BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19689_g5_i1 len=353 path=[1979:0-352]

Length=353
                                                                      Score     E

emb|CDP02199.1|  unnamed protein product                                115   4e-28   
ref|XP_011098576.1|  PREDICTED: probable pectate lyase P56              112   1e-26   
ref|XP_004234780.1|  PREDICTED: probable pectate lyase P56              105   1e-24   
dbj|BAK05605.1|  predicted protein                                      103   2e-23   
ref|XP_006361836.1|  PREDICTED: probable pectate lyase P56-like         102   2e-23   
ref|XP_004233352.1|  PREDICTED: pectate lyase-like                      102   3e-23   
ref|XP_006357121.1|  PREDICTED: pectate lyase-like                      100   1e-22   
ref|XP_004155392.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    100   1e-22   
ref|XP_004135462.1|  PREDICTED: probable pectate lyase P59-like         100   1e-22   
ref|XP_009757256.1|  PREDICTED: pectate lyase                           100   1e-22   
ref|XP_009599824.1|  PREDICTED: pectate lyase                         99.4    2e-22   
ref|XP_009389712.1|  PREDICTED: pectate lyase-like                    99.8    3e-22   
ref|XP_010683249.1|  PREDICTED: pectate lyase-like                    99.8    3e-22   
ref|XP_004964534.1|  PREDICTED: pectate lyase-like                    99.8    3e-22   
ref|XP_008341537.1|  PREDICTED: pectate lyase-like                    99.8    4e-22   
emb|CDY66593.1|  BnaCnng51570D                                        99.8    6e-22   
ref|XP_009342871.1|  PREDICTED: pectate lyase-like                    99.0    6e-22   
ref|XP_008357758.1|  PREDICTED: pectate lyase-like                    99.0    6e-22   
ref|XP_009121613.1|  PREDICTED: probable pectate lyase 19             99.4    8e-22   
ref|XP_008446316.1|  PREDICTED: probable pectate lyase P59            98.6    8e-22   
ref|XP_002282500.3|  PREDICTED: pectate lyase                         98.2    1e-21   Vitis vinifera
emb|CAN79927.1|  hypothetical protein VITISV_042447                   98.2    1e-21   Vitis vinifera
ref|XP_006363934.1|  PREDICTED: pectate lyase-like                    97.8    1e-21   
ref|XP_006573090.1|  PREDICTED: probable pectate lyase 3-like         98.2    1e-21   
ref|XP_010551866.1|  PREDICTED: probable pectate lyase 19             98.2    1e-21   
emb|CBI22159.3|  unnamed protein product                              98.2    2e-21   
ref|NP_001056781.1|  Os06g0144200                                     97.8    2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|KHN01171.1|  Putative pectate lyase 3                              97.4    2e-21   
gb|EAZ35814.1|  hypothetical protein OsJ_20107                        94.7    2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99626.1|  hypothetical protein OsI_21605                        97.4    2e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_004302354.1|  PREDICTED: probable pectate lyase P59-like       97.4    2e-21   
dbj|BAD68402.1|  putative pectate lyase homolog                       97.4    2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|AAA16476.1|  pectate lyase homolog                                 97.4    2e-21   Zea mays [maize]
ref|XP_003552513.1|  PREDICTED: pectate lyase-like                    97.4    2e-21   
ref|XP_008443432.1|  PREDICTED: probable pectate lyase 19             97.1    3e-21   
ref|XP_009131435.1|  PREDICTED: probable pectate lyase 19             97.4    3e-21   
ref|XP_010096345.1|  putative pectate lyase 7                         96.3    3e-21   
ref|XP_011085777.1|  PREDICTED: probable pectate lyase P59            96.7    4e-21   
gb|AGT16687.1|  pectate lyase                                         96.7    4e-21   
gb|KHN13652.1|  Pectate lyase                                         96.7    4e-21   
ref|XP_010492335.1|  PREDICTED: probable pectate lyase 19             97.1    4e-21   
gb|EMS65801.1|  hypothetical protein TRIUR3_32637                     95.1    5e-21   
ref|XP_006842121.1|  hypothetical protein AMTR_s00078p00106380        96.3    6e-21   
ref|XP_004147462.1|  PREDICTED: probable pectate lyase 7-like         96.3    6e-21   
gb|KGN59593.1|  hypothetical protein Csa_3G827350                     96.3    6e-21   
ref|XP_007215366.1|  hypothetical protein PRUPE_ppa005602mg           95.9    8e-21   
ref|XP_009797403.1|  PREDICTED: pectate lyase-like                    95.9    8e-21   
ref|XP_008389523.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...  95.9    9e-21   
ref|XP_004236194.1|  PREDICTED: probable pectate lyase P59            95.5    9e-21   
ref|XP_008365507.1|  PREDICTED: pectate lyase-like                    95.1    9e-21   
emb|CDP14850.1|  unnamed protein product                              95.5    1e-20   
emb|CDX70590.1|  BnaC03g06740D                                        95.9    1e-20   
ref|XP_009617495.1|  PREDICTED: probable pectate lyase P59            95.5    1e-20   
ref|XP_002437815.1|  hypothetical protein SORBIDRAFT_10g003090        95.5    1e-20   Sorghum bicolor [broomcorn]
ref|NP_001056786.1|  Os06g0145100                                     94.4    1e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004228388.1|  PREDICTED: pectate lyase                         95.1    1e-20   
ref|XP_003613595.1|  Pectate lyase                                    95.1    1e-20   
ref|XP_009360393.1|  PREDICTED: probable pectate lyase 3              95.1    1e-20   
ref|XP_009802165.1|  PREDICTED: probable pectate lyase P59            95.1    2e-20   
ref|XP_006344502.1|  PREDICTED: probable pectate lyase P59-like       94.7    2e-20   
ref|XP_006655782.1|  PREDICTED: pectate lyase-like                    94.0    2e-20   
ref|XP_010550068.1|  PREDICTED: probable pectate lyase 19             95.1    2e-20   
ref|NP_001056784.1|  Os06g0144900                                     94.7    2e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99621.1|  hypothetical protein OsI_21600                        94.7    2e-20   Oryza sativa Indica Group [Indian rice]
emb|CDX74293.1|  BnaA03g27540D                                        95.1    2e-20   
ref|XP_006431087.1|  hypothetical protein CICLE_v10011762mg           94.4    2e-20   
ref|XP_006826355.1|  hypothetical protein AMTR_s00004p00123190        95.1    2e-20   
