAADRYELPRLRLLCESYLCKHISVNSVATTLALADRHHAM  354

Query  509  ELKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWA  688
            ELK+VCL+FAAENL+AV+++DGF+YLK+NCP+LQSE+L+TVAGCE+ECSS GGKS+SVW 
Sbjct  355  ELKSVCLKFAAENLSAVIRTDGFDYLKDNCPALQSEILRTVAGCEEECSS-GGKSQSVWG  413

Query  689  QLSDSGDTDGRRVRQR  736
            QLSD GDT GRRVR R
Sbjct  414  QLSDGGDTSGRRVRPR  429



>gb|EAZ28871.1| hypothetical protein OsJ_12909 [Oryza sativa Japonica Group]
Length=415

 Score =   311 bits (798),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 170/256 (66%), Positives = 203/256 (79%), Gaps = 14/256 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV ST+D S  HSIH+P+SDIG HFG LL+N EG D+I NVAGEKFHAH+LVLA
Sbjct  162  INCTVGVVVSTMDYSKPHSIHVPESDIGYHFGTLLDNQEGVDVICNVAGEKFHAHQLVLA  221

Query  182  ARSPIFRSEFFDGLESDEQ-----------EIVISNMESKVFKAMLHFVYtdslleddle  328
            ARS  FRSE F+  ESDE+           EIVI +ME KVFKA+LHF+Y D+L+ DD  
Sbjct  222  ARSSFFRSELFEH-ESDEEKNEVDTSNEIKEIVIDDMEPKVFKAVLHFMYRDNLVGDDEL  280

Query  329  asssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAM  508
            ++SSS           KLL AADRY+L RL+ +CE+YLCK ISVNSVA TLALAD +HAM
Sbjct  281  SASSSDCSIFDTLA-GKLLAAADRYELPRLRLLCESYLCKHISVNSVATTLALADRHHAM  339

Query  509  ELKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWA  688
            ELK+VCL+FAAENL+AV+++DGF+YLK+NCP+LQSE+L+TVAGCE+ECSS GGKS+SVW 
Sbjct  340  ELKSVCLKFAAENLSAVIRTDGFDYLKDNCPALQSEILRTVAGCEEECSS-GGKSQSVWG  398

Query  689  QLSDSGDTDGRRVRQR  736
            QLSD GDT GRRVR R
Sbjct  399  QLSDGGDTSGRRVRPR  414



>ref|XP_004981480.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Setaria italica]
Length=428

 Score =   311 bits (797),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 166/256 (65%), Positives = 205/256 (80%), Gaps = 14/256 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV ST+D S  HSI +P+SDIG HFG LL+N EG D+IF+VAGEKFHAHKLVLA
Sbjct  175  INCTVGVVVSTMDYSRPHSIEVPESDIGYHFGTLLDNQEGVDVIFSVAGEKFHAHKLVLA  234

Query  182  ARSPIFRSEFFDGLESDEQ-----------EIVISNMESKVFKAMLHFVYtdslleddle  328
            ARS  FRSEFFD  ESDE+           EIVI +M+ KVFKA+LHF+Y D+L+ DD  
Sbjct  235  ARSSFFRSEFFDH-ESDEEKNEADTRNEIKEIVIDDMDPKVFKAVLHFIYRDNLVNDDEL  293

Query  329  asssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAM  508
            ++SSS           KL+ AAD+Y+L RL+ +CE+YLCK ISVNSV+ TLALAD +HAM
Sbjct  294  SASSSHGSVFDTLA-GKLMAAADKYELPRLRLLCESYLCKHISVNSVSTTLALADRHHAM  352

Query  509  ELKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWA  688
            ELK+VCL+FAAENL+AV++S+G++YLK+NCP+LQSE+L+T+AGCE++CSS GGKS+SVWA
Sbjct  353  ELKSVCLKFAAENLSAVIRSEGYDYLKDNCPALQSEILRTLAGCEEQCSS-GGKSQSVWA  411

Query  689  QLSDSGDTDGRRVRQR  736
            QLSD GDT GRRVR R
Sbjct  412  QLSDGGDTSGRRVRPR  427



>gb|KHM99118.1| BTB/POZ and MATH domain-containing protein 4 [Glycine soja]
Length=361

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 163/246 (66%), Positives = 200/246 (81%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S  DC   +SI+IP+SDIG+HFG LL+NMEGSDIIF+VAGEKFHAHKL+LA
Sbjct  115  INCTVGVVVSASDCPQHYSINIPESDIGSHFGALLDNMEGSDIIFDVAGEKFHAHKLMLA  174

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssip-si  358
            ARSP FRS+F DGL+ ++ EI+++++E KVFKAMLHF+Y D+L E+    SS+++    +
Sbjct  175  ARSPEFRSKFLDGLDEEKNEIIVTDLEPKVFKAMLHFIYKDTLTEEVATVSSTTTSHFPV  234

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL AKLL AAD+Y LGRL+ +CE+ LCKDI VNSVA  L LAD  HA ELK VCL+FA
Sbjct  235  SETLTAKLLAAADKYGLGRLRLICESCLCKDICVNSVADILTLADHCHATELKAVCLKFA  294

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            A+NLAAVM+SDGFE++KE  P LQSE+LKT+AG E E SS   KS+SVW QLSD GDT+G
Sbjct  295  AQNLAAVMRSDGFEHMKEKGPWLQSEILKTIAGGEGEGSSAVEKSQSVWGQLSDGGDTNG  354

Query  719  RRVRQR  736
            RRVRQR
Sbjct  355  RRVRQR  360



>ref|XP_006651896.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like, 
partial [Oryza brachyantha]
Length=428

 Score =   310 bits (794),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 168/256 (66%), Positives = 205/256 (80%), Gaps = 14/256 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV ST+D S  HSIH+P+SDIG HFG LL++ EG D+I +VAGEKFHAHKLVLA
Sbjct  175  INCTVGVVVSTMDYSKPHSIHVPESDIGYHFGTLLDSQEGVDVICDVAGEKFHAHKLVLA  234

Query  182  ARSPIFRSEFFDGLESDEQ-----------EIVISNMESKVFKAMLHFVYtdslleddle  328
            ARS  FRS+FF+  ESDE+           EIVI +ME KVFKA+LHF+Y D+L++DD  
Sbjct  235  ARSSFFRSQFFEN-ESDEEKNEVDTSNEIKEIVIDDMEPKVFKAVLHFMYRDNLVDDDEL  293

Query  329  asssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAM  508
            ++SSS           KLL AAD+Y+L RL+ +CE+YLCK ISVNSVA TLALAD +HAM
Sbjct  294  SASSSDCSVFDTLA-GKLLAAADKYELPRLRLLCESYLCKHISVNSVATTLALADRHHAM  352

Query  509  ELKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWA  688
            EL++VCL+FAAENL+AV+++DGF+YLK+NCPSLQSE+L+TVAGCE+ECSS GGKS+SVW 
Sbjct  353  ELESVCLKFAAENLSAVIRTDGFDYLKDNCPSLQSEILRTVAGCEEECSS-GGKSQSVWG  411

Query  689  QLSDSGDTDGRRVRQR  736
            QLSD GDT GRRVR R
Sbjct  412  QLSDGGDTSGRRVRPR  427



>ref|XP_003617061.1| Speckle-type POZ protein [Medicago truncatula]
 gb|AET00020.1| BTB/POZ/MATH-domain protein [Medicago truncatula]
Length=407

 Score =   309 bits (792),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 164/246 (67%), Positives = 197/246 (80%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +DC  ++SIH+P+SDIG+HFG LLEN EGSD+ F+VAGEKF  HKLVLA
Sbjct  161  INCTVGVVVSAVDCPQLNSIHVPESDIGSHFGALLENNEGSDVTFDVAGEKFPGHKLVLA  220

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssip-si  358
            ARSP FRS+FFDG + D QE+V++++E KVFKAMLHF+Y DSL E+    SS++S    +
Sbjct  221  ARSPEFRSKFFDGTDMDTQEVVVTDLEPKVFKAMLHFIYRDSLTEEVDMVSSTTSSDFPV  280

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL AKLL AAD+Y L RL+ MCE+ LCKDI V+SVA  L LAD  HA ELK VCL+FA
Sbjct  281  SETLIAKLLGAADKYGLERLRLMCESRLCKDIGVSSVANILTLADHCHATELKAVCLKFA  340

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
             +NLAAVM+SDGFE +KE CP LQSE+LKTVAGC+ +  S G KS+SVWAQLSD GDT G
Sbjct  341  TQNLAAVMRSDGFESMKEKCPWLQSEILKTVAGCDGDSCSTGEKSQSVWAQLSDGGDTIG  400

Query  719  RRVRQR  736
            RRVRQR
Sbjct  401  RRVRQR  406



>ref|XP_003545187.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Glycine max]
Length=396

 Score =   309 bits (791),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 161/246 (65%), Positives = 197/246 (80%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S  DC   +SI+IP+SDIG+HFG LL+NMEGSDIIF+VAGEKFHAHKL+LA
Sbjct  150  INCTVGVVVSASDCPQHYSINIPESDIGSHFGALLDNMEGSDIIFDVAGEKFHAHKLMLA  209

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            ARSP FRS+F DGL+ ++ EI+++++E KVFKAMLHF+Y      E    +S+++S   +
Sbjct  210  ARSPEFRSKFLDGLDEEKNEIIVTDLEPKVFKAMLHFIYKDTLTEEVATVSSTTTSHFPV  269

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL AKLL AAD+Y LGRL+ +CE+ LCKDI VNSVA  L LAD  HA ELK VCL+FA
Sbjct  270  SETLTAKLLAAADKYGLGRLRLICESCLCKDICVNSVADILTLADHCHATELKAVCLKFA  329

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            A+NLAAVM+SDGFE++KE  P LQSE+LKT+AG E E SS   KS+SVW QLSD GDT+G
Sbjct  330  AQNLAAVMRSDGFEHMKEKGPWLQSEILKTIAGGEGEGSSAVEKSQSVWGQLSDGGDTNG  389

Query  719  RRVRQR  736
            RRVRQR
Sbjct  390  RRVRQR  395



>ref|XP_007161865.1| hypothetical protein PHAVU_001G104500g [Phaseolus vulgaris]
 ref|XP_007161866.1| hypothetical protein PHAVU_001G104500g [Phaseolus vulgaris]
 gb|ESW33859.1| hypothetical protein PHAVU_001G104500g [Phaseolus vulgaris]
 gb|ESW33860.1| hypothetical protein PHAVU_001G104500g [Phaseolus vulgaris]
Length=431

 Score =   310 bits (794),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 168/247 (68%), Positives = 206/247 (83%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S+IDCS +++I +P+SDIG+HFGMLLEN EGSD+ F+V GE+FHAHKLVLA
Sbjct  156  INCTVGVVVSSIDCSKLNTIQVPESDIGSHFGMLLENEEGSDVTFSVGGERFHAHKLVLA  215

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            ARS  F +EFF+G+E DEQ+IV+++ME KVFKA+LHF+Y    + +++L  S SS +PS+
Sbjct  216  ARSTAFETEFFNGMEEDEQDIVVTDMEPKVFKALLHFIYRDTLIDDEELFVSRSSFLPSV  275

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S++  AKLL AA++YDL RLK MCE+ LCKDIS++SVA  LALAD Y A ELK+VCL+F+
Sbjct  276  SESFAAKLLAAAEKYDLPRLKLMCESVLCKDISIDSVAYILALADRYRATELKSVCLQFS  335

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVMQSDGFEYLKENCP LQSELLKTVAGCE+E  SG GK RSVWAQ SD GDT+ 
Sbjct  336  AENLVAVMQSDGFEYLKENCPLLQSELLKTVAGCEEEF-SGEGKCRSVWAQFSDGGDTND  394

Query  719  RRVRQRT  739
            R VRQ+T
Sbjct  395  RSVRQQT  401



>ref|XP_006826332.1| hypothetical protein AMTR_s00004p00105320 [Amborella trichopoda]
 gb|ERM93569.1| hypothetical protein AMTR_s00004p00105320 [Amborella trichopoda]
Length=403

 Score =   308 bits (790),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 161/247 (65%), Positives = 199/247 (81%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +DC  +H I +P+SDIG HFG LLEN EGSDI+F+V+GEKFHAHKLVL 
Sbjct  158  INCTVGVVVSAMDCFRLHRIQVPESDIGIHFGALLENREGSDIVFDVSGEKFHAHKLVLV  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssss-ipsi  358
            ARS +FR  F    + ++ EI I++++ KVFKA+LHF+Y D L+ED+   +S  +    +
Sbjct  218  ARSAVFRDRFLGSSDMNQYEIKITDLDPKVFKALLHFIYRDCLIEDEELKTSGMTCSSIL  277

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
             +TL  KLL AAD+YDLGRL+ MCEA LCKDISV++VA  LALAD YHAMELKTVCL++A
Sbjct  278  DETLLTKLLAAADKYDLGRLRLMCEANLCKDISVDNVADILALADRYHAMELKTVCLKYA  337

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENLAAVM+++GF +L+E CPSLQSELLKTVAGCE++CSS  G+SRSVWAQLSD  D +G
Sbjct  338  AENLAAVMRTEGFGHLREKCPSLQSELLKTVAGCEEDCSS-AGRSRSVWAQLSDGTDDNG  396

Query  719  RRVRQRT  739
            RRVRQRT
Sbjct  397  RRVRQRT  403



>ref|XP_010036255.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 [Eucalyptus 
grandis]
 gb|KCW47780.1| hypothetical protein EUGRSUZ_K01525 [Eucalyptus grandis]
 gb|KCW47781.1| hypothetical protein EUGRSUZ_K01525 [Eucalyptus grandis]
Length=428

 Score =   310 bits (793),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 196/245 (80%), Gaps = 3/245 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSI +P+SDIGAHFG LLE  EGSD+ FNV+GEKFHAHKLVLA
Sbjct  156  INCTVGVVVSEIDCPRLHSIQVPESDIGAHFGFLLEKEEGSDVTFNVSGEKFHAHKLVLA  215

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+F SEF + +E D  E++IS+ME  VF+A+LHF+Y D+L ED+  +  S+      
Sbjct  216  ARSPVFESEFLNAMEEDSDEVIISDMEPTVFQALLHFIYKDTLDEDEELSIPSAFCSPSE  275

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
              + AKLL AADRY+L RLK +CE+ LCK ISV+SVA+ LALA+ +HAM+LK++CL+FAA
Sbjct  276  MPV-AKLLAAADRYNLPRLKLICESILCKGISVDSVARILALAEQHHAMDLKSICLKFAA  334

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENL AVM+SDGFEYLKENCPSLQSELLKTVAGCE++ S GG  +RSV+AQ SD  +T+ R
Sbjct  335  ENLVAVMRSDGFEYLKENCPSLQSELLKTVAGCEEQVSGGG--NRSVFAQFSDGNETNDR  392

Query  722  RVRQR  736
             +RQ+
Sbjct  393  SIRQQ  397



>emb|CBI31240.3| unnamed protein product [Vitis vinifera]
Length=361

 Score =   305 bits (781),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 174/247 (70%), Positives = 201/247 (81%), Gaps = 4/247 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +H I +PDSDIGAHFGMLLEN EGSD+IF+V+GEKFHAHKLVLA
Sbjct  115  INCTVGVVVSAIDCSRLHPIQVPDSDIGAHFGMLLENEEGSDVIFDVSGEKFHAHKLVLA  174

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssss-ipsi  358
            ARSPIF SEF +G E D+QEIV+ +M+ K+FKA+LHF+Y DSL+ED+   +S SS + S 
Sbjct  175  ARSPIFESEFINGPEDDKQEIVVKDMDPKIFKAVLHFIYRDSLIEDEELLTSGSSCMVSE  234

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SDT+ AKLL AAD+Y L RL+ MCEA LCKDISVNSV+K LALAD YHAM+LK VCL+FA
Sbjct  235  SDTIAAKLLAAADKYGLTRLRLMCEALLCKDISVNSVSKILALADRYHAMDLKAVCLKFA  294

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGG---GKSRSVWAQLSDSGD  709
            AENL AVM+SDGFEYLK NCP LQSELLKTVAGCE+E S GG    +SR+ W QLSD  D
Sbjct  295  AENLVAVMRSDGFEYLKANCPLLQSELLKTVAGCEEEFSGGGKSRKRSRTFWVQLSDGSD  354

Query  710  TDGRRVR  730
              GR  R
Sbjct  355  EGGRNAR  361



>ref|XP_002533853.1| Speckle-type POZ protein, putative [Ricinus communis]
 gb|EEF28528.1| Speckle-type POZ protein, putative [Ricinus communis]
Length=397

 Score =   306 bits (784),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 169/242 (70%), Positives = 193/242 (80%), Gaps = 19/242 (8%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSI                  +GSD+ FNVAGEKFHAHKLVLA
Sbjct  156  INCTVGVVVSAIDCPRLHSI------------------QGSDVTFNVAGEKFHAHKLVLA  197

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslledd-leasssssipsi  358
            ARSP+FRS+FFD  E + QE++I+++E KVFKAMLHF+Y D+L ED   E SSSS   ++
Sbjct  198  ARSPLFRSKFFDIEEEENQEVLITDLEPKVFKAMLHFMYRDTLTEDVDTETSSSSCFSAV  257

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL AKLL AAD+Y L RL+ MCE++LCKDISV+SVA  LALADC HA ELK VCLRFA
Sbjct  258  SETLTAKLLAAADKYGLDRLRLMCESHLCKDISVDSVASILALADCNHATELKAVCLRFA  317

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENLAAVM+SDGFEYLKENCP LQSELLKTVAGCE+ECSSGGGKSRSVWAQLSD GDT+G
Sbjct  318  AENLAAVMRSDGFEYLKENCPLLQSELLKTVAGCEEECSSGGGKSRSVWAQLSDGGDTNG  377

Query  719  RR  724
            RR
Sbjct  378  RR  379



>gb|ABY60297.1| At3g03740 [Arabidopsis thaliana]
 gb|ABY60298.1| At3g03740 [Arabidopsis thaliana]
 gb|ABY60299.1| At3g03740 [Arabidopsis thaliana]
 gb|ABY60300.1| At3g03740 [Arabidopsis thaliana]
 gb|ABY60301.1| At3g03740 [Arabidopsis thaliana]
 gb|ABY60302.1| At3g03740 [Arabidopsis thaliana]
 gb|ABY60303.1| At3g03740 [Arabidopsis thaliana]
 gb|ABY60304.1| At3g03740 [Arabidopsis thaliana]
 gb|ABY60305.1| At3g03740 [Arabidopsis thaliana]
 gb|ABY60307.1| At3g03740 [Arabidopsis thaliana]
 gb|ABY60308.1| At3g03740 [Arabidopsis thaliana]
 gb|ABY60309.1| At3g03740 [Arabidopsis thaliana]
 gb|ABY60310.1| At3g03740 [Arabidopsis thaliana]
Length=276

 Score =   301 bits (771),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 162/246 (66%), Positives = 198/246 (80%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P SDIG+HFGMLLEN +GSDI FNV+GEKF AH+LVLA
Sbjct  10   INCTVGVVVSEIDCPRLHSIHVPASDIGSHFGMLLENEDGSDITFNVSGEKFRAHRLVLA  69

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+F SEF D    ++++I +++ME KVFKA+LH++Y D+L+ED   +SSS S    S
Sbjct  70   ARSPVFESEFLDVTGEEDRDIEVTDMEPKVFKALLHYIYKDALIEDAESSSSSGSSVGPS  129

Query  362  d--tlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
               TL AKLL AAD+Y L RL  MCE+ LCKDISV+SVA  LALAD Y+A  LK+VCL+F
Sbjct  130  ASDTLAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLKF  189

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSG-DT  712
            AAENL AVM+SDGF+YL+E+CPSLQSELLKTVAGCE+E S GGGK+RSVW Q SD G +T
Sbjct  190  AAENLIAVMRSDGFDYLREHCPSLQSELLKTVAGCEEELSGGGGKTRSVWGQFSDGGAET  249

Query  713  DGRRVR  730
            +GR+ +
Sbjct  250  NGRQAQ  255



>gb|ABY60311.1| At3g03740-like protein [Arabidopsis lyrata]
Length=279

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 196/247 (79%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P SDIG+HFGMLLEN +GSDI FNV+GEKF AH+LVLA
Sbjct  10   INCTVGVVVSEIDCPRLHSIHVPASDIGSHFGMLLENEDGSDITFNVSGEKFRAHRLVLA  69

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtds--lleddleasssssips  355
            ARSP+F SEF D    ++++I +++ME KVFKA+LH++Y D+     +   +S SS  PS
Sbjct  70   ARSPVFESEFLDDTGEEDRDIEVTDMEPKVFKALLHYIYKDALIEDAESSSSSGSSVGPS  129

Query  356  isdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
             SDTL AKLL AAD+Y L RL  MCE+ LCKDISV+SVA  LALAD Y+A  LK+VCL+F
Sbjct  130  ASDTLAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLKF  189

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSG-DT  712
            AAENL AVM+SDGF+YL+E+CPSLQSELLKTVAGCE+E S GGGK+RSVW Q SD G +T
Sbjct  190  AAENLIAVMRSDGFDYLREHCPSLQSELLKTVAGCEEELSGGGGKTRSVWGQFSDGGAET  249

Query  713  DGRRVRQ  733
            + R  RQ
Sbjct  250  NERNGRQ  256



>gb|ABY60306.1| At3g03740 [Arabidopsis thaliana]
Length=276

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 162/246 (66%), Positives = 197/246 (80%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P SDIG+HFGMLLEN +GSDI FNV+GEKF AH+LVLA
Sbjct  10   INCTVGVVVSEIDCPRLHSIHVPASDIGSHFGMLLENEDGSDITFNVSGEKFRAHRLVLA  69

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+F SEF D    ++ +I +++ME KVFKA+LH++Y D+L+ED   +SSS S    S
Sbjct  70   ARSPVFESEFLDVTGEEDHDIEVTDMEPKVFKALLHYIYKDALIEDAESSSSSGSSVGPS  129

Query  362  d--tlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
               TL AKLL AAD+Y L RL  MCE+ LCKDISV+SVA  LALAD Y+A  LK+VCL+F
Sbjct  130  ASDTLAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLKF  189

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSG-DT  712
            AAENL AVM+SDGF+YL+E+CPSLQSELLKTVAGCE+E S GGGK+RSVW Q SD G +T
Sbjct  190  AAENLIAVMRSDGFDYLREHCPSLQSELLKTVAGCEEELSGGGGKTRSVWGQFSDGGAET  249

Query  713  DGRRVR  730
            +GR+ +
Sbjct  250  NGRQAQ  255



>ref|XP_009411294.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=399

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 161/246 (65%), Positives = 205/246 (83%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +D   +H I +P+SD G HFG++L+  EGSD++F+VAGEKFHAHKLVLA
Sbjct  152  INCTVGVVVSVVDSPRLHHIQVPESDFGMHFGVILDEQEGSDVVFDVAGEKFHAHKLVLA  211

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSPIF ++FFDGL+ +  EI++++ME  VFKA+LHF+Y D+L++DD+ A+ +    SIS
Sbjct  212  ARSPIFHTQFFDGLDGESNEIIVTDMEPAVFKAILHFIYRDTLVDDDMLATPNLPESSIS  271

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL AKLL AADRY LGRL+ +CEA+LC++ISVNSVA TLALAD  HA+ELK  CL+F A
Sbjct  272  DTLVAKLLAAADRYSLGRLRLLCEAHLCREISVNSVASTLALADRCHAIELKAACLKFVA  331

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENL+AVM+S GFEYLK++CPSLQSELLK +AGC++ECSS GG +RSVWA+LSD  D++GR
Sbjct  332  ENLSAVMRSSGFEYLKDHCPSLQSELLKIIAGCDEECSS-GGNNRSVWAELSDGEDSNGR  390

Query  722  RVRQRT  739
            RVR RT
Sbjct  391  RVRPRT  396



>ref|XP_009396476.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Musa acuminata subsp. malaccensis]
Length=399

 Score =   304 bits (779),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 161/246 (65%), Positives = 196/246 (80%), Gaps = 4/246 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +D  G+HS+H+P+SDIG HFG LL+  EGSD++F+V+GEK HAHKLVLA
Sbjct  152  INCTVGVVVSVMDSPGLHSVHVPESDIGMHFGSLLDKQEGSDVVFDVSGEKIHAHKLVLA  211

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSPIF S FFDGL+ +  EI +++M  KVFKAMLHF+Y D+LLEDD+  +S     S+S
Sbjct  212  ARSPIFHSLFFDGLDDERNEIAVTDMVPKVFKAMLHFIYRDTLLEDDILVTSYLPESSVS  271

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL AKLL AAD+Y L RL+ +CEA+LC++ISVNSVA TLALAD YHAMELK  CL+FAA
Sbjct  272  DTLVAKLLAAADKYCLERLRLLCEAHLCREISVNSVASTLALADQYHAMELKASCLKFAA  331

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENLAAVM+S GFE LK+N P+LQSELL T+AGC++E      KSRS W QLSD  D+ GR
Sbjct  332  ENLAAVMRSSGFEQLKDNSPALQSELLTTIAGCDEEYK----KSRSDWGQLSDGEDSSGR  387

Query  722  RVRQRT  739
            R+R RT
Sbjct  388  RIRPRT  393



>gb|KCW50987.1| hypothetical protein EUGRSUZ_J00615 [Eucalyptus grandis]
Length=403

 Score =   304 bits (778),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 166/247 (67%), Positives = 198/247 (80%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S+ID   ++SI +P+S+IG HFGMLLENMEGSDI F+V GEKFHAHKLVLA
Sbjct  157  INCTVGVVVSSIDRPILNSIRVPESNIGTHFGMLLENMEGSDITFDVWGEKFHAHKLVLA  216

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleass-sssipsi  358
            ARS +FRSE FDG+  ++QEIV+ ++E  VFKA+L+F+YTD+L ED+   +S S    S+
Sbjct  217  ARSSVFRSELFDGVGENKQEIVVDDLEPAVFKALLYFIYTDNLPEDEKSVTSCSGHAYSM  276

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL  KLL  ADRY + RL+ MC +YLCKDISV +V + LALAD YHA ELK VCL+FA
Sbjct  277  SETLLVKLLAVADRYGVDRLRIMCGSYLCKDISVTTVCEILALADRYHAKELKAVCLKFA  336

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENLAAVM+SDGFE LKEN  SLQSELLKTVAGCE + S   GK+RSVWAQLSD GD+ G
Sbjct  337  AENLAAVMRSDGFECLKENNVSLQSELLKTVAGCEKDLSPDSGKTRSVWAQLSDGGDSHG  396

Query  719  RRVRQRT  739
            RRVRQR 
Sbjct  397  RRVRQRN  403



>ref|XP_006408271.1| hypothetical protein EUTSA_v10020746mg [Eutrema salsugineum]
 gb|ESQ49724.1| hypothetical protein EUTSA_v10020746mg [Eutrema salsugineum]
Length=440

 Score =   305 bits (781),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 166/248 (67%), Positives = 199/248 (80%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P+SDIG+HFGMLLEN +GSDI FNV+GEKF AH+LVLA
Sbjct  147  INCTVGVVVSEIDCPRLHSIHVPESDIGSHFGMLLENEDGSDITFNVSGEKFRAHRLVLA  206

Query  182  ARSPIFRSEFFDGLESDE-QEIVISNMESKVFKAMLHFVYtds--lleddleasssssip  352
            ARSP+F SEF D  E +E ++I +++ME KVFKA+LH++Y D+     +   +S SS  P
Sbjct  207  ARSPVFESEFLDVSEEEEDRDIEVTDMEPKVFKALLHYIYKDALIEDAESSSSSGSSVGP  266

Query  353  sisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLR  532
            S SDTL AKLL AAD+Y L RL  MCE+ LCKDISV+SVA  LALAD Y+A  LK+VCL+
Sbjct  267  SASDTLAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLK  326

Query  533  FAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSG-D  709
            FAAENL AVM+SDGF+YL+E+CPSLQSELLKTVAGCE+E S GGGK+RSVWAQ SD G D
Sbjct  327  FAAENLIAVMRSDGFDYLREHCPSLQSELLKTVAGCEEELSGGGGKTRSVWAQFSDGGAD  386

Query  710  TDGRRVRQ  733
            T+ R  RQ
Sbjct  387  TNERSGRQ  394



>ref|XP_008667501.1| PREDICTED: uncharacterized protein LOC100273191 isoform X1 [Zea 
mays]
 tpg|DAA51837.1| TPA: hypothetical protein ZEAMMB73_694112 [Zea mays]
Length=428

 Score =   305 bits (780),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 165/256 (64%), Positives = 202/256 (79%), Gaps = 14/256 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV ST+D S  HSI +P+SDIG HFG LL+ +EG D+IF+VAGEKFHAHKLVLA
Sbjct  175  INCTVGVVVSTMDYSRPHSIEVPESDIGYHFGTLLDTLEGVDVIFSVAGEKFHAHKLVLA  234

Query  182  ARSPIFRSEFFDGLESDEQ-----------EIVISNMESKVFKAMLHFVYtdslleddle  328
            ARS  FRSEFFD  ESDE+           EIVI +M+  VFKA+LHF+Y D+L+ DD  
Sbjct  235  ARSSFFRSEFFDH-ESDEEKNETGTGDEIKEIVIDDMDPVVFKAVLHFMYRDNLVNDDEL  293

Query  329  asssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAM  508
             +SSS           KL+ AAD+Y+L RL+ +CE+YLCK +SVNSVA TLALAD YHA+
Sbjct  294  MASSSDCSIFDSLA-GKLMAAADKYELPRLRLLCESYLCKHVSVNSVATTLALADRYHAI  352

Query  509  ELKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWA  688
            ELK+VCL+FAAENL+AV++++GF+YLK+NCPSLQSE+L+TVAGCE++CSS G KS+SVWA
Sbjct  353  ELKSVCLKFAAENLSAVIRTEGFDYLKDNCPSLQSEILRTVAGCEEQCSS-GVKSQSVWA  411

Query  689  QLSDSGDTDGRRVRQR  736
            QLSD GDT GRRVR R
Sbjct  412  QLSDGGDTSGRRVRPR  427



>ref|NP_001140637.1| speckle-type POZ protein [Zea mays]
 gb|ACF84225.1| unknown [Zea mays]
 gb|AFW67396.1| speckle-type POZ protein [Zea mays]
 gb|AIB05410.1| orphans transcription factor, partial [Zea mays]
Length=428

 Score =   304 bits (779),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 202/255 (79%), Gaps = 12/255 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV ST+D S  HSI +P+SDIG HFG LL+  EG D+IF+VAGEKFHAHKLVLA
Sbjct  175  INCTVGVVVSTMDYSRPHSIEVPESDIGFHFGTLLDTQEGVDVIFSVAGEKFHAHKLVLA  234

Query  182  ARSPIFRSEFFD--------GLESDEQ--EIVISNMESKVFKAMLHFVYtdslleddlea  331
            ARSP FRSEFFD        G ++ ++  EIVI +M+  VFKA+LHF+Y D+L+ DD  +
Sbjct  235  ARSPFFRSEFFDHELGEEKNGTDTGDEIKEIVIDDMDPVVFKAVLHFIYRDNLVNDDELS  294

Query  332  sssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAME  511
            +SSS           KL+ AAD+Y+L RL+ +CE+YLCK ISVNSVA TLALAD +HAME
Sbjct  295  ASSSDCSIFDRLS-GKLMAAADKYELPRLRLLCESYLCKHISVNSVATTLALADRHHAME  353

Query  512  LKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQ  691
            LK+VCL+FAAENL+AV++++GF+YLK+NCPSLQSE+L+TVAGCE+ CSS G KS+SVWAQ
Sbjct  354  LKSVCLKFAAENLSAVIRTEGFDYLKDNCPSLQSEILRTVAGCEEPCSS-GLKSQSVWAQ  412

Query  692  LSDSGDTDGRRVRQR  736
            LSD GDT GRRVR R
Sbjct  413  LSDGGDTSGRRVRPR  427



>ref|NP_001058976.1| Os07g0167200 [Oryza sativa Japonica Group]
 dbj|BAC07391.1| putative zinc finger POZ domain protein [Oryza sativa Japonica 
Group]
 dbj|BAF20890.1| Os07g0167200 [Oryza sativa Japonica Group]
 gb|EEC81579.1| hypothetical protein OsI_25033 [Oryza sativa Indica Group]
 gb|EEE66629.1| hypothetical protein OsJ_23221 [Oryza sativa Japonica Group]
Length=424

 Score =   304 bits (778),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 197/255 (77%), Gaps = 11/255 (4%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV STID S  HSI +PDSDIG HFG LL+N EG D++ +V GE+FHAHKLVLA
Sbjct  172  INCTVGVVVSTIDYSRPHSILVPDSDIGYHFGTLLDNHEGVDVVLSVGGERFHAHKLVLA  231

Query  182  ARSPIFRSEFFD---------GLESDEQEIVISNMESKVFKAMLHFVYtdslleddleas  334
            ARS +FRS+FFD         G   D QEIVI +ME KVFKAMLHF+Y D+L++D+    
Sbjct  232  ARSTVFRSKFFDDEDGEKNEPGENDDVQEIVIDDMEPKVFKAMLHFIYRDTLVDDNELGG  291

Query  335  ssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMEL  514
            SSS            L  AAD+YDL RL+ +CE+YLCK ISV +VA TLALAD +HAMEL
Sbjct  292  SSSEGSIFDTLAAKLL-AAADKYDLARLRLLCESYLCKAISVATVASTLALADRHHAMEL  350

Query  515  KTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQL  694
            K VCL+FAAENL+AV++++GF+YLK+NCPSLQSE+L+T+AGCE+ECSS GGKS+SVW QL
Sbjct  351  KAVCLKFAAENLSAVIRTEGFDYLKDNCPSLQSEILRTLAGCEEECSS-GGKSQSVWGQL  409

Query  695  SDSGDTDGRRVRQRT  739
            SD GDT GRRVR RT
Sbjct  410  SDGGDTSGRRVRPRT  424



>ref|XP_003554047.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Glycine max]
 ref|XP_006604260.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=432

 Score =   304 bits (779),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 166/247 (67%), Positives = 204/247 (83%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S+IDCS +++I +P+SDIGAHFGMLLEN EGSD+ F+V GE+FHAHKLVLA
Sbjct  157  INCTVGVVVSSIDCSKLNTIQVPESDIGAHFGMLLENEEGSDVTFSVGGERFHAHKLVLA  216

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            ARS  F +EFF+G+E D+ +IV+++ME KVFKA+LHF+Y    + +++L  S SS +PS+
Sbjct  217  ARSTAFETEFFNGMEEDDHDIVVTDMEPKVFKALLHFIYRDTLIDDEELFMSRSSFLPSV  276

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S++  AKLL AA++Y L RLK MCE+ LCKDIS++SVA  LALAD Y A ELK+VCL+F+
Sbjct  277  SESFAAKLLAAAEKYGLPRLKLMCESVLCKDISIDSVAYILALADRYRATELKSVCLQFS  336

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVMQSDGFEYLKENCP LQSELLKTVAGCE+E  SG GK RSVWAQ SD GDT+ 
Sbjct  337  AENLVAVMQSDGFEYLKENCPLLQSELLKTVAGCEEEF-SGEGKCRSVWAQFSDGGDTND  395

Query  719  RRVRQRT  739
            R VRQ+T
Sbjct  396  RSVRQQT  402



>ref|XP_006657481.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Oryza brachyantha]
Length=426

 Score =   304 bits (778),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 198/255 (78%), Gaps = 12/255 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV STID S  HSI +PDSDIG HFG LL+N EG D+I NV GE+FHAHKLVLA
Sbjct  173  INCTVGVVVSTIDYSRPHSIQVPDSDIGYHFGTLLDNHEGVDVILNVGGERFHAHKLVLA  232

Query  182  ARSPIFRSEFFDGL---------ESDE-QEIVISNMESKVFKAMLHFVYtdslleddlea  331
            ARS +FRS+F D +         ESDE  EI+I +ME KVFKAMLHF+Y D+L++D+   
Sbjct  233  ARSTVFRSKFLDDVLDGEKNEAGESDELHEIIIDDMEPKVFKAMLHFIYRDTLVDDNELD  292

Query  332  sssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAME  511
            +SSS            L  AAD YDL RL+ +CE+YLCK ISV +V+ TLALAD YHAME
Sbjct  293  ASSSEGSISDTLAAKLL-AAADMYDLARLRLLCESYLCKGISVATVSSTLALADRYHAME  351

Query  512  LKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQ  691
            LK VCL+FAAENL+AV++++GF+YLK+NCPSLQSE+L+T+AGCE+ECSS GGKS+SVWAQ
Sbjct  352  LKAVCLKFAAENLSAVIRTEGFDYLKDNCPSLQSEILRTLAGCEEECSS-GGKSQSVWAQ  410

Query  692  LSDSGDTDGRRVRQR  736
            LSD GDT GRRVR R
Sbjct  411  LSDGGDTSGRRVRPR  425



>dbj|BAJ90220.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   304 bits (778),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 194/255 (76%), Gaps = 12/255 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV STID S  HSI +PDSDIG HFG LL++ EG D+I NV+GE+FHAHKLVLA
Sbjct  178  INCTVGVVVSTIDYSRSHSIQVPDSDIGYHFGSLLDSNEGVDVILNVSGERFHAHKLVLA  237

Query  182  ARSPIFRSEFFD----------GLESDEQEIVISNMESKVFKAMLHFVYtdslleddlea  331
            ARS +FRS+ FD              D +EIVI +ME KVFKAMLHF+Y D+L+ D    
Sbjct  238  ARSTVFRSKLFDDESEGEKNEVNESEDLEEIVIDDMEPKVFKAMLHFIYRDTLVNDYELD  297

Query  332  sssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAME  511
            +SSS            L  AAD+YDLGRL+ +CE+YLCKDISV SVA TLALAD +HAME
Sbjct  298  ASSSMGSIFDTLAAKLL-AAADKYDLGRLRLLCESYLCKDISVASVASTLALADSHHAME  356

Query  512  LKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQ  691
            LK VCL+FAAENL+AV+++DGF+YLK+ CPSLQSE+L+TVAGCE+ CSS GGKS+SVW Q
Sbjct  357  LKAVCLKFAAENLSAVIRTDGFDYLKDTCPSLQSEILRTVAGCEEPCSS-GGKSQSVWGQ  415

Query  692  LSDSGDTDGRRVRQR  736
            LSD GDT GRRVR R
Sbjct  416  LSDGGDTSGRRVRPR  430



>gb|KHN34655.1| BTB/POZ and MATH domain-containing protein 4 [Glycine soja]
Length=409

 Score =   303 bits (777),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 168/247 (68%), Positives = 206/247 (83%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S+IDCS +++I +P+SDIGAHFGMLLEN EGSD+ F+V GE+FHAHKLVLA
Sbjct  134  INCTVGVVVSSIDCSKLNTIQVPESDIGAHFGMLLENEEGSDVTFSVGGERFHAHKLVLA  193

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddle-asssssipsi  358
            ARS  F +EFF+G+E D+ +IV+++ME KVFKA+LHF+Y D+L++D+    S SS +PS+
Sbjct  194  ARSTAFETEFFNGMEEDDHDIVVTDMEPKVFKALLHFIYRDTLIDDEELFMSRSSFLPSV  253

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S++  AKLL AA++Y L RLK MCE+ LCKDIS++SVA  LALAD Y A ELK+VCL+F+
Sbjct  254  SESFAAKLLAAAEKYGLPRLKLMCESVLCKDISIDSVAYILALADRYRATELKSVCLQFS  313

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVMQSDGFEYLKENCP LQSELLKTVAGCE+E  SG GK RSVWAQ SD GDT+ 
Sbjct  314  AENLVAVMQSDGFEYLKENCPLLQSELLKTVAGCEEEF-SGEGKCRSVWAQFSDGGDTND  372

Query  719  RRVRQRT  739
            R VRQ+T
Sbjct  373  RSVRQQT  379



>dbj|BAJ93826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score =   304 bits (779),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 164/256 (64%), Positives = 202/256 (79%), Gaps = 14/256 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S+++ S  HS+ +PDSDIG HFG LL++ EG+D+IF+VAGEKFHAHKLVLA
Sbjct  187  INCTVGVVTSSMEYSRPHSLEVPDSDIGYHFGTLLDSQEGADVIFSVAGEKFHAHKLVLA  246

Query  182  ARSPIFRSEFFDGLESDEQ-----------EIVISNMESKVFKAMLHFVYtdslleddle  328
            ARS  FRSEF D  ESDE+           EIVI +ME KVF+A+LHF+Y D+L+ DD  
Sbjct  247  ARSSFFRSEFLDP-ESDEENSEVDTSNEIKEIVIDDMEPKVFQAVLHFMYRDNLVGDDEL  305

Query  329  asssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAM  508
            + SSS  P        KLL AAD+Y+L RL+ +CE+YLCK ISV SVA TLALAD +HA 
Sbjct  306  SPSSSDCPIFDTLA-GKLLAAADKYELPRLRVLCESYLCKQISVKSVATTLALADRHHAT  364

Query  509  ELKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWA  688
            ELK+VCL+FAAENL+AV+++DGF+YLK+NCP+LQSE+L+TVAGCE+ECSS GGKS+SVW 
Sbjct  365  ELKSVCLKFAAENLSAVIRTDGFDYLKDNCPALQSEILRTVAGCEEECSS-GGKSQSVWG  423

Query  689  QLSDSGDTDGRRVRQR  736
            Q+SD GDT GRRVR R
Sbjct  424  QISDGGDTSGRRVRPR  439



>gb|AAM60841.1| unknown [Arabidopsis thaliana]
Length=436

 Score =   303 bits (776),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 162/246 (66%), Positives = 198/246 (80%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P SDIG+HFGMLLEN +GSDI FNV+GEKF AH+LVLA
Sbjct  147  INCTVGVVVSEIDCPRLHSIHVPASDIGSHFGMLLENEDGSDITFNVSGEKFRAHRLVLA  206

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+F SEF D    ++++I +++ME KVFKA+LH++Y D+L+ED   +SSS S    S
Sbjct  207  ARSPVFESEFLDVTGEEDRDIEVTDMEPKVFKALLHYIYKDALIEDAESSSSSGSSVGPS  266

Query  362  d--tlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
               TL AKLL AAD+Y L RL  MCE+ LCKDISV+SVA  LALAD Y+A  LK+VCL+F
Sbjct  267  ASDTLAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLKF  326

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSG-DT  712
            AAENL AVM+SDGF+YL+E+CPSLQSELLKTVAGCE+E S GGGK+RSVW Q SD G +T
Sbjct  327  AAENLIAVMRSDGFDYLREHCPSLQSELLKTVAGCEEELSGGGGKTRSVWGQFSDGGAET  386

Query  713  DGRRVR  730
            +GR+ +
Sbjct  387  NGRQAQ  392



>ref|XP_002884409.1| hypothetical protein ARALYDRAFT_896389 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60668.1| hypothetical protein ARALYDRAFT_896389 [Arabidopsis lyrata subsp. 
lyrata]
Length=437

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 196/247 (79%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P SDIG+HFGMLLEN +GSDI FNV+GEKF AH+LVLA
Sbjct  147  INCTVGVVVSEIDCPRLHSIHVPASDIGSHFGMLLENEDGSDITFNVSGEKFRAHRLVLA  206

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtds--lleddleasssssips  355
            ARSP+F SEF D    ++++I +++ME KVFKA+LH++Y D+     +   +S SS  PS
Sbjct  207  ARSPVFESEFLDDTGEEDRDIEVTDMEPKVFKALLHYIYKDALIEDAESSSSSGSSVGPS  266

Query  356  isdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
             SDTL AKLL AAD+Y L RL  MCE+ LCKDISV+SVA  LALAD Y+A  LK+VCL+F
Sbjct  267  ASDTLAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLKF  326

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSG-DT  712
            AAENL AVM+SDGF+YL+E+CPSLQSELLKTVAGCE+E S GGGK+RSVW Q SD G +T
Sbjct  327  AAENLIAVMRSDGFDYLREHCPSLQSELLKTVAGCEEELSGGGGKTRSVWGQFSDGGAET  386

Query  713  DGRRVRQ  733
            + R  RQ
Sbjct  387  NERNGRQ  393



>ref|XP_010031623.1| PREDICTED: BTB/POZ and MATH domain-containing protein 5 [Eucalyptus 
grandis]
Length=507

 Score =   305 bits (780),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 166/246 (67%), Positives = 198/246 (80%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S+ID   ++SI +P+S+IG HFGMLLENMEGSDI F+V GEKFHAHKLVLA
Sbjct  261  INCTVGVVVSSIDRPILNSIRVPESNIGTHFGMLLENMEGSDITFDVWGEKFHAHKLVLA  320

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleass-sssipsi  358
            ARS +FRSE FDG+  ++QEIV+ ++E  VFKA+L+F+YTD+L ED+   +S S    S+
Sbjct  321  ARSSVFRSELFDGVGENKQEIVVDDLEPAVFKALLYFIYTDNLPEDEKSVTSCSGHAYSM  380

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL  KLL  ADRY + RL+ MC +YLCKDISV +V + LALAD YHA ELK VCL+FA
Sbjct  381  SETLLVKLLAVADRYGVDRLRIMCGSYLCKDISVTTVCEILALADRYHAKELKAVCLKFA  440

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENLAAVM+SDGFE LKEN  SLQSELLKTVAGCE + S   GK+RSVWAQLSD GD+ G
Sbjct  441  AENLAAVMRSDGFECLKENNVSLQSELLKTVAGCEKDLSPDSGKTRSVWAQLSDGGDSHG  500

Query  719  RRVRQR  736
            RRVRQR
Sbjct  501  RRVRQR  506



>gb|ACG37150.1| speckle-type POZ protein [Zea mays]
Length=428

 Score =   302 bits (774),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 202/255 (79%), Gaps = 12/255 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV ST+D S  HSI +P+SDIG HFG LL+  EG D+IF+VAGEKFHAHKLVLA
Sbjct  175  INCTVGVVVSTMDYSRPHSIEVPESDIGFHFGTLLDTQEGVDVIFSVAGEKFHAHKLVLA  234

Query  182  ARSPIFRSEFFD--------GLESDEQ--EIVISNMESKVFKAMLHFVYtdslleddlea  331
            ARSP FRSEFFD        G ++ ++  EIVI +M+  VFKA+LHF+Y D+L+ DD  +
Sbjct  235  ARSPFFRSEFFDHELGEEKNGTDTGDEIKEIVIDDMDPVVFKAVLHFIYRDNLVNDDELS  294

Query  332  sssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAME  511
            +SSS           KL+ AAD+Y+L RL+ +CE+YLCK ISVNSVA TLALAD +HAME
Sbjct  295  ASSSDCSIFDSLS-GKLMAAADKYELPRLRLLCESYLCKHISVNSVATTLALADRHHAME  353

Query  512  LKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQ  691
            LK+VCL+FAAENL+AV++++GF+YLK+NCPSLQSE+L+TVAGCE+ CSS G KS+SVWAQ
Sbjct  354  LKSVCLKFAAENLSAVIRTEGFDYLKDNCPSLQSEILRTVAGCEEPCSS-GLKSQSVWAQ  412

Query  692  LSDSGDTDGRRVRQR  736
            LSD GDT GRRVR R
Sbjct  413  LSDGGDTCGRRVRPR  427



>ref|XP_006369190.1| hypothetical protein POPTR_0001s18490g [Populus trichocarpa]
 gb|ERP65759.1| hypothetical protein POPTR_0001s18490g [Populus trichocarpa]
Length=258

 Score =   296 bits (758),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 193/231 (84%), Gaps = 4/231 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S  +CS ++SI +P+SDIGAHFGMLL+NMEGSD+IFNVAGEKFHAHKLVL+
Sbjct  15   INCTVGVVVSATNCSQLNSIQVPESDIGAHFGMLLDNMEGSDVIFNVAGEKFHAHKLVLS  74

Query  182  ARSPIFRSEFFD-GLESDEQEIVISNMESKVFKAMLHFVYtdslledd-leasssssips  355
            ARSP FRS+FFD G+E DEQEIVIS++E  VFKAMLHF+Y D+L ED  +  SSSS + S
Sbjct  75   ARSPFFRSKFFDDGVEEDEQEIVISDLEPVVFKAMLHFIYRDTLTEDVDMATSSSSPVCS  134

Query  356  isdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
            +S+TL  KLL AADRY + RL+ MCE++LCKDISVNSV+  LALAD +HA ELK VCL+F
Sbjct  135  VSETLTTKLLAAADRYGMDRLRLMCESHLCKDISVNSVSSILALADGHHATELKAVCLKF  194

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWA  688
            AAENLAAVM+SDGF YLKENCPSLQSELLKTVAGCE+   SG G+   V +
Sbjct  195  AAENLAAVMRSDGFTYLKENCPSLQSELLKTVAGCEE--VSGDGRDSKVTS  243



>ref|NP_566212.2| BTB/POZ and M4 domain-containing protein [Arabidopsis thaliana]
 sp|Q9SRV1.1|BPM4_ARATH RecName: Full=BTB/POZ and MATH domain-containing protein 4; AltName: 
Full=Protein BTB-POZ AND MATH DOMAIN 4; Short=AtBPM4 
[Arabidopsis thaliana]
 gb|AAF00643.1|AC009540_20 unknown protein [Arabidopsis thaliana]
 gb|AAK32896.1|AF367309_1 AT3g03740/F20H23_23 [Arabidopsis thaliana]
 gb|AAL15375.1| AT3g03740/F20H23_23 [Arabidopsis thaliana]
 gb|AEE73980.1| BTB/POZ and M4 domain-containing protein [Arabidopsis thaliana]
Length=465

 Score =   303 bits (776),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 161/246 (65%), Positives = 197/246 (80%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P SDIG+HFGMLLEN +GSDI FNV+GEKF AH+LVLA
Sbjct  176  INCTVGVVVSEIDCPRLHSIHVPASDIGSHFGMLLENEDGSDITFNVSGEKFRAHRLVLA  235

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtds--lleddleasssssips  355
            ARSP+F SEF D    ++++I +++ME KVFKA+LH++Y D+     +   +S SS  PS
Sbjct  236  ARSPVFESEFLDVTGEEDRDIEVTDMEPKVFKALLHYIYKDALIEDAESSSSSGSSVGPS  295

Query  356  isdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
             SDTL AKLL AAD+Y L RL  MCE+ LCKDISV+SVA  LALAD Y+A  LK+VCL+F
Sbjct  296  ASDTLAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLKF  355

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSG-DT  712
            AAENL AVM+SDGF+YL+E+CPSLQSELLKTVAGCE+E S GGGK+RSVW Q SD G +T
Sbjct  356  AAENLIAVMRSDGFDYLREHCPSLQSELLKTVAGCEEELSGGGGKTRSVWGQFSDGGAET  415

Query  713  DGRRVR  730
            +GR+ +
Sbjct  416  NGRQAQ  421



>ref|XP_003548681.2| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Glycine max]
Length=508

 Score =   303 bits (777),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 165/247 (67%), Positives = 204/247 (83%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S+IDCS +++I +P+SDIGAHFGMLLEN EGSD+ F+V GE+FHAHKLVLA
Sbjct  233  INCTVGVVVSSIDCSKLNTIQVPESDIGAHFGMLLENEEGSDVTFSVGGERFHAHKLVLA  292

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            ARS  F +EFF+G+E D+ ++V+++ME KVFKA+LHF+Y    + +++L  S SS +PS+
Sbjct  293  ARSTAFETEFFNGMEEDDHDVVVTDMEPKVFKALLHFIYRDTLIDDEELFMSRSSFLPSV  352

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S++  AKLL AA++Y L RLK MCE+ LCKDIS++SVA  LALAD Y A ELK+VCL+F+
Sbjct  353  SESFAAKLLAAAEKYGLPRLKLMCESVLCKDISIDSVAYILALADRYRATELKSVCLQFS  412

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVMQSDGFEYLKENCP LQSELLKTVAGCE+E  SG GK RSVWAQ SD GDT+ 
Sbjct  413  AENLVAVMQSDGFEYLKENCPLLQSELLKTVAGCEEEF-SGEGKCRSVWAQFSDGGDTND  471

Query  719  RRVRQRT  739
            R VRQ+T
Sbjct  472  RSVRQQT  478



>ref|XP_002463757.1| hypothetical protein SORBIDRAFT_01g005590 [Sorghum bicolor]
 gb|EER90755.1| hypothetical protein SORBIDRAFT_01g005590 [Sorghum bicolor]
Length=429

 Score =   300 bits (768),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 202/255 (79%), Gaps = 12/255 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV ST+D S  HSI +P+SDIG HFG LL+  EG D+IF+VAGEKFHAHKLVLA
Sbjct  176  INCTVGVVVSTMDYSRPHSIEVPESDIGYHFGTLLDTQEGVDVIFSVAGEKFHAHKLVLA  235

Query  182  ARSPIFRSEFFD---GLESDE-------QEIVISNMESKVFKAMLHFVYtdslleddlea  331
            ARSP FRSEFFD   G E +E       +EIVI +M+  VFKA+LHF+Y D+L++DD  +
Sbjct  236  ARSPFFRSEFFDHESGEEKNETDTKDEIKEIVIDDMDPVVFKAVLHFIYRDNLVDDDELS  295

Query  332  sssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAME  511
            +SSS           KL+ AAD+Y+L RL+ +CE+YLCK ISVNSVA TLALAD +HA+E
Sbjct  296  ASSSDCSIFDSLA-GKLMAAADKYELPRLRLLCESYLCKHISVNSVATTLALADRHHAVE  354

Query  512  LKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQ  691
            LK+VCL+FAAENL+AV++++GF+YLK+NC SLQSE+L+TVAGCE+ CSS G KS+SVWAQ
Sbjct  355  LKSVCLKFAAENLSAVIRTEGFDYLKDNCISLQSEILRTVAGCEEPCSS-GVKSQSVWAQ  413

Query  692  LSDSGDTDGRRVRQR  736
            LSD GDT GRRVR R
Sbjct  414  LSDGGDTSGRRVRPR  428



>ref|XP_009411295.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009411297.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=393

 Score =   298 bits (763),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 202/242 (83%), Gaps = 1/242 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +D   +H I +P+SD G HFG++L+  EGSD++F+VAGEKFHAHKLVLA
Sbjct  152  INCTVGVVVSVVDSPRLHHIQVPESDFGMHFGVILDEQEGSDVVFDVAGEKFHAHKLVLA  211

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSPIF ++FFDGL+ +  EI++++ME  VFKA+LHF+Y D+L++DD+ A+ +    SIS
Sbjct  212  ARSPIFHTQFFDGLDGESNEIIVTDMEPAVFKAILHFIYRDTLVDDDMLATPNLPESSIS  271

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL AKLL AADRY LGRL+ +CEA+LC++ISVNSVA TLALAD  HA+ELK  CL+F A
Sbjct  272  DTLVAKLLAAADRYSLGRLRLLCEAHLCREISVNSVASTLALADRCHAIELKAACLKFVA  331

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENL+AVM+S GFEYLK++CPSLQSELLK +AGC++ECSS GG +RSVWA+LSD  D++GR
Sbjct  332  ENLSAVMRSSGFEYLKDHCPSLQSELLKIIAGCDEECSS-GGNNRSVWAELSDGEDSNGR  390

Query  722  RV  727
            RV
Sbjct  391  RV  392



>ref|XP_004491159.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=421

 Score =   299 bits (765),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 162/268 (60%), Positives = 197/268 (74%), Gaps = 23/268 (9%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  + SIH+P+SDIG+HFG LL+NMEGSD+ F+VAGEK  AHKLVLA
Sbjct  153  INCTVGVVVSAIDCPQLQSIHVPESDIGSHFGTLLDNMEGSDVTFDVAGEKCPAHKLVLA  212

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
             RSP FRS FF+ ++ D+QEIVI+++E KVFKAMLHF+YT     + D+ +S ++S   +
Sbjct  213  TRSPEFRSTFFNSMDIDKQEIVITDLEPKVFKAMLHFIYTDTLTEDADMVSSITASDFLV  272

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL AKLL AAD+Y L RL+ MCE+ LCK I V+SVA  L LAD  HA ELK VCL+FA
Sbjct  273  SETLIAKLLAAADKYGLARLRLMCESRLCKYICVSSVANILTLADHCHATELKAVCLKFA  332

Query  539  AENLA----------------------AVMQSDGFEYLKENCPSLQSELLKTVAGCEDEC  652
            A+NLA                      AVM+SDGFEY+KE CP LQSE+LKT+AGCE + 
Sbjct  333  AQNLAARKAFIHVIYICHWLLPSLSDQAVMRSDGFEYMKEKCPWLQSEILKTIAGCEGDS  392

Query  653  SSGGGKSRSVWAQLSDSGDTDGRRVRQR  736
             S G KS+SVWAQLSD GDT+GRRVRQR
Sbjct  393  CSPGEKSQSVWAQLSDGGDTNGRRVRQR  420



>ref|NP_001141107.1| uncharacterized protein LOC100273191 [Zea mays]
 gb|ACF85419.1| unknown [Zea mays]
 tpg|DAA51838.1| TPA: hypothetical protein ZEAMMB73_694112 [Zea mays]
Length=427

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 199/252 (79%), Gaps = 14/252 (6%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV ST+D S  HSI +P+SDIG HFG LL+ +EG D+IF+VAGEKFHAHKLVLA
Sbjct  175  INCTVGVVVSTMDYSRPHSIEVPESDIGYHFGTLLDTLEGVDVIFSVAGEKFHAHKLVLA  234

Query  182  ARSPIFRSEFFDGLESDEQ-----------EIVISNMESKVFKAMLHFVYtdslleddle  328
            ARS  FRSEFFD  ESDE+           EIVI +M+  VFKA+LHF+Y D+L+ DD  
Sbjct  235  ARSSFFRSEFFDH-ESDEEKNETGTGDEIKEIVIDDMDPVVFKAVLHFMYRDNLVNDDEL  293

Query  329  asssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAM  508
             +SSS           KL+ AAD+Y+L RL+ +CE+YLCK +SVNSVA TLALAD YHA+
Sbjct  294  MASSSDCSIFDSLA-GKLMAAADKYELPRLRLLCESYLCKHVSVNSVATTLALADRYHAI  352

Query  509  ELKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWA  688
            ELK+VCL+FAAENL+AV++++GF+YLK+NCPSLQSE+L+TVAGCE++CSS G KS+SVWA
Sbjct  353  ELKSVCLKFAAENLSAVIRTEGFDYLKDNCPSLQSEILRTVAGCEEQCSS-GVKSQSVWA  411

Query  689  QLSDSGDTDGRR  724
            QLSD GDT GRR
Sbjct  412  QLSDGGDTSGRR  423



>ref|XP_004288385.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Fragaria vesca subsp. vesca]
Length=429

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 197/248 (79%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S ID S +HSIH+PDSDIGAHF   LEN EGSD+ F V+G KF AHKLVLA
Sbjct  154  INCTVGVVVSAIDSSRLHSIHVPDSDIGAHFSTFLENGEGSDVTFIVSGVKFPAHKLVLA  213

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP F +EFF GLE D QEIV+++ME KVFKA+LHF+YTD+L+ED+  +  SSS    S
Sbjct  214  ARSPEFGNEFFSGLEEDNQEIVVNDMEPKVFKALLHFLYTDTLVEDEEFSEPSSSSCMPS  273

Query  362  d--tlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
                L AKLL AAD+Y L RL+ MCE+ LCKDISVNSVA  LALAD Y A ELK+VCL+F
Sbjct  274  LSDVLAAKLLAAADKYGLTRLRLMCESVLCKDISVNSVANILALADRYSAFELKSVCLKF  333

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTD  715
            AAENL AVM++DGFE LKENCP LQSELLKTVAG E+E S+ GGKS+SVWAQ SD G+++
Sbjct  334  AAENLVAVMETDGFELLKENCPLLQSELLKTVAGSEEELSA-GGKSQSVWAQFSDGGNSN  392

Query  716  GRRVRQRT  739
             RR RQ+T
Sbjct  393  DRRARQQT  400



>ref|XP_004493213.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Cicer arietinum]
Length=442

 Score =   297 bits (761),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 165/247 (67%), Positives = 205/247 (83%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S+IDCS +++IH+P+SDIG+HFGMLLEN EGSDIIF+V GE+FHAHKLVLA
Sbjct  168  INCTVGVVVSSIDCSKLNTIHVPESDIGSHFGMLLENEEGSDIIFSVGGERFHAHKLVLA  227

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            ARS  F +EFF+ +E D+ ++V+++ME KVFKA+LHF+Y    + +++L  S SS +PSI
Sbjct  228  ARSTAFENEFFNKMEEDDCDVVVTDMEPKVFKALLHFIYRDALIEDEELFMSRSSFLPSI  287

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+T  AKLL AA++YDL RLK MCE+ LCKDIS++SVA  LALAD Y+A ELK++CL+F+
Sbjct  288  SETFAAKLLAAAEKYDLPRLKLMCESVLCKDISIDSVAYILALADRYNAAELKSICLQFS  347

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVMQSDGFEYLKENCP LQSELLKTVAGCE+E  SG GK RSVWAQ SD  + + 
Sbjct  348  AENLVAVMQSDGFEYLKENCPLLQSELLKTVAGCEEEF-SGEGKCRSVWAQFSDGVEDND  406

Query  719  RRVRQRT  739
            R VRQ+T
Sbjct  407  RSVRQQT  413



>ref|XP_010524999.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Tarenaya hassleriana]
Length=442

 Score =   297 bits (760),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 167/248 (67%), Positives = 200/248 (81%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P SDIG+HFGMLLEN EG+D+ FNVAGEKF AH+LVLA
Sbjct  147  INCTVGVVVSEIDCPRLHSIHVPASDIGSHFGMLLENEEGADVTFNVAGEKFRAHRLVLA  206

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            ARSP+F +E  +G   ++QEI +S+ME +VFKA+LH++Y    + E +L A+ SS  PS 
Sbjct  207  ARSPVFENELLEGTGDEDQEIEVSDMEPRVFKALLHYIYKDALIEEAELSATGSSVGPSA  266

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SDTL AKLL AAD+Y L RL  MCE+ LCKD+SVNSVA  LALAD Y+A  LK+V L+FA
Sbjct  267  SDTLAAKLLAAADKYRLPRLSLMCESVLCKDMSVNSVANILALADRYNATALKSVSLKFA  326

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSG-DTD  715
            AENL AVM+SDGFEYL+E+CPSLQSELLKTVAGCE+E S  GGK+RSVWAQ SDSG DT+
Sbjct  327  AENLVAVMRSDGFEYLREHCPSLQSELLKTVAGCEEEFS--GGKTRSVWAQFSDSGADTN  384

Query  716  GRRVRQRT  739
             R VRQ+T
Sbjct  385  DRSVRQQT  392



>gb|EMS49890.1| BTB/POZ and MATH domain-containing protein 4 [Triticum urartu]
Length=495

 Score =   298 bits (764),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 162/255 (64%), Positives = 195/255 (76%), Gaps = 12/255 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV STID SG HSI +PDSDIG HFG LL++ EG D+I NV+GE+FHAHKLVLA
Sbjct  242  INCTVGVVVSTIDYSGPHSIQVPDSDIGYHFGSLLDSNEGVDVILNVSGERFHAHKLVLA  301

Query  182  ARSPIFRSEFFD----------GLESDEQEIVISNMESKVFKAMLHFVYtdslleddlea  331
            ARS +FRS+ FD              D +EIV+ ++E KVFKAMLHF+Y D+L++D    
Sbjct  302  ARSTVFRSKLFDDESEGDKNEVNESEDLKEIVLDDLEPKVFKAMLHFIYRDTLVDDYELD  361

Query  332  sssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAME  511
            +SSS            L  AAD+YDLGRL+ +CE+YLCK ISV SVA TLALAD +HAME
Sbjct  362  ASSSMGSIFDTLAAKLL-AAADKYDLGRLRLLCESYLCKGISVASVASTLALADSHHAME  420

Query  512  LKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQ  691
            LK VCL+FAAENL+AV+++DGF+ LK+NCPSLQSE+L+TVAGCE+ CSS GGKS+SVW Q
Sbjct  421  LKAVCLKFAAENLSAVIRTDGFDCLKDNCPSLQSEILRTVAGCEEPCSS-GGKSQSVWGQ  479

Query  692  LSDSGDTDGRRVRQR  736
            LSD GDT GRRVR R
Sbjct  480  LSDGGDTSGRRVRPR  494



>ref|XP_010485725.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X1 [Camelina sativa]
Length=438

 Score =   295 bits (756),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 195/248 (79%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P SDIG+HFGMLLEN +GSDI FNV+GE F AH+LVLA
Sbjct  147  INCTVGVVVSEIDCPRLHSIHVPASDIGSHFGMLLENEDGSDITFNVSGEMFRAHRLVLA  206

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtds--lleddleasssssips  355
            ARSP+F SEF D    ++++I +++ME KVFKA+LH++Y D+     +   +S SS  PS
Sbjct  207  ARSPVFESEFLDVTGEEDRDIEVTDMEPKVFKALLHYIYKDALIEDAESSSSSGSSVGPS  266

Query  356  isdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
             SDTL AKLL AAD+Y L RL  MCE+ LCKDISV+SVA  LALAD Y+A  LK+VCL+F
Sbjct  267  ASDTLAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLKF  326

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSG-DT  712
            AAENL AV++SDG++YLKE+CPSLQSELLKT AGCE+E  SGGGK+RSVW Q SD G DT
Sbjct  327  AAENLNAVIRSDGYDYLKEHCPSLQSELLKTFAGCEEEL-SGGGKTRSVWGQFSDGGADT  385

Query  713  DGRRVRQR  736
            + R  RQR
Sbjct  386  NERNGRQR  393



>gb|AFD04128.1| speckle-type POZ, partial [Triticum aestivum]
Length=426

 Score =   295 bits (755),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 193/255 (76%), Gaps = 12/255 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV STID S  HSI +PDSDIG HFG LL++ EG D+I NV+GE+FHAHKLVLA
Sbjct  173  INCTVGVVVSTIDYSRPHSIQVPDSDIGYHFGSLLDSNEGVDVILNVSGERFHAHKLVLA  232

Query  182  ARSPIFRSEFFD----------GLESDEQEIVISNMESKVFKAMLHFVYtdslleddlea  331
            ARS +FRS+ FD              D +EIV+ ++E KVFKAMLHF+Y D+L++D    
Sbjct  233  ARSTVFRSKLFDDESEGDKNEVNESEDLKEIVLDDLEPKVFKAMLHFIYRDTLVDDYELD  292

Query  332  sssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAME  511
            +SSS            L  AAD+YDLGRL+ +CE+YLCK ISV SVA TLA  + +HAME
Sbjct  293  ASSSMGSIFDTLAAKLL-AAADKYDLGRLRLLCESYLCKGISVASVANTLATGESHHAME  351