ref|XP_006482544.1|  PREDICTED: probable pectate lyase 19-like        94.4    3e-20   
ref|XP_011085780.1|  PREDICTED: probable pectate lyase P59            94.7    3e-20   
ref|XP_003519771.2|  PREDICTED: probable pectate lyase 3-like         94.4    3e-20   
ref|XP_008339934.1|  PREDICTED: probable pectate lyase 3              94.4    3e-20   
gb|KHN08706.1|  Putative pectate lyase 3                              94.4    3e-20   
ref|XP_010420165.1|  PREDICTED: probable pectate lyase 19 isoform X3  94.7    3e-20   
emb|CDX91953.1|  BnaC03g32550D                                        94.4    4e-20   
gb|EYU34111.1|  hypothetical protein MIMGU_mgv1a006386mg              94.0    4e-20   
ref|XP_004490003.1|  PREDICTED: probable pectate lyase 3-like iso...  94.4    4e-20   
ref|XP_004490004.1|  PREDICTED: probable pectate lyase 3-like iso...  93.2    4e-20   
ref|XP_008230729.1|  PREDICTED: pectate lyase                         94.0    4e-20   
ref|XP_008456459.1|  PREDICTED: pectate lyase-like                    94.0    4e-20   
ref|XP_006428983.1|  hypothetical protein CICLE_v10013750mg           94.0    4e-20   
ref|XP_010915114.1|  PREDICTED: LOW QUALITY PROTEIN: pectate lyas...  94.0    4e-20   
ref|XP_006286712.1|  hypothetical protein CARUB_v10002862mg           94.7    4e-20   
ref|XP_009758350.1|  PREDICTED: pectate lyase-like                    94.0    5e-20   
ref|XP_009599232.1|  PREDICTED: pectate lyase-like                    94.0    5e-20   
ref|XP_009789922.1|  PREDICTED: pectate lyase-like                    93.2    5e-20   
ref|XP_008339935.1|  PREDICTED: probable pectate lyase 3              94.0    5e-20   
ref|XP_006480843.1|  PREDICTED: probable pectate lyase 19-like        93.6    5e-20   
gb|EAY99627.1|  hypothetical protein OsI_21606                        93.2    5e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_010256490.1|  PREDICTED: pectate lyase-like                    93.6    5e-20   
ref|XP_010317101.1|  PREDICTED: probable pectate lyase P59            92.8    5e-20   
ref|XP_006357289.1|  PREDICTED: probable pectate lyase 3-like         94.0    6e-20   
ref|XP_011098575.1|  PREDICTED: probable pectate lyase P59            93.6    6e-20   
ref|XP_010420163.1|  PREDICTED: probable pectate lyase 19 isoform X1  94.0    6e-20   
ref|XP_010420164.1|  PREDICTED: probable pectate lyase 19 isoform X2  93.6    7e-20   
ref|XP_009587688.1|  PREDICTED: pectate lyase-like                    92.8    7e-20   
ref|XP_006354795.1|  PREDICTED: pectate lyase-like                    92.4    1e-19   
ref|XP_011097774.1|  PREDICTED: pectate lyase-like                    92.4    1e-19   
gb|KDO49831.1|  hypothetical protein CISIN_1g044170mg                 91.7    2e-19   
gb|KEH24975.1|  pectate lyase P59-like protein                        92.4    2e-19   
ref|XP_008221660.1|  PREDICTED: probable pectate lyase 3              92.4    2e-19   
ref|XP_009134622.1|  PREDICTED: probable pectate lyase 7              92.4    2e-19   
gb|ABK28696.1|  unknown                                               92.4    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197015.4|  putative pectate lyase 19                           92.4    2e-19   Arabidopsis thaliana [mouse-ear cress]
gb|EMT27253.1|  hypothetical protein F775_20306                       91.3    2e-19   
ref|XP_009125036.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...  92.4    2e-19   
ref|XP_003613596.1|  Pectate lyase                                    92.0    2e-19   
ref|XP_010066949.1|  PREDICTED: pectate lyase                         91.7    2e-19   
sp|Q9LFP5.1|PLY19_ARATH  RecName: Full=Probable pectate lyase 19;...  92.0    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004165454.1|  PREDICTED: pectate lyase-like                    91.7    2e-19   
emb|CDY28691.1|  BnaCnng05770D                                        92.0    2e-19   
ref|XP_002270089.1|  PREDICTED: pectate lyase                         91.3    4e-19   Vitis vinifera
ref|XP_009788285.1|  PREDICTED: pectate lyase-like                    91.3    4e-19   
ref|XP_002871648.1|  pectate lyase family protein                     91.7    4e-19   
ref|XP_004298448.1|  PREDICTED: probable pectate lyase 3-like         90.9    5e-19   
ref|XP_009627245.1|  PREDICTED: pectate lyase-like                    90.9    6e-19   
ref|XP_009598230.1|  PREDICTED: pectate lyase-like                    90.9    6e-19   
ref|XP_010112093.1|  putative pectate lyase 7                         90.5    6e-19   
ref|XP_010105747.1|  putative pectate lyase P59                       90.5    7e-19   
gb|EPS66620.1|  hypothetical protein M569_08154                       90.5    7e-19   
ref|XP_010453638.1|  PREDICTED: probable pectate lyase 19             90.9    8e-19   
ref|XP_010417138.1|  PREDICTED: probable pectate lyase 7              87.0    1e-18   
ref|XP_008446067.1|  PREDICTED: pectate lyase-like                    89.4    1e-18   
ref|XP_010678579.1|  PREDICTED: pectate lyase-like                    89.7    1e-18   
ref|XP_011087217.1|  PREDICTED: pectate lyase-like                    89.7    1e-18   
ref|XP_009761969.1|  PREDICTED: probable pectate lyase P59            89.7    1e-18   
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15             89.7    2e-18   
emb|CDY01151.1|  BnaA04g06680D                                        89.7    2e-18   
ref|XP_010485518.1|  PREDICTED: probable pectate lyase 7              90.1    2e-18   
emb|CDY53564.1|  BnaC04g55760D                                        89.7    2e-18   
ref|XP_006484673.1|  PREDICTED: probable pectate lyase 19-like        89.4    2e-18   
ref|XP_009615547.1|  PREDICTED: probable pectate lyase P59            89.4    2e-18   
dbj|BAJ99909.1|  predicted protein                                    87.8    2e-18   
gb|KFK25747.1|  hypothetical protein AALP_AA8G154300                  89.7    2e-18   
ref|XP_006361835.1|  PREDICTED: probable pectate lyase P59-like       89.4    2e-18   
ref|NP_001150425.1|  LOC100284055 precursor                           89.4    3e-18   Zea mays [maize]
ref|XP_008793504.1|  PREDICTED: pectate lyase-like                    89.0    3e-18   
ref|XP_004232242.1|  PREDICTED: probable pectate lyase P59            89.0    3e-18   
dbj|BAD95093.1|  pectate lyase like protein                           85.9    3e-18   Arabidopsis thaliana [mouse-ear cress]
gb|EYU24412.1|  hypothetical protein MIMGU_mgv1a011674mg              87.4    3e-18   
gb|KDO49230.1|  hypothetical protein CISIN_1g036607mg                 88.6    3e-18   
ref|XP_009599826.1|  PREDICTED: probable pectate lyase P59 isofor...  88.6    4e-18   
ref|XP_009599825.1|  PREDICTED: probable pectate lyase P59 isofor...  88.6    4e-18   
ref|XP_002437204.1|  hypothetical protein SORBIDRAFT_10g022830        88.6    4e-18   Sorghum bicolor [broomcorn]
ref|XP_007046218.1|  Pectate lyase family protein, putative           88.6    4e-18   
ref|XP_002511525.1|  Pectate lyase precursor, putative                88.6    4e-18   Ricinus communis
ref|XP_002517472.1|  pectate lyase, putative                          88.2    4e-18   Ricinus communis
ref|XP_004234779.1|  PREDICTED: probable pectate lyase P59            88.6    5e-18   
gb|EYU36839.1|  hypothetical protein MIMGU_mgv1a006379mg              88.6    5e-18   
emb|CDY01846.1|  BnaC06g28860D                                        87.8    5e-18   
gb|AAB69766.1|  putative pectate lyase Nt59                           85.1    5e-18   Nicotiana tabacum [American tobacco]
ref|XP_010445460.1|  PREDICTED: probable pectate lyase 15             85.1    6e-18   
ref|XP_010513594.1|  PREDICTED: probable pectate lyase 7              88.2    6e-18   
gb|AGT16685.1|  pectate lyase precursor                               86.7    6e-18   
ref|XP_004162547.1|  PREDICTED: probable pectate lyase P59-like       87.8    6e-18   
ref|XP_009789921.1|  PREDICTED: probable pectate lyase P59            88.2    6e-18   
ref|XP_009105327.1|  PREDICTED: probable pectate lyase 5              87.4    6e-18   
emb|CDY56220.1|  BnaAnng14170D                                        87.4    7e-18   
ref|XP_003530685.1|  PREDICTED: probable pectate lyase 3-like         87.8    7e-18   
ref|XP_004489168.1|  PREDICTED: pectate lyase-like                    87.8    7e-18   
ref|XP_011013803.1|  PREDICTED: pectate lyase-like                    87.4    7e-18   
ref|XP_009380431.1|  PREDICTED: pectate lyase-like                    87.4    9e-18   
ref|XP_010463548.1|  PREDICTED: probable pectate lyase 7              87.8    9e-18   
ref|XP_006338480.1|  PREDICTED: probable pectate lyase P59-like       87.8    9e-18   
sp|P15722.1|PLY59_SOLLC  RecName: Full=Probable pectate lyase P59...  87.8    9e-18   Solanum lycopersicum
ref|XP_006374492.1|  hypothetical protein POPTR_0015s07590g           87.4    9e-18   
ref|XP_002870357.1|  pectate lyase family protein                     87.8    9e-18   
gb|KHN13490.1|  Putative pectate lyase 3                              86.7    9e-18   
gb|EYU28712.1|  hypothetical protein MIMGU_mgv1a006498mg              87.4    1e-17   
ref|XP_006291220.1|  hypothetical protein CARUB_v10017351mg           87.0    1e-17   
ref|XP_011071024.1|  PREDICTED: pectate lyase-like                    87.4    1e-17   
ref|XP_006357122.1|  PREDICTED: probable pectate lyase P59-like       87.4    1e-17   
ref|NP_567409.1|  probable pectate lyase 15                           87.4    1e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KGN47799.1|  hypothetical protein Csa_6G404140                     87.0    1e-17   
ref|XP_009381244.1|  PREDICTED: pectate lyase-like                    87.0    1e-17   
ref|XP_004966014.1|  PREDICTED: pectate lyase-like                    87.4    1e-17   
emb|CDY03964.1|  BnaC02g36790D                                        86.7    1e-17   
ref|XP_004152537.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...  87.0    1e-17   
ref|NP_001190720.1|  probable pectate lyase 15                        87.0    1e-17   
ref|XP_004146792.1|  PREDICTED: probable pectate lyase P59-like       87.0    2e-17   
ref|XP_007227702.1|  hypothetical protein PRUPE_ppa005744mg           87.0    2e-17   
ref|XP_009126031.1|  PREDICTED: probable pectate lyase 19             87.0    2e-17   
emb|CAN77957.1|  hypothetical protein VITISV_021245                   86.3    2e-17   Vitis vinifera
ref|XP_010488478.1|  PREDICTED: probable pectate lyase 9              87.0    2e-17   
ref|XP_006437462.1|  hypothetical protein CICLE_v10031653mg           86.7    2e-17   
emb|CBI15265.3|  unnamed protein product                              86.3    2e-17   
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                85.9    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004514773.1|  PREDICTED: probable pectate lyase 3-like         86.7    2e-17   
emb|CDY63769.1|  BnaCnng42620D                                        87.0    2e-17   
ref|XP_009129418.1|  PREDICTED: putative pectate lyase 11             86.3    2e-17   
ref|XP_010033216.1|  PREDICTED: pectate lyase-like                    86.7    2e-17   
ref|XP_002272638.2|  PREDICTED: pectate lyase-like                    86.7    2e-17   Vitis vinifera
gb|KCW52797.1|  hypothetical protein EUGRSUZ_J02132                   86.7    2e-17   
emb|CDY34149.1|  BnaA02g28910D                                        85.5    2e-17   
gb|AAM60924.1|  putative pectate lyase                                86.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDX85564.1|  BnaA02g02490D                                        86.7    2e-17   
ref|XP_008221658.1|  PREDICTED: pectate lyase-like                    86.3    2e-17   
ref|NP_186776.1|  putative pectate lyase 7                            86.7    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007224275.1|  hypothetical protein PRUPE_ppa019055mg           86.3    3e-17   
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2  86.3    3e-17   
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1  86.3    3e-17   
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1  86.3    3e-17   
ref|XP_009779191.1|  PREDICTED: probable pectate lyase P59            86.3    3e-17   
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2  86.3    3e-17   
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15             86.3    3e-17   
gb|KFK37588.1|  hypothetical protein AALP_AA3G002600                  86.3    3e-17   
ref|XP_007032453.1|  Pectate lyase family protein                     85.9    4e-17   
ref|XP_010925369.1|  PREDICTED: pectate lyase                         85.9    4e-17   
gb|AES91206.2|  pectate lyase P59-like protein                        85.5    4e-17   
ref|XP_006299938.1|  hypothetical protein CARUB_v10016149mg           85.9    4e-17   