Query  512  LKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQ  691
            LK VCL+FAAENL+AV+++DGF+YLK+NCPSLQSE+L+TVAGCE+ CSS GGKS+SVW Q
Sbjct  352  LKAVCLKFAAENLSAVIRTDGFDYLKDNCPSLQSEILRTVAGCEEPCSS-GGKSQSVWGQ  410

Query  692  LSDSGDTDGRRVRQR  736
            LSD GDT GRRVR R
Sbjct  411  LSDGGDTSGRRVRPR  425



>ref|XP_008244139.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 [Prunus 
mume]
Length=427

 Score =   294 bits (753),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 172/242 (71%), Positives = 199/242 (82%), Gaps = 2/242 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            +NCTVGVV S ID S +HSI +P+SDIGAHFGMLLEN EGSD+ FNV G KFHAHKLVLA
Sbjct  154  LNCTVGVVVSAIDSSRLHSIDVPESDIGAHFGMLLENEEGSDVTFNVRGVKFHAHKLVLA  213

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssss-ipsi  358
            ARSP F SEF +G+E D  EIV+ +ME KVFKA+LHF+YTD+L+ED+  + +SSS +PS+
Sbjct  214  ARSPEFESEFLNGMEEDNHEIVVVDMEPKVFKALLHFIYTDNLIEDEEFSVTSSSCLPSL  273

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SD L AKLL AAD+Y L RL  MCE+ LCKDISVNSVA  LALAD + AM+LK+VCL+FA
Sbjct  274  SDKLAAKLLAAADKYGLARLALMCESVLCKDISVNSVANILALADRFSAMDLKSVCLKFA  333

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVM++DGFE LKENCP LQSELLKTVAG E+E  SGGGKSRSVWAQ SD GDT  
Sbjct  334  AENLVAVMETDGFELLKENCPLLQSELLKTVAGTEEEL-SGGGKSRSVWAQFSDGGDTTD  392

Query  719  RR  724
            RR
Sbjct  393  RR  394



>ref|XP_007202130.1| hypothetical protein PRUPE_ppa006091mg [Prunus persica]
 gb|EMJ03329.1| hypothetical protein PRUPE_ppa006091mg [Prunus persica]
Length=427

 Score =   294 bits (752),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 200/242 (83%), Gaps = 2/242 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            +NCTVGVV S ID S +HSI +P+SDIGAHFGMLLEN EGSD+ FNV G KFHAHKLVLA
Sbjct  154  LNCTVGVVVSAIDSSRLHSIDVPESDIGAHFGMLLENEEGSDVTFNVRGVKFHAHKLVLA  213

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssss-ipsi  358
            ARSP F SEF +G+E D +EIV+ +ME KVFKA+LHF+YTD+L+ED+  + +SSS +PS+
Sbjct  214  ARSPEFESEFLNGMEEDNREIVVVDMEPKVFKALLHFIYTDNLIEDEEFSVTSSSCMPSL  273

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SD L AKLL AAD+Y L RL  MCE+ LCKD+SVNSVA  LALAD + AM+LK+VCL+FA
Sbjct  274  SDKLAAKLLAAADKYGLARLALMCESVLCKDVSVNSVANILALADRFSAMDLKSVCLKFA  333

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVM++DGFE LKENCP LQSELLKTVAG E+E  SGGGKSRSVWAQ SD GDT  
Sbjct  334  AENLVAVMETDGFELLKENCPLLQSELLKTVAGTEEEL-SGGGKSRSVWAQFSDGGDTTD  392

Query  719  RR  724
            RR
Sbjct  393  RR  394



>emb|CDY29955.1| BnaC01g40530D [Brassica napus]
Length=449

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 166/252 (66%), Positives = 202/252 (80%), Gaps = 7/252 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P SDIG+HFGMLLEN +GSDI FNV+GEKF AH+LVLA
Sbjct  147  INCTVGVVVSEIDCPRLHSIHVPASDIGSHFGMLLENEDGSDITFNVSGEKFRAHRLVLA  206

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtds--lleddleasssssip  352
            ARSP+F SEF D + E++E++I +++ME KVFKA+LH++Y D+     + + +S SS  P
Sbjct  207  ARSPVFESEFLDVIGEAEERDIEVTDMEPKVFKALLHYIYKDALIEDAETVSSSGSSVGP  266

Query  353  sisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLR  532
            S SDTL AKLL AAD+Y L RL  MCE+ LCKDISV+SVA  LALAD Y+A  LK+VCL+
Sbjct  267  SASDTLAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLK  326

Query  533  FAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECS---SGGGKSRSVWAQLSDS  703
            FAAENL AVM+SDGF+YL+E+CPSLQSELLKTVAGCE+E S    GGGK+RSVW Q SD 
Sbjct  327  FAAENLIAVMRSDGFDYLREHCPSLQSELLKTVAGCEEELSGGGGGGGKTRSVWGQFSDG  386

Query  704  G-DTDGRRVRQR  736
            G DT+ R VRQ+
Sbjct  387  GADTNERSVRQQ  398



>gb|EMT28882.1| Speckle-type POZ protein [Aegilops tauschii]
Length=612

 Score =   299 bits (765),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 195/255 (76%), Gaps = 12/255 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV STID S  HSI +PDSD+G HFG LL++ EG D+I NV+GE+FHAHKLVLA
Sbjct  359  INCTVGVVVSTIDYSRPHSIQVPDSDLGYHFGSLLDSNEGVDVILNVSGERFHAHKLVLA  418

Query  182  ARSPIFRSEFFD----------GLESDEQEIVISNMESKVFKAMLHFVYtdslleddlea  331
            ARS +FRS+ FD              D +EIV+ ++E KVFKAMLHF+Y D+L++D    
Sbjct  419  ARSTVFRSKLFDDESEGDKNEVNESEDLKEIVLDDLEPKVFKAMLHFIYRDTLVDDYELD  478

Query  332  sssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAME  511
            +SSS            L  AAD+YDLGRL+ +CE+YLCK ISV SVA TLALAD +HAME
Sbjct  479  ASSSMGSIFDTLAAKLL-AAADKYDLGRLRLLCESYLCKGISVASVASTLALADSHHAME  537

Query  512  LKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQ  691
            LK VCL+FAAENL+AV+++DGF+YLK+NCPSLQSE+L+TVAGCE+ CSS GGKS+SVW Q
Sbjct  538  LKAVCLKFAAENLSAVIRTDGFDYLKDNCPSLQSEILRTVAGCEEPCSS-GGKSQSVWGQ  596

Query  692  LSDSGDTDGRRVRQR  736
            LSD GDT GRRVR R
Sbjct  597  LSDGGDTSGRRVRPR  611



>ref|XP_003557844.2| PREDICTED: probable zinc metalloprotease EGY1, chloroplastic 
[Brachypodium distachyon]
Length=923

 Score =   306 bits (783),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 166/256 (65%), Positives = 203/256 (79%), Gaps = 14/256 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV ST+D S  HSI +P+SDIG HFG LL+  EG+D+IF+VAGEKFHAHKLVLA
Sbjct  670  INCTVGVVISTMDYSRPHSIEVPESDIGYHFGTLLDTEEGADVIFSVAGEKFHAHKLVLA  729

Query  182  ARSPIFRSEFFDGLESDEQ-----------EIVISNMESKVFKAMLHFVYtdslleddle  328
            ARS  FRSEFFD  ESDE+           EIVI +ME+KVFKA+LHF+Y D+L+ DD  
Sbjct  730  ARSSFFRSEFFDS-ESDEEKNEADISNEIKEIVIDDMEAKVFKAVLHFMYRDNLVSDDEL  788

Query  329  asssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAM  508
            ++SSS           KLL AAD+Y+L RL+ +CE+YLCK ISVNSVA TLALAD +HA 
Sbjct  789  SASSSGCSIFDTLA-GKLLAAADKYELQRLRVLCESYLCKQISVNSVATTLALADQHHAT  847

Query  509  ELKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWA  688
            ELK+VCL+FAAENL+AV+++DGF+YLK++C +LQSE+L+TVAGCE+ECSS GGKS+SVW 
Sbjct  848  ELKSVCLKFAAENLSAVIRTDGFDYLKDHCSALQSEILRTVAGCENECSS-GGKSQSVWG  906

Query  689  QLSDSGDTDGRRVRQR  736
            Q+SD GDT GRRVR R
Sbjct  907  QISDGGDTSGRRVRPR  922



>ref|XP_010463833.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Camelina sativa]
Length=438

 Score =   292 bits (747),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 162/248 (65%), Positives = 196/248 (79%), Gaps = 5/248 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P SDIG+HFGMLLEN +GSDI FNV+GEKF AH+LVLA
Sbjct  147  INCTVGVVVSEIDCPRLHSIHVPASDIGSHFGMLLENEDGSDITFNVSGEKFCAHRLVLA  206

Query  182  ARSPIFRSEFFDGLESDE-QEIVISNMESKVFKAMLHFVYtds--lleddleasssssip  352
            ARSP+F SEF D +  +E ++I +++ME KVFKA+LH++Y D+     +   +S SS  P
Sbjct  207  ARSPVFESEFLDVVTGEEDRDIEVTDMEPKVFKALLHYIYKDALIEDAESSSSSGSSVGP  266

Query  353  sisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLR  532
            S SDTL AKLL AAD+Y L RL  MCE+ LCKDISV+SVA  LALAD Y+A  LK+VCL+
Sbjct  267  SASDTLAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLK  326

Query  533  FAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSG-D  709
            FAAENL AV++SDG++YLKE+CPSLQSELLKT AGCE+E  SGGGK+RSVW Q SD G D
Sbjct  327  FAAENLNAVIRSDGYDYLKEHCPSLQSELLKTFAGCEEEL-SGGGKTRSVWGQFSDGGAD  385

Query  710  TDGRRVRQ  733
            T+ R  RQ
Sbjct  386  TNERNGRQ  393



>tpg|DAA51835.1| TPA: hypothetical protein ZEAMMB73_694112 [Zea mays]
Length=243

 Score =   285 bits (730),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 155/246 (63%), Positives = 192/246 (78%), Gaps = 14/246 (6%)
 Frame = +2

Query  35   IDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLAARSPIFRSEFF  214
            +D S  HSI +P+SDIG HFG LL+ +EG D+IF+VAGEKFHAHKLVLAARS  FRSEFF
Sbjct  1    MDYSRPHSIEVPESDIGYHFGTLLDTLEGVDVIFSVAGEKFHAHKLVLAARSSFFRSEFF  60

Query  215  DGLESDEQ-----------EIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            D  ESDE+           EIVI +M+  VFKA+LHF+Y D+L+ DD   +SSS      
Sbjct  61   DH-ESDEEKNETGTGDEIKEIVIDDMDPVVFKAVLHFMYRDNLVNDDELMASSSDCSIFD  119

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
                 KL+ AAD+Y+L RL+ +CE+YLCK +SVNSVA TLALAD YHA+ELK+VCL+FAA
Sbjct  120  SLA-GKLMAAADKYELPRLRLLCESYLCKHVSVNSVATTLALADRYHAIELKSVCLKFAA  178

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENL+AV++++GF+YLK+NCPSLQSE+L+TVAGCE++CSS G KS+SVWAQLSD GDT GR
Sbjct  179  ENLSAVIRTEGFDYLKDNCPSLQSEILRTVAGCEEQCSS-GVKSQSVWAQLSDGGDTSGR  237

Query  722  RVRQRT  739
            RVR R 
Sbjct  238  RVRPRV  243



>ref|XP_010513722.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Camelina sativa]
Length=438

 Score =   291 bits (745),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 195/248 (79%), Gaps = 5/248 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P SDIG+HFGMLLEN +GSDI FNV+GE F AH+LVLA
Sbjct  147  INCTVGVVVSEIDCPRLHSIHVPASDIGSHFGMLLENEDGSDITFNVSGEMFRAHRLVLA  206

Query  182  ARSPIFRSEFFDGLESDE-QEIVISNMESKVFKAMLHFVYtds--lleddleasssssip  352
            ARSP+F SEF D +  +E ++I +++ME KVFKA+LH++Y D+     +   +S SS  P
Sbjct  207  ARSPVFESEFLDVVTGEEDRDIEVTDMEPKVFKALLHYIYKDAIIEDAESSSSSGSSVGP  266

Query  353  sisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLR  532
            S SDTL AKLL AAD+Y L RL  MCE+ LCKDISV+SVA  LALAD Y+A  LK+VCL+
Sbjct  267  SASDTLAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLK  326

Query  533  FAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSG-D  709
            FAAENL AV++SDG++YLKE+CPSLQSELLKT AGCE+E  SGGGK+RSVW Q SD G D
Sbjct  327  FAAENLNAVIRSDGYDYLKEHCPSLQSELLKTFAGCEEEL-SGGGKTRSVWGQFSDGGAD  385

Query  710  TDGRRVRQ  733
            T+ R  RQ
Sbjct  386  TNERNGRQ  393



>ref|XP_008451035.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 [Cucumis 
melo]
Length=409

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 155/248 (63%), Positives = 191/248 (77%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S+I+     +I IP+S+IGAHFG LLEN+EGSD+ FNV GEKF AH+L+LA
Sbjct  163  INCTVGVVVSSIERPHSQTISIPESNIGAHFGALLENLEGSDVTFNVDGEKFQAHRLILA  222

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            ARSP+FRSEF   LE  ++EI + ++E  VFKA+L+F+YT     +  + +SSSSS   +
Sbjct  223  ARSPMFRSEFLHMLEESKEEIFVKDLEPNVFKALLYFIYTDSIAEDVVVSSSSSSSDSGV  282

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
             D   AKLL AADRY L RL+ MCE++LCK++SV SVA+ L+ A+ +HA ELK VCLRFA
Sbjct  283  GDHFMAKLLAAADRYGLERLRLMCESHLCKNLSVRSVAQVLSFAEEHHATELKAVCLRFA  342

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVA-GCEDECSSGGGKSRSVWAQLSDSGDTD  715
            A NL AVMQS GFE+LKEN PSLQSELLK +A  C D CS+G  KSRSVWAQLSD GD++
Sbjct  343  AMNLGAVMQSKGFEHLKENNPSLQSELLKILAQNCGDVCSNGS-KSRSVWAQLSDGGDSN  401

Query  716  GRRVRQRT  739
            GRRVRQRT
Sbjct  402  GRRVRQRT  409



>gb|KHG25171.1| BTB/POZ and MATH domain-containing 4 -like protein [Gossypium 
arboreum]
Length=467

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 179/292 (61%), Positives = 211/292 (72%), Gaps = 48/292 (16%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S  DC  +HSI +P+SDIG+HFG+LLEN EGSDI FNV GEKFHAHKLVLA
Sbjct  149  INCTVGVVVSETDCPRLHSIQVPESDIGSHFGILLENEEGSDITFNVFGEKFHAHKLVLA  208

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddl-easssssipsi  358
            ARSP+F +EF D +E D+ EIV+++ME KVFKA+LHF+Y DSL++D+    +SSSS+PS+
Sbjct  209  ARSPVFEAEFSDRME-DDNEIVVTDMEPKVFKALLHFIYRDSLIDDEEFVGTSSSSMPSV  267

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SD L AKLL AAD+YDL RL+ MCE+ LCKDISVNSVA  LALAD +HAM+LK+VCL+FA
Sbjct  268  SDALAAKLLAAADKYDLPRLRLMCESVLCKDISVNSVANILALADRHHAMDLKSVCLKFA  327

Query  539  AENL---------------------------------------------AAVMQSDGFEY  583
            AENL                                             +AVM+SDGFEY
Sbjct  328  AENLVGSYFVFLVLAVYGPRLRAACWSYLFEVRLLRCFSSLSQPVPAHGSAVMRSDGFEY  387

Query  584  LKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGRRVRQRT  739
            LKENCP+LQSELLKTVAGCE+E  SGGGKSRSVWA LSD GDT  R VRQ+T
Sbjct  388  LKENCPTLQSELLKTVAGCEEEF-SGGGKSRSVWAHLSDGGDTINRSVRQQT  438



>ref|XP_010520490.1| PREDICTED: BTB/POZ and MATH domain-containing protein 5 [Tarenaya 
hassleriana]
Length=412

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 154/253 (61%), Positives = 189/253 (75%), Gaps = 9/253 (4%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S I C  +H IH+PDS++G HFG LL+NMEGSD+ F+VAGEKF AHKLVLA
Sbjct  159  INCTVGVVVSEIRCPRLHVIHVPDSELGLHFGKLLDNMEGSDVTFDVAGEKFQAHKLVLA  218

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdsll----eddleasssssi  349
            ARSP F+S+FF G   D Q + I ++E +VFKA++HF+Y DSL             S  +
Sbjct  219  ARSPFFKSKFFRG-PVDNQIVTIDDLEPRVFKALIHFMYKDSLPEDVEPVKTHTFHSLKL  277

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
              IS+TL AKLL  A+ Y L RL+ MCE+++CK +S+NSVAK LALAD Y+A ELK VCL
Sbjct  278  SEISETLIAKLLATAEVYKLDRLRLMCESHICKGVSINSVAKILALADRYNASELKGVCL  337

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSS----GGGKSRSVWAQLS  697
            RF AENLAAV+Q++G+EY+K++CP LQSELLKTVAG E+   S    GGGKS+SVWAQLS
Sbjct  338  RFTAENLAAVLQTEGYEYVKDHCPKLQSELLKTVAGYEEASISISCGGGGKSQSVWAQLS  397

Query  698  DSGDTDGRRVRQR  736
            D GDT  RR RQR
Sbjct  398  DGGDTSSRRGRQR  410



>ref|XP_006297705.1| hypothetical protein CARUB_v10013733mg [Capsella rubella]
 gb|EOA30603.1| hypothetical protein CARUB_v10013733mg [Capsella rubella]
Length=437

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 158/247 (64%), Positives = 193/247 (78%), Gaps = 4/247 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P+SDIG+HFGMLLEN +GSDI FNV+GE+F AH+LVLA
Sbjct  147  INCTVGVVVSEIDCPRLHSIHVPESDIGSHFGMLLENEDGSDITFNVSGERFCAHRLVLA  206

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtds--lleddleasssssips  355
            ARSP+F SEF D    ++ +I +++ME KVFKA+LH++Y D+     +   +S SS  PS
Sbjct  207  ARSPVFESEFLDVNGEEDCDIEVTDMEPKVFKALLHYIYKDALIEDAESSSSSGSSVGPS  266

Query  356  isdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
             SDTL AKLL AAD+Y L RL  MCE+ LCKDISV+SVA  LALAD Y+A  LK+VCL+F
Sbjct  267  ASDTLAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLKF  326

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDS-GDT  712
            AAENL AV++S GF+YL+E+CPSLQSELLKT AGCE+E  SGGGK+RSVW Q SD   DT
Sbjct  327  AAENLHAVVRSHGFDYLREHCPSLQSELLKTFAGCEEEL-SGGGKTRSVWGQFSDGVADT  385

Query  713  DGRRVRQ  733
            + R  RQ
Sbjct  386  NERNGRQ  392



>ref|XP_003624698.1| Speckle-type POZ protein [Medicago truncatula]
 gb|ABD28533.1| BTB/POZ; MATH [Medicago truncatula]
 gb|AES80916.1| BTB/POZ/MATH-domain protein [Medicago truncatula]
Length=422

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 203/247 (82%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S+IDCS + +IH+P+SDIG+HFGMLLEN EGSD+ F+V GE+FHAHKLV+A
Sbjct  148  INCTVGVVVSSIDCSKLTTIHVPESDIGSHFGMLLENEEGSDVTFSVGGERFHAHKLVMA  207

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            ARS  F +EFF+ +E D++++V+++ME KVFKA+LHF+Y    + +++   SSSS +PSI
Sbjct  208  ARSTAFETEFFNSMEEDDRDVVVTDMEPKVFKALLHFIYRDTLIEDEEFFMSSSSFLPSI  267

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+T  AKLL AA++YDL RLK MCE+ LCKDIS++SVA  LALAD YHA ELK +CL+F+
Sbjct  268  SETFAAKLLAAAEKYDLPRLKLMCESVLCKDISIDSVAYILALADRYHATELKAICLQFS  327

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            AENL AVMQSDGFEYLKENCP LQSELLKTVA   +E  SG GK RSVWAQ+SD G+T+ 
Sbjct  328  AENLVAVMQSDGFEYLKENCPLLQSELLKTVA-GGEEEFSGEGKCRSVWAQVSDGGETND  386

Query  719  RRVRQRT  739
            R VRQ+T
Sbjct  387  RSVRQQT  393



>emb|CDY67137.1| BnaAnng23640D [Brassica napus]
Length=356

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 167/252 (66%), Positives = 200/252 (79%), Gaps = 7/252 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P SDIG+HFGMLLEN +GSDI FNV+GEKF AH+LVLA
Sbjct  57   INCTVGVVVSEIDCPRLHSIHVPASDIGSHFGMLLENEDGSDITFNVSGEKFRAHRLVLA  116

Query  182  ARSPIFRSEFFD-GLESDEQEIVISNMESKVFKAMLHFVYtdsll--eddleasssssip  352
            ARSP+F SEF D   E + +EI +++ME KVFKA+LH++Y D+L+   +   +S SS  P
Sbjct  117  ARSPVFESEFLDVIGEEEGREIEVNDMEPKVFKALLHYIYKDALIEDAESASSSGSSVGP  176

Query  353  sisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLR  532
            S SDTL AKLL AAD+Y L RL  MCE+ LCKDISV+SVA  LALAD Y+A  LK+VCL+
Sbjct  177  SASDTLAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLK  236

Query  533  FAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECS---SGGGKSRSVWAQLSDS  703
            FAAENL AVM+SDGF+YL+E+CPSLQSELLKTVAGCE+E S    GGGK+RSVW Q SD 
Sbjct  237  FAAENLIAVMRSDGFDYLREHCPSLQSELLKTVAGCEEELSGGGGGGGKTRSVWGQFSDG  296

Query  704  G-DTDGRRVRQR  736
            G DT+ R VRQ+
Sbjct  297  GADTNERSVRQQ  308



>ref|XP_003557540.2| PREDICTED: BTB/POZ and MATH domain-containing protein 5 [Brachypodium 
distachyon]
Length=547

 Score =   288 bits (737),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 158/255 (62%), Positives = 191/255 (75%), Gaps = 12/255 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV STID S  HSI +PDSDIG  FG+LL++ EG DII NV GEKFHAH+LVLA
Sbjct  294  INCTVGVVVSTIDYSRPHSIQVPDSDIGYDFGLLLDSNEGIDIILNVRGEKFHAHQLVLA  353

Query  182  ARSPIFRSEFFDGLESDEQE----------IVISNMESKVFKAMLHFVYtdslleddlea  331
            ARS +FRS  FD   + +++          +VI +ME KVFKAMLHF+Y D+L++D    
Sbjct  354  ARSSVFRSRLFDDESAGDKDKIDENDDLKVVVIDDMEPKVFKAMLHFIYRDTLVDDYELD  413

Query  332  sssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAME  511
            +SSS            L  AAD+YDL RLK +CE+YLCK ISV SVA TLALAD +HAME
Sbjct  414  ASSSEGSIFDTLAAKLL-AAADKYDLERLKLLCESYLCKGISVASVASTLALADDHHAME  472

Query  512  LKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQ  691
            LK VCL+FAAENL+AV+++ GF+YLK+NCP+LQSE+L+TVAGCE+ C S GGKS+SVW Q
Sbjct  473  LKAVCLKFAAENLSAVIRTSGFDYLKDNCPALQSEILRTVAGCEEPCIS-GGKSQSVWGQ  531

Query  692  LSDSGDTDGRRVRQR  736
            LSD GDT GRRVR R
Sbjct  532  LSDGGDTSGRRVRPR  546



>gb|KGN66383.1| hypothetical protein Csa_1G600230 [Cucumis sativus]
Length=409

 Score =   283 bits (725),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 158/248 (64%), Positives = 195/248 (79%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S+I+     +I IP+S+IGAHFG LLEN+EGSD+ F+V GEKF AH+L+LA
Sbjct  163  INCTVGVVVSSIERPHSQTISIPESNIGAHFGALLENLEGSDVTFDVDGEKFQAHRLILA  222

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+FRSEF   LE  ++EI + ++E  VFKA+L+F+YTDS+ ED +E+SSSSS  S  
Sbjct  223  ARSPMFRSEFLHMLEESKEEIFVKDLEPNVFKALLYFIYTDSIAEDVVESSSSSSSDSDV  282

Query  362  dtl-pAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                 AKLL AAD+Y L RL+ MCE++LCK++SV SVA+ L+ A+ +HA ELK VCLRFA
Sbjct  283  GDHFMAKLLAAADKYGLERLRLMCESHLCKNLSVRSVAQVLSFAEEHHATELKAVCLRFA  342

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVA-GCEDECSSGGGKSRSVWAQLSDSGDTD  715
            A NL AVMQS GFE+LKEN PSLQSELLK +A  C D CS+G  KSRSVWAQLSD GD++
Sbjct  343  AMNLGAVMQSKGFEHLKENNPSLQSELLKILAQNCGDVCSNGS-KSRSVWAQLSDGGDSN  401

Query  716  GRRVRQRT  739
            GRRVRQRT
Sbjct  402  GRRVRQRT  409



>ref|XP_010485726.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X2 [Camelina sativa]
Length=430

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 187/246 (76%), Gaps = 8/246 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P SDIG+HFGMLLEN +GSDI FNV+GE F AH+LVLA
Sbjct  147  INCTVGVVVSEIDCPRLHSIHVPASDIGSHFGMLLENEDGSDITFNVSGEMFRAHRLVLA  206

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+F SEF D    ++++I +++ME KVFK  L          +   +S SS  PS S
Sbjct  207  ARSPVFESEFLDVTGEEDRDIEVTDMEPKVFKDAL------IEDAESSSSSGSSVGPSAS  260

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL AKLL AAD+Y L RL  MCE+ LCKDISV+SVA  LALAD Y+A  LK+VCL+FAA
Sbjct  261  DTLAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLKFAA  320

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSG-DTDG  718
            ENL AV++SDG++YLKE+CPSLQSELLKT AGCE+E  SGGGK+RSVW Q SD G DT+ 
Sbjct  321  ENLNAVIRSDGYDYLKEHCPSLQSELLKTFAGCEEEL-SGGGKTRSVWGQFSDGGADTNE  379

Query  719  RRVRQR  736
            R  RQR
Sbjct  380  RNGRQR  385



>ref|XP_004955562.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Setaria italica]
Length=442

 Score =   281 bits (720),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 192/255 (75%), Gaps = 12/255 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV STID S  HSI +PDSDIG HFG LL+N EG D+I NV GE+FHAHKLVLA
Sbjct  189  INCTVGVVVSTIDYSRPHSIQVPDSDIGYHFGSLLDNEEGVDVILNVGGERFHAHKLVLA  248

Query  182  ARSPIFRSEFFDGL---------ESDE-QEIVISNMESKVFKAMLHFVYtdslleddlea  331
            ARS +FRS+FFD           ESDE +E  I +ME KVFKAMLHF+Y D+L++++   
Sbjct  249  ARSHVFRSQFFDDESDGEKSEVDESDELREFFIDDMEPKVFKAMLHFLYRDTLVDENELG  308

Query  332  sssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAME  511
            +SSS            L  AAD+Y+LGRL+ +CE+YLCK ++V SV+ TL LAD + AME
Sbjct  309  ASSSDGSVFDTLAAKLL-AAADKYELGRLRLLCESYLCKGVTVASVSSTLELADRHRAME  367

Query  512  LKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQ  691
            LK VCL+FAAENL+AVM+SDGF  L+ENC +LQ+ELLKTVAGCE+ CSS GGKS+SV AQ
Sbjct  368  LKAVCLKFAAENLSAVMRSDGFNRLRENCLALQAELLKTVAGCEEPCSS-GGKSQSVCAQ  426

Query  692  LSDSGDTDGRRVRQR  736
            LSD GDT GRRVR R
Sbjct  427  LSDGGDTSGRRVRPR  441



>emb|CDX70957.1| BnaC03g10410D [Brassica napus]
Length=410

 Score =   281 bits (718),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 150/252 (60%), Positives = 195/252 (77%), Gaps = 6/252 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S + C  +HSI +PDS++G+HFG+LL++MEGSD+ F++AGEKF AHKLVLA
Sbjct  158  INCTVGVVVSEVQCPRLHSIRVPDSELGSHFGVLLDSMEGSDVTFDIAGEKFQAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARSP F+S+FF+  E++ +E+ I+N+E KVFKA+L F+Y DSL ED    ++ +     +
Sbjct  218  ARSPFFKSKFFNEPEANNREVPINNLEPKVFKALLQFMYKDSLPEDVEPVTAHTFDLLKL  277

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
            P I +TL  KLL AADRY+L RL+ +CE+++CK +SV SVAK LALAD Y A ELK VCL
Sbjct  278  PDIYETLIVKLLAAADRYNLNRLRLLCESHICKGVSVKSVAKILALADRYKATELKDVCL  337

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDEC-SSGGGKSRSVWAQLSD-S  703
            +F AENLAAV+++D ++ LK+ C SLQSELLK VAG E+   S+GG KS+SVWAQLSD  
Sbjct  338  KFTAENLAAVLETDAYQQLKDECLSLQSELLKAVAGYEEASNSTGGAKSQSVWAQLSDGG  397

Query  704  GDTDGRRVRQRT  739
            GDT  R VRQRT
Sbjct  398  GDTSSRHVRQRT  409



>ref|XP_010454419.1| PREDICTED: BTB/POZ and MATH domain-containing protein 5-like 
[Camelina sativa]
Length=410

 Score =   280 bits (717),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 149/252 (59%), Positives = 194/252 (77%), Gaps = 6/252 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S I C  +HS+ +PDS++G+HFG+LL++MEGSD+ F++AGEKF AHKLVLA
Sbjct  158  INCTVGVVVSEIHCPQLHSVQVPDSELGSHFGVLLDSMEGSDVTFDIAGEKFPAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARSP F+S FF+  E++  E+ I+++E +VFKA+LHF+Y DSL ED   A++ +     +
Sbjct  218  ARSPFFKSTFFNEFEANNSEVTINDLEPRVFKALLHFMYKDSLPEDVEPATTYTFERLKL  277

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
              I +TL  KLL AAD+YDL RL+ +CEA++CK +SV SVAK LALAD Y+A ELK VCL
Sbjct  278  TEIYETLIVKLLAAADKYDLNRLRLLCEAHICKGVSVKSVAKILALADRYNAKELKGVCL  337

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGC-EDECSSGGGKSRSVWAQLSD-S  703
             F AENLAAV+++D ++ +K+ C +LQSELLK VAG  ED  S+GG KS+SVWAQLSD  
Sbjct  338  TFTAENLAAVLETDAYKQMKDECVTLQSELLKAVAGQEEDSNSTGGAKSQSVWAQLSDGG  397

Query  704  GDTDGRRVRQRT  739
            GDT  R VRQRT
Sbjct  398  GDTSSRHVRQRT  409



>ref|NP_001150930.1| LOC100284563 [Zea mays]
 gb|ACG40984.1| speckle-type POZ protein [Zea mays]
 tpg|DAA59692.1| TPA: speckle-type POZ protein [Zea mays]
Length=432

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 162/256 (63%), Positives = 191/256 (75%), Gaps = 12/256 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV STID S  HSIH+PDSDIG  FG LL++ EG+D+I NV GE+FHAHKLVLA
Sbjct  179  INCTVGVVVSTIDYSIPHSIHVPDSDIGYDFGSLLDSQEGADVILNVGGERFHAHKLVLA  238

Query  182  ARSPIFRSEFFDGL---------ESDE-QEIVISNMESKVFKAMLHFVYtdslleddlea  331
            ARS +F S+FFD           E+DE +E  I +ME  VFKAMLHF+Y D+L++DD   
Sbjct  239  ARSHVFGSQFFDDESDGEKSEVNETDELKEFSIDDMEPNVFKAMLHFIYRDTLVDDDELG  298

Query  332  sssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAME  511
            +SSS            L  A  +Y L RLK +CE+YLCK ISV SVA TLALAD +HAME
Sbjct  299  ASSSDGSIFDTPAAKLLAAAD-KYHLARLKSLCESYLCKGISVASVASTLALADRHHAME  357

Query  512  LKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQ  691
            LK VCL+FAAENL+AVM+S+GF YLK+NCPSLQSE+LKTVAGCED+CSS  GKS+SV  Q
Sbjct  358  LKAVCLKFAAENLSAVMRSEGFIYLKDNCPSLQSEILKTVAGCEDQCSS-VGKSQSVCGQ  416

Query  692  LSDSGDTDGRRVRQRT  739
            LSD GD+  RRVRQRT
Sbjct  417  LSDGGDSSCRRVRQRT  432



>gb|KFK37801.1| speckle-type poz protein [Arabis alpina]
Length=434

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/247 (64%), Positives = 190/247 (77%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P SDIG+HFGMLLEN +GSDI FNV+GEKF AH+LVL+
Sbjct  147  INCTVGVVVSEIDCPRLHSIHVPASDIGSHFGMLLENEDGSDITFNVSGEKFRAHRLVLS  206

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtds--lleddleasssssips  355
            ARSP+F SEF D    + ++I +++ME KVFKA+LH++Y D+     +   +S SS  PS
Sbjct  207  ARSPVFESEFLDVTGEEVRDIEVTDMEPKVFKALLHYIYKDALIEDAESASSSGSSVGPS  266

Query  356  isdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
             SDTL AKLL AAD+Y L RL  MCE+ LCKDISV SVA  LALAD ++A  LK+VCL+F
Sbjct  267  ASDTLAAKLLGAADKYKLPRLSLMCESVLCKDISVESVANILALADRHNASALKSVCLKF  326

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECS-SGGGKSRSVWAQLSDSGDT  712
            AAENL  VM+S+GFEYL+E+CPSLQSELLKTVAGCE+E S  GGGK+RSVW Q SD G  
Sbjct  327  AAENLIDVMRSEGFEYLREHCPSLQSELLKTVAGCEEELSGGGGGKTRSVWGQFSDGGTN  386

Query  713  DGRRVRQ  733
               R +Q
Sbjct  387  TNERRQQ  393



>ref|XP_009131834.1| PREDICTED: BTB/POZ and MATH domain-containing protein 5 [Brassica 
rapa]
Length=410

 Score =   278 bits (712),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 148/252 (59%), Positives = 192/252 (76%), Gaps = 6/252 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S + C  +HSI +PDS++G+HFG LL++MEGSD+ F++AGEKF AHKLVLA
Sbjct  158  INCTVGVVVSEVQCPRLHSIRVPDSELGSHFGFLLDSMEGSDVTFDIAGEKFQAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARSP F+S+FF   E + +E+ I+N+E KVFKA+L F+Y DSL ED    ++ +     +
Sbjct  218  ARSPFFKSKFFTEPEENNREVTINNLEPKVFKALLQFMYKDSLPEDVEPVAAHTYDLLKL  277

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
            P + +TL  KLL AAD+Y+L RL+ +CE+++CK +SV SVAK LALAD Y A ELK VCL
Sbjct  278  PEMYETLIVKLLAAADKYNLNRLRLLCESHICKGVSVKSVAKILALADRYKATELKDVCL  337

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDEC-SSGGGKSRSVWAQLSD-S  703
            +F AENLAAV+++D ++ LK+ C SLQSELLK VAG E+   S+GG KS+SVWAQLSD  
Sbjct  338  KFTAENLAAVLETDAYQQLKDECLSLQSELLKAVAGYEEASNSTGGAKSQSVWAQLSDGG  397

Query  704  GDTDGRRVRQRT  739
            GDT  R VRQRT
Sbjct  398  GDTSSRHVRQRT  409



>gb|KFK26316.1| hypothetical protein AALP_AA8G231700 [Arabis alpina]
Length=410

 Score =   278 bits (711),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 148/252 (59%), Positives = 192/252 (76%), Gaps = 6/252 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S I C  +HS+ +PDS++G+HFG+LL++MEGSDI F++AGEKF AHKLVLA
Sbjct  158  INCTVGVVVSEIHCPRLHSVQVPDSELGSHFGVLLDSMEGSDITFDIAGEKFPAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi-  358
            ARSP F+S+FF+  E+D  E+ I+++E  VFKA+L F+Y DSL ED    ++ +      
Sbjct  218  ARSPFFKSKFFNEPEADNSEVTINDLEPTVFKALLQFMYKDSLPEDVEPVTTHTFDTIKL  277

Query  359  ---sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
                +TL  KLL AAD+Y+L RL+ +CE+++CK +SV SVAK LALAD Y+A ELK+VCL
Sbjct  278  FEIYETLIVKLLAAADKYELKRLRLLCESHICKGVSVKSVAKILALADRYNAAELKSVCL  337

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCED-ECSSGGGKSRSVWAQLSD-S  703
            +F AENLAAV+++D ++ LK+ C SLQSELLK VAG ED   S+GG KS+SVWAQLSD  
Sbjct  338  KFTAENLAAVLETDAYKELKDECLSLQSELLKAVAGYEDGSNSTGGAKSQSVWAQLSDGG  397

Query  704  GDTDGRRVRQRT  739
            GDT  R VRQRT
Sbjct  398  GDTSSRHVRQRT  409



>emb|CDX88828.1| BnaA03g08210D [Brassica napus]
Length=410

 Score =   278 bits (710),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 148/252 (59%), Positives = 193/252 (77%), Gaps = 6/252 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S + C  +HSI +PDS++G+HFG+LL++MEGSD+ F++AGEKF AHKLVLA
Sbjct  158  INCTVGVVVSEVHCPRLHSIRVPDSELGSHFGVLLDSMEGSDVTFDIAGEKFQAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARSP F+S+FF   E + +E+ I+N+E KVFKA+L F+Y DSL ED    ++ +     +
Sbjct  218  ARSPFFKSKFFTEPEENNREVTINNLEPKVFKALLQFMYKDSLPEDVEPVAAHTYDLLKL  277

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
            P + +TL  KLL AAD+Y+L RL+ +CE+++CK +SV SVAK LALAD Y A ELK VCL
Sbjct  278  PEMYETLIVKLLAAADKYNLNRLRLLCESHICKGVSVKSVAKILALADRYKATELKDVCL  337

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDEC-SSGGGKSRSVWAQLSD-S  703
            +F AENLAAV+++D ++ LK+ C SLQSELLK VAG E+   S+GG KS+SVWAQLSD  
Sbjct  338  KFTAENLAAVLETDAYQQLKDECLSLQSELLKAVAGYEEASNSAGGAKSQSVWAQLSDGG  397

Query  704  GDTDGRRVRQRT  739
            GDT  R VRQRT
Sbjct  398  GDTSSRHVRQRT  409



>ref|XP_006293225.1| hypothetical protein CARUB_v10019549mg [Capsella rubella]
 gb|EOA26123.1| hypothetical protein CARUB_v10019549mg [Capsella rubella]
Length=412

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 193/250 (77%), Gaps = 4/250 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCT+GVV S I C  +HSIH+PDS++G+ FG LL+ +EGSD+ F++AGEKF AHKLVLA
Sbjct  162  INCTIGVVSSEIHCPRLHSIHVPDSELGSDFGNLLDTLEGSDVEFDIAGEKFRAHKLVLA  221

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdsll----eddleasssssi  349
            ARS  FRS+F++ LE++  E+VIS++E KVFKA+LHF+Y DSL          + +   +
Sbjct  222  ARSSFFRSKFYNILEANNNELVISDLEPKVFKALLHFMYKDSLSGDVEPVTAHSFNLLKL  281

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
              I +TL  KLL AA++Y+L RL+ +CE++LCK IS++SV+K LAL+D Y+A ELK+V L
Sbjct  282  SEIDETLIVKLLAAANKYNLSRLRLLCESHLCKGISISSVSKILALSDRYNATELKSVSL  341

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGD  709
            +FAAENL AV+Q+  +E LK++ P+LQSELL+ VAG ++  SSG GKS+SVW QLSD+G+
Sbjct  342  KFAAENLQAVLQTKAYEDLKDDYPNLQSELLQAVAGYDETSSSGEGKSQSVWGQLSDNGE  401

Query  710  TDGRRVRQRT  739
            T  RR+RQRT
Sbjct  402  TSSRRLRQRT  411



>gb|EMT17722.1| Speckle-type POZ protein [Aegilops tauschii]
Length=818

 Score =   287 bits (735),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/253 (60%), Positives = 185/253 (73%), Gaps = 26/253 (10%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV ST++ S  HS+ +PDSDIG HFG LLE+ EG+D+IF+VAGEKFHAHKLVLA
Sbjct  579  INCTVGVVTSTMEYSRPHSLEVPDSDIGHHFGTLLESQEGADVIFSVAGEKFHAHKLVLA  638

Query  182  ARSPIFRSEFFDGLESDEQ-----------EIVISNMESKVFKAMLHFVYtdslleddle  328
            ARS  FRSEF D  ESDE+           EIVI +ME KVF+     +Y          
Sbjct  639  ARSSFFRSEFLDP-ESDEENSEVDTSNEIKEIVIDDMEPKVFQFNKLDLYLIKYCPIFDT  697

Query  329  asssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAM  508
             +              KLL AAD+Y+L RL+ +CE+YLCK ISV SVA TLALAD +HA 
Sbjct  698  LA-------------GKLLAAADKYELPRLRVLCESYLCKQISVKSVATTLALADRHHAT  744

Query  509  ELKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWA  688
            ELK+VCL+FAAENL+AV+++DGF+YLK+NCP+LQSE+L+TVAGCE+ECSS GGKS+SVW 
Sbjct  745  ELKSVCLKFAAENLSAVIRTDGFDYLKDNCPALQSEILRTVAGCEEECSS-GGKSQSVWG  803

Query  689  QLSDSGDTDGRRV  727
            Q+SD GDT GRR+
Sbjct  804  QISDGGDTSGRRI  816



>ref|XP_010493218.1| PREDICTED: BTB/POZ and MATH domain-containing protein 5 [Camelina 
sativa]
Length=410

 Score =   276 bits (707),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/252 (58%), Positives = 194/252 (77%), Gaps = 6/252 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S I C  +HS+ +PDS++G+HFG+LL++MEGSD+ F+++GE+F AHKLVLA
Sbjct  158  INCTVGVVVSEIHCPQLHSVQVPDSELGSHFGVLLDSMEGSDVTFDISGERFQAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARSP F+S FF+  E++  E+ I+++E +VFKA+LHF+Y DSL ED   A++ +     +
Sbjct  218  ARSPFFKSTFFNEFEANNSEVTINDLEPRVFKALLHFMYKDSLPEDVEPATTYTFERLKL  277

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
              I +TL  KLL AAD+YDL RL+ +CEA++CK +SV SVAK LALAD Y+A ELK VCL
Sbjct  278  SDIYETLIVKLLAAADKYDLNRLRLLCEAHICKGVSVKSVAKILALADRYNAKELKGVCL  337

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCED-ECSSGGGKSRSVWAQLSD-S  703
             F AENLAAV+++D ++ +K+ C +LQSELLK VAG E+   S+GG KS+SVWAQLSD  
Sbjct  338  TFTAENLAAVLETDAYKQMKDECVTLQSELLKAVAGQEEGSNSTGGAKSQSVWAQLSDGG  397

Query  704  GDTDGRRVRQRT  739
            GDT  R VRQRT
Sbjct  398  GDTSSRHVRQRT  409



>gb|ABK24368.1| unknown [Picea sitchensis]
Length=411

 Score =   276 bits (706),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 187/248 (75%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            +NCTVGVV S  +   +HSI +P+SD+G HFG LLEN E SD+ F+VAGEKFHAHKLVLA
Sbjct  166  LNCTVGVVVSATESPMLHSISVPESDLGLHFGALLENQEASDVTFDVAGEKFHAHKLVLA  225

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVY--tdslleddleasssssips  355
            ARSP+F+++FFD  E    E+VI++ME  VFKAMLH++Y  T    E     SSSSS  S
Sbjct  226  ARSPVFKAKFFDSSE-QSNEVVITDMEPTVFKAMLHYIYRDTLPDEEPSSPNSSSSSSSS  284

Query  356  isdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
             ++TL  +LL  A  Y L RL+ +CE+ LC+ ISVN+VA TLALA+ +HA +LK  CL+F
Sbjct  285  TTETLTERLLAVAQLYGLRRLRLLCESKLCRSISVNTVASTLALAESHHATDLKATCLKF  344

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTD  715
            AAENLA VM+S GFEYLKE CP LQSELLKTVA  ED+CSS GGK+RSVWAQLSD  D +
Sbjct  345  AAENLAGVMRSKGFEYLKEKCPLLQSELLKTVAHFEDDCSS-GGKTRSVWAQLSDGTDIN  403

Query  716  GRRVRQRT  739
            GRRVR RT
Sbjct  404  GRRVRPRT  411



>ref|XP_006287859.1| hypothetical protein CARUB_v10001086mg [Capsella rubella]
 gb|EOA20757.1| hypothetical protein CARUB_v10001086mg [Capsella rubella]
Length=410

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 147/252 (58%), Positives = 193/252 (77%), Gaps = 6/252 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S I C  +HS+H+PDS++GAHFG+LL++MEGSD+ F++AGEKF AHKLVLA
Sbjct  158  INCTVGVVVSEIHCPQLHSVHVPDSELGAHFGVLLDSMEGSDVTFDIAGEKFLAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARSP F+S FF   +++  E+ I+++E +VFKA+LHF+Y DSL ED   A++ +     +
Sbjct  218  ARSPFFKSTFFSEFDANNSEVTINDLEPRVFKALLHFMYKDSLPEDVEPATTHTFERLKL  277

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
              I +TL  K+L AAD+YDL RL+ +CEA++CK +SV SVAK LALAD Y+A ELK VCL
Sbjct  278  SEIYETLIVKILAAADKYDLNRLRLLCEAHICKGVSVKSVAKILALADRYNAKELKGVCL  337

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCED-ECSSGGGKSRSVWAQLSD-S  703
             F AENLAAV+ ++ ++ +K+ C +LQSELLK VAG E+   S+GG KS+SVWAQLSD  
Sbjct  338  TFTAENLAAVLDTEAYQQMKDECVTLQSELLKAVAGQEEGSNSTGGAKSQSVWAQLSDGG  397

Query  704  GDTDGRRVRQRT  739
            GDT  R VRQRT
Sbjct  398  GDTSSRHVRQRT  409



>ref|XP_004144146.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform 3 [Cucumis sativus]
Length=333

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 154/244 (63%), Positives = 192/244 (79%), Gaps = 3/244 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S+I+     +I IP+S+IGAHFG LLEN+EGSD+ F+V GEKF AH+L+LA
Sbjct  29   INCTVGVVVSSIERPHSQTISIPESNIGAHFGALLENLEGSDVTFDVDGEKFQAHRLILA  88

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+FRSEF   LE  ++EI + ++E  VFKA+L+F+YTDS+ ED +E+SSSSS  S  
Sbjct  89   ARSPMFRSEFLHMLEESKEEIFVKDLEPNVFKALLYFIYTDSIAEDVVESSSSSSSDSDV  148

Query  362  -dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
             D   AKLL AAD+Y L RL+ MCE++LCK++SV SVA+ L+ A+ +HA ELK VCLRFA
Sbjct  149  GDHFMAKLLAAADKYGLERLRLMCESHLCKNLSVRSVAQVLSFAEEHHATELKAVCLRFA  208

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVA-GCEDECSSGGGKSRSVWAQLSDSGDTD  715
            A NL AVMQS GFE+LKEN PSLQSELLK +A  C D CS+G  KSRSVWAQLSD GD++
Sbjct  209  AMNLGAVMQSKGFEHLKENNPSLQSELLKILAQNCGDVCSNGS-KSRSVWAQLSDGGDSN  267

Query  716  GRRV  727
            GRR+
Sbjct  268  GRRM  271



>gb|AGV54250.1| BTB/POZ and MATH domain-containing protein 4-like protein [Phaseolus 
vulgaris]
Length=431

 Score =   276 bits (706),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 188/246 (76%), Gaps = 2/246 (1%)
 Frame = +2

Query  5    NCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLAA  184
            N  VGVV S+ID S +++  +P+S+IGAH G  LEN EGSD+ F + GE F  HKLVLAA
Sbjct  157  NRPVGVVVSSIDWSKLNTKKVPESEIGAHSGKGLENEEGSDVTFFLGGESFPPHKLVLAA  216

Query  185  RSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsisd  364
            RS  F +EFF+G+E DEQ+IV+++ME KVFKA+LHF+Y D+L++D+    S SS      
Sbjct  217  RSTAFETEFFNGMEEDEQDIVVTDMEPKVFKALLHFIYRDTLIDDEELFVSRSSFLPSVS  276

Query  365  tl-pAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
                AKLL AA++YDL RLK MCE+ LCKDIS++SVA  LALAD Y A ELK+VCL+F A
Sbjct  277  ESFAAKLLAAAEKYDLPRLKLMCESVLCKDISIDSVAYILALADRYRATELKSVCLQFFA  336

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGR  721
            ENL AVMQSDGFEYLKENCP LQSELLKTVAGCE+E  SG GK RSVWAQ SD GDT+ R
Sbjct  337  ENLVAVMQSDGFEYLKENCPLLQSELLKTVAGCEEEF-SGEGKCRSVWAQFSDGGDTNDR  395

Query  722  RVRQRT  739
             VRQ+T
Sbjct  396  SVRQQT  401



>ref|XP_010535766.1| PREDICTED: BTB/POZ and MATH domain-containing protein 5-like 
[Tarenaya hassleriana]
Length=407

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/251 (59%), Positives = 192/251 (76%), Gaps = 6/251 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INC +GVV S   C    +IH+P S++G HFGMLL+NMEGSD+  +VAGEKF AHKLVLA
Sbjct  157  INCKIGVVISETHCPRFRAIHVPASELGLHFGMLLDNMEGSDVTLDVAGEKFQAHKLVLA  216

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            A+SP F+S+FF+G E+D + + I+++E KVFKA+LHF+Y DSL ED     + S     +
Sbjct  217  AQSPYFKSKFFNGPEADNEVVTINDLEPKVFKALLHFMYKDSLPEDVEPVLTQSFDSLEL  276

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
              IS+TL AKL+ AAD Y L RL+ MCE+++CK +S+NSVAK L +AD Y+A+ELK VCL
Sbjct  277  SEISETLVAKLMAAADIYKLDRLRLMCESHICKGLSINSVAKILVIADRYNAVELKGVCL  336

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSD-SG  706
            RFAAENLAAV++++ +EY+KE+CP LQ+ELL+ VAG ED   S GGKS SVWAQLS+  G
Sbjct  337  RFAAENLAAVLETEAYEYVKEDCPKLQTELLRAVAGFEDATCS-GGKSTSVWAQLSEGGG  395

Query  707  DTDGRRVRQRT  739
            ++  RRVRQRT
Sbjct  396  ESISRRVRQRT  406



>ref|XP_002871964.1| BTB-POZ and math domain 5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48223.1| BTB-POZ and math domain 5 [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/252 (58%), Positives = 193/252 (77%), Gaps = 6/252 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S I C  +HS+H+PDS++G+HFG+LL++MEGSD+ F++AGEKF AHKLVLA
Sbjct  158  INCTVGVVVSEIQCPQLHSVHVPDSELGSHFGVLLDSMEGSDVTFDIAGEKFLAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARSP F+S FF    +D  E+ I+++E KVFKA+L F+Y DSL ED   A++ +     +
Sbjct  218  ARSPFFKSMFFSEFAADNTEVTINDLEPKVFKALLQFMYKDSLPEDVEPATTHTFERLKL  277

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
              I +TL  K+L AAD+YDL RL+ +CE+++C+ +SV SVAK LALAD Y+A ELK VCL
Sbjct  278  SEIYETLIVKVLAAADKYDLIRLRLLCESHICQGVSVKSVAKILALADRYNAKELKNVCL  337

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCED-ECSSGGGKSRSVWAQLSD-S  703
            +F AENLAAV+++D ++ +K+ C +LQSELLK VAG E+   +SGG KS+SVWAQLSD  
Sbjct  338  KFTAENLAAVLETDAYQQMKDECVTLQSELLKAVAGHEEGSNTSGGAKSQSVWAQLSDGG  397

Query  704  GDTDGRRVRQRT  739
            GDT  R VRQRT
Sbjct  398  GDTSSRHVRQRT  409



>ref|XP_004159364.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Cucumis sativus]
Length=648

 Score =   275 bits (704),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 153/244 (63%), Positives = 191/244 (78%), Gaps = 3/244 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S+I+     +I IP+S+IGAHFG LLEN+EGSD+ F+V GEKF AH+L+LA
Sbjct  29   INCTVGVVVSSIERPHSQTISIPESNIGAHFGALLENLEGSDVTFDVDGEKFQAHRLILA  88

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+FRSEF   LE  ++EI + ++E  VFKA+L+F+YTDS+ ED +E+SSSSS  S  
Sbjct  89   ARSPMFRSEFLHMLEESKEEIFVKDLEPNVFKALLYFIYTDSIAEDVVESSSSSSSDSDV  148

Query  362  d-tlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                 AKLL AAD+Y L RL+ MCE++LCK++SV SVA+ L+ A+ +HA ELK VCLRFA
Sbjct  149  GDHFMAKLLAAADKYGLERLRLMCESHLCKNLSVRSVAQVLSFAEEHHATELKAVCLRFA  208

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVA-GCEDECSSGGGKSRSVWAQLSDSGDTD  715
            A NL AVMQS GFE+LKEN PSLQSELLK +A  C D CS+G  KSRSVWAQLSD GD++
Sbjct  209  AMNLGAVMQSKGFEHLKENNPSLQSELLKILAQNCGDVCSNGS-KSRSVWAQLSDGGDSN  267

Query  716  GRRV  727
            GRR+
Sbjct  268  GRRM  271



>ref|XP_009102074.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and MATH domain-containing 
protein 4 [Brassica rapa]
Length=471

 Score =   270 bits (691),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 167/277 (60%), Positives = 200/277 (72%), Gaps = 32/277 (12%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSIH+P SDIG+HFGMLLEN +GSDI FNV+GEKF AH+LVLA
Sbjct  147  INCTVGVVVSEIDCPRLHSIHVPASDIGSHFGMLLENEDGSDITFNVSGEKFRAHRLVLA  206

Query  182  ARSPIFRSEFFD-GLESDEQEIVISNMESKVFK-------------------------AM  283
            ARSP+F SEF D   E + +EI +++ME KVFK                         A+
Sbjct  207  ARSPVFESEFLDVIGEEEGREIEVNDMEPKVFKVXFVLNLLKLLXAPVXFLMLFFVLKAL  266

Query  284  LHFVYtdsll--eddleasssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDIS  457
            LH++Y D+L+   +   +S SS  PS SDTL AKLL AAD+Y L RL  MCE+ LCKDIS
Sbjct  267  LHYIYKDALIEDAESASSSGSSVGPSASDTLAAKLLGAADKYKLPRLSLMCESVLCKDIS  326

Query  458  VNSVAKTLALADCYHAMELKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAG  637
            V+SVA  LALAD Y+A  LK+VCL+FAAENL AVM+SDGF+YL+E+CPSLQSELLKTVAG
Sbjct  327  VDSVANILALADRYNASALKSVCLKFAAENLIAVMRSDGFDYLREHCPSLQSELLKTVAG  386

Query  638  CEDECS---SGGGKSRSVWAQLSDSG-DTDGRRVRQR  736
            CE+E S    GGGK+RSVW Q SD G DT+ R VRQ+
Sbjct  387  CEEELSGGGGGGGKTRSVWGQFSDGGADTNERSVRQQ  423



>ref|XP_010549705.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 [Tarenaya 
hassleriana]
Length=384

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/245 (59%), Positives = 181/245 (74%), Gaps = 8/245 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S  DC   H IH+P+SDIG+HFG LLEN EGSD+ FNVAGEKF AH+LVLA
Sbjct  147  INCTVGVVVSETDCPRYHLIHVPESDIGSHFGTLLENEEGSDVTFNVAGEKFRAHRLVLA  206

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP++ +E  +G   +++EI +++ME +VFKA+LH++Y D+L+E+   A++ SS     
Sbjct  207  ARSPVYENELLEGTADEDREIEVTDMEPRVFKALLHYIYKDALVEEMELATTGSSASDTL  266

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
                     AAD+Y L RL  MCE+ LCK +SVNSVA  LA+AD ++A  LK+VCL+FAA
Sbjct  267  AAKLLA---AADKYRLPRLSLMCESVLCKGLSVNSVANILAIADRHNASALKSVCLKFAA  323

Query  542  ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGC-EDECSSGGGKSRSVWAQLSDSGDTDG  718
            ENL AVM+SDGF YL+E+CP LQSELLKTVAGC EDE S  GGK+RSVWAQ SD   T+ 
Sbjct  324  ENLVAVMRSDGFAYLREHCPLLQSELLKTVAGCEEDEVS--GGKTRSVWAQFSDG--TND  379

Query  719  RRVRQ  733
            R  R 
Sbjct  380  RSTRH  384



>ref|XP_006400672.1| hypothetical protein EUTSA_v10013671mg [Eutrema salsugineum]
 gb|ESQ42125.1| hypothetical protein EUTSA_v10013671mg [Eutrema salsugineum]
Length=415

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 189/257 (74%), Gaps = 11/257 (4%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S I C  +HS+ +P+S++G+HFG+LL++MEGSD+ F++AGEK  AHKLVLA
Sbjct  158  INCTVGVVVSEIHCPRLHSVQVPESELGSHFGVLLDSMEGSDVTFDIAGEKIQAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARSP F+S+FF+  E+   E+ I ++E KVFKA+L F+Y DSL ED     + +     +
Sbjct  218  ARSPFFKSKFFNEFEASNTEVKIDDLEPKVFKALLQFMYKDSLPEDVEAVYTHTFDLLKL  277

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
            P I +TL  KLL A+D+YDL RL+ +CE++L K +SV SVAK L LAD Y A ELK+VCL
Sbjct  278  PEIYETLIVKLLAASDKYDLNRLRLLCESHLSKGVSVKSVAKILVLADRYSARELKSVCL  337

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCED-ECSSGGGKSRSVWAQLSD--  700
            +F+AENLAAV+++D +  LK+ C SLQSELLK VAG E+   S+GG KS+SVWAQLSD  
Sbjct  338  KFSAENLAAVLETDAYLQLKDECLSLQSELLKAVAGYEEGSNSTGGAKSQSVWAQLSDGG  397

Query  701  ----SGDTDGRRVRQRT  739
                 GDT  R VRQRT
Sbjct  398  GGGGGGDTSSRHVRQRT  414



>ref|XP_002325436.2| speckle-type POZ family protein [Populus trichocarpa]
 gb|EEE99817.2| speckle-type POZ family protein [Populus trichocarpa]
Length=357

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 165/199 (83%), Gaps = 2/199 (1%)
 Frame = +2

Query  140  VAGEKFHAHKLVLAARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslled  319
            V G+KFHAHKLVL ARSP+F +E  D +E D  EIVIS++E KVFKA+LHF+Y D L+ED
Sbjct  132  VQGQKFHAHKLVLVARSPVFENELLDAMEEDNSEIVISDIEPKVFKALLHFIYKDDLIED  191

Query  320  dleasssssipsis-dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADC  496
            +  ++SSS+      DTL AKLLEAADRYDL RL+ MCEA LCKDISV+SVAK LALAD 
Sbjct  192  EELSASSSTSVISVFDTLTAKLLEAADRYDLPRLRLMCEAVLCKDISVSSVAKILALADR  251

Query  497  YHAMELKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSR  676
            YHAM+LK+VCL+F+AENL AV+QSDGFEYLKENCP LQSELLKTVAGCE++  SGGGKSR
Sbjct  252  YHAMDLKSVCLKFSAENLVAVVQSDGFEYLKENCPLLQSELLKTVAGCEEDV-SGGGKSR  310

Query  677  SVWAQLSDSGDTDGRRVRQ  733
            SVWAQ SD GDT+ R VRQ
Sbjct  311  SVWAQFSDGGDTNDRSVRQ  329



>ref|NP_197600.1| BTB-POZ and math domain 5 [Arabidopsis thaliana]
 sp|Q1EBV6.1|BPM5_ARATH RecName: Full=BTB/POZ and MATH domain-containing protein 5; AltName: 
Full=Protein BTB-POZ AND MATH DOMAIN 5; Short=AtBPM5 
[Arabidopsis thaliana]
 gb|ABG25067.1| At5g21010 [Arabidopsis thaliana]
 gb|AED92919.1| BTB-POZ and math domain-containing protein [Arabidopsis thaliana]
Length=410

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 149/252 (59%), Positives = 195/252 (77%), Gaps = 6/252 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S I C  +HS+H+PDS++G+HFG+LL++MEGSDI FN+AGEKF AHKLVLA
Sbjct  158  INCTVGVVVSEILCPQLHSVHVPDSELGSHFGVLLDSMEGSDITFNIAGEKFLAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARSP F+S+FF   E++  E+ I+++E KVFKA+L F+Y DSL ED   A++ +     +
Sbjct  218  ARSPFFKSKFFSEFEANNTEVTINDLEPKVFKALLQFMYKDSLPEDVEPATAHTFERLKL  277

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
              I +TL  K+L AAD+YDL RL+ +CE+++CK +SV SVAK LALAD Y+A ELK VCL
Sbjct  278  SEIYETLIVKVLAAADKYDLIRLRLLCESHICKGVSVKSVAKILALADRYNAKELKGVCL  337

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCED-ECSSGGGKSRSVWAQLSD-S  703
            +F AENLAAV+++D ++ +K+ C +LQSELLK VAG E+   S+GG KS+SVWAQLSD  
Sbjct  338  KFTAENLAAVLETDAYQQMKDECVTLQSELLKAVAGHEEGSNSTGGAKSQSVWAQLSDGG  397

Query  704  GDTDGRRVRQRT  739
            GDT  R VRQRT
Sbjct  398  GDTTSRHVRQRT  409



>gb|AAM61175.1| unknown [Arabidopsis thaliana]
Length=410

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 149/252 (59%), Positives = 195/252 (77%), Gaps = 6/252 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S I C  +HS+H+PDS++G+HFG+LL++MEGSDI FN+AGEKF AHKLVLA
Sbjct  158  INCTVGVVVSEILCPQLHSVHVPDSELGSHFGVLLDSMEGSDITFNIAGEKFLAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARSP F+S+FF   E++  E+ I+++E KVFKA+L F+Y DSL ED   A++ +     +
Sbjct  218  ARSPFFKSKFFSEFEANNTEVTINDLEPKVFKALLQFMYKDSLPEDVEPATAHTFERLKL  277

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
              I +TL  K+L AAD+YDL RL+ +CE+++CK +SV SVAK LALAD Y+A ELK VCL
Sbjct  278  SEIYETLIVKVLAAADKYDLIRLRLLCESHICKGVSVKSVAKILALADRYNAKELKGVCL  337

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCED-ECSSGGGKSRSVWAQLSD-S  703
            +F AENLAAV+++D ++ +K+ C +LQSELLK VAG E+   S+GG KS+SVWAQLSD  
Sbjct  338  KFTAENLAAVLETDAYQQMKDECVTLQSELLKAVAGHEEGSNSTGGAKSQSVWAQLSDGG  397

Query  704  GDTDGRRVRQRT  739
            GDT  R VRQRT
Sbjct  398  GDTTSRHVRQRT  409



>ref|XP_002875616.1| BTB-POZ and math domain 6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51875.1| BTB-POZ and math domain 6 [Arabidopsis lyrata subsp. lyrata]
Length=415

 Score =   261 bits (666),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 144/250 (58%), Positives = 193/250 (77%), Gaps = 4/250 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S I C  + SIH+PDS++G+HFG LL+ +EGSD+ F++AGEK  AHKLVLA
Sbjct  165  INCTVGVVVSEIHCPQLLSIHVPDSELGSHFGKLLDTLEGSDVTFDIAGEKIQAHKLVLA  224

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARS  FRS+F++  E++  E+ IS++E KVFKA+LHF+Y DSL  +    ++ S     +
Sbjct  225  ARSQFFRSKFYNVPEANNNEVAISDLEPKVFKALLHFMYKDSLPGNVEPVTAHSFDLLRL  284

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
              I DTL  KLL A++ Y+L RL+ +CE+++CK +S++SV+K LALAD Y+A ELK+V L
Sbjct  285  SEIDDTLIVKLLAASEMYNLSRLRLLCESHICKAVSISSVSKILALADKYNATELKSVSL  344

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGD  709
            +F AENLAAV+Q+  +E LK++CP+LQSELLK VAG ++  SSGGGKS+SVWAQLSD G+
Sbjct  345  KFTAENLAAVLQTKAYEDLKDDCPNLQSELLKVVAGYDETSSSGGGKSQSVWAQLSDGGE  404

Query  710  TDGRRVRQRT  739
            T  RRVRQRT
Sbjct  405  TSSRRVRQRT  414



>ref|NP_189956.2| BTB-POZ and math domain-containing protein [Arabidopsis thaliana]
 sp|A1L4W5.1|BPM6_ARATH RecName: Full=BTB/POZ and MATH domain-containing protein 6; AltName: 
Full=Protein BTB-POZ AND MATH DOMAIN 6; Short=AtBPM6 
[Arabidopsis thaliana]
 gb|ABM06022.1| At3g43700 [Arabidopsis thaliana]
 gb|AEE77819.1| BTB-POZ and math domain-containing protein [Arabidopsis thaliana]
Length=415

 Score =   260 bits (665),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 146/250 (58%), Positives = 192/250 (77%), Gaps = 4/250 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S + C  + SIH+PDS++G+HFG LL+ ++GSD+ F+VAGEKF AHKLVLA
Sbjct  165  INCTVGVVVSEMHCPRLLSIHVPDSELGSHFGKLLDTLQGSDVTFDVAGEKFQAHKLVLA  224

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARS  FRS F++ L  +  ++VIS++E KVFKA+LHF+Y DSL  D    ++ S      
Sbjct  225  ARSQFFRSMFYNTLAENNSDVVISDLEPKVFKALLHFMYKDSLPGDVEPLTAHSFDLLRP  284

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
              I DTL  KLL AA+ Y+L RL+ +CE+++CK IS++SV+K LAL+D Y+A ELK+V L
Sbjct  285  SEIDDTLIVKLLAAAEMYNLSRLRLLCESHICKGISISSVSKILALSDKYNASELKSVSL  344

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGD  709
            +F AENLAAV+Q+  +E LK++CP+LQSELLK VAG +D  SSGGGKS+SVWAQLS+ G+
Sbjct  345  KFTAENLAAVLQTKAYEDLKDDCPNLQSELLKAVAGYDDTSSSGGGKSQSVWAQLSNGGE  404

Query  710  TDGRRVRQRT  739
            T  RRVRQRT
Sbjct  405  TSSRRVRQRT  414



>emb|CAB83071.1| putative protein [Arabidopsis thaliana]
Length=411

 Score =   260 bits (664),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 146/250 (58%), Positives = 192/250 (77%), Gaps = 4/250 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S + C  + SIH+PDS++G+HFG LL+ ++GSD+ F+VAGEKF AHKLVLA
Sbjct  161  INCTVGVVVSEMHCPRLLSIHVPDSELGSHFGKLLDTLQGSDVTFDVAGEKFQAHKLVLA  220