ref|XP_009587689.1|  PREDICTED: probable pectate lyase P59            85.9    4e-17   
ref|XP_003609009.1|  Pectate lyase                                    85.9    4e-17   
ref|XP_002436463.1|  hypothetical protein SORBIDRAFT_10g003080        85.9    4e-17   Sorghum bicolor [broomcorn]
gb|AFK39232.1|  unknown                                               82.4    5e-17   
ref|XP_002882189.1|  pectate lyase family protein                     85.9    5e-17   
dbj|BAH20311.1|  AT3G01270                                            84.7    5e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006852264.1|  hypothetical protein AMTR_s00049p00173370        85.1    5e-17   
gb|EPS62426.1|  hypothetical protein M569_12361                       85.1    6e-17   
gb|KHN08855.1|  Putative pectate lyase P59                            85.1    6e-17   
ref|XP_008365939.1|  PREDICTED: probable pectate lyase 20             80.5    7e-17   
ref|XP_010514446.1|  PREDICTED: putative pectate lyase 11 isoform X1  84.7    8e-17   
ref|XP_009369346.1|  PREDICTED: pectate lyase-like                    84.7    8e-17   
ref|XP_010425491.1|  PREDICTED: putative pectate lyase 11             84.3    9e-17   
ref|XP_010502717.1|  PREDICTED: putative pectate lyase 11             84.3    1e-16   
ref|XP_008374522.1|  PREDICTED: pectate lyase-like                    84.7    1e-16   
ref|XP_007153840.1|  hypothetical protein PHAVU_003G069100g           84.7    1e-16   
ref|NP_001046281.1|  Os02g0214400                                     84.7    1e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EAY85003.1|  hypothetical protein OsI_06363                        84.7    1e-16   Oryza sativa Indica Group [Indian rice]
gb|EEE56553.1|  hypothetical protein OsJ_05879                        84.3    1e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KHG07401.1|  putative pectate lyase P59                            84.3    1e-16   
dbj|BAA95715.1|  pectate lyase-like protein                           84.3    1e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDP02198.1|  unnamed protein product                              84.7    1e-16   
ref|NP_189376.1|  putative pectate lyase 11                           84.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KHN19379.1|  Putative pectate lyase P59                            82.4    2e-16   
ref|XP_003621115.1|  Pectate lyase                                    84.3    2e-16   
ref|XP_009151965.1|  PREDICTED: putative pectate lyase 11 isoform X2  84.0    2e-16   
ref|XP_009151964.1|  PREDICTED: putative pectate lyase 11 isoform X1  84.0    2e-16   
ref|XP_002875382.1|  predicted protein                                84.0    2e-16   
emb|CDP00293.1|  unnamed protein product                              84.3    2e-16   
ref|XP_007139601.1|  hypothetical protein PHAVU_008G043600g           84.3    2e-16   
ref|XP_007157384.1|  hypothetical protein PHAVU_002G065800g           84.0    2e-16   
gb|KEH19822.1|  pectate lyase-like protein                            84.0    2e-16   
gb|AAA86241.1|  pectate lyase homolog                                 84.0    2e-16   Medicago sativa [alfalfa]
gb|AFK46866.1|  unknown                                               80.5    2e-16   
ref|XP_009804999.1|  PREDICTED: probable pectate lyase 8              83.6    2e-16   
dbj|BAF01663.1|  pectate lyase like protein                           82.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010068708.1|  PREDICTED: pectate lyase-like                    83.6    3e-16   
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15             83.6    3e-16   
ref|XP_006338637.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...  83.2    3e-16   
gb|KHG08946.1|  Pectate lyase                                         83.2    3e-16   
ref|XP_009624534.1|  PREDICTED: probable pectate lyase 8              83.6    3e-16   
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg           83.6    3e-16   
emb|CDY18738.1|  BnaC08g08780D                                        83.6    3e-16   
ref|XP_002311599.2|  pectate lyase family protein                     83.2    3e-16   Populus trichocarpa [western balsam poplar]
gb|KHG05193.1|  hypothetical protein F383_30875                       82.4    3e-16   
gb|KFK33662.1|  hypothetical protein AALP_AA5G043100                  82.8    4e-16   
ref|XP_004236303.1|  PREDICTED: probable pectate lyase 18             82.8    4e-16   
ref|XP_008786760.1|  PREDICTED: pectate lyase-like                    83.2    4e-16   
ref|XP_010464311.1|  PREDICTED: probable pectate lyase 8              82.8    4e-16   
ref|XP_010486231.1|  PREDICTED: probable pectate lyase 8              82.8    4e-16   
ref|XP_010447044.1|  PREDICTED: probable pectate lyase 8              82.8    4e-16   
ref|XP_007209148.1|  hypothetical protein PRUPE_ppa005859mg           82.8    4e-16   
ref|XP_010528323.1|  PREDICTED: probable pectate lyase 19             83.2    4e-16   
ref|XP_010670318.1|  PREDICTED: pectate lyase-like                    82.8    4e-16   
ref|XP_009403112.1|  PREDICTED: pectate lyase-like                    82.8    5e-16   
gb|KHG20840.1|  Pectate lyase                                         79.0    5e-16   
ref|XP_008239834.1|  PREDICTED: pectate lyase-like                    82.8    5e-16   
ref|NP_187357.1|  putative pectate lyase 8                            82.4    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884619.1|  pectate lyase family protein                     82.4    6e-16   
ref|XP_011025954.1|  PREDICTED: probable pectate lyase P59            82.4    6e-16   
ref|XP_002520133.1|  Pectate lyase precursor, putative                82.4    7e-16   Ricinus communis
ref|XP_006297766.1|  hypothetical protein CARUB_v10013802mg           81.6    7e-16   
gb|EAZ01460.1|  hypothetical protein OsI_23496                        78.2    7e-16   Oryza sativa Indica Group [Indian rice]
gb|AAQ62996.1|  oil palm polygalacturonase allergen PEST361           82.4    7e-16   Elaeis guineensis
emb|CDY66697.1|  BnaAnng22760D                                        82.4    8e-16   
gb|KDO40644.1|  hypothetical protein CISIN_1g015623mg                 82.0    8e-16   
ref|XP_006297767.1|  hypothetical protein CARUB_v10013802mg           82.0    8e-16   
gb|AFW76465.1|  hypothetical protein ZEAMMB73_776134                  82.0    8e-16   