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARS  FRS F++ L  +  ++VIS++E KVFKA+LHF+Y DSL  D    ++ S      
Sbjct  221  ARSQFFRSMFYNTLAENNSDVVISDLEPKVFKALLHFMYKDSLPGDVEPLTAHSFDLLRP  280

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
              I DTL  KLL AA+ Y+L RL+ +CE+++CK IS++SV+K LAL+D Y+A ELK+V L
Sbjct  281  SEIDDTLIVKLLAAAEMYNLSRLRLLCESHICKGISISSVSKILALSDKYNASELKSVSL  340

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGD  709
            +F AENLAAV+Q+  +E LK++CP+LQSELLK VAG +D  SSGGGKS+SVWAQLS+ G+
Sbjct  341  KFTAENLAAVLQTKAYEDLKDDCPNLQSELLKAVAGYDDTSSSGGGKSQSVWAQLSNGGE  400

Query  710  TDGRRVRQRT  739
            T  RRVRQRT
Sbjct  401  TSSRRVRQRT  410



>ref|XP_002961582.1| hypothetical protein SELMODRAFT_270271 [Selaginella moellendorffii]
 ref|XP_002971221.1| hypothetical protein SELMODRAFT_171839 [Selaginella moellendorffii]
 gb|EFJ27819.1| hypothetical protein SELMODRAFT_171839 [Selaginella moellendorffii]
 gb|EFJ36842.1| hypothetical protein SELMODRAFT_270271 [Selaginella moellendorffii]
Length=409

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 180/246 (73%), Gaps = 4/246 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I CTVGVV S++     HS+ +P+SDIG HF  LLE+ EG+D+ FNV GE F AHKL+LA
Sbjct  166  ITCTVGVVVSSMQALKQHSLLVPESDIGQHFLSLLESGEGTDVNFNVKGEAFSAHKLLLA  225

Query  182  ARSPIFRSEFFDGLESDEQEIV-ISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+F+++ F  ++ +  +++ I +ME  VFKAMLHF+Y DSL + +    SSS   + 
Sbjct  226  ARSPVFKAQLFGPMKDENGDVIEIDDMEPPVFKAMLHFIYKDSLPDTNEMTGSSSQSTAT  285

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADR+ L RL+ +CE+ LC+ I+V++VA TLALAD +HA +LK VCL+FA
Sbjct  286  MMAQ--HLLAAADRFCLDRLRLLCESRLCEQITVDTVATTLALADQHHASQLKNVCLKFA  343

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDG  718
            A NLA VMQSDGFEYL+E+CPSLQSELLKTVAG E+E  + G K+R+VW  ++D GD  G
Sbjct  344  ASNLAVVMQSDGFEYLRESCPSLQSELLKTVAGVEEEAKA-GTKNRTVWTHVADGGDGLG  402

Query  719  RRVRQR  736
            RRVRQ+
Sbjct  403  RRVRQK  408



>ref|XP_007015537.1| BTB/POZ and MATH domain-containing protein 4 isoform 2 [Theobroma 
cacao]
 gb|EOY33156.1| BTB/POZ and MATH domain-containing protein 4 isoform 2 [Theobroma 
cacao]
Length=348

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 159/186 (85%), Gaps = 1/186 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +P+S+IGAHFGMLLENMEGSDI F+VAGEKFHAHKLVLA
Sbjct  163  INCTVGVVVSAIDCSRLHSIQVPESNIGAHFGMLLENMEGSDITFDVAGEKFHAHKLVLA  222

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddlea-sssssipsi  358
            ARSP+FRSEFFDG++ ++QEIVI+N + KVFKA+LHF+Y D+L ED     S+ SS+ SI
Sbjct  223  ARSPVFRSEFFDGMDEEKQEIVITNFDPKVFKALLHFIYRDTLSEDVESVGSTFSSVSSI  282

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL AKLL AADRY L RLK MCE++LCK+ISVNSVAK LALAD YHA ELK VCLRFA
Sbjct  283  SETLIAKLLAAADRYGLERLKLMCESHLCKNISVNSVAKILALADQYHASELKAVCLRFA  342

Query  539  AENLAA  556
            AENLA 
Sbjct  343  AENLAG  348



>ref|XP_009126498.1| PREDICTED: BTB/POZ and MATH domain-containing protein 5-like 
[Brassica rapa]
Length=409

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 189/256 (74%), Gaps = 10/256 (4%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +    +HS+ +PDS+IG+HFG+LL++MEGSD+ F+++GEKF AHKLVLA
Sbjct  153  INCTVGVVVSEVQRPQLHSVRVPDSEIGSHFGVLLDSMEGSDVTFDISGEKFQAHKLVLA  212

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARSP F+S+  + L ++  E+ I+++E KVFKA+L F+Y DSL ED    ++ +    ++
Sbjct  213  ARSPFFKSKILNELGANNTEVTINDLEPKVFKALLQFMYRDSLPEDVEPVTTLTFEFLTL  272

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
            P I +TL  KLLEAA++Y + RL+ +CEA +CK +SV SVAK LALAD Y A ELK+ CL
Sbjct  273  PEIYETLVVKLLEAAEKYGMNRLRLLCEARICKGVSVKSVAKILALADRYKATELKSACL  332

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDEC--SSGGGKSRSVWAQLSD-  700
             F AENLAAV+++D ++ +K+ C +LQSELLK VAG E+E   SSG  KS+SVWAQLSD 
Sbjct  333  LFTAENLAAVLETDAYKEMKDECLTLQSELLKAVAGYEEEGSHSSGEDKSQSVWAQLSDG  392

Query  701  ---SGDTDGRRVRQRT  739
                GD   R VRQRT
Sbjct  393  GGGGGDISSRHVRQRT  408



>ref|XP_010503047.1| PREDICTED: BTB/POZ and MATH domain-containing protein 6-like 
isoform X1 [Camelina sativa]
 ref|XP_010503048.1| PREDICTED: BTB/POZ and MATH domain-containing protein 6-like 
isoform X2 [Camelina sativa]
Length=412

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 191/250 (76%), Gaps = 4/250 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S I C  +HSIH+PDS++G+ FG LL+ +EGSD+  ++AGEKF AHKLVLA
Sbjct  162  INCTVGVVVSEIHCPRLHSIHVPDSELGSDFGKLLDTLEGSDVKIDIAGEKFEAHKLVLA  221

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARS  FRS F++  E++  E+VIS++E KVFKA+LHF+Y DSL  D    ++ S     +
Sbjct  222  ARSSFFRSMFYNMPEANNNEVVISDLEPKVFKALLHFMYKDSLSGDVEPVTAHSFGLLKL  281

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
              I +TL  KLL AA +Y+L RL+ +CE+++CK +S++SV+K LAL+D Y+A ELK+V L
Sbjct  282  SEIDETLIVKLLAAATKYNLSRLRSLCESHICKAVSISSVSKILALSDRYNATELKSVSL  341

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGD  709
             FAAENLAAV+Q+  +E +K++ P+LQSELLK VAG ++  SSGGGKS+SVW QLSD G+
Sbjct  342  NFAAENLAAVLQTKAYEDVKDDYPNLQSELLKAVAGYDETSSSGGGKSQSVWGQLSDGGE  401

Query  710  TDGRRVRQRT  739
            T  RR+RQRT
Sbjct  402  TSSRRLRQRT  411



>ref|XP_006598960.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Glycine max]
 gb|KHN46738.1| BTB/POZ and MATH domain-containing protein 4 [Glycine soja]
Length=396

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/246 (56%), Positives = 190/246 (77%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGV+ S+ID + ++ I +P+SD+GA F +LLEN + SD+ F V+GE+FHA+KLVL 
Sbjct  133  INCTVGVLVSSIDSTKLNPIQVPESDLGADFAILLENEQFSDVTFTVSGERFHANKLVLV  192

Query  182  ARSPIFRSEFFDGLESDEQ-EIVISNMESKVFKAMLHFVYtdslle-ddleasssssips  355
            ARS +F++EFF G+E D++ +IV+++ME KVFKA+LH++Y D+L+E ++L    SS +PS
Sbjct  193  ARSTVFQTEFFKGMEKDDRGDIVVNDMEPKVFKALLHYIYRDTLIEDEELFMLHSSLLPS  252

Query  356  isdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
            +S++ PAKLL AA++Y+L RLK MCE+ LCKDIS++SVA  L LAD Y A ELK++CL+F
Sbjct  253  LSESFPAKLLAAAEKYELPRLKLMCESVLCKDISIDSVAYILPLADRYRATELKSICLKF  312

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTD  715
            +A+NL AVMQSDGF+YLK+NCP L  ELLKTV GCE++  SG  K  ++  Q S   DT 
Sbjct  313  SAQNLRAVMQSDGFKYLKQNCPWLLVELLKTVGGCEEKF-SGKRKYATMRGQSSGGDDTG  371

Query  716  GRRVRQ  733
             R V +
Sbjct  372  ARSVNK  377



>ref|XP_006842152.1| hypothetical protein AMTR_s00078p00129860 [Amborella trichopoda]
 gb|ERN03827.1| hypothetical protein AMTR_s00078p00129860 [Amborella trichopoda]
Length=293

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 179/234 (76%), Gaps = 3/234 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I CTVGVV S  D   ++SI +P+SD+GA+FG LLE +E SD +F+V+GEK  AHK+VLA
Sbjct  41   IKCTVGVVVSATDSFQLYSIQVPESDLGAYFGALLETLEDSDAVFDVSGEKVLAHKIVLA  100

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddle--asssssips  355
            ARSP+F+++FFD  E    EIV++++E KVFKAM+HF+Y D+L++++ E   SS  S  S
Sbjct  101  ARSPVFQAQFFDVSEETNGEIVVTDLEPKVFKAMIHFIYKDTLVDEEEEEFTSSFGSSSS  160

Query  356  isdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
            +++ LPAKLL AAD+Y+L RL+R+CE+ LCKDISV++VA TLALA+ +HA ELK +CL++
Sbjct  161  VAERLPAKLLAAADKYELERLRRLCESKLCKDISVSTVASTLALAERHHATELKAMCLKY  220

Query  536  AAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLS  697
            AAENLA VM SD FE +K+  P LQSE+LKTVA  E E  S   K  SVWAQLS
Sbjct  221  AAENLADVMCSDAFEQMKDEFPFLQSEILKTVAELEQENGS-TAKGTSVWAQLS  273



>ref|XP_006446682.1| hypothetical protein CICLE_v10015761mg [Citrus clementina]
 gb|ESR59922.1| hypothetical protein CICLE_v10015761mg [Citrus clementina]
Length=354

 Score =   243 bits (619),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 160/199 (80%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +P+SDIGAHFGMLL+N E SDI F+VAGEKF AHKLVLA
Sbjct  153  INCTVGVVVSAIDCSRLHSIQVPESDIGAHFGMLLDNAESSDITFDVAGEKFPAHKLVLA  212

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslle---ddleasssssip  352
            ARSPIFRS+FFD LE D+QEI+IS++E KVFKAMLHF+Y D+L E    D+   SSS + 
Sbjct  213  ARSPIFRSKFFDELEEDKQEIIISDLEPKVFKAMLHFIYRDTLTEDVDVDVATPSSSCMS  272

Query  353  sisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLR  532
            S+SDTL AKLL AADRY L RL+ MC ++LCKDISVNSVAK L+LAD +HA ELK VCLR
Sbjct  273  SVSDTLTAKLLAAADRYGLERLRLMCGSHLCKDISVNSVAKILSLADEHHATELKAVCLR  332

Query  533  FAAENLAAVMQSDGFEYLK  589
            FAAENLA + Q     Y+K
Sbjct  333  FAAENLAGLFQFPCVLYVK  351



>ref|XP_002976951.1| hypothetical protein SELMODRAFT_443336 [Selaginella moellendorffii]
 ref|XP_002980693.1| hypothetical protein SELMODRAFT_420185 [Selaginella moellendorffii]
 gb|EFJ18344.1| hypothetical protein SELMODRAFT_420185 [Selaginella moellendorffii]
 gb|EFJ22061.1| hypothetical protein SELMODRAFT_443336 [Selaginella moellendorffii]
Length=413

 Score =   244 bits (623),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 177/249 (71%), Gaps = 6/249 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I CTVGVV S++      S+ +P+SDIG HFG LLE+ EGSDI F V GE FHAHK+VLA
Sbjct  161  ITCTVGVVVSSMQALRQQSLPVPESDIGRHFGALLESGEGSDITFEVDGEVFHAHKMVLA  220

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVY--tdslleddleasssssip  352
            ARSP+FR++    L +S+ + + + ++++ VF+AML+F+Y        + L +SS SS  
Sbjct  221  ARSPVFRAQLNGPLSDSNVKLLQLEDIKAPVFEAMLYFIYRDALPDASEVLSSSSYSSTS  280

Query  353  sisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLR  532
              S  +   LL AADRY L RL+ +CEA LC+D+S+++VA TLALA+ +HA +LK VCL+
Sbjct  281  LASTMMAQHLLAAADRYGLDRLRIVCEAKLCEDVSIDTVATTLALAEQHHATQLKRVCLK  340

Query  533  FAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCE---DECSSGGGKSRSVWAQLSDS  703
            FAA NLAAV+QSDGF+YLKE+CPSLQSELL+TVAG E   D+    G K RSVW  L+D 
Sbjct  341  FAASNLAAVIQSDGFDYLKESCPSLQSELLRTVAGVEGGDDDELRPGSKRRSVWTHLADG  400

Query  704  GDTDGRRVR  730
             D  GRRVR
Sbjct  401  TDGTGRRVR  409



>ref|XP_001772248.1| predicted protein [Physcomitrella patens]
 gb|EDQ62901.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   242 bits (618),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 134/250 (54%), Positives = 179/250 (72%), Gaps = 8/250 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I CTVGVV S+     M+SI +P+ D+G HFG LL++ EG+D+   V GE +HAHKLVLA
Sbjct  157  ITCTVGVVVSSTQGPRMYSIPVPELDLGEHFGALLDSGEGTDVTLEVDGELYHAHKLVLA  216

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+F+++ F  + +     I I ++E  VFKA+LHF+Y DSL +    A + S+   +
Sbjct  217  ARSPVFQAQLFGPMRDRSSGNIEIKDIEPPVFKALLHFIYRDSLPDMKELAGAPSTSILL  276

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            +      LL AADRY L RL+ +CE+ LC+++SV++VA TLALA+ +HA ELK VCL+FA
Sbjct  277  A----QHLLAAADRYGLDRLRLLCESKLCENVSVDTVATTLALAEQHHAAELKAVCLKFA  332

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAG-CEDECSSG--GGKSRSVWAQLSDSGD  709
            A NLAAVMQS+GFEYL+++CP+LQSELLKTVAG CE+   +G    ++RSVW QLSD  D
Sbjct  333  AANLAAVMQSEGFEYLRDSCPTLQSELLKTVAGVCEESVVTGVISNRNRSVWGQLSDGTD  392

Query  710  TDGRRVRQRT  739
              GRRVR RT
Sbjct  393  ASGRRVRPRT  402



>ref|XP_001783005.1| predicted protein [Physcomitrella patens]
 gb|EDQ52168.1| predicted protein [Physcomitrella patens]
Length=401

 Score =   241 bits (616),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 131/250 (52%), Positives = 177/250 (71%), Gaps = 8/250 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I CTVGVV S+     ++SI +P+ D+G HFG LL++ EG+D+ F V GE +HAHKLVLA
Sbjct  156  ITCTVGVVVSSTQGPRLYSIPVPEPDLGHHFGALLDSGEGADVKFEVDGELYHAHKLVLA  215

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+F+++ F  + + +   I I ++E  VFKA+LHF+Y DSL +      + S+   +
Sbjct  216  ARSPVFKAQLFGPMRDRNSDHIEIKDIEPPVFKALLHFIYRDSLPDTKELIGAPSTSTLL  275

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            +      LL AADRY L RL+ +CE+ LC+++SV++VA TLALA+ +HA ELK VCL+FA
Sbjct  276  A----QHLLAAADRYGLDRLRLLCESKLCENVSVDTVATTLALAEHHHAAELKAVCLKFA  331

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGG---GKSRSVWAQLSDSGD  709
            A NLAAVM S+GFEYL+++CP+LQSELLKTVAG  +E    G    ++RSVW QLSD  D
Sbjct  332  ASNLAAVMHSEGFEYLRDSCPTLQSELLKTVAGVYEEGVGTGVTSNRNRSVWGQLSDGAD  391

Query  710  TDGRRVRQRT  739
              GRRVR RT
Sbjct  392  AGGRRVRPRT  401



>gb|KDO47648.1| hypothetical protein CISIN_1g015782mg [Citrus sinensis]
Length=343

 Score =   239 bits (611),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 155/189 (82%), Gaps = 3/189 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +P+SDIGAHFGMLL+N E SDI F+VAGEKF AHKLVLA
Sbjct  153  INCTVGVVVSAIDCSRLHSIQVPESDIGAHFGMLLDNAESSDITFDVAGEKFPAHKLVLA  212

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslle---ddleasssssip  352
            ARSPIFRS+FFD LE D+QEI+IS++E KVFKAMLHF+Y D+L E    D+   SSS + 
Sbjct  213  ARSPIFRSKFFDELEEDKQEIIISDLEPKVFKAMLHFIYRDTLTEDVDVDVATPSSSCMS  272

Query  353  sisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLR  532
            S+SDTL AKLL AADRY L RL+ MC ++LCKDISVNSVAK L+LAD +HA ELK VCLR
Sbjct  273  SVSDTLTAKLLAAADRYGLERLRLMCGSHLCKDISVNSVAKILSLADEHHATELKAVCLR  332

Query  533  FAAENLAAV  559
            FAAENLA  
Sbjct  333  FAAENLAGT  341



>gb|KHN47485.1| BTB/POZ and MATH domain-containing protein 4 [Glycine soja]
Length=369

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 166/219 (76%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCT+ V+ S+ID S +++I +P+SDIG HFGMLLE+ E  D+ F+V GE+FHAHKLVLA
Sbjct  151  INCTIAVLVSSIDSSQLNTIQVPESDIGEHFGMLLEDEESFDVTFSVGGERFHAHKLVLA  210

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            ARS +F ++FF+ ++ D+QEIV+ +ME KVFKA+LHFVY    L +++L    SS  PS+
Sbjct  211  ARSTMFETQFFNAMKKDDQEIVVIDMEPKVFKALLHFVYRDTLLEDEELFMLDSSFFPSL  270

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S++  AKLL A ++Y L RL  MCE+ LCKDISV+SVA   ALAD Y A  LK++C +F+
Sbjct  271  SESFIAKLLAAGEKYGLPRLMLMCESILCKDISVDSVAYIFALADRYCATHLKSMCQKFS  330

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECS  655
            AEN  A+M SDGFEYLK+NCP LQSELLKT  GCE E S
Sbjct  331  AENFDAMMHSDGFEYLKKNCPLLQSELLKTGVGCEKEFS  369



>ref|XP_001776409.1| predicted protein [Physcomitrella patens]
 gb|EDQ58793.1| predicted protein [Physcomitrella patens]
Length=396

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/250 (51%), Positives = 176/250 (70%), Gaps = 8/250 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I CTVGVV S+     ++SI +P+ D+G HFG LL++ EG+D+ F V GE + AHK+VLA
Sbjct  151  ITCTVGVVVSSTQGPRLYSIPVPEPDLGQHFGALLDSGEGADVTFEVDGEVYQAHKMVLA  210

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+F+++ F  + + +   I I ++E  VFKA+LHF+Y DSL +      + S+   +
Sbjct  211  ARSPVFKAQLFGPMRDRNSGNIEIEDVEPPVFKALLHFIYRDSLPDTKELIRAPSTSILL  270

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            +      LL AADRY L RL+ +CE+ LC+++SV++VA TLALA+ +HA ELK VCL+FA
Sbjct  271  A----QHLLAAADRYGLDRLRLLCESKLCENVSVDTVATTLALAEQHHAAELKAVCLKFA  326

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGG---GKSRSVWAQLSDSGD  709
            A NLAAVM S+GFEYL+++CP+LQSELLKTVAG  +E    G    ++RSVW Q+SD  D
Sbjct  327  ASNLAAVMHSEGFEYLRDSCPTLQSELLKTVAGVYEEGVGTGVISNRNRSVWGQMSDGAD  386

Query  710  TDGRRVRQRT  739
              GRRVR RT
Sbjct  387  AGGRRVRPRT  396



>ref|XP_003555034.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Glycine max]
Length=378

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 165/219 (75%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCT+ V+ S+ID S +++I +P+SDIG HFGMLLE+ E  D+ F V GE+FHAHKLVLA
Sbjct  160  INCTIVVLVSSIDSSQLNTIQVPESDIGEHFGMLLEDEESFDVTFLVGGERFHAHKLVLA  219

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            A+S +F ++FF+ ++ D+QEIV+ +ME KVFKA+LHFVY    L +++L    SS  PS+
Sbjct  220  AQSTMFETQFFNAMKKDDQEIVVIDMEPKVFKALLHFVYRDTLLEDEELFMLDSSFFPSL  279

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S++  AKLL A ++Y L RL  MCE+ LCKDISV+SVA   ALAD Y A  LK++C +F+
Sbjct  280  SESFIAKLLAAGEKYGLPRLMLMCESILCKDISVDSVAYIFALADRYRATHLKSICQKFS  339

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECS  655
            AEN  A+M SDGFEYLK+NCP LQSELLKT  GCE + S
Sbjct  340  AENFDAMMHSDGFEYLKKNCPLLQSELLKTGVGCEKQFS  378



>ref|XP_008789447.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Phoenix dactylifera]
Length=348

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 159/193 (82%), Gaps = 2/193 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +D   +HSI +P+SDIG HFGMLL+  EGSD++F+VAGEKFHAHKLVLA
Sbjct  158  INCTVGVVLSVMDSPRLHSIQVPESDIGMHFGMLLDKQEGSDVVFDVAGEKFHAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+FR++FFD L+ ++ EIV+++ME KVF+AMLHF+Y D+ +EDD   +SSS   S+S
Sbjct  218  ARSPVFRAQFFDELDCEKNEIVVTDMEPKVFEAMLHFIYRDTFVEDDALMASSSPASSVS  277

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTLP KLL AAD+Y L RL+ MCE+YLCKDISVNSVA TLALAD +HAMELK  CL+FAA
Sbjct  278  DTLPGKLLAAADKYGLERLQLMCESYLCKDISVNSVASTLALADQHHAMELKAACLKFAA  337

Query  542  ENLAAVMQSDGFE  580
            ENLA   + DG++
Sbjct  338  ENLAG--RYDGWK  348



>ref|XP_010918009.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Elaeis guineensis]
Length=348

 Score =   234 bits (597),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +D   +HSI +P+SDIG HFGMLL+  EGSD++F+VAGEKFHAHKLVLA
Sbjct  158  INCTVGVVVSVMDSPRLHSIQVPESDIGMHFGMLLDKQEGSDVVFDVAGEKFHAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+FR++FFD L+ ++ EIV+++ME KVF+AMLHF+Y D+ +EDD   +SSS + S+S
Sbjct  218  ARSPVFRAQFFDELDCEKNEIVVTDMEPKVFEAMLHFIYRDTFVEDDALIASSSPVSSVS  277

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL  KLL AAD+Y L RL+ MCE+YLCKDISVNSVA TLALAD +HAMELK  CL+FAA
Sbjct  278  DTLAGKLLAAADKYGLERLQLMCESYLCKDISVNSVASTLALADRHHAMELKAACLKFAA  337

Query  542  ENLAA  556
            ENLA 
Sbjct  338  ENLAG  342



>ref|XP_010266709.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X2 [Nelumbo nucifera]
Length=352

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 158/197 (80%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +PDSDIG HFG LLEN EGSDI+FNV G+KF+AHKLVLA
Sbjct  156  INCTVGVVVSAIDCSRLHSIQVPDSDIGDHFGTLLENQEGSDIVFNVDGDKFYAHKLVLA  215

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtds------lleddleasss  340
            ARSP+FR+EFFDGL E D+ EI+I++ME KVFKA+LHF+Y D+      L+  +   SSS
Sbjct  216  ARSPVFRAEFFDGLEEEDKHEIIITDMEPKVFKALLHFIYRDTLIDDEELVPSNSSTSSS  275

Query  341  ssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKT  520
            S +  +S+TL AKLL AAD+Y L RL+ MCE+YLCKDISVNSVAKTLALAD YHAMELK 
Sbjct  276  SCVSPVSETLAAKLLAAADKYGLARLRLMCESYLCKDISVNSVAKTLALADRYHAMELKA  335

Query  521  VCLRFAAENLAAVMQSD  571
            VCL+FAAENL     ++
Sbjct  336  VCLKFAAENLGGTYPTN  352



>ref|XP_008811723.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X2 [Phoenix dactylifera]
Length=359

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +D   +HSI +P+SDIG HFGMLL+  EGSD++F+VAGEKFHAHKLVLA
Sbjct  158  INCTVGVVVSVMDSPRLHSIQVPESDIGMHFGMLLDKQEGSDVVFDVAGEKFHAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+FR++FFD L+ +E EIV+++ME KVF+AMLHF+Y D+ +EDD   +SSS   S+S
Sbjct  218  ARSPMFRAQFFDELDCEESEIVVTDMEPKVFEAMLHFIYRDTFIEDDALVASSSPESSMS  277

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL  KLL AAD+Y L RL+ MCE+YLCKD+SV+SVA TL+LAD YHAMELK  CL+FAA
Sbjct  278  DTLAGKLLAAADKYGLERLRLMCESYLCKDMSVDSVASTLSLADRYHAMELKAACLKFAA  337

Query  542  ENLAAV  559
            ENL  V
Sbjct  338  ENLPGV  343



>ref|XP_002970063.1| hypothetical protein SELMODRAFT_267336 [Selaginella moellendorffii]
 ref|XP_002985255.1| hypothetical protein SELMODRAFT_121807 [Selaginella moellendorffii]
 gb|EFJ13749.1| hypothetical protein SELMODRAFT_121807 [Selaginella moellendorffii]
 gb|EFJ29187.1| hypothetical protein SELMODRAFT_267336 [Selaginella moellendorffii]
Length=405

 Score =   234 bits (597),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 171/248 (69%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I CTVGVV S    + ++SI  P+ DIG HFG L E+ EG+D+ F+  GE F AHKLVLA
Sbjct  160  ITCTVGVVMSWTQVTKIYSIQPPEQDIGKHFGALFESGEGADLTFDADGETFKAHKLVLA  219

Query  182  ARSPIFRSEFFDGLESDEQEIV-ISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+F+++    L     +++ + ++ + VFKAML F+YTD+L +    +  SSS    
Sbjct  220  ARSPVFKAQLMGPLRERTSDVLRVEDILAPVFKAMLQFMYTDALPDTAELSGVSSSSSPT  279

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CEA LC+ +SV++VA TLALA+ +HA +LK VCL++A
Sbjct  280  LLYQ--HLLAAADRYGLDRLRLLCEAKLCETVSVDTVATTLALAELHHASQLKGVCLKYA  337

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSG-GGKSRSVWAQLSDSGDTD  715
            A+NL+AVMQS+G++YL+E+CP L  +LLKTVAG   +   G GGK   +W QLSD GD +
Sbjct  338  ADNLSAVMQSEGYDYLRESCPVLLFDLLKTVAGVGKDLFVGSGGKGGYIWGQLSDGGDVN  397

Query  716  GRRVRQRT  739
            GRRVRQ+T
Sbjct  398  GRRVRQKT  405



>ref|XP_006604026.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Glycine max]
Length=375

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 165/219 (75%), Gaps = 4/219 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCT+ V+ S+ID S +++I +P+SDIG HFGMLLE+ E  D+ F+V GE+FHAHKLVLA
Sbjct  160  INCTIAVLVSSIDSSQLNTIQVPESDIGEHFGMLLEDEESFDVTFSVGGERFHAHKLVLA  219

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleass-sssipsi  358
            ARS +F ++FF+ L+ D+QEIV+ +ME K   A+LHFVY D+LLED+      SS  PS+
Sbjct  220  ARSTMFETQFFNALKKDDQEIVVIDMEPK---ALLHFVYRDTLLEDEELFMLDSSFFPSL  276

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S++  AKLL A ++Y L RL  MCE+ LCKDISV+SVA   ALAD Y A  LK++C +F+
Sbjct  277  SESFIAKLLAAGEKYGLPRLMLMCESILCKDISVDSVAYIFALADRYCATHLKSICQKFS  336

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECS  655
            AEN  AVM SDGFEYLK+NCP LQSELLKT  GCE E S
Sbjct  337  AENFDAVMHSDGFEYLKKNCPLLQSELLKTGVGCEKEFS  375



>ref|XP_006604020.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Glycine max]
Length=375

 Score =   230 bits (587),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 165/219 (75%), Gaps = 4/219 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCT+ V+ S+ID S +++I +P+SDIG HFGMLLE+ E  D+ F+V GE+FHAHKLVLA
Sbjct  160  INCTIAVLVSSIDSSQLNTIQVPESDIGEHFGMLLEDEESFDVTFSVGGERFHAHKLVLA  219

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleass-sssipsi  358
            ARS +F ++FF+ ++ D+QEIV+ +ME K   A+LHFVY D+LLED+      SS  PS+
Sbjct  220  ARSTMFETQFFNAMKKDDQEIVVIDMEPK---ALLHFVYRDTLLEDEELFMLDSSFFPSL  276

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S++  AKLL A ++Y L RL  MCE+ LCKDISV+SVA   ALAD Y A  LK++C +F+
Sbjct  277  SESFIAKLLAAGEKYGLPRLMLMCESILCKDISVDSVAYIFALADRYCATHLKSICQKFS  336

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECS  655
            AEN  AVM SDGFEYLK+NCP LQSELLKT  GCE E S
Sbjct  337  AENFDAVMHSDGFEYLKKNCPLLQSELLKTGVGCEKEFS  375



>ref|XP_010921384.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Elaeis guineensis]
Length=357

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +D   +HSI +P+SDIG HFGMLL+  EGSD++F+VAGEKFHAHKLVLA
Sbjct  158  INCTVGVVVSVMDSPRLHSIQVPESDIGMHFGMLLDKQEGSDVVFDVAGEKFHAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARS +FR++FFD L+ ++ EIV+++ME KVF+AMLHF+Y D+ +EDD+  +SSS + S+S
Sbjct  218  ARSAVFRAQFFDELDCEKSEIVVTDMEPKVFEAMLHFIYRDTFIEDDVLVASSSPVSSMS  277

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            DTL  KLL AAD+Y L RL+ MCE+YLCKD+SV+SVA TL+LAD YHA+ELK  CL+FAA
Sbjct  278  DTLAGKLLAAADKYGLERLRLMCESYLCKDMSVDSVASTLSLADRYHALELKAACLKFAA  337

Query  542  ENLAAV  559
            ENLA V
Sbjct  338  ENLAGV  343



>ref|XP_010412486.1| PREDICTED: BTB/POZ and MATH domain-containing protein 6 [Camelina 
sativa]
Length=392

 Score =   228 bits (580),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 179/250 (72%), Gaps = 24/250 (10%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S I C  +HSIH+PDS++G+ FG LL+ +EGSD+ F++AGEKF AHKLVLA
Sbjct  162  INCTVGVVVSEIHCPRLHSIHVPDSELGSDFGKLLDTLEGSDVKFDIAGEKFQAHKLVLA  221

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARS                    S++E KVFKA+LHF+Y DSL  D    ++ S     +
Sbjct  222  ARS--------------------SDLEPKVFKALLHFMYKDSLSGDVEPVTAHSFGLLKL  261

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
              I +TL  KLL AA +Y+L RL+ +CE+++CK +S++SV+K LAL+D Y+A ELK+V L
Sbjct  262  SEIDETLIVKLLAAATKYNLSRLRSLCESHICKAVSISSVSKILALSDRYNATELKSVSL  321

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGD  709
             FAAENLAAV+Q+  +E +K++ P+LQSELLK VAG ++  SSGGGKS+SVW QLSD G+
Sbjct  322  NFAAENLAAVLQTKAYEDVKDDYPNLQSELLKAVAGYDETSSSGGGKSQSVWGQLSDGGE  381

Query  710  TDGRRVRQRT  739
            T  RR+RQRT
Sbjct  382  TSSRRLRQRT  391



>ref|XP_006604027.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Glycine max]
Length=371

 Score =   227 bits (579),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 164/219 (75%), Gaps = 4/219 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCT+ V+ S+ID S +++I +P+SDIG HFGMLLE+ E  D+ F+V GE+FHAHKLVLA
Sbjct  156  INCTIAVLVSSIDSSQLNTIQVPESDIGEHFGMLLEDEESFDVTFSVGGERFHAHKLVLA  215

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleass-sssipsi  358
            ARS +F ++FF+ ++ D+QEIV+ +ME K   A+LHFVY D+LLED+      SS  PS+
Sbjct  216  ARSTMFETQFFNAMKKDDQEIVVIDMEPK---ALLHFVYRDTLLEDEELFMLDSSFFPSL  272

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S++  AKLL A ++Y L RL  MCE+ LCKDISV+SVA   ALAD Y A  LK++C +F+
Sbjct  273  SESFIAKLLAAGEKYGLPRLMLMCESILCKDISVDSVAYIFALADRYCATHLKSICQKFS  332

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECS  655
            AEN  AVM SDGFEYLK+N P LQSELLKT  GCE E S
Sbjct  333  AENFDAVMHSDGFEYLKKNWPLLQSELLKTGVGCEKEFS  371



>ref|XP_008442028.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X2 [Cucumis melo]
Length=366

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 154/189 (81%), Gaps = 1/189 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S ID S +HSIH+P+SDIGAHFG LLEN EGSDI FNV+GEKF AHKLVLA
Sbjct  153  INCTVGVVVSGIDSSRLHSIHVPESDIGAHFGTLLENEEGSDITFNVSGEKFRAHKLVLA  212

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddl-easssssipsi  358
            ARSP+F ++F + +E D  EI+I+ ME +VFKA+LHF+Y D+L EDD    +SSSS+PS+
Sbjct  213  ARSPVFENDFVNMMEEDNDEILITEMEPRVFKALLHFIYRDTLPEDDEFLEASSSSVPSL  272

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
             D+LPAKLL AAD+YDL RL+ MCE+ LCKDISVNSV+  LALAD YHA +LK+VCL+F 
Sbjct  273  PDSLPAKLLAAADKYDLPRLRLMCESVLCKDISVNSVSHILALADLYHAADLKSVCLKFT  332

Query  539  AENLAAVMQ  565
            AENL  + Q
Sbjct  333  AENLVGLRQ  341



>gb|AAK68819.1| Unknown protein [Arabidopsis thaliana]
Length=429

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 176/228 (77%), Gaps = 4/228 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S I C  +HS+H+PDS++G+HFG+LL++MEGSDI FN+AGEKF AHKLVLA
Sbjct  158  INCTVGVVVSEILCPQLHSVHVPDSELGSHFGVLLDSMEGSDITFNIAGEKFLAHKLVLA  217

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARSP F+S+FF   E++  E+ I+++E KVFKA+L F+Y DSL ED   A++ +     +
Sbjct  218  ARSPFFKSKFFSEFEANNTEVTINDLEPKVFKALLQFMYKDSLPEDVEPATAHTFERLKL  277

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
              I +TL  K+L AAD+YDL RL+ +CE+++CK +SV SVAK LALAD Y+A ELK VCL
Sbjct  278  SEIYETLIVKVLAAADKYDLIRLRLLCESHICKGVSVKSVAKILALADRYNAKELKGVCL  337

Query  530  RFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKS  673
            +F AENLAAV+++D ++ +K+ C +LQSELLK VAG E+  +S G +S
Sbjct  338  KFTAENLAAVLETDAYQQMKDECVTLQSELLKAVAGHEEGSNSTGEQS  385



>ref|XP_010653194.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and MATH domain-containing 
protein 4 [Vitis vinifera]
Length=367

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 156/189 (83%), Gaps = 1/189 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +H I +PDSDIGAHFGMLLEN EGSD+IF+V+GEKFHAHKLVLA
Sbjct  156  INCTVGVVVSAIDCSRLHPIQVPDSDIGAHFGMLLENEEGSDVIFDVSGEKFHAHKLVLA  215

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssss-ipsi  358
            ARSPIF SEF +G E D+QEIV+ +M+ K+FKA+LHF+Y DSL+ED+   +S SS + S 
Sbjct  216  ARSPIFESEFINGPEDDKQEIVVKDMDPKIFKAVLHFIYRDSLIEDEELLTSGSSCMVSE  275

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SDT+ AKLL AAD+Y L RL+ MCEA LCKDISVNSV+K LALAD YHAM+LK VCL+FA
Sbjct  276  SDTIAAKLLAAADKYGLTRLRLMCEALLCKDISVNSVSKILALADRYHAMDLKAVCLKFA  335

Query  539  AENLAAVMQ  565
            AENL    Q
Sbjct  336  AENLVGGPQ  344



>ref|XP_007029996.1| BTB-POZ and MATH domain 4 isoform 2 [Theobroma cacao]
 gb|EOY10498.1| BTB-POZ and MATH domain 4 isoform 2 [Theobroma cacao]
Length=357

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 155/189 (82%), Gaps = 1/189 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +H I +P+SDIGAHFGMLLEN EGSDI FNV GEKFHAHKLVLA
Sbjct  149  INCTVGVVVSEIDCPRLHPIQVPESDIGAHFGMLLENEEGSDITFNVFGEKFHAHKLVLA  208

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssss-ipsi  358
            +RSP+F +EF D +E D  EIV+++ME KVFKA+LHF+Y D+L++D+    +SSS +PS+
Sbjct  209  SRSPVFEAEFSDRMEEDNNEIVVTDMEPKVFKALLHFIYRDTLIDDEEFLGTSSSCMPSV  268

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SD L +KLL AAD+YDL RL+ MCE+ LCKDISVNSVA  LALAD YHAM+LK+VCL+FA
Sbjct  269  SDALASKLLAAADKYDLPRLRLMCESVLCKDISVNSVANILALADRYHAMDLKSVCLKFA  328

Query  539  AENLAAVMQ  565
            AENL  V +
Sbjct  329  AENLVGVPE  337



>ref|XP_006604030.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=375

 Score =   225 bits (573),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 164/219 (75%), Gaps = 4/219 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCT+ V+ S+ID S +++I +P+SDIG HFGMLLE+ E  D+ F V GE+FHAHKLVLA
Sbjct  160  INCTIVVLVSSIDSSQLNTIQVPESDIGEHFGMLLEDEESFDVTFLVGGERFHAHKLVLA  219

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleass-sssipsi  358
            A+S +F ++FF+ ++ D+QEIV+ +ME K   A+LHFVY D+LLED+      SS  PS+
Sbjct  220  AQSTMFETQFFNAMKKDDQEIVVIDMEPK---ALLHFVYRDTLLEDEELFMLDSSFFPSL  276

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S++  AKLL A ++Y L RL  MCE+ LCKDISV+SVA   ALAD Y A  LK++C +F+
Sbjct  277  SESFIAKLLAAGEKYGLPRLMLMCESILCKDISVDSVAYIFALADRYRATHLKSICQKFS  336

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECS  655
            AEN  A+M SDGFEYLK+NCP LQSELLKT  GCE + S
Sbjct  337  AENFDAMMHSDGFEYLKKNCPLLQSELLKTGVGCEKQFS  375



>ref|XP_006479174.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X3 [Citrus sinensis]
Length=359

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 156/190 (82%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +P+SDIG HFGMLLEN E SDI FNVAGEKFHAHKLVLA
Sbjct  160  INCTVGVVVSAIDCSRLHSIQVPESDIGDHFGMLLENEESSDITFNVAGEKFHAHKLVLA  219

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslled-dleasssssipsi  358
            ARSP+F +EF D +E D  EIV+++ME KVFKA+LHF+Y D+L+ED +  ASSSS +PS+
Sbjct  220  ARSPVFETEFLDAMEEDNHEIVVTDMEPKVFKALLHFIYKDTLIEDGECSASSSSCVPSV  279

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SDTL AKLL AA++Y L RL+ MCE+ LCK ISVNSVA TLALAD + AM+LK+VCL+FA
Sbjct  280  SDTLEAKLLAAAEKYVLPRLRLMCESVLCKVISVNSVAHTLALADRHCAMDLKSVCLKFA  339

Query  539  AENLAAVMQS  568
            AENL   + S
Sbjct  340  AENLVGGLGS  349



>gb|KCW47782.1| hypothetical protein EUGRSUZ_K01525 [Eucalyptus grandis]
Length=359

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 147/188 (78%), Gaps = 1/188 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDC  +HSI +P+SDIGAHFG LLE  EGSD+ FNV+GEKFHAHKLVLA
Sbjct  156  INCTVGVVVSEIDCPRLHSIQVPESDIGAHFGFLLEKEEGSDVTFNVSGEKFHAHKLVLA  215

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARSP+F SEF + +E D  E++IS+ME  VF+A+LHF+Y    L++D E S  S+  S S
Sbjct  216  ARSPVFESEFLNAMEEDSDEVIISDMEPTVFQALLHFIY-KDTLDEDEELSIPSAFCSPS  274

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
            +   AKLL AADRY+L RLK +CE+ LCK ISV+SVA+ LALA+ +HAM+LK++CL+FAA
Sbjct  275  EMPVAKLLAAADRYNLPRLKLICESILCKGISVDSVARILALAEQHHAMDLKSICLKFAA  334

Query  542  ENLAAVMQ  565
            ENL +  Q
Sbjct  335  ENLLSCAQ  342



>gb|KDO66065.1| hypothetical protein CISIN_1g013880mg [Citrus sinensis]
Length=359

 Score =   222 bits (566),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +P+SDIG HFGMLLEN E SDI FNV GEKFHAHKLVLA
Sbjct  160  INCTVGVVVSAIDCSRLHSIQVPESDIGDHFGMLLENEESSDITFNVVGEKFHAHKLVLA  219

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslled-dleasssssipsi  358
            ARSP+F +EF D +E D  EIV+++ME KVFKA+LHF+Y D+L+ED +  ASSSS +PS+
Sbjct  220  ARSPVFETEFLDAMEEDNHEIVVTDMEPKVFKALLHFIYKDTLIEDGECSASSSSCVPSV  279

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SDTL AKLL AA++Y L RL+ MCE+ LCK ISVNSVA TLALAD + AM+LK+VCL+FA
Sbjct  280  SDTLEAKLLAAAEKYVLPRLRLMCESVLCKVISVNSVAHTLALADRHCAMDLKSVCLKFA  339

Query  539  AENLAAVMQS  568
            AENL   + S
Sbjct  340  AENLVGGLGS  349



>ref|XP_009353081.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Pyrus x bretschneideri]
Length=375

 Score =   223 bits (567),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 164/222 (74%), Gaps = 7/222 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S ID S +HSIH+PDSDIG HFGMLLEN EGSD+ FNV GE+FHAHKLVLA
Sbjct  156  INCTVGVVVSAIDSSRLHSIHVPDSDIGDHFGMLLENEEGSDVTFNVCGERFHAHKLVLA  215

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssss-ipsi  358
            ARSP+F  EFFDG++ +  ++V+++ + KVFKA+LHF+YTD+L+ED+  + +SS  + S+
Sbjct  216  ARSPLFEKEFFDGMKEENHDVVVTDTDPKVFKALLHFIYTDNLIEDEELSDASSLCMSSL  275

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SD L AKLL A+D+Y L RL+ MCE+ LCK +SVNSVA  LALAD Y AM+LK+VCL+FA
Sbjct  276  SDGLAAKLLAASDKYGLPRLRLMCESVLCKIMSVNSVAIILALADRYRAMDLKSVCLKFA  335

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELL----KTVAGCEDEC  652
            AENL  +++    +  +   PS    +L    KT   C   C
Sbjct  336  AENLVGILKI--LKTWESRMPSWNRMVLSISRKTAHCCSRSC  375



>gb|KDO66066.1| hypothetical protein CISIN_1g013880mg [Citrus sinensis]
Length=368

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 157/194 (81%), Gaps = 2/194 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +P+SDIG HFGMLLEN E SDI FNV GEKFHAHKLVLA
Sbjct  160  INCTVGVVVSAIDCSRLHSIQVPESDIGDHFGMLLENEESSDITFNVVGEKFHAHKLVLA  219

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslled-dleasssssipsi  358
            ARSP+F +EF D +E D  EIV+++ME KVFKA+LHF+Y D+L+ED +  ASSSS +PS+
Sbjct  220  ARSPVFETEFLDAMEEDNHEIVVTDMEPKVFKALLHFIYKDTLIEDGECSASSSSCVPSV  279

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SDTL AKLL AA++Y L RL+ MCE+ LCK ISVNSVA TLALAD + AM+LK+VCL+FA
Sbjct  280  SDTLEAKLLAAAEKYVLPRLRLMCESVLCKVISVNSVAHTLALADRHCAMDLKSVCLKFA  339

Query  539  AENLAAV-MQSDGF  577
            AENL  +  Q D F
Sbjct  340  AENLVGMSFQFDLF  353



>gb|KEH28339.1| BTB/POZ/MATH-domain protein [Medicago truncatula]
Length=350

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 147/187 (79%), Gaps = 1/187 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +DC  ++SIH+P+SDIG+HFG LLEN EGSD+ F+VAGEKF  HKLVLA
Sbjct  161  INCTVGVVVSAVDCPQLNSIHVPESDIGSHFGALLENNEGSDVTFDVAGEKFPGHKLVLA  220

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssip-si  358
            ARSP FRS+FFDG + D QE+V++++E KVFKAMLHF+Y DSL E+    SS++S    +
Sbjct  221  ARSPEFRSKFFDGTDMDTQEVVVTDLEPKVFKAMLHFIYRDSLTEEVDMVSSTTSSDFPV  280

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL AKLL AAD+Y L RL+ MCE+ LCKDI V+SVA  L LAD  HA ELK VCL+FA
Sbjct  281  SETLIAKLLGAADKYGLERLRLMCESRLCKDIGVSSVANILTLADHCHATELKAVCLKFA  340

Query  539  AENLAAV  559
             +NLA +
Sbjct  341  TQNLAGI  347



>gb|KEH28340.1| BTB/POZ/MATH-domain protein [Medicago truncatula]
Length=348

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 147/187 (79%), Gaps = 1/187 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +DC  ++SIH+P+SDIG+HFG LLEN EGSD+ F+VAGEKF  HKLVLA
Sbjct  161  INCTVGVVVSAVDCPQLNSIHVPESDIGSHFGALLENNEGSDVTFDVAGEKFPGHKLVLA  220

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssip-si  358
            ARSP FRS+FFDG + D QE+V++++E KVFKAMLHF+Y DSL E+    SS++S    +
Sbjct  221  ARSPEFRSKFFDGTDMDTQEVVVTDLEPKVFKAMLHFIYRDSLTEEVDMVSSTTSSDFPV  280

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+TL AKLL AAD+Y L RL+ MCE+ LCKDI V+SVA  L LAD  HA ELK VCL+FA
Sbjct  281  SETLIAKLLGAADKYGLERLRLMCESRLCKDIGVSSVANILTLADHCHATELKAVCLKFA  340

Query  539  AENLAAV  559
             +NLA +
Sbjct  341  TQNLAVI  347



>ref|XP_009787612.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Nicotiana sylvestris]
Length=407

 Score =   221 bits (563),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 166/252 (66%), Gaps = 17/252 (7%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            + CTVGVVRS  +    +S+ +P SDIG+HFG LLE+ EG+DI F V GE F AHKLVLA
Sbjct  164  VQCTVGVVRSYNETPKTYSLPVPPSDIGSHFGQLLESGEGADIKFEVEGEVFAAHKLVLA  223

Query  182  ARSPIFRSEFFDGLESDE-QEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  L+ D  Q I +  +++ VFKA+LHF+Y D+L +        +     
Sbjct  224  ARSPVFRAQLFGPLKEDNVQSIKVEEIQAPVFKALLHFIYWDALPDLQELVGLDTKWAVT  283

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AAD+Y L RL+ +CEA LC+D+++N+VA TLALAD +H ++LK+VCL+F 
Sbjct  284  LMAQ--HLLAAADQYGLERLRALCEAKLCEDVTINTVATTLALADQHHCVQLKSVCLKFI  341

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDEC----SSGGGKSRSVWAQLSD  700
            A  ENL AVMQS+GF++LKE+CPS+ +ELLK VAG  +        GG         + D
Sbjct  342  ALPENLKAVMQSEGFDHLKESCPSVITELLKYVAGMNEHAIISYVHGG--------HILD  393

Query  701  SGDTDGRRVRQR  736
              D +GRRV+QR
Sbjct  394  GTDVNGRRVKQR  405



>emb|CDP03595.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   221 bits (563),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 126/252 (50%), Positives = 170/252 (67%), Gaps = 16/252 (6%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C VGVVRS  +   ++SI +P SDIG HFG LLE  +G+D+ F V GEKF AHKLVLA
Sbjct  166  VHCCVGVVRSQTEGPKIYSIPLPPSDIGQHFGQLLECGKGTDVNFEVNGEKFSAHKLVLA  225

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  + + D Q I + +ME+ VFKA+LHF+Y D L + +     +S   + 
Sbjct  226  ARSPVFRAQLFGPMKDHDTQCIRVEDMEAPVFKALLHFIYWDCLPDMEELTGLNSKGATS  285

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CEA LC+D+++N+VA TLALA+ +H  +LK+VCL+F 
Sbjct  286  LMAQ--HLLAAADRYGLDRLRLICEANLCEDVAINTVATTLALAEQHHCFQLKSVCLKFV  343

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLS----D  700
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA   +        S SV  QL+    D
Sbjct  344  AMPENLRAVMQTDGFEYLKESCPSVLTELLEYVARINEH-------SVSVNKQLTDGILD  396

Query  701  SGDTDGRRVRQR  736
              D +GRRV+QR
Sbjct  397  GSDVNGRRVKQR  408



>ref|XP_010093790.1| BTB/POZ and MATH domain-containing protein 4 [Morus notabilis]
 gb|EXB54641.1| BTB/POZ and MATH domain-containing protein 4 [Morus notabilis]
Length=401

 Score =   220 bits (560),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +DC  +H+I +P+SD+GA FGMLLENMEGSDI F+VAGEKFHAHKLVLA
Sbjct  152  INCTVGVVVSAVDCPRLHTIQVPESDMGAQFGMLLENMEGSDITFDVAGEKFHAHKLVLA  211

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            ARSPIFRS+FF+GLE  ++E+ ++++E KVFKAMLHF+Y    + + +LE SSSS +  +
Sbjct  212  ARSPIFRSKFFEGLEETKEEVEVTDVEPKVFKAMLHFIYRDSLIEDVELETSSSSPVSLV  271

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            SD+L AKLL AADRY L RL+ MCE++LCKDISV SVA+ LALA+ Y+A +LK VCLRF 
Sbjct  272  SDSLTAKLLAAADRYGLERLRVMCESHLCKDISVKSVAEILALAERYNASDLKAVCLRFT  331

Query  539  AENLAA  556
            AENLA 
Sbjct  332  AENLAG  337



>ref|XP_009621647.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Nicotiana tomentosiformis]
Length=407

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/252 (49%), Positives = 164/252 (65%), Gaps = 17/252 (7%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            + CTVGVVRS  +     S+ +P SDIG HFG LLE+ EG+DI F V GE F AHKLVLA
Sbjct  164  VQCTVGVVRSYNETPKTFSLPVPPSDIGIHFGQLLESGEGADIKFEVEGEVFAAHKLVLA  223

Query  182  ARSPIFRSEFFDGLESDE-QEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  L+ D  Q I +  +++ VFKA+LHF+Y DSL +        +     
Sbjct  224  ARSPVFRAQLFGPLKEDNVQSIKVEEIQAPVFKALLHFIYWDSLPDLQELVGLDTKWAVT  283

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AAD+Y L RL+ +CEA LC+D+++N+VA TLALAD +H ++LK+VCL+F 
Sbjct  284  LMAQ--HLLAAADQYGLERLRALCEAKLCEDVTINTVATTLALADQHHCVQLKSVCLKFI  341

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDEC----SSGGGKSRSVWAQLSD  700
            A  ENL AVMQS+GF++LKE+CPS+ +ELLK VAG  +        GG         + D
Sbjct  342  ALPENLKAVMQSEGFDHLKESCPSVITELLKYVAGMNEHAIISYVHGG--------HILD  393

Query  701  SGDTDGRRVRQR  736
              D +GRRV+QR
Sbjct  394  GTDVNGRRVKQR  405



>ref|XP_006443497.1| hypothetical protein CICLE_v10020215mg [Citrus clementina]
 ref|XP_006443498.1| hypothetical protein CICLE_v10020215mg [Citrus clementina]
 gb|ESR56737.1| hypothetical protein CICLE_v10020215mg [Citrus clementina]
 gb|ESR56738.1| hypothetical protein CICLE_v10020215mg [Citrus clementina]
Length=370

 Score =   217 bits (552),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 154/189 (81%), Gaps = 6/189 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S IDCS +HSI +P+SDIG HFGMLLEN E SDI FNVAGEKFHAHKLVLA
Sbjct  160  INCTVGVVVSAIDCSRLHSIQVPESDIGDHFGMLLENEESSDITFNVAGEKFHAHKLVLA  219

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFK-----AMLHFVYtdslled-dleassss  343
            ARSP+F +EF D +E D  EIV+++ME KVFK     A+LHF+Y D+L+ED +  ASSSS
Sbjct  220  ARSPVFETEFLDAMEEDNHEIVVTDMEPKVFKHVNRQALLHFIYKDTLIEDGECSASSSS  279

Query  344  sipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTV  523
             +PS+SDTL AKLL AA++Y L RL+ MCE+ LCK ISVNSVA TLALAD + AM+LK+V
Sbjct  280  CVPSVSDTLEAKLLAAAEKYVLPRLRLMCESVLCKVISVNSVAHTLALADRHCAMDLKSV  339

Query  524  CLRFAAENL  550
            CL+FAAENL
Sbjct  340  CLKFAAENL  348



>gb|KEH23724.1| BTB/POZ/MATH-domain protein [Medicago truncatula]
Length=410

 Score =   218 bits (554),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 167/248 (67%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            +NC+VGVVRS  +   ++SI IP S+IG  FG LLEN +GSD+ F V GE F AHKLVLA
Sbjct  167  VNCSVGVVRSRTEGPKIYSIAIPPSNIGHQFGQLLENGKGSDVSFEVDGEVFTAHKLVLA  226

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  + +   Q I + +ME+ VFKA+LHF+Y DSL +       ++   + 
Sbjct  227  ARSPVFRAQLFGPMRDQSTQSIKVEDMEAPVFKALLHFMYWDSLPDMQELTGMNTKWATT  286

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CEA LC+D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  287  LMAQ--HLLAAADRYALERLRLICEASLCEDVAINTVATTLALAEQHHCFQLKAVCLKFI  344

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA    E S    K R+    + D  D 
Sbjct  345  ATSENLRAVMQTDGFEYLKESCPSVLTELLEYVARF-TEHSDFLCKHRN--EAILDGSDI  401

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  402  NGRRVKQR  409



>ref|XP_006339418.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006339419.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X2 [Solanum tuberosum]
Length=407

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 164/252 (65%), Gaps = 17/252 (7%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I CTVGVVRS  +     S+ +P SDIG HFGMLLE+ EG+DI F V GE F AHKLVLA
Sbjct  164  IQCTVGVVRSYNETPKTFSLPVPPSDIGLHFGMLLESGEGADIKFEVEGEVFAAHKLVLA  223

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+ R++ F  L E + Q I +  +++ VFKA+LHF+Y D+L +        +     
Sbjct  224  ARSPVLRAQLFGPLKEENVQSIRVEEIQAPVFKALLHFIYWDALPDLQELVGLDTKWAVA  283

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AAD+Y L RL+ +CEA LC+D+++N+VA TLALAD +H ++LK+VCL+F 
Sbjct  284  LMAQ--HLLAAADQYGLERLRALCEAKLCEDVTINTVATTLALADQHHCVQLKSVCLKFI  341

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDEC----SSGGGKSRSVWAQLSD  700
            A  ENL AVMQS+GF++L+E+CPS+ +ELLK VAG  +        GG         + D
Sbjct  342  ALPENLKAVMQSEGFDHLRESCPSVITELLKYVAGMNEHAIISYVHGG--------HILD  393

Query  701  SGDTDGRRVRQR  736
              D +GRRV+QR
Sbjct  394  GTDVNGRRVKQR  405



>gb|EYU46623.1| hypothetical protein MIMGU_mgv1a007354mg [Erythranthe guttata]
Length=410

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 168/248 (68%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C VGVV+S  +   ++SI +P SDIG HFG LLE+ +GSD+ F+V GE F AHKLVLA
Sbjct  167  VHCCVGVVKSHTEGPKIYSIPLPPSDIGQHFGQLLESGKGSDVNFDVNGENFSAHKLVLA  226

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ +  + + + Q I I +ME  VFKA+LHF+Y D+L + +     +    + 
Sbjct  227  ARSPVFRAQLYGPMKDQNTQCINIEDMEPPVFKALLHFMYWDTLPDLEELTGMNLPWAAT  286

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              +    LL AADRY L RL+ +CEA LC+D+++N+VA TLALA+ +H  +LK+VCL+F 
Sbjct  287  MMSQ--HLLAAADRYGLDRLRLLCEAKLCEDVAINTVANTLALAEQHHCFQLKSVCLKFV  344

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ+DGFEYLKE+CP + +ELL+ VA   +   + G +       + D  D 
Sbjct  345  ALPENLRAVMQTDGFEYLKESCPHVLTELLEYVARTNEHSIAMGKQGIEA---ILDGSDV  401

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  402  NGRRVKQR  409



>gb|EPS58860.1| hypothetical protein M569_15950 [Genlisea aurea]
Length=404

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 163/248 (66%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C+VGVV+S  +   +++I IP SDIG HFG LL   EG+DI F V GE F AHKLV+A
Sbjct  161  VHCSVGVVKSHTEGPKVYTIPIPPSDIGQHFGQLLGTGEGADITFEVDGETFAAHKLVIA  220

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ +  + + D Q I + +ME+ VFKA+LHF+Y D L +       +S   S 
Sbjct  221  ARSPVFRAQLYGPMKDRDTQHIKVEDMEAPVFKALLHFIYWDVLPDMVELTGLNSKWAST  280

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              T    LL AADRY L RL+ +CEA LC+ +++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  281  LMTQ--HLLAAADRYCLDRLRLLCEATLCEQVAINTVATTLALAEQHHCFQLKAVCLKFV  338

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQS+GFEYLKE+CP + +ELL+ VA   +  S GG +       L D  D 
Sbjct  339  AMSENLRAVMQSEGFEYLKESCPDVLTELLEHVARVNEHLSVGGKQG---IGHLMDRNDG  395

Query  713  DGRRVRQR  736
              RRV+QR
Sbjct  396  SSRRVKQR  403



>ref|XP_006604419.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Glycine max]
Length=410

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 126/248 (51%), Positives = 167/248 (67%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            +NC+VGVVRS  +   +++I IP S IG  FG LLE+ +GSD+ F V G+ F AHKLVLA
Sbjct  167  VNCSVGVVRSHTEGPKIYTIAIPPSSIGQKFGQLLESGKGSDVNFEVNGDIFAAHKLVLA  226

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  + + + Q I + +ME+ VFKA+LHF+Y DSL +       +S   S 
Sbjct  227  ARSPVFRAQLFGPMKDQNTQRIKVEDMEAPVFKALLHFIYWDSLPDMQELTGLNSKWAST  286

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ MCEA LC+D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  287  LMAQ--HLLAAADRYGLERLRLMCEASLCEDVAINTVATTLALAEQHHCFQLKAVCLKFI  344

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA    E S    K R+    L D  D 
Sbjct  345  ATSENLRAVMQTDGFEYLKESCPSVLTELLEYVARF-TEHSDIMCKHRN--EALLDGSDI  401

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  402  NGRRVKQR  409



>ref|XP_011079801.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Sesamum indicum]
Length=410

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 168/248 (68%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C VGVVRS  +   ++SI +P SDIG HFG LLE+ +G+D+ F V GE F+ HKLVLA
Sbjct  167  VHCCVGVVRSHTEGPKIYSIPLPPSDIGQHFGQLLESGKGTDVTFEVDGETFNGHKLVLA  226

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ +  ++    E I + +ME+ VFKA+LHF+Y D+L + +     +S   S 
Sbjct  227  ARSPVFRAQLYGPMKDQNSECIKVEDMEAPVFKALLHFMYWDALPDLEELTGLNSKWAST  286

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              +    LL AADRY L RL+ +CEA LC+D+++N+VA TLALA+ +H  +LK+VCL+F 
Sbjct  287  LMSQ--HLLAAADRYGLDRLRLLCEANLCEDVAINTVATTLALAEQHHCFQLKSVCLKFV  344

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ+DGFEYLKE+CP + +ELL+ VA   +   + G +       + D  D 
Sbjct  345  AQPENLRAVMQTDGFEYLKESCPHVLTELLEYVARINEHSIAVGKQGIE---GILDGSDV  401

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  402  NGRRVKQR  409



>ref|XP_004229460.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Solanum lycopersicum]
Length=407

 Score =   216 bits (549),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 123/252 (49%), Positives = 163/252 (65%), Gaps = 17/252 (7%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I CTVGVVRS  +     S+ +P SDIG HFG LLE+ EG+DI F V GE F AHKLVLA
Sbjct  164  IQCTVGVVRSYNETPKTFSLPVPPSDIGLHFGQLLESGEGADIKFEVEGEVFAAHKLVLA  223

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+ R++ F  L E + Q I +  +++ VFKA+LHF+Y DSL +        +     
Sbjct  224  ARSPVLRAQLFGPLKEENIQSIRVEEIQAPVFKALLHFIYWDSLPDLQELVGLDTKWAVA  283

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AAD+Y L RL+ +CEA LC+D+++N+VA TLALAD +H ++LK+VCL+F 
Sbjct  284  LMAQ--HLLAAADQYGLERLRALCEAKLCEDVTINTVATTLALADQHHCVQLKSVCLKFI  341

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDEC----SSGGGKSRSVWAQLSD  700
            A  ENL AVMQS+GF++LKE+CPS+ +ELLK VAG  +        GG         + D
Sbjct  342  ALPENLKAVMQSEGFDHLKESCPSVITELLKYVAGMNEHAIISYVHGG--------HILD  393

Query  701  SGDTDGRRVRQR  736
              D +GRRV+QR
Sbjct  394  GTDVNGRRVKQR  405



>ref|XP_007162393.1| hypothetical protein PHAVU_001G148400g [Phaseolus vulgaris]
 gb|ESW34387.1| hypothetical protein PHAVU_001G148400g [Phaseolus vulgaris]
Length=411

 Score =   216 bits (549),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 127/248 (51%), Positives = 166/248 (67%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            +NC+VGVVRS  +   +++I IP S IG  FG LLEN +GSD+ F V GE F AHKLVLA
Sbjct  168  VNCSVGVVRSRTEGPKIYTIAIPPSSIGQQFGQLLENRKGSDVNFEVDGEIFAAHKLVLA  227

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  + + + Q I + +ME+ VFKA+LHF+Y DSL +       +S   S 
Sbjct  228  ARSPVFRAQLFGPMKDQNTQCIKVEDMEAPVFKALLHFIYWDSLPDMHELTGLNSKWAST  287

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+  CEA LC+D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  288  LMAQ--HLLAAADRYGLERLRLKCEASLCEDVAINTVATTLALAEQHHCFQLKAVCLKFI  345

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA    E S    K R+    L D  D 
Sbjct  346  ATSENLRAVMQTDGFEYLKESCPSVLTELLEYVARF-TEHSDFMCKHRN--EALLDGSDI  402

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  403  NGRRVKQR  410



>ref|XP_011082543.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Sesamum indicum]
Length=410

 Score =   215 bits (548),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 167/248 (67%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C VGVV+S  +   ++SI +P SDIG HFG LLE+ +G+D+ F V GE F AHKLVLA
Sbjct  167  VHCCVGVVKSHTEGPKIYSIPLPPSDIGQHFGKLLESGKGTDVNFEVDGETFSAHKLVLA  226

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ +  ++    E I I +ME+ VFKA+LHF+Y D+L + +     +S   S 
Sbjct  227  ARSPVFRAQLYGPMKDQNTECIKIEDMEAPVFKALLHFIYWDTLPDMEELTGLNSKWAST  286

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              +    LL AADRY L RL+ +CE+ LC+DI++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  287  LMSQ--HLLAAADRYGLDRLRLLCESNLCEDIAINTVATTLALAEQHHCFQLKAVCLKFV  344

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ+DGFEYLKE+CP + +ELL+ VA   +   + G +       + D  D 
Sbjct  345  ALPENLRAVMQTDGFEYLKESCPHVLTELLEYVARINEHSVAVGKQGLEA---ILDGSDI  401

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  402  NGRRVKQR  409



>emb|CDY71585.1| BnaCnng73550D [Brassica napus]
Length=202

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 146/213 (69%), Gaps = 16/213 (8%)
 Frame = +2

Query  113  MEGSDIIFNVAGEKFHAHKLVLAARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHF  292
            MEGSD+ FN+AG+KF AHKLVLAARSP F+S+F + LE +  E+ I+++E KVFKA+L F
Sbjct  1    MEGSDVTFNIAGDKFQAHKLVLAARSPFFKSKFSNELEPNSTEVTINDLEPKVFKALLQF  60

Query  293  VYtdslleddleasssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVA  472
            +Y DSL E+                   KLL AAD+Y L RL+ +CE+++CK +SV SVA
Sbjct  61   IYKDSLPEEVEPTLI------------VKLLAAADKYYLNRLRLLCESHICKGVSVKSVA  108

Query  473  KTLALADCYHAMELKTVCLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDEC  652
            K LALA  Y A ELK+VCL+  AENLAAV+++DG++  K+ C SLQSELLK VA  E+  
Sbjct  109  KILALAHIYKATELKSVCLKLTAENLAAVLETDGYQQQKDECLSLQSELLKAVAAFEESS  168

Query  653  SS-GGGKSRSVWAQLS---DSGDTDGRRVRQRT  739
             S GG  S SVWAQLS     GDT  R VRQRT
Sbjct  169  HSIGGAMSLSVWAQLSDGGGGGDTSSRHVRQRT  201



>gb|KDP21503.1| hypothetical protein JCGZ_21974 [Jatropha curcas]
Length=407

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 168/252 (67%), Gaps = 16/252 (6%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C+VGVV+S  +    +SI +P S+IG HFG LLEN +G+D+ F V GE F AHKLVLA
Sbjct  164  VHCSVGVVKSCTEGPKTYSIAVPPSNIGQHFGQLLENGKGTDVNFEVDGEVFAAHKLVLA  223

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  + + + Q I + +ME+ VFKA+LHF+Y DSL + +     +S   S 
Sbjct  224  ARSPVFRAQLFGPMKDQNTQLIKVEDMEAPVFKALLHFIYWDSLPDLEELTGLNSKWAST  283