gb|KDP45476.1|  hypothetical protein JCGZ_09725                       82.4    8e-16   
emb|CDY11033.1|  BnaA03g46920D                                        81.6    9e-16   
emb|CDX92652.1|  BnaC07g39100D                                        81.6    9e-16   
ref|XP_009102560.1|  PREDICTED: probable pectate lyase 9              82.0    9e-16   
ref|XP_009137472.1|  PREDICTED: probable pectate lyase 18             81.6    9e-16   
ref|NP_001150723.1|  pectate lyase precursor                          82.0    1e-15   
ref|XP_006297643.1|  hypothetical protein CARUB_v10013661mg           82.0    1e-15   
gb|AFW87059.1|  pectate lyase                                         82.0    1e-15   
ref|XP_008372438.1|  PREDICTED: probable pectate lyase 8              82.0    1e-15   
ref|XP_010528200.1|  PREDICTED: putative pectate lyase 11             81.6    1e-15   
ref|XP_010242445.1|  PREDICTED: pectate lyase                         81.6    1e-15   
gb|KHG16093.1|  hypothetical protein F383_07683                       82.0    1e-15   
ref|XP_009371193.1|  PREDICTED: probable pectate lyase 8              82.0    1e-15   
emb|CAN69905.1|  hypothetical protein VITISV_001007                   80.9    1e-15   
gb|AAM61584.1|  putative pectate lyase                                81.3    1e-15   
ref|XP_004304685.1|  PREDICTED: pectate lyase-like                    81.3    1e-15   
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15             81.6    1e-15   
ref|XP_004489374.1|  PREDICTED: pectate lyase-like                    81.3    2e-15   
ref|XP_010248740.1|  PREDICTED: probable pectate lyase 18             80.9    2e-15   
ref|XP_007031685.1|  Pectin lyase-like superfamily protein            80.9    2e-15   
ref|XP_006447221.1|  hypothetical protein CICLE_v10015474mg           80.9    2e-15   
emb|CAA43413.1|  pectate lyase                                        79.3    2e-15   
emb|CDX83690.1|  BnaC07g24300D                                        80.9    2e-15   
gb|KHG27438.1|  Pectate lyase                                         77.4    2e-15   
gb|AAA16475.1|  pectate lyase homolog                                 76.6    2e-15   
ref|XP_002526952.1|  Pectate lyase precursor, putative                80.5    2e-15   
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1   80.9    2e-15   
sp|P40973.1|PLY_LILLO  RecName: Full=Pectate lyase; Flags: Precursor  80.9    2e-15   
emb|CDX77470.1|  BnaA07g06080D                                        80.9    2e-15   
ref|XP_007137422.1|  hypothetical protein PHAVU_009G125800g           80.9    2e-15   
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22             80.5    2e-15   
gb|KHF99208.1|  hypothetical protein F383_08934                       80.9    2e-15   
ref|XP_007037229.1|  Pectate lyase family protein                     80.9    3e-15   
ref|XP_003618787.1|  Pectate lyase                                    80.5    3e-15   
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5              80.1    3e-15   
ref|XP_006439649.1|  hypothetical protein CICLE_v10020193mg           80.5    3e-15   
emb|CDY20049.1|  BnaA09g02020D                                        80.5    3e-15   
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2   80.5    3e-15   
ref|XP_009111570.1|  PREDICTED: putative pectate lyase 11             80.1    3e-15   
emb|CDY00156.1|  BnaC09g01450D                                        80.1    3e-15   
ref|XP_009112069.1|  PREDICTED: probable pectate lyase 22             80.5    3e-15   
ref|XP_006477525.1|  PREDICTED: pectate lyase-like                    80.5    3e-15   
ref|XP_004156698.1|  PREDICTED: putative pectate lyase 11-like        80.1    3e-15   
ref|XP_004142773.1|  PREDICTED: putative pectate lyase 11-like        80.1    3e-15   
emb|CDY16732.1|  BnaA09g06500D                                        80.5    3e-15   
ref|XP_010684949.1|  PREDICTED: probable pectate lyase 8              80.5    3e-15   
gb|KDO76053.1|  hypothetical protein CISIN_1g013757mg                 80.5    3e-15   
emb|CDY48132.1|  BnaCnng15740D                                        80.5    3e-15   
ref|XP_007151585.1|  hypothetical protein PHAVU_004G059200g           80.1    3e-15   
ref|XP_009349844.1|  PREDICTED: probable pectate lyase 8              80.5    3e-15   
ref|XP_009340844.1|  PREDICTED: pectate lyase-like                    80.1    3e-15   
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5              80.1    4e-15   
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5              80.1    4e-15   
ref|XP_010547043.1|  PREDICTED: probable pectate lyase 8              80.1    4e-15   
ref|XP_010695977.1|  PREDICTED: probable pectate lyase 18             79.7    4e-15   
ref|XP_009109237.1|  PREDICTED: probable pectate lyase 18             79.7    4e-15   
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3   79.3    4e-15   
emb|CDY24847.1|  BnaA08g14630D                                        79.7    4e-15   
emb|CDY05654.1|  BnaC02g38830D                                        78.2    4e-15   
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18             79.7    5e-15   
gb|KDO82123.1|  hypothetical protein CISIN_1g015702mg                 78.2    5e-15   
emb|CDY08948.1|  BnaC08g11780D                                        79.7    5e-15   
ref|XP_011009454.1|  PREDICTED: pectate lyase-like                    80.1    5e-15   
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8              80.1    5e-15   
gb|KFK29019.1|  hypothetical protein AALP_AA7G078200                  79.7    5e-15   
ref|XP_004508770.1|  PREDICTED: probable pectate lyase P59-like       79.7    5e-15   
emb|CDY28857.1|  BnaC06g26450D                                        79.3    6e-15   
ref|XP_008458848.1|  PREDICTED: pectate lyase-like                    79.3    6e-15   
ref|NP_001234029.1|  probable pectate lyase P18 precursor             79.3    6e-15   
ref|XP_008366366.1|  PREDICTED: pectate lyase-like                    79.7    7e-15   
gb|EYU34765.1|  hypothetical protein MIMGU_mgv1a023431mg              79.3    7e-15   
ref|XP_008340139.1|  PREDICTED: probable pectate lyase 5              79.3    7e-15   
gb|EYU22437.1|  hypothetical protein MIMGU_mgv1a006496mg              79.7    7e-15   
ref|XP_006280540.1|  hypothetical protein CARUB_v10026482mg           79.3    7e-15   