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CEA LC+D+++N+VA TLALA+ +H ++LK VCL+F 
Sbjct  284  LMCQ--HLLAAADRYALDRLRLLCEANLCEDVAINTVATTLALAEQHHCVQLKAVCLKFV  341

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDE----CSSGGGKSRSVWAQLSD  700
            A  ENL AVMQ+DGFEYL+E+CPS+ +ELL+ VA   +     C  G          + D
Sbjct  342  AMPENLRAVMQTDGFEYLRESCPSVLTELLEYVARVSEHSVIICRHGN-------EAILD  394

Query  701  SGDTDGRRVRQR  736
              D +GRRV+QR
Sbjct  395  GSDLNGRRVKQR  406



>ref|XP_006846362.1| hypothetical protein AMTR_s00012p00261580 [Amborella trichopoda]
 gb|ERN08037.1| hypothetical protein AMTR_s00012p00261580 [Amborella trichopoda]
Length=390

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/249 (51%), Positives = 163/249 (65%), Gaps = 12/249 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            + CTVGVVR+  +    +SI++P SD+G  F  LL+    SD++F V GE F AHKLVLA
Sbjct  149  MRCTVGVVRNRFEGIMQYSIYVPPSDMGQCFKELLDTGSASDVVFEVCGETFKAHKLVLA  208

Query  182  ARSPIFRSEFFDGLESDEQ--EIVISNMESKVFKAMLHFVYtdslleddleasssssips  355
             RSP+F+++FF GL  D    +I I  +E  VFKAMLHF+Y+D+L +    +S+ S  P 
Sbjct  209  TRSPVFKAQFF-GLVGDPNIDKIEIEGIEPAVFKAMLHFIYSDTLPDLPESSSTYSWTPM  267

Query  356  isdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRF  535
                    LL AADRY L RLK +CEA LC+++S +SVA TLALA+ YH  +LK VCLRF
Sbjct  268  AQ-----HLLAAADRYGLDRLKLVCEARLCEEVSTDSVATTLALAERYHCKQLKDVCLRF  322

Query  536  AA--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGD  709
            AA   +L AVMQSDGF YL+E CP++ SELLK VA  +++ S    K  + W  LSDSG 
Sbjct  323  AAAPSHLGAVMQSDGFSYLEEECPTILSELLKMVAVADEDSSPMSRKRGTQWLTLSDSG-  381

Query  710  TDGRRVRQR  736
             D RR R R
Sbjct  382  -DARRARPR  389



>ref|XP_006444138.1| hypothetical protein CICLE_v10020406mg [Citrus clementina]
 ref|XP_006479773.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Citrus sinensis]
 gb|ESR57378.1| hypothetical protein CICLE_v10020406mg [Citrus clementina]
 gb|KDO68822.1| hypothetical protein CISIN_1g015430mg [Citrus sinensis]
Length=407

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 169/252 (67%), Gaps = 16/252 (6%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C+VGVV+S  +   ++SI IP S+IG HFG LLE+ + +D+ F V GE F AHKLVLA
Sbjct  164  VHCSVGVVKSHTEGPKIYSIAIPPSNIGQHFGQLLESGKRTDVNFEVNGETFAAHKLVLA  223

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ +  + + + Q I + +ME+ VFKA+LHF+Y DSL + +     SS   S 
Sbjct  224  ARSPVFRAQLYGPMKDQNTQCIKVEDMEAPVFKALLHFIYWDSLPDMEELTGMSSKWAST  283

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              +    LL AADRY L RL+ +CEA LC+D+++N+VA TLALA+ +H  +LK+VCL+F 
Sbjct  284  LMSQ--HLLAAADRYGLERLRLLCEANLCEDVAINTVATTLALAEQHHCFQLKSVCLKFV  341

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDE----CSSGGGKSRSVWAQLSD  700
            A  ENL AVMQ+DGFEYLKE+CPSL +ELL+ VA   +     C  G          + D
Sbjct  342  AMPENLRAVMQTDGFEYLKESCPSLLTELLEYVAKVSEHSVVVCRHGN-------EAILD  394

Query  701  SGDTDGRRVRQR  736
              D +GRRV+QR
Sbjct  395  GSDVNGRRVKQR  406



>ref|XP_010278817.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
[Nelumbo nucifera]
Length=407

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/253 (47%), Positives = 164/253 (65%), Gaps = 16/253 (6%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C+VGVVRS  +   ++SI +P S+IG HFG LLE+  G+D+ F V GE F AHKLVLA
Sbjct  164  VHCSVGVVRSHTEGPKIYSIPVPSSNIGQHFGHLLESGRGTDVNFEVDGEIFSAHKLVLA  223

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  ++    E I + +ME+  FKA+LHF+Y D + +       +S   S 
Sbjct  224  ARSPVFRAQLFGPMKDRNTECIKVEDMEAPAFKALLHFIYWDDIPDMQEFTGLNSKWAST  283

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CEA LC+D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  284  LMGQ--HLLAAADRYGLERLRLLCEAKLCEDVAINTVATTLALAEQHHCFQLKAVCLKFV  341

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDE----CSSGGGKSRSVWAQLSD  700
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA   +     C  G          + D
Sbjct  342  AQPENLRAVMQTDGFEYLKESCPSVLTELLEYVARVGEHSVIVCRYGN-------EAILD  394

Query  701  SGDTDGRRVRQRT  739
              D +GRRV+QRT
Sbjct  395  GSDVNGRRVKQRT  407



>ref|XP_007161863.1| hypothetical protein PHAVU_001G104300g, partial [Phaseolus vulgaris]
 gb|ESW33857.1| hypothetical protein PHAVU_001G104300g, partial [Phaseolus vulgaris]
Length=381

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 162/218 (74%), Gaps = 4/218 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            +NCTVGV+ +T+D S +  I +P+S I  HFGML E+ + SD+ F V G KF+AHK+VLA
Sbjct  145  VNCTVGVLPTTLDNSMI--IEVPESSIAVHFGMLFEDEQSSDVTFCVGGNKFYAHKIVLA  202

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddlea-sssssipsi  358
            ARS +F+ +FF+  E  ++EI++++ME KV KA+LHF+Y D+L+ED+    S  S++ S+
Sbjct  203  ARSSVFKDQFFNETEKVDREILVNDMEPKVLKALLHFIYKDTLIEDEELHFSVPSTMTSL  262

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S     KLL AA +Y L RLK MCE+ LCK IS+NSVA+ L ++DCY A++LK++CLRF+
Sbjct  263  SKLYVTKLLAAAHKYQLPRLKLMCESVLCKHISINSVAQILIISDCYDAIQLKSICLRFS  322

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDEC  652
             ENL AV++S GF++LK+ CP LQ ELLKTVA  E EC
Sbjct  323  TENLEAVLKSHGFKHLKKKCPLLQYELLKTVAK-EIEC  359



>ref|XP_008681390.1| PREDICTED: speckle-type POZ protein isoform X1 [Zea mays]
Length=375

 Score =   212 bits (539),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 153/206 (74%), Gaps = 16/206 (8%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV ST+D S  HSI +P+SDIG HFG LL+  EG D+IF+VAGEKFHAHKLVLA
Sbjct  175  INCTVGVVVSTMDYSRPHSIEVPESDIGFHFGTLLDTQEGVDVIFSVAGEKFHAHKLVLA  234

Query  182  ARSPIFRSEFFD--------GLESDEQ--EIVISNMESKVFKAMLHFVYtdslleddlea  331
            ARSP FRSEFFD        G ++ ++  EIVI +M+  VFKA+LHF+Y    L +D E 
Sbjct  235  ARSPFFRSEFFDHELGEEKNGTDTGDEIKEIVIDDMDPVVFKAVLHFIY-RDNLVNDDEL  293

Query  332  sssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAME  511
            S+SSS  SI D L  KL+ AAD+Y+L RL+ +CE+YLCK ISVNSVA TLALAD +HAME
Sbjct  294  SASSSDCSIFDRLSGKLMAAADKYELPRLRLLCESYLCKHISVNSVATTLALADRHHAME  353

Query  512  LKTVCLRFAAENLAAVMQSDGFEYLK  589
            LK+VCL+FAAENL     SD   YL+
Sbjct  354  LKSVCLKFAAENL-----SDALMYLQ  374



>ref|XP_010652109.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Vitis vinifera]
 emb|CBI32329.3| unnamed protein product [Vitis vinifera]
Length=402

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 167/252 (66%), Gaps = 16/252 (6%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C+VG+VRS  +   ++SI +P  +IG HFG LLE+ +G+D+ F V GE F AHKLVLA
Sbjct  159  VHCSVGLVRSHTEGPKIYSIAVPPCNIGQHFGQLLESGKGTDVNFEVDGETFSAHKLVLA  218

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  + + + Q I + +ME+ VFKA+LHF+Y DSL + +     +S   S 
Sbjct  219  ARSPVFRAQLFGPMKDQNTQCIKVEDMEAPVFKALLHFIYWDSLPDMEELTGLNSKWAST  278

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CE+ LC+D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  279  LMAQ--HLLAAADRYGLDRLRLLCESNLCEDVAINTVATTLALAEQHHCFQLKAVCLKFV  336

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDE----CSSGGGKSRSVWAQLSD  700
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA   +     C  G          + D
Sbjct  337  AMPENLRAVMQTDGFEYLKESCPSVLTELLEYVARVSEHSVIVCRHGN-------EAILD  389

Query  701  SGDTDGRRVRQR  736
              D +GRRV+QR
Sbjct  390  GSDINGRRVKQR  401



>tpg|DAA51839.1| TPA: hypothetical protein ZEAMMB73_694112 [Zea mays]
Length=375

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 153/207 (74%), Gaps = 18/207 (9%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV ST+D S  HSI +P+SDIG HFG LL+ +EG D+IF+VAGEKFHAHKLVLA
Sbjct  175  INCTVGVVVSTMDYSRPHSIEVPESDIGYHFGTLLDTLEGVDVIFSVAGEKFHAHKLVLA  234

Query  182  ARSPIFRSEFFDGLESDEQ-----------EIVISNMESKVFKAMLHFVYtdslleddle  328
            ARS  FRSEFFD  ESDE+           EIVI +M+  VFKA+LHF+Y    L +D E
Sbjct  235  ARSSFFRSEFFDH-ESDEEKNETGTGDEIKEIVIDDMDPVVFKAVLHFMY-RDNLVNDDE  292

Query  329  asssssipsisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAM  508
              +SSS  SI D+L  KL+ AAD+Y+L RL+ +CE+YLCK +SVNSVA TLALAD YHA+
Sbjct  293  LMASSSDCSIFDSLAGKLMAAADKYELPRLRLLCESYLCKHVSVNSVATTLALADRYHAI  352

Query  509  ELKTVCLRFAAENLAAVMQSDGFEYLK  589
            ELK+VCL+FAAENL     SD   YL+
Sbjct  353  ELKSVCLKFAAENL-----SDALMYLQ  374



>ref|XP_010090357.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis]
 gb|EXB39327.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis]
Length=404

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/248 (47%), Positives = 164/248 (66%), Gaps = 13/248 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            +NC VGVV+S  +    +SI IP S+IG HFG LLE+ +G+D+ F V GE F AHKLVL 
Sbjct  166  VNCIVGVVKSRTEGPKTYSIAIPPSNIGQHFGQLLESGKGTDVTFEVYGEHFSAHKLVLG  225

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  ++    E I I +ME+ VFKA+LHF+Y DSL + +     +S   S 
Sbjct  226  ARSPVFRAQLFGPMKDQNTECIKIEDMEAPVFKALLHFIYWDSLPDVEELTGLNSKWAST  285

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CE+ LC+ +++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  286  LMAQ--HLLAAADRYGLERLRLLCESSLCEHVAINTVATTLALAEQHHCFQLKAVCLKFV  343

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVM++DGFEYLK++CPS+ ++LL+ +A      S  G ++      + D  D 
Sbjct  344  AMPENLGAVMETDGFEYLKQSCPSVMTDLLQYIANV--AVSKHGNEA------VLDGSDI  395

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  396  NGRRVKQR  403



>gb|KHG07672.1| BTB/POZ and MATH domain-containing 2 -like protein [Gossypium 
arboreum]
Length=405

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 167/252 (66%), Gaps = 16/252 (6%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C+VGVV+S  +   ++SI +  S+I  HFG LLE+ +G+D+ F V GE  HAHKLVLA
Sbjct  162  VHCSVGVVKSHTEGPKIYSIAVTPSNISRHFGKLLESGKGTDVSFEVDGEVIHAHKLVLA  221

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  + + + ++I I +ME+ VFKA+LHF+Y DSL +       +S   S 
Sbjct  222  ARSPVFRAQLFGPMKDQNTKQIKIEDMEAPVFKALLHFIYWDSLPDMQELTGLNSKWASA  281

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              +    LL AADRY L RL+ +CEA LC+D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  282  LMSQ--HLLAAADRYGLDRLRLLCEANLCEDVTINTVATTLALAEQHHCFQLKAVCLKFV  339

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDE----CSSGGGKSRSVWAQLSD  700
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA   +     C  G          + D
Sbjct  340  AMPENLRAVMQTDGFEYLKESCPSVLTELLEHVARVNEHSVIVCRHGN-------EAILD  392

Query  701  SGDTDGRRVRQR  736
              D +GRRV+QR
Sbjct  393  GSDANGRRVKQR  404



>ref|XP_006297810.1| hypothetical protein CARUB_v10013845mg [Capsella rubella]
 gb|EOA30708.1| hypothetical protein CARUB_v10013845mg [Capsella rubella]
Length=407

 Score =   210 bits (534),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 116/248 (47%), Positives = 162/248 (65%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            + C VGVV+S  +    ++I +P SD+G  FG LLE+ +G+DI F+V GE F AHKLVLA
Sbjct  163  VRCCVGVVKSRTEGPRSYNIPVPVSDLGQQFGKLLESEKGADITFDVDGETFPAHKLVLA  222

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  L S+  + I I ++E+ +FK +LHF+Y D L +      +     S 
Sbjct  223  ARSPVFRAQLFGPLRSENTKCITIEDIEAPIFKMLLHFIYWDELPDMQDLMGTDLKWAST  282

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CE+ LC+ IS+N+VA TLALA+ +H  +LK  CL+F 
Sbjct  283  LVAQ--HLLAAADRYALERLRTICESKLCEGISINTVATTLALAEQHHCFQLKAACLKFI  340

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVM++DGF+YLKE+CPSL SELL+ VA   +   +  G  + ++A   D  D 
Sbjct  341  ALPENLKAVMETDGFDYLKESCPSLLSELLEYVARLSEHSLTSSGNRKELFA---DGCDV  397

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  398  NGRRVKQR  405



>ref|XP_006489244.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Citrus sinensis]
 gb|KDO74864.1| hypothetical protein CISIN_1g015649mg [Citrus sinensis]
Length=403

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 122/250 (49%), Positives = 162/250 (65%), Gaps = 12/250 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C VGVV+S  +    +SI +P SDIG  FG LLE    +D+ F V GE+F AHKLVLA
Sbjct  159  VSCCVGVVKSYTEGPKTYSIPVPPSDIGKQFGKLLEGGRFTDVNFEVDGERFAAHKLVLA  218

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
             RSP+F+++ F  L + + Q I + +ME  VFKA+LHF+Y D+L + +     S    S 
Sbjct  219  TRSPVFKAQLFGPLKDQNTQCIKVEDMEVPVFKALLHFIYWDALPDMEDLVDLSPKWAST  278

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RLK +CEA LC+D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  279  LMAQ--HLLAAADRYALERLKLLCEAKLCEDVAINTVATTLALAEQHHCSQLKAVCLKFI  336

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVA--GCEDECSSGGGKSRSVWAQLSDSG  706
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA  G     +SG G        L D  
Sbjct  337  ASPENLKAVMQTDGFEYLKESCPSVLTELLQYVAKIGEHSVIASGHGNE-----TLPDGC  391

Query  707  DTDGRRVRQR  736
            D +GRRV+QR
Sbjct  392  DVNGRRVKQR  401



>ref|XP_010038130.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Eucalyptus grandis]
 gb|KCW49942.1| hypothetical protein EUGRSUZ_K03404 [Eucalyptus grandis]
Length=407

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 165/251 (66%), Gaps = 14/251 (6%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C VGVVRS  +   + SI +P S IG   G LLE+ +G+D+ F V GE + AHKLVLA
Sbjct  164  VHCIVGVVRSHTEGPKIFSIPVPPSSIGQDLGKLLESGKGADVSFEVDGEVYPAHKLVLA  223

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ +  + + + ++I + +ME  VFKA+LHF+Y DSL +        +   S 
Sbjct  224  ARSPVFRAQLYGPMKDQNTKQIRVEDMEPSVFKALLHFIYFDSLPDLQELTGLDTKWAST  283

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              +    LL AADRY L RL+ +CEA LC+D+++N+VA TLALA+ +H  +LK VCLRF 
Sbjct  284  LMSQ--HLLAAADRYGLDRLRLLCEANLCQDVAINTVATTLALAEQHHCFQLKAVCLRFV  341

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDE---CSSGGGKSRSVWAQLSDS  703
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA   ++    SS G +       + D 
Sbjct  342  AMPENLRAVMQTDGFEYLKESCPSVLTELLEYVARASEQSMIVSSHGNEG------ILDG  395

Query  704  GDTDGRRVRQR  736
             D +GRRV+QR
Sbjct  396  SDANGRRVKQR  406



>gb|KEH23545.1| BTB/POZ/MATH-domain protein [Medicago truncatula]
Length=349

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S+IDCS + +IH+P+SDIG+HFGMLLEN EGSD+ F+V GE+FHAHKLV+A
Sbjct  148  INCTVGVVVSSIDCSKLTTIHVPESDIGSHFGMLLENEEGSDVTFSVGGERFHAHKLVMA  207

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYt-dslleddleasssssipsi  358
            ARS  F +EFF+ +E D++++V+++ME KVFKA+LHF+Y    + +++   SSSS +PSI
Sbjct  208  ARSTAFETEFFNSMEEDDRDVVVTDMEPKVFKALLHFIYRDTLIEDEEFFMSSSSFLPSI  267

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S+T  AKLL AA++YDL RLK MCE+ LCKDIS++SVA  LALAD YHA ELK +CL+F+
Sbjct  268  SETFAAKLLAAAEKYDLPRLKLMCESVLCKDISIDSVAYILALADRYHATELKAICLQFS  327

Query  539  AENLAA  556
            AENL  
Sbjct  328  AENLVG  333



>ref|XP_009599207.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Nicotiana tomentosiformis]
Length=411

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 165/248 (67%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C VGVVRS  +    ++I +P S+IG HFG LLE+ +G+D+ F V GE F AHKLVLA
Sbjct  168  VHCCVGVVRSRTEGPKTYAISLPPSNIGLHFGQLLESGKGTDVNFEVDGEIFAAHKLVLA  227

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ +  ++    E I + +ME+ VFKA++HF+Y D L + +     +S   S 
Sbjct  228  ARSPVFRAQLYGPMKDQNTEHIKVEDMEAPVFKALIHFIYWDVLPDMEELTGLNSKWAST  287

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              +    LL AADRY L RL+ +CEA LC+++++N+VA TLALA+ +H  +LK+VCL+F 
Sbjct  288  LMSQ--HLLAAADRYGLDRLRLLCEANLCEEVAINTVATTLALAEQHHCFQLKSVCLKFV  345

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ+DGF+YL+E+CP + +ELL+ VA   +           V   + D GD 
Sbjct  346  AMPENLRAVMQTDGFDYLRESCPHVLTELLEYVARVSEHSGIASKLGNEV---ILDGGDV  402

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  403  NGRRVKQR  410



>ref|XP_006419782.1| hypothetical protein CICLE_v10005094mg [Citrus clementina]
 gb|ESR33022.1| hypothetical protein CICLE_v10005094mg [Citrus clementina]
Length=403

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 122/250 (49%), Positives = 161/250 (64%), Gaps = 12/250 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C VGVV+S  +    +SI +P SDIG  FG LLE    +D+ F V GE F AHKLVLA
Sbjct  159  VSCCVGVVKSYTEGPKTYSIPVPPSDIGKQFGKLLEGGRFTDVNFEVDGESFAAHKLVLA  218

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
             RSP+F+++ F  L + + Q I + +ME  VFKA+LHF+Y D+L + +     S    S 
Sbjct  219  TRSPVFKAQLFGPLKDQNTQCIKVEDMEVPVFKALLHFIYWDALPDMEDLVDLSPKWAST  278

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RLK +CEA LC+D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  279  LMAQ--HLLAAADRYALERLKLLCEAKLCEDVAINTVATTLALAEQHHCSQLKAVCLKFI  336

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVA--GCEDECSSGGGKSRSVWAQLSDSG  706
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA  G     +SG G        L D  
Sbjct  337  ASPENLKAVMQTDGFEYLKESCPSVLTELLQYVAKIGEHSVIASGHGNE-----TLPDGC  391

Query  707  DTDGRRVRQR  736
            D +GRRV+QR
Sbjct  392  DVNGRRVKQR  401



>ref|XP_008458543.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Cucumis melo]
 gb|KGN46162.1| hypothetical protein Csa_6G061240 [Cucumis sativus]
Length=411

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 164/252 (65%), Gaps = 15/252 (6%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I+C VGVV+S  +   ++SI  P SDIG HFG LLE+ + +D+ F V GE F AHKLVLA
Sbjct  166  IHCVVGVVKSHTEGPKIYSITPPPSDIGQHFGKLLESGKLTDVNFEVDGETFSAHKLVLA  225

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  L+    E I + +ME+ VFKA+LHF+Y D+L +       +S   S 
Sbjct  226  ARSPVFRAQLFGPLKDQNTECIKVEDMEAPVFKALLHFIYWDALPDMQEIVGLNSKWAST  285

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              +    LL AADRY L RLK +CEA LC+D+++N+VA TLALA+ +H  +LK VCL+  
Sbjct  286  LMSQ--HLLAAADRYALDRLKLLCEAKLCEDVAINTVATTLALAEQHHCFQLKAVCLKVI  343

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDE----CSSGGGKSRSVWAQLSD  700
            A  ENL AVMQ++GFEYLKE+CPS+ +ELL+ VA   +     CS  G  +      + D
Sbjct  344  ALPENLRAVMQTEGFEYLKESCPSVLTELLEYVARVTEHAVITCSGYGNGT------VLD  397

Query  701  SGDTDGRRVRQR  736
                +GRRVRQR
Sbjct  398  GSYVNGRRVRQR  409



>gb|KHN18899.1| BTB/POZ and MATH domain-containing protein 2 [Glycine soja]
Length=381

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 163/248 (66%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            +NC+VGVV+S  +   ++ I IP S++G  FG LLE+ +GSD+ F V GE F AHKLVLA
Sbjct  138  VNCSVGVVKSHTEGPKIYKIPIPPSNMGQQFGKLLESGKGSDVSFEVNGEIFAAHKLVLA  197

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  ++      I + +ME+ VFKA+LH +Y DSL +       SS   + 
Sbjct  198  ARSPVFRAQLFGPMKDQNTHCIKVEDMEAPVFKALLHVIYWDSLPDMQELTGLSSKWATT  257

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ MCEA LC D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  258  LMAQ--HLLAAADRYGLERLRLMCEASLCDDVAINTVATTLALAEQHHCFQLKAVCLKFV  315

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA    E S    K R+    + D  D 
Sbjct  316  ARPENLRAVMQTDGFEYLKESCPSVLTELLEYVARFT-EHSDFLCKHRN--EVILDGSDV  372

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  373  NGRRVKQR  380



>ref|XP_009799864.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Nicotiana sylvestris]
Length=411

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/248 (46%), Positives = 165/248 (67%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C VGVVRS  +    ++I +P S+IG HFG LLE+ +G+D+ F V GE F AHKLVLA
Sbjct  168  VHCCVGVVRSRTEGPKTYAIPLPPSNIGLHFGQLLESGKGTDVNFEVDGEIFAAHKLVLA  227

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ +  ++    E I I +ME+ VFKA++HF+Y D L + +     +S   S 
Sbjct  228  ARSPVFRAQLYGPMKDQNTEHIKIEDMEAPVFKALIHFIYWDVLPDMEELTGLNSKWAST  287

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              +    +L AADRY L RL+ +CEA LC+++++N++A TLALA+ +H  +LK+VCL+F 
Sbjct  288  LMSQ--HMLAAADRYGLDRLRLLCEANLCEEVAINTIATTLALAEQHHCFQLKSVCLKFV  345

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ+DGF+YL+E+CP + +ELL+ VA   +           V   + D GD 
Sbjct  346  AMPENLRAVMQTDGFDYLRESCPHVLTELLEYVARVSEHSGIASKLGNEV---ILDGGDV  402

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  403  NGRRVKQR  410



>ref|XP_008438731.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Cucumis 
melo]
Length=408

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 164/250 (66%), Gaps = 12/250 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I C VGVV+S  +   ++SI  P S+IG HFG LLE+ + +D+ F V GE F AHKLV+A
Sbjct  164  IKCVVGVVKSQTEGPKIYSITPPPSNIGQHFGKLLESGKCADVNFEVNGEIFAAHKLVIA  223

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  L + D + I + ++E+ VFKA+LHF+Y D+L +      ++S   S 
Sbjct  224  ARSPVFRAQLFGPLKDKDTRLIKVEDIEAPVFKALLHFMYWDNLPDMLELVGANSKWAST  283

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RLK +CEA LC+DI++N+VA TLALA+ +H  +LK  CLRF 
Sbjct  284  LMAQ--HLLAAADRYALDRLKLLCEAKLCEDIAINTVATTLALAEQHHCFQLKAACLRFI  341

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDE--CSSGGGKSRSVWAQLSDSG  706
            A  ENL AVMQSDGF+YLKE+CP++ +ELL+ VA   +    +SG G          D  
Sbjct  342  AMPENLKAVMQSDGFDYLKESCPAVLTELLQYVARVTEHNVLTSGFGN-----LTFLDGS  396

Query  707  DTDGRRVRQR  736
            D +GRRV+QR
Sbjct  397  DLNGRRVKQR  406



>ref|XP_010551778.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X1 [Tarenaya hassleriana]
Length=410

 Score =   208 bits (529),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 119/250 (48%), Positives = 165/250 (66%), Gaps = 8/250 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            + C VGVV+S  +    + IH+  SD+G HFG LLE+ +G+D+ F V GE F AHK+VLA
Sbjct  162  VRCCVGVVKSHTEGPRSYKIHVSPSDLGQHFGKLLESGKGADVTFEVDGEAFSAHKVVLA  221

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  L + + Q I I +ME+ +FK +LHF+Y D L +      + S   S 
Sbjct  222  ARSPVFRAQLFGPLKDRNTQCIRIEDMEAPIFKVLLHFIYWDELPDMQELMGTESKWAST  281

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CE+ LC+ IS+N+VA TLALA+ +H  +LK VCL+F 
Sbjct  282  LVAQ--HLLAAADRYALERLRAICESKLCEGISINTVATTLALAEQHHCFQLKAVCLKFI  339

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVA--GCEDECSSGGGKSRSVWAQLSDSG  706
            A  ENL AVMQ++GFEYL E+CPS+ +ELL+ VA  G     ++  G  + V A L+D  
Sbjct  340  AFPENLKAVMQTEGFEYLNESCPSVLTELLEYVARLGEHSITAASSGHRKEVVA-LADGC  398

Query  707  DTDGRRVRQR  736
            D++GRRV+QR
Sbjct  399  DSNGRRVKQR  408



>gb|AAO72687.1| zinc finger POZ domain protein [Oryza sativa Japonica Group]
Length=183

 Score =   201 bits (510),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 136/167 (81%), Gaps = 2/167 (1%)
 Frame = +2

Query  236  QEIVISNMESKVFKAMLHFVYtdslleddleasssssipsisdtlpAKLLEAADRYDLGR  415
            +EIVI +ME KVF+A   F+Y D+L+ DD  ++SSS           KLL AADRY+L R
Sbjct  18   KEIVIDDMEPKVFQAGFLFMYRDNLVGDDELSASSSDCSIFDTLA-GKLLAAADRYELPR  76

Query  416  LKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAAENLAAVMQSDGFEYLKEN  595
            L+ +CE+YLCK ISVNSVA TLALAD +HAMELK+VCL+FAAENL+AV+++DGF+YLK+N
Sbjct  77   LRLLCESYLCKHISVNSVATTLALADRHHAMELKSVCLKFAAENLSAVIRTDGFDYLKDN  136

Query  596  CPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDTDGRRVRQR  736
            CP+LQSE+L+TVAGCE+ECSS GGKS+SVW QLSD GDT GRRVR R
Sbjct  137  CPALQSEILRTVAGCEEECSS-GGKSQSVWGQLSDGGDTSGRRVRPR  182



>ref|XP_010255859.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 isoform 
X1 [Nelumbo nucifera]
Length=405

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/252 (47%), Positives = 162/252 (64%), Gaps = 16/252 (6%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C+VGVV S  +    + I +P S+IG HFG LLE+ +G+D+ F V GE F AHKLVLA
Sbjct  162  VHCSVGVVGSHTEGPKFYLITVPTSNIGQHFGQLLESGKGTDVNFEVDGEIFAAHKLVLA  221

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  ++    E I + +ME+ VFKA+LHF+Y D L +       +S   S 
Sbjct  222  ARSPVFRAQLFGPMKDRNTECIKVQDMEAPVFKALLHFIYWDDLPDMQELTGLNSKGAST  281

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   +L AADRY L RL+ +CEA LC+D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  282  LMGQ--HMLAAADRYGLERLRLLCEAKLCEDVAINTVATTLALAEQHHCFQLKAVCLKFV  339

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDE----CSSGGGKSRSVWAQLSD  700
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA   +     C  G          + D
Sbjct  340  ALPENLKAVMQTDGFEYLKESCPSVLTELLEYVARVGEHSVIVCRHGN-------EAVLD  392

Query  701  SGDTDGRRVRQR  736
              D +GRRV+QR
Sbjct  393  GSDVNGRRVKQR  404



>gb|ABR16952.1| unknown [Picea sitchensis]
Length=390

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 153/222 (69%), Gaps = 6/222 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I CTVGVV S I    +H I IP+S++G  FG LLE++E +D+ F+V+GEKFHAH++VLA
Sbjct  169  ICCTVGVVVSAIHGPRLHYIRIPESNLGQQFGALLEDVENADVTFDVSGEKFHAHRVVLA  228

Query  182  ARSPIFRSEFFDGLES-DEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+F+S FF   E  +++EI I   + +VFKAMLHF+Y D+L + +  A         
Sbjct  229  ARSPVFKSMFFGSSEEWNDKEISIEGTKPEVFKAMLHFIYRDTLPDLEEHADLEELSDPS  288

Query  359  sdtlpAK-----LLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTV  523
               L  +     LL AADRY L +L+ +CE+ + + I+V++VAK L LA  Y A +LK+ 
Sbjct  289  PCFLTPETMIEYLLTAADRYGLRQLRWLCESRISQGITVSTVAKILELAQRYQASQLKSA  348

Query  524  CLRFAAENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDE  649
            CL+FAA NL  VM+S+GFEYLKENCPSLQ ELL+TVA  +D+
Sbjct  349  CLKFAASNLEEVMKSEGFEYLKENCPSLQLELLQTVAQFKDD  390



>ref|XP_006407971.1| hypothetical protein EUTSA_v10020850mg [Eutrema salsugineum]
 gb|ESQ49424.1| hypothetical protein EUTSA_v10020850mg [Eutrema salsugineum]
Length=406

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 161/248 (65%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            + C VGVV+S  +    ++I +P SD+G  FG LLE+ +G+D+ F+V GE F AHKLVLA
Sbjct  162  VRCCVGVVKSRTEGPRSYNIPVPVSDLGQQFGKLLESRKGADVTFHVDGETFPAHKLVLA  221

Query  182  ARSPIFRSEFFDGLES-DEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  L++ + + I I +ME+ +FK +LHF+Y D L +      +     S 
Sbjct  222  ARSPVFRAQLFGPLKNQNTKYINIEDMEAPIFKMLLHFIYWDELPDMQDLMGTDLKWAST  281

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CE+ LC+ IS+N+VA TLALA+ +H  +LK  CL+F 
Sbjct  282  LVAQ--HLLAAADRYALERLRTICESKLCEGISINTVATTLALAEQHHCFQLKAACLKFI  339

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVM++DGF+YLKE+CP L SELL+ VA   +   +  G  +  +A   D  D 
Sbjct  340  ASPENLKAVMETDGFDYLKESCPCLLSELLEYVARLSEHSLTSSGNRKEFYA---DGCDV  396

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  397  NGRRVKQR  404



>gb|KDP40087.1| hypothetical protein JCGZ_02085 [Jatropha curcas]
Length=412

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 161/250 (64%), Gaps = 14/250 (6%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I C VGVV+S  +    ++I +P SDIG HFG  LE+  G+D+ F V GE F AHKLVLA
Sbjct  170  IRCCVGVVKSHTEGPRTYTIAVPPSDIGQHFGKFLESGRGADVNFEVDGEIFSAHKLVLA  229

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  ++    + I + +ME+ +FKA+LHF+Y D+L + +      S   S 
Sbjct  230  ARSPVFRAQLFGPMKDQSTQCIKVEDMEAPIFKALLHFIYWDALPDVEELVGLHSKWAST  289

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL A+DRY L RL+ +CE  LC+DI++N+VA TLALA+ +  ++LK VCL+F 
Sbjct  290  LMAQ--HLLAASDRYALDRLRLLCETRLCEDIAINTVATTLALAEQHQCLQLKAVCLKFI  347

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVA--GCEDECSSGGGKSRSVWAQLSDSG  706
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA  G     + G G         S  G
Sbjct  348  ALPENLKAVMQTDGFEYLKESCPSVITELLQYVAKMGEHSVITCGHGNE-------SLDG  400

Query  707  DTDGRRVRQR  736
            D +GRRV+QR
Sbjct  401  DINGRRVKQR  410



>gb|KHG23818.1| BTB/POZ and MATH domain-containing 2 -like protein [Gossypium 
arboreum]
Length=402

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 118/252 (47%), Positives = 165/252 (65%), Gaps = 16/252 (6%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C+VGVV S  +   + SI +P S+IG HFG LLE+ + +D+ F V GE F AHKLVLA
Sbjct  159  VHCSVGVVMSHTEGPKIFSIAVPPSNIGHHFGQLLESGKQTDVSFEVDGEFFPAHKLVLA  218

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  + + + ++I + +ME+ VFKA+LHF+Y DSL + +     +S   S 
Sbjct  219  ARSPVFRAQLFGPMKDHNTKQIEVEDMEAPVFKALLHFIYWDSLPDMEELTGLTSKWAST  278

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              +    LL AADRY L RL+ MCEA LC+ +++N+VA TLALA+ +H   LK VCL+F 
Sbjct  279  LMSQ--HLLAAADRYGLDRLRLMCEANLCEVVAINTVATTLALAEQHHCFRLKAVCLKFV  336

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDE----CSSGGGKSRSVWAQLSD  700
            A  ENL AVMQ+DGFEYLK++CPS+ +ELL+ VA   +     C  G          + D
Sbjct  337  AMPENLRAVMQTDGFEYLKQSCPSVLTELLEYVARVNEHPVIVCRHGN-------EAILD  389

Query  701  SGDTDGRRVRQR  736
              D +GRRV+QR
Sbjct  390  GSDANGRRVKQR  401



>ref|XP_007050686.1| BTB-POZ and MATH domain 2 [Theobroma cacao]
 gb|EOX94843.1| BTB-POZ and MATH domain 2 [Theobroma cacao]
Length=493

 Score =   207 bits (527),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 114/249 (46%), Positives = 165/249 (66%), Gaps = 16/249 (6%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C+VGVV+S  +   ++SI +P S+IG HFG LLE+ +G+D+ F V GE F AHKLVLA
Sbjct  163  VHCSVGVVKSHTEGPKVYSIAVPPSNIGHHFGQLLESGKGTDVSFEVDGEVFPAHKLVLA  222

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  + + + ++I + +ME+ VFKA+LHF+Y       D++  +  +    
Sbjct  223  ARSPVFRAQLFGPMKDQNTRKIKVEDMEAPVFKALLHFIY--WDCLPDMQELTGLNSKWA  280

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
            S  +   LL AADRY L RL+ +CEA LC+D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  281  STLMSQHLLAAADRYGLDRLRLLCEANLCEDVAINTVATTLALAEQHHCFQLKAVCLKFV  340

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDE----CSSGGGKSRSVWAQLSD  700
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA   +     C  G          + D
Sbjct  341  AMPENLRAVMQTDGFEYLKESCPSVLTELLEYVARVNEHSVIVCRHGN-------EAILD  393

Query  701  SGDTDGRRV  727
              D +GRR+
Sbjct  394  GSDANGRRL  402



>ref|XP_009120926.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 isoform 
X1 [Brassica rapa]
Length=400

 Score =   205 bits (521),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 160/248 (65%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            + C VGVV+S  +    ++I +P S++G  FG LLE+ +G D+ F V GE F AHKLVLA
Sbjct  156  VRCRVGVVKSCTEVQRNYNIPVPVSNLGQQFGNLLESGKGCDVTFQVDGETFSAHKLVLA  215

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  L + +   + I +MES +FK +LHF+Y D L +      + S   S 
Sbjct  216  ARSPVFRAQLFGPLRDRNTDRVEIEDMESPIFKVLLHFIYWDELPDMQELMGTDSKSAST  275

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RLK +CE+ LC+ I++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  276  LVAQ--HLLAAADRYALERLKLICESRLCEGITINTVATTLALAEQHHCFQLKAVCLKFV  333

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            +  ENL AVMQ+DG +YLK++CPSL +ELLK VA   +   S  G  + ++A   D  D 
Sbjct  334  SLPENLKAVMQTDGVDYLKKSCPSLLTELLKYVARLGEHSVSASGYRKEMFA---DGCDA  390

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  391  NGRRVKQR  398



>gb|KHG23128.1| BTB/POZ and MATH domain-containing protein 2 [Gossypium arboreum]
Length=408

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 165/250 (66%), Gaps = 12/250 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I C VGVV+S  +   ++SI  P SDIG HFG LLE+ +G+D+ F V GE F AHKL+LA
Sbjct  164  IRCCVGVVKSHTEGPKIYSITAPPSDIGQHFGKLLESGKGADVKFEVDGEIFDAHKLILA  223

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  L + + Q I + +ME+ VFKA+LHF+Y D+L + +    S+S   S 
Sbjct  224  ARSPVFRAQLFGPLKDQNTQSIRVEDMEAPVFKALLHFIYWDALPDMEELMGSTSKWAST  283

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L R++ +CEA LC+ +++N+VA TLALA+ ++ + LK VCL+F 
Sbjct  284  LVAQ--HLLAAADRYALERMRLLCEAKLCEGVTINTVATTLALAEQHNCLHLKGVCLKFI  341

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVA--GCEDECSSGGGKSRSVWAQLSDSG  706
            A  ENL AVMQ+DGFEYLKE+CP + +ELL+ VA  G     S G  K  S+     D  
Sbjct  342  ALPENLKAVMQTDGFEYLKESCPGVLAELLQYVAKIGEHSVNSCGYRKEGSL-----DGS  396

Query  707  DTDGRRVRQR  736
            D +GRRV+ R
Sbjct  397  DVNGRRVKPR  406



>ref|XP_008235067.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Prunus mume]
Length=357

 Score =   203 bits (517),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 164/248 (66%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            +NC VGVV+S  +   ++SI +P S +G  FG LLE+ +G+D+ F + GE F AHKLVLA
Sbjct  114  VNCMVGVVKSHTEGPKIYSIPVPPSSMGHQFGRLLESGKGTDVNFEIDGEIFAAHKLVLA  173

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  ++      I + ++E+ VFKA+LHF+Y DSL + +     +S+  S 
Sbjct  174  ARSPVFRAQLFGPMKDQNTRCIKVEDIEAPVFKALLHFIYWDSLPDMEELTGINSNGSST  233

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CEA LCKD+++N+VA TLALA+ +H  +LKTVCLRF 
Sbjct  234  LMAQ--HLLAAADRYGLDRLRLLCEANLCKDVAINTVATTLALAEQHHCFQLKTVCLRFV  291

Query  539  AE--NLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A   NL+ VMQ+DG+++LKE+CPS+ +ELL+ VA   +   S     R     + D  D 
Sbjct  292  ATPGNLSGVMQTDGYKHLKESCPSVLTELLEYVARVSEHSVS---LCRHGNEAILDGSDI  348

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  349  NGRRVKQR  356



>ref|XP_004493645.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Cicer arietinum]
Length=497

 Score =   207 bits (526),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 162/245 (66%), Gaps = 8/245 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            +NC+VGVVRS  +   ++SI IP SDIG  FG LLE+ +GSD+ F V GE F AHKLVLA
Sbjct  167  VNCSVGVVRSRTEGPKIYSIAIPPSDIGQKFGQLLESGKGSDVSFEVNGEIFTAHKLVLA  226

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  ++      I + +ME+ VFKA+LHF+Y DSL +       +S   + 
Sbjct  227  ARSPVFRAQLFGPMKDQNTRCIKVEDMEAPVFKALLHFMYWDSLPDMQELTGMNSKWATT  286

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CE  LC+D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  287  LMAQ--HLLAAADRYALERLRLICEVSLCEDVAINTVATTLALAEQHHCFQLKAVCLKFI  344

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA    E S    K R+    + D  D 
Sbjct  345  ATSENLRAVMQTDGFEYLKESCPSVLTELLEYVARFT-EHSDFMCKHRN--EAILDGSDV  401

Query  713  DGRRV  727
            +GRR+
Sbjct  402  NGRRL  406



>ref|XP_009134877.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Brassica 
rapa]
 emb|CDY58342.1| BnaA03g57430D [Brassica napus]
Length=403

 Score =   204 bits (520),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 113/248 (46%), Positives = 161/248 (65%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            + C VGVV+S  +    ++I +P SD+G  FG LLE+ +G D+ F V GE F AH LVLA
Sbjct  159  VRCCVGVVKSHTEGPRSYNIPVPVSDLGHQFGKLLESGKGVDVTFQVDGETFPAHTLVLA  218

Query  182  ARSPIFRSEFFDGLES-DEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  L++ + + I I +ME+ +FK  LHF+Y D L + +    +     S 
Sbjct  219  ARSPVFRAQLFGPLKNQNTKRIEIEDMEAPIFKMFLHFIYWDELPDMEDIMGTDLKWAST  278

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CE+ LC+ IS+N+VA TLALA+ +H  +LK  CL+F 
Sbjct  279  LVAQ--HLLAAADRYALERLRTICESKLCEGISINTVATTLALAEQHHCFQLKAACLKFI  336

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  +NL AVM++DGF+YLKE+CP L SELL+ VA   +   +  G+ + ++A   D GD 
Sbjct  337  ALPQNLKAVMETDGFDYLKESCPCLLSELLEYVARLSEHSLTSTGQRKELYA---DGGDV  393

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  394  NGRRVKQR  401



>ref|XP_002279548.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 [Vitis 
vinifera]
 emb|CBI26169.3| unnamed protein product [Vitis vinifera]
Length=408

 Score =   204 bits (520),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 119/250 (48%), Positives = 163/250 (65%), Gaps = 11/250 (4%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I C+VGVV+S  +   +++I +  S+IG HFG LLE+ +G+D+ F V GE F AHKLVLA
Sbjct  163  IRCSVGVVKSYTEGPKIYTIAVMPSNIGQHFGQLLESGKGTDVNFEVDGEIFSAHKLVLA  222

Query  182  ARSPIFRSEFFDGLES-DEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  ++  + Q I I +ME+ VFKA+LHF Y D+L +       +S   S 
Sbjct  223  ARSPVFRAQLFGPMKDCNTQLIKIEDMEAPVFKALLHFTYWDALPDMQELVGMNSKWAST  282

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CE  LC+D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  283  MMAQ--HLLAAADRYGLDRLRLLCEDKLCEDVAINTVATTLALAEQHHCFQLKAVCLKFV  340

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVA--GCEDECSSGGGKSRSVWAQLSDSG  706
            A  ENL AVMQ+DGF+YLK++CPS+ +ELL+ VA  G       G G        L D  
Sbjct  341  ALPENLKAVMQTDGFDYLKQSCPSVLTELLEYVARIGEHSVIVCGHGNENI----LLDGS  396

Query  707  DTDGRRVRQR  736
            D +GRRV+QR
Sbjct  397  DVNGRRVKQR  406



>emb|CDY08064.1| BnaC03g34590D [Brassica napus]
Length=407

 Score =   204 bits (520),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 113/248 (46%), Positives = 161/248 (65%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            + C VGVV+S  +    ++I +P SD+G  FG LLE+ +G D+ F V GE F AH LVLA
Sbjct  163  VRCCVGVVKSHTEGPRSYNIPVPVSDLGHQFGKLLESGKGVDVTFQVDGETFPAHTLVLA  222

Query  182  ARSPIFRSEFFDGLES-DEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  L++ + + I I +ME+ +FK  LHF+Y D L + +    +     S 
Sbjct  223  ARSPVFRAQLFGPLKNQNTKRIDIEDMEAPIFKMFLHFIYWDELPDMEDIMGTDLKWAST  282

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CE+ LC+ IS+N+VA TLALA+ +H  +LK  CL+F 
Sbjct  283  LVAQ--HLLAAADRYALERLRTICESKLCEGISINTVATTLALAEQHHCFQLKAACLKFI  340

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  +NL AVM++DGF+YLKE+CP L SELL+ VA   +   +  G+ + ++A   D GD 
Sbjct  341  ALPQNLKAVMETDGFDYLKESCPCLLSELLEYVARLSEHSLTSTGQRKELYA---DGGDV  397

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  398  NGRRVKQR  405



>gb|KHG05413.1| BTB/POZ and MATH domain-containing 2 -like protein [Gossypium 
arboreum]
Length=404

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/252 (46%), Positives = 163/252 (65%), Gaps = 16/252 (6%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C+VGVV S  +    +SI +P S IG HFG LL+  +G+D+ F V GE F+AHKLVLA
Sbjct  161  VHCSVGVVTSHTEGPKFYSIAVPPSRIGHHFGQLLKIGKGTDVSFEVDGEVFYAHKLVLA  220

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  + E + ++I + ++E+ VFKA+LHF+Y DSL +        S   + 
Sbjct  221  ARSPVFRAQLFGPMKEQNTKQIKVEDIEAPVFKALLHFMYWDSLPDMQELTGLDSKWVTT  280

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              +    LL AADRY L RL+ +CE+ LC+D+++N+ A TLALA+ +H  +LK VCL+F 
Sbjct  281  LMSQ--HLLAAADRYGLERLRLLCESNLCEDVTINTAATTLALAEQHHCFQLKAVCLKFV  338

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDE----CSSGGGKSRSVWAQLSD  700
            A  ENL AVMQ+DGF YLKE+CPS+ +ELL+ VA   +     C  G          + D
Sbjct  339  AVPENLRAVMQTDGFVYLKESCPSVMTELLEYVARVIEHSMYVCKHG-------IEPIFD  391

Query  701  SGDTDGRRVRQR  736
              D +GRRV+QR
Sbjct  392  GSDANGRRVKQR  403



>ref|XP_006588617.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Glycine max]
 gb|KHN03775.1| BTB/POZ and MATH domain-containing protein 2 [Glycine soja]
Length=413

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 163/248 (66%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            +NC+VGVV+S  +   ++ I IP S++G  FG LLE+ + SD+ F V GE F AHKLVLA
Sbjct  170  VNCSVGVVKSHTEGPKIYKIPIPSSNMGQQFGKLLESGKDSDVSFEVNGEIFAAHKLVLA  229

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  +++     I + +ME+ VFKA+LH +Y DSL +       SS   + 
Sbjct  230  ARSPVFRAQLFGPMKNQNTHCIKVEDMEAPVFKALLHVIYWDSLPDMQELTGLSSKWATT  289

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ MCE  LC+D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  290  LMAQ--HLLAAADRYGLERLRLMCETSLCEDVAINTVATTLALAEQHHCFQLKAVCLKFV  347

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA    E S    K R+    + D  D 
Sbjct  348  ARPENLRAVMQTDGFEYLKESCPSVLTELLEYVARF-TEHSDFLCKHRN--ELILDGSDV  404

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  405  NGRRVKQR  412



>ref|XP_010905244.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X1 [Elaeis guineensis]
Length=414

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/252 (46%), Positives = 163/252 (65%), Gaps = 17/252 (7%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C+VGVVRS  +   +++I +P S+I  HFG LLE+ +G+D+ F V GE F AHKLVLA
Sbjct  172  VSCSVGVVRSRTEGPKIYTIPVPPSNIAQHFGQLLESGKGTDVAFEVDGEIFAAHKLVLA  231

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  + + + Q I + +ME+ VFKA+LHF+Y DSL + +     ++   S 
Sbjct  232  ARSPVFRAQLFGPMKDRNMQCIKVEDMEATVFKALLHFIYWDSLPDMEELTGLNTKWAST  291

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RLK +CE  LC+D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  292  LMAQ--HLLAAADRYALERLKSLCEVKLCEDVAINTVATTLALAEQHHCFQLKAVCLKFI  349

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCED----ECSSGGGKSRSVWAQLSD  700
            A  ENL AVMQ+DGFEYLK +CPS+ +ELL  VA   +     C+           +  D
Sbjct  350  ALPENLRAVMQTDGFEYLKVSCPSILTELLDYVARVGEHSVIPCTYAN--------EALD  401

Query  701  SGDTDGRRVRQR  736
              D +GRRV+ R
Sbjct  402  GSDANGRRVKPR  413



>ref|XP_006850808.1| hypothetical protein AMTR_s00025p00114450 [Amborella trichopoda]
 gb|ERN12389.1| hypothetical protein AMTR_s00025p00114450 [Amborella trichopoda]
Length=408

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/249 (45%), Positives = 164/249 (66%), Gaps = 9/249 (4%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C+VGVVRS  +   +++I +P S+IG HFG LLE+ +G+D+ F V GE F  HKLVLA
Sbjct  166  VHCSVGVVRSHTEGPKLYTIPVPPSNIGEHFGKLLESGQGADVSFEVDGEIFPTHKLVLA  225

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++    ++    + I ++++E+ VFKA+LHF+YTD+L +       +S   + 
Sbjct  226  ARSPVFRAQLMGPMKDQNTDCIKVTDIEAPVFKALLHFIYTDTLPDMQELTGLTSKCATT  285

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY + RL+ +CE  LC+DIS+N+VA TLALA+ +H  +LK+VCL+F 
Sbjct  286  LMAQ--HLLAAADRYGMERLRLLCEVKLCEDISINTVATTLALAEQHHCFQLKSVCLKFV  343

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A   NL AVMQ++GFEYLK++CP + +ELL+ VA   +            +    D  D+
Sbjct  344  ALPTNLRAVMQTEGFEYLKQSCPPVLTELLEYVARVGEHSIITCRHQNEAF----DGTDS  399

Query  713  DGRRVRQRT  739
            +GRRV+QRT
Sbjct  400  NGRRVKQRT  408



>ref|XP_008808250.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X1 [Phoenix dactylifera]
Length=414

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/252 (45%), Positives = 164/252 (65%), Gaps = 17/252 (7%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C+VGVVRS  +   +++I +P S+I  HFG LLE+ +G+D+ F V GE F AHKLVLA
Sbjct  172  VSCSVGVVRSRTEGPKIYTIPVPPSNIAQHFGQLLESGKGTDVAFEVDGEIFSAHKLVLA  231

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  + + + Q I + +ME+ +FKA+LHF+Y DSL + +     ++   S 
Sbjct  232  ARSPVFRAQLFGPMKDRNMQCIKVEDMEAPIFKALLHFIYWDSLPDMEELTGLNTKWAST  291

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RLK +CE  LC+D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  292  LMAQ--HLLAAADRYALERLKSLCEVKLCEDVAINTVATTLALAEQHHCFQLKAVCLKFI  349

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLS----D  700
            A  ENL AVMQ+DGFEYL+ +CPS+ +ELL+ VA          G+   +    +    D
Sbjct  350  ALPENLRAVMQTDGFEYLRVSCPSILTELLEYVARV--------GEHSVIPCTFANDALD  401

Query  701  SGDTDGRRVRQR  736
              D +GRRV+ R
Sbjct  402  GSDANGRRVKPR  413



>ref|XP_011006874.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Populus euphratica]
Length=410

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 168/250 (67%), Gaps = 14/250 (6%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            + C VGVV+S  +    ++I +P S+IG HFG LL++ +G+D+ F V GE F +HK+VLA
Sbjct  168  VRCCVGVVKSHTEGPKTYTISVPPSNIGQHFGKLLDSGKGTDVNFEVDGETFASHKIVLA  227

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  + + + Q I + +ME+ VFKA++HF+Y D+L + +     +S   S 
Sbjct  228  ARSPVFRAQLFGPMKDQNTQCIKVEDMEAPVFKALIHFMYWDALPDIEELVGLNSKWVST  287

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CEA LC+D+++N+VA TLALA+ +  ++LK+VCL+F 
Sbjct  288  LMAQ--HLLAAADRYALERLRLLCEARLCEDVAINTVATTLALAEQHQCIQLKSVCLKFI  345

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA         G +S       +D+ D+
Sbjct  346  ALPENLKAVMQTDGFEYLKESCPSVITELLQYVA-------KNGERSVITCTHGNDTLDS  398

Query  713  D--GRRVRQR  736
            D  GRRV+QR
Sbjct  399  DMNGRRVKQR  408



>ref|XP_004495233.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X2 [Cicer arietinum]
Length=410

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 163/248 (66%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            +NC+VGVV+S  +    +SI I  S IG  FG LLE  +GSD+ F V GE F AHKLVLA
Sbjct  167  VNCSVGVVKSHTEGPKTYSIAISPSSIGHQFGKLLEGGKGSDVSFEVNGEIFAAHKLVLA  226

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARS +FR++ F  + + + Q I + ++E+ VFKA+LH +Y DSL +       SS   + 
Sbjct  227  ARSAVFRAQLFGPMKDQNTQCIKVEDIEAPVFKALLHVIYWDSLPDMQELTGLSSKWATT  286

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              +    LL AADRY L RL+ MCEA LC+D+++N+VA TLALA+ +H   LK VCL+F 
Sbjct  287  LMSQ--HLLAAADRYGLDRLRLMCEASLCEDVAINTVATTLALAEQHHCFRLKAVCLKFI  344

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA    E S    K R+   Q+ D  D 
Sbjct  345  ARPENLRAVMQTDGFEYLKESCPSVLTELLEYVARF-TEHSDFLCKHRN--EQILDGSDI  401

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  402  NGRRVKQR  409



>ref|XP_003590693.1| Speckle-type POZ protein [Medicago truncatula]
 gb|AES60944.1| BTB/POZ/MATH-domain protein [Medicago truncatula]
Length=418

 Score =   202 bits (514),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 162/248 (65%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            +NC+VGVVRS  +     SI I  S IG  FG LLE+ + SD+ F V GE F AHKLVLA
Sbjct  171  VNCSVGVVRSHTEGPKTFSIPISPSTIGHQFGKLLESGKSSDVNFEVNGEIFAAHKLVLA  230

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  + + + Q I + ++E+ VFKA+LH +Y DSL +       +S   + 
Sbjct  231  ARSPVFRAQLFGPMKDQNTQCIKVEDIEAPVFKALLHVIYWDSLPDMQELTGINSKWATT  290

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ MCEA LC+D+++N+VA TLALA+ +H  +LK VCL+F 
Sbjct  291  LMAQ--HLLAAADRYALDRLRLMCEASLCEDVAINTVATTLALAEQHHCFQLKAVCLKFI  348

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA    E S    K R+    + D  D 
Sbjct  349  ARPENLRAVMQTDGFEYLKESCPSVLTELLEYVARF-TEHSDFLCKHRN--EAILDGSDV  405

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  406  NGRRVKQR  413



>gb|KFK38092.1| hypothetical protein AALP_AA3G068300 [Arabis alpina]
Length=406

 Score =   202 bits (513),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 158/248 (64%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            + C VGVV+S  +    ++I +P SD+G  FG LL++  G+DI F V GE F AHKLVLA
Sbjct  162  VRCCVGVVKSRTEGPRSYNIPVPVSDLGQQFGKLLDSERGADITFEVDGETFPAHKLVLA  221

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  L++     I + ++E+ +FK +LHF+Y D L +      +     S 
Sbjct  222  ARSPVFRAQLFGPLKNGNTTCINVEDIEAPIFKMLLHFIYWDELPDMQDLIGTDLKWAST  281

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CE+ LC+ IS+N+VA TL LA+ +H  +LK  CL+F 
Sbjct  282  LVAQ--HLLAAADRYALERLRTICESKLCEGISINTVATTLTLAEQHHCFQLKAACLKFI  339

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVM++DGF+YLKE+CPSL SELL+ VA   +   +  G  + ++A   D  D 
Sbjct  340  ASPENLKAVMETDGFDYLKESCPSLLSELLEYVARLSEHSITSSGNRKELYA---DGCDV  396

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  397  NGRRVKQR  404



>ref|XP_010545078.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Tarenaya hassleriana]
Length=534

 Score =   205 bits (521),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/248 (46%), Positives = 160/248 (65%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C+VGVVRS ++   ++ I IP SDI   FG LLE+ +G+D+ F V GE F AHKL+LA
Sbjct  291  VHCSVGVVRSRVEGPRVYYIEIPPSDICHDFGKLLESGKGTDVSFEVDGELFAAHKLILA  350

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  ++      I I ++E+ VFKA+LHF+Y       DL+  +  +    
Sbjct  351  ARSPVFRAQLFGPMKDRNTHCITIEDIEAPVFKALLHFIY--WDSLPDLQELAGLNSKWA  408

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
               +   LL AADRY L RL+  C A LC D+++N+VA TLALA+ +H  +LK VCL++ 
Sbjct  409  LTLMSQHLLAAADRYGLERLRLQCMANLCDDVTINTVATTLALAEQHHCFQLKNVCLKYI  468

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ++GFEYLKE+CPS+ +ELL+ VA   + C+   G        + D  D 
Sbjct  469  AMPENLRAVMQTEGFEYLKESCPSVLTELLEQVARVSEHCTIVKGTGSEA---VLDGSDV  525

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  526  NGRRVKQR  533



>ref|XP_002516797.1| Speckle-type POZ protein, putative [Ricinus communis]
 gb|EEF45411.1| Speckle-type POZ protein, putative [Ricinus communis]
Length=403

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 163/252 (65%), Gaps = 18/252 (7%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            I C VGVV+S  +    ++I +  SDIG HFG LLE+ +G+D+ F V GE F AHKLVLA
Sbjct  161  IRCCVGVVKSQTEGPKTYTIAVLPSDIGQHFGKLLESGKGADVNFEVDGEVFSAHKLVLA  220

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
             RSP+FR++ F  + + + Q I + +ME+ VFKA+LHF+Y D+L + +     +S   S 
Sbjct  221  TRSPVFRAQLFGPMKDQNTQCIKVEDMEAPVFKALLHFIYWDALPDVEELVGLNSKWAST  280

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CEA LC+DI++N+VA TLALA+ +  ++LK VCL+F 
Sbjct  281  LIAQ--HLLAAADRYALERLRLVCEAKLCEDIAINTVATTLALAEQHQCLQLKAVCLKFI  338

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDE----CSSGGGKSRSVWAQLSD  700
            A  ENL AVMQ+DGFEYLKE+CP + +ELL+ VA   +     C+ G           S 
Sbjct  339  ALPENLKAVMQTDGFEYLKESCPCVITELLQYVARIGEHSGIACAHGNE---------SL  389

Query  701  SGDTDGRRVRQR  736
             GD +GRRV+QR
Sbjct  390  DGDLNGRRVKQR  401



>ref|XP_010326625.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Solanum lycopersicum]
Length=412

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 164/248 (66%), Gaps = 8/248 (3%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++C VGVVRS  +    +SI +  SDIG HFG LLE+ + +D+ F+V GE F AHKLVLA
Sbjct  169  VHCCVGVVRSHTEGPKTYSIPLSPSDIGLHFGQLLESGKDTDVNFDVNGEVFAAHKLVLA  228

Query  182  ARSPIFRSEFFDGLESDEQE-IVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  ++    E I + +ME+ VFKA+LHF+Y D L + +     ++   S 
Sbjct  229  ARSPVFRAQLFGPMKDQNTEHIKVEDMEAPVFKALLHFMYWDVLPDMEELTGLNTKWAST  288

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
              +    LL AAD Y L RL+ +CEA LC+++++N+VA TLALA+ +H  +LK+VCL+F 
Sbjct  289  LMSQ--HLLAAADCYGLDRLRLLCEANLCEEVAINTVATTLALAEQHHCFQLKSVCLKFV  346

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ+DGF+YL+E+CP + +ELL+ VA   +  S        +   + D GD 
Sbjct  347  AMPENLRAVMQTDGFDYLRESCPHVLTELLEYVARVNEHSSITNKLGNGL---VLDGGDF  403

Query  713  DGRRVRQR  736
            +GRRV+QR
Sbjct  404  NGRRVKQR  411



>emb|CDP00137.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/256 (43%), Positives = 167/256 (65%), Gaps = 13/256 (5%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            ++CTVGVVR+ ++    ++I +P SD+G +   LLE+  GSDI F V  E F AHKL+LA
Sbjct  81   MHCTVGVVRTRVEGPKQYTISVPPSDMGQNLKYLLESEIGSDITFQVGDEAFKAHKLILA  140

Query  182  ARSPIFRSEFFDGLESDEQEIV-ISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++FF  +    +EIV ++++E  +FK MLHF+Y+D L +      S+S   S 
Sbjct  141  ARSPVFRAQFFGLIGDPNKEIVELADIEPSIFKVMLHFIYSDDLPDLHEITGSTSMCTST  200

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RLK++CEA LC+++S ++VA TL+LA+ +H ++LK +CL+FA
Sbjct  201  IMLQ--HLLAAADRYGLDRLKQLCEARLCEEVSADTVATTLSLAEQHHCLQLKAICLKFA  258

Query  539  AENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRS----------VWA  688
            A NL  VMQS+GF +L+ +CPSL SELL+T+A  +++ +    K RS             
Sbjct  259  ATNLGVVMQSEGFRHLELSCPSLLSELLETIASVDEKPNLMSSKKRSGSSIFGIDLVADG  318

Query  689  QLSDSGDTDGRRVRQR  736
              ++S + + RR+R+R
Sbjct  319  AAAESVNPNVRRIRRR  334



>ref|XP_010425835.1| PREDICTED: BTB/POZ and MATH domain-containing protein 6-like 
[Camelina sativa]
Length=354

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 146/192 (76%), Gaps = 4/192 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S I C  +HSIH+PDS++G+HFG LL+ +EGSD+ F++AGEKF AHKLVLA
Sbjct  162  INCTVGVVVSEIHCPRLHSIHVPDSELGSHFGKLLDTLEGSDVKFDIAGEKFQAHKLVLA  221

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleassss----si  349
            ARS  FRS+F++  E++  E+VIS++E KVFKA+LHF+Y DSL  D    ++ S     +
Sbjct  222  ARSSFFRSKFYNMPEANNNELVISDLEPKVFKALLHFMYKDSLSGDVEPVTAHSFGLLKL  281

Query  350  psisdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCL  529
              I +TL  KLL AA +Y+L RL+ +CE+++CK +S++SV+K LAL+D Y+A ELK+V L
Sbjct  282  SEIDETLIVKLLAAATKYNLSRLRSLCESHICKAVSISSVSKILALSDRYNATELKSVSL  341

Query  530  RFAAENLAAVMQ  565
             FAAENLA  ++
Sbjct  342  NFAAENLAGTIK  353



>ref|XP_002315535.1| speckle-type POZ family protein [Populus trichocarpa]
 gb|EEF01706.1| speckle-type POZ family protein [Populus trichocarpa]
Length=410

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 167/250 (67%), Gaps = 14/250 (6%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            + C VGVV+S  +    ++I +P S+IG HFG LL++  G+D+ F V GE F +HK+VLA
Sbjct  168  VRCCVGVVKSHTEGPKTYTISVPPSNIGQHFGKLLDSGTGTDVNFEVDGETFASHKIVLA  227

Query  182  ARSPIFRSEFFDGL-ESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsi  358
            ARSP+FR++ F  + + + Q I + +ME+ VFKA++HF+Y D+L + +     +S   S 
Sbjct  228  ARSPVFRAQLFGPMKDQNTQCIKVEDMEAPVFKALIHFMYWDALPDIEELVGLNSKWVST  287

Query  359  sdtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFA  538
                   LL AADRY L RL+ +CEA LC+D+++N+VA TLALA+ +  ++LK+VCL+F 
Sbjct  288  LMAQ--HLLAAADRYALERLRLLCEARLCEDVAINTVATTLALAEQHQCIQLKSVCLKFI  345

Query  539  A--ENLAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDECSSGGGKSRSVWAQLSDSGDT  712
            A  ENL AVMQ+DGFEYLKE+CPS+ +ELL+ VA         G +S       +D+ D+
Sbjct  346  ALPENLKAVMQTDGFEYLKESCPSVITELLQYVA-------KNGERSVITCTLGNDTLDS  398

Query  713  D--GRRVRQR  736
            D  GRRV+QR
Sbjct  399  DMNGRRVKQR  408



>ref|XP_010113211.1| BTB/POZ and MATH domain-containing protein 4 [Morus notabilis]
 gb|EXC74092.1| BTB/POZ and MATH domain-containing protein 4 [Morus notabilis]
Length=359

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 134/183 (73%), Gaps = 3/183 (2%)
 Frame = +2

Query  2    INCTVGVVRSTIDCSGMHSIHIPDSDIGAHFGMLLENMEGSDIIFNVAGEKFHAHKLVLA  181
            INCTVGVV S +D S + S+H+P SDIG HFGMLLEN EGSD+ FNV+G KF AHKLV+A
Sbjct  146  INCTVGVVVSAMDSSRLQSVHVPQSDIGVHFGMLLENEEGSDVTFNVSGVKFPAHKLVMA  205

Query  182  ARSPIFRSEFFDGLESDEQEIVISNMESKVFKAMLHFVYtdslleddleasssssipsis  361
            ARS +F  E FDG+E D  EIVI++ME  VFKA+LHF+Y D+L+E     +SSSS     
Sbjct  206  ARSSVFEKEIFDGIEEDNPEIVITDMEPDVFKALLHFIYRDTLMEGVDSLNSSSSSSETL  265

Query  362  dtlpAKLLEAADRYDLGRLKRMCEAYLCKDISVNSVAKTLALADCYHAMELKTVCLRFAA  541
                     AAD+Y L RL+ MCE+ LCKDISV SV+  LALAD +HA +LK+VCL+FAA
Sbjct  266  AAKLLA---AADKYLLPRLRLMCESVLCKDISVTSVSNILALADRHHATDLKSVCLKFAA  322

Query  542  ENL  550
            ENL
Sbjct  323  ENL  325



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2714028746400