ref|XP_011010949.1|  PREDICTED: pectate lyase-like                    79.3    7e-15   
emb|CDP16631.1|  unnamed protein product                              79.3    8e-15   
gb|AAB69759.1|  putative pectate lyase                                79.3    8e-15   
ref|NP_172894.1|  putative pectate lyase 3                            79.3    9e-15   
ref|XP_009105097.1|  PREDICTED: probable pectate lyase 5              79.0    9e-15   
ref|XP_006438176.1|  hypothetical protein CICLE_v10031429mg           79.3    9e-15   
ref|XP_010496063.1|  PREDICTED: probable pectate lyase 3              79.3    9e-15   
ref|XP_002300069.1|  pectate lyase family protein                     79.0    1e-14   
emb|CAN76500.1|  hypothetical protein VITISV_004734                   79.0    1e-14   
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5              79.0    1e-14   
gb|AAL91923.1|  pectate lyase                                         74.7    1e-14   
ref|NP_564906.1|  putative pectate lyase 5                            79.0    1e-14   
ref|XP_011005067.1|  PREDICTED: probable pectate lyase P59            79.0    1e-14   
gb|AAL91924.1|  pectate lyase                                         75.5    1e-14   
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8              79.0    1e-14   
ref|XP_007037816.1|  Pectin lyase-like superfamily protein isoform 2  77.8    1e-14   
ref|XP_010476496.1|  PREDICTED: probable pectate lyase 3              79.0    1e-14   
gb|ABR17766.1|  unknown                                               79.0    1e-14   
ref|XP_007151201.1|  hypothetical protein PHAVU_004G026400g           79.0    1e-14   
ref|XP_008235520.1|  PREDICTED: probable pectate lyase 8              79.0    1e-14   
ref|NP_189065.2|  putative pectate lyase 9                            79.0    1e-14   
ref|XP_009359518.1|  PREDICTED: probable pectate lyase 18             78.6    1e-14   
ref|NP_001057945.1|  Os06g0583900                                     79.0    1e-14   
ref|XP_002323835.1|  hypothetical protein POPTR_0017s11450g           79.0    1e-14   
gb|KDP46367.1|  hypothetical protein JCGZ_10207                       78.6    1e-14   
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1  78.6    1e-14   
ref|XP_006484000.1|  PREDICTED: probable pectate lyase 5-like         78.6    1e-14   
gb|KDO82120.1|  hypothetical protein CISIN_1g015702mg                 78.2    1e-14   
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                    78.6    1e-14   
ref|XP_004489554.1|  PREDICTED: probable pectate lyase 5-like         78.2    2e-14   
ref|XP_009408830.1|  PREDICTED: pectate lyase-like                    78.6    2e-14   
ref|XP_003571658.1|  PREDICTED: pectate lyase-like                    78.2    2e-14   
ref|XP_010038352.1|  PREDICTED: probable pectate lyase 8              78.2    2e-14   
emb|CAA63496.1|  pectate lyase                                        77.8    2e-14   
ref|XP_009127577.1|  PREDICTED: probable pectate lyase 5              78.2    2e-14   
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5              77.8    2e-14   
ref|XP_010033351.1|  PREDICTED: pectate lyase-like                    77.8    2e-14   
ref|XP_006302330.1|  hypothetical protein CARUB_v10020387mg           78.2    2e-14   
gb|ABG74583.1|  pectate lyase                                         74.7    2e-14   
emb|CDY12666.1|  BnaA02g13340D                                        77.8    2e-14   
ref|XP_009111860.1|  PREDICTED: probable pectate lyase 20             78.2    2e-14   
ref|XP_003608909.1|  Pectate lyase                                    77.8    2e-14   
ref|XP_007026137.1|  Root hair specific 14                            77.8    2e-14   
emb|CAA22985.1|  putative pectate lyase                               77.8    2e-14   
gb|AAK25850.1|AF360140_1  putative pectate lyase                      77.8    2e-14   
ref|XP_007138209.1|  hypothetical protein PHAVU_009G189800g           78.2    2e-14   
emb|CDY32557.1|  BnaC02g17500D                                        77.8    2e-14   
dbj|BAI94495.1|  pectate lyase                                        77.8    2e-14   
ref|XP_002867644.1|  pectate lyase family protein                     77.8    2e-14   
ref|NP_567707.1|  putative pectate lyase 18                           77.8    2e-14   
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8              77.8    3e-14   
ref|XP_010531484.1|  PREDICTED: probable pectate lyase 5              77.4    3e-14   
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8              77.8    3e-14   
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg           77.8    3e-14   
ref|XP_006443655.1|  hypothetical protein CICLE_v10019202mg           78.6    3e-14   
gb|KHG08055.1|  putative pectate lyase P59                            77.8    3e-14   
gb|KDO65869.1|  hypothetical protein CISIN_1g013239mg                 77.8    3e-14   
dbj|BAF43573.1|  pectate lyase                                        77.4    3e-14   
ref|XP_003543726.1|  PREDICTED: pectate lyase                         77.8    3e-14   
ref|XP_006480190.1|  PREDICTED: probable pectate lyase 8-like         77.8    3e-14   
gb|ACU23277.1|  unknown                                               77.8    3e-14   
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5              77.4    3e-14   
ref|XP_007044917.1|  Pectate lyase family protein                     77.4    3e-14   
ref|XP_006283843.1|  hypothetical protein CARUB_v10004942mg           77.4    3e-14   
ref|XP_002892805.1|  hypothetical protein ARALYDRAFT_471616           77.8    3e-14   
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like        77.4    4e-14   
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg              77.4    4e-14   
ref|XP_008679844.1|  PREDICTED: pectate lyase                         77.4    4e-14   
gb|KHN13240.1|  Putative pectate lyase 3                              77.4    4e-14   
gb|ACF87417.1|  unknown                                               77.4    4e-14   
gb|KGN49087.1|  hypothetical protein Csa_6G513510                     74.7    4e-14   
ref|XP_002453531.1|  hypothetical protein SORBIDRAFT_04g007450        77.4    4e-14   
ref|XP_010940647.1|  PREDICTED: probable pectate lyase 8              77.4    4e-14   
ref|XP_002887143.1|  pectate lyase family protein                     77.0    4e-14   
ref|XP_010109687.1|  hypothetical protein L484_015172                 77.4    4e-14   
gb|EYU17974.1|  hypothetical protein MIMGU_mgv1a006571mg              77.4    4e-14   
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like        77.4    5e-14   
gb|KHG30349.1|  hypothetical protein F383_15991                       77.4    5e-14   
gb|AEX12158.1|  hypothetical protein 0_514_01                         73.9    5e-14   
gb|KHG06252.1|  hypothetical protein F383_10745                       77.0    5e-14   
ref|XP_002306040.1|  hypothetical protein POPTR_0004s12300g           77.0    5e-14   
gb|KDP26717.1|  hypothetical protein JCGZ_17875                       76.6    5e-14   
ref|XP_009129753.1|  PREDICTED: probable pectate lyase 20             77.0    6e-14   
emb|CDY33938.1|  BnaA02g30490D                                        77.0    6e-14   
ref|XP_003601872.1|  Pectate lyase                                    77.0    6e-14   
gb|AAM67091.1|  putative pectate lyase                                76.6    6e-14   
emb|CDY19932.1|  BnaA09g03190D                                        76.6    6e-14   
ref|XP_009377460.1|  PREDICTED: probable pectate lyase 1              74.3    6e-14   
ref|XP_003622996.1|  Pectate lyase 1-27                               77.0    6e-14   
ref|XP_002885608.1|  pectate lyase family protein                     77.0    7e-14   
gb|KFK31278.1|  hypothetical protein AALP_AA6G091900                  76.6    7e-14   
gb|AAG28907.1|AC008113_23  F12A21.12                                  76.3    7e-14   
gb|AAK66161.1|  pectate lyase                                         76.3    7e-14   
ref|XP_010415362.1|  PREDICTED: probable pectate lyase 5              76.6    7e-14   
gb|EMS61728.1|  putative pectate lyase 7                              75.5    7e-14   
ref|XP_010470701.1|  PREDICTED: probable pectate lyase 5              76.6    7e-14   
emb|CBI33346.3|  unnamed protein product                              76.6    8e-14   
gb|AAF19196.1|AF206320_1  pectate lyase 2                             76.6    8e-14   
gb|KHG23093.1|  hypothetical protein F383_29772                       76.3    8e-14   
ref|XP_009385867.1|  PREDICTED: probable pectate lyase 8 isoform X2   76.6    8e-14   
emb|CDY56668.1|  BnaCnng30870D                                        76.3    8e-14   
ref|XP_002285639.2|  PREDICTED: probable pectate lyase 8              76.6    8e-14   
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like        76.6    8e-14   
emb|CAN78491.1|  hypothetical protein VITISV_004934                   76.3    9e-14   
ref|XP_002285340.1|  PREDICTED: probable pectate lyase 5              76.3    9e-14   
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2   76.3    9e-14   
ref|XP_002511275.1|  Pectate lyase precursor, putative                75.5    1e-13   
ref|XP_009609746.1|  PREDICTED: probable pectate lyase 8              76.3    1e-13   
emb|CDY05655.1|  BnaC02g38820D                                        76.3    1e-13   
ref|XP_010475133.1|  PREDICTED: probable pectate lyase 1              76.3    1e-13   
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                  75.9    1e-13   
gb|KHG22755.1|  hypothetical protein F383_29653                       75.9    1e-13   
ref|XP_002892236.1|  pectate lyase family protein                     76.3    1e-13   
ref|XP_010457526.1|  PREDICTED: probable pectate lyase 1              76.3    1e-13   
ref|NP_563715.1|  putative pectate lyase 1                            76.3    1e-13   
ref|XP_006307575.1|  hypothetical protein CARUB_v10009197mg           76.3    1e-13   
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1   76.3    1e-13   
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1   76.3    1e-13   
gb|AES72123.2|  pectate lyase family protein                          75.9    1e-13   
ref|XP_010484103.1|  PREDICTED: probable pectate lyase 1              75.9    1e-13   
gb|AAF19195.1|AF206319_1  pectate lyase 1                             75.9    1e-13   
gb|AET83414.1|  hypothetical protein                                  73.2    1e-13   
ref|XP_009385866.1|  PREDICTED: probable pectate lyase 8 isoform X1   76.3    1e-13   
ref|XP_003554335.1|  PREDICTED: pectate lyase-like                    75.9    1e-13   
gb|KHN35421.1|  Putative pectate lyase P18                            74.3    1e-13   
ref|XP_011072008.1|  PREDICTED: probable pectate lyase 18             75.9    1e-13   
ref|XP_010102919.1|  hypothetical protein L484_018936                 75.9    1e-13   
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2   75.9    1e-13   
gb|KFK41187.1|  hypothetical protein AALP_AA2G097000                  75.5    1e-13   
ref|XP_007201029.1|  hypothetical protein PRUPE_ppa006229mg           75.9    1e-13   
gb|ABK92535.1|  unknown                                               73.9    1e-13   
ref|XP_009110541.1|  PREDICTED: probable pectate lyase 3              75.9    1e-13   
gb|KHG12411.1|  hypothetical protein F383_06737                       75.5    2e-13   
ref|XP_009799817.1|  PREDICTED: probable pectate lyase 8              75.9    2e-13   
emb|CAN71915.1|  hypothetical protein VITISV_007917                   75.5    2e-13   
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2   75.5    2e-13   
dbj|BAK06965.1|  predicted protein                                    75.9    2e-13   
ref|XP_009406385.1|  PREDICTED: probable pectate lyase 18             75.5    2e-13   
gb|KDO69411.1|  hypothetical protein CISIN_1g015569mg                 73.9    2e-13   
ref|XP_010100325.1|  hypothetical protein L484_027633                 75.5    2e-13   
gb|KHG19997.1|  hypothetical protein F383_02891                       75.5    2e-13   
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1   75.5    2e-13   
gb|AEN70985.1|  pectate lyase                                         75.5    2e-13   
gb|KFK43687.1|  hypothetical protein AALP_AA1G160000                  75.9    2e-13   
ref|XP_011087066.1|  PREDICTED: pectate lyase                         75.5    2e-13   
gb|ADB90475.1|  pectate lyase                                         75.5    2e-13   
gb|EMT25421.1|  Pectate lyase                                         74.3    2e-13   
ref|XP_006656188.1|  PREDICTED: pectate lyase-like                    75.5    2e-13   
gb|ABK25017.1|  unknown                                               75.5    2e-13   



>emb|CDP02199.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   115 bits (287),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 54/92 (59%), Positives = 64/92 (70%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPK-GPLFKEVTHRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     FKEVTHRD P   W KWTWVSDGDVFLNGA F PSG+  GA+++
Sbjct  262  IISQGNRFIAPPLSQFFKEVTHRDAPVALWSKWTWVSDGDVFLNGARFVPSGNPDGARQF  321

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              L+L+   PG  V  +T+F+G L C IG+ C
Sbjct  322  AALELIKAAPGTEVFTLTRFSGFLSCVIGRAC  353



>ref|XP_011098576.1| PREDICTED: probable pectate lyase P56 [Sesamum indicum]
Length=465

 Score =   112 bits (279),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 51/93 (55%), Positives = 65/93 (70%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHR--DCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            IISQGNR+ AP  P  ++VTHR  D P+  W+KWTWV+D DVFLNGA+F PSGD  GA  
Sbjct  373  IISQGNRYIAPPLPDKRQVTHREADSPESEWRKWTWVTDHDVFLNGAYFVPSGDPNGAAT  432

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            Y  L+ + P PG+ V  +T+FAG L+C +  PC
Sbjct  433  YLALEKIRPAPGEQVYDLTRFAGALKCVVSLPC  465



>ref|XP_004234780.1| PREDICTED: probable pectate lyase P56 [Solanum lycopersicum]
 sp|P15721.2|PLY56_SOLLC RecName: Full=Probable pectate lyase P56; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33524.1| P56 protein [Solanum lycopersicum]
Length=398

 Score =   105 bits (263),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS---WKKWTWVSDGDVFLNGAFFRPSGDQKGAQ  181
            IISQGNRF A    L KEVT+R+    S   W KWTW++DGD F NGA F PSGDQ    
Sbjct  305  IISQGNRFIAEDKLLVKEVTYREKSTSSVEEWMKWTWITDGDDFENGATFTPSGDQNLLS  364

Query  180  KYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            K  HL+L+ P P   VG +TKF+G L CKI +PC
Sbjct  365  KIDHLNLIQPEPSSKVGLLTKFSGALSCKIRRPC  398



>dbj|BAK05605.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=448

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/92 (53%), Positives = 62/92 (67%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP  P  KEVT R+  P + +K W W S GDV +NGAFF  SG Q   + Y
Sbjct  358  IISQGNRFIAPDDPNAKEVTKREYTPYNEYKDWVWKSQGDVMMNGAFFNQSGGQN-ERTY  416

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G++D +    GK VG++T+FAG L C++GKPC
Sbjct  417  GNMDFIPAKHGKYVGQLTQFAGTLECRVGKPC  448



>ref|XP_006361836.1| PREDICTED: probable pectate lyase P56-like [Solanum tuberosum]
Length=398

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 59/94 (63%), Gaps = 3/94 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS---WKKWTWVSDGDVFLNGAFFRPSGDQKGAQ  181
            IISQGNRF A    L KEVT+R+    S   W KWTW+SDGD   NGA F PSGDQ    
Sbjct  305  IISQGNRFIAEDKLLVKEVTYREKSTSSVEEWMKWTWISDGDDLENGATFTPSGDQNLLS  364

Query  180  KYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            K  HL+L+ P P   VG +TKF+G L C I +PC
Sbjct  365  KIDHLNLIQPEPSSKVGLLTKFSGALSCNIRRPC  398



>ref|XP_004233352.1| PREDICTED: pectate lyase-like [Solanum lycopersicum]
Length=397

 Score =   102 bits (253),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 51/92 (55%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF A   PL KEVTHR+  ++S WK WTW+S  D   NGAFF+ SGDQ    K 
Sbjct  306  IISQGNRFIAQASPLIKEVTHREKVEESEWKNWTWLSIDDDMQNGAFFKTSGDQDALSKL  365

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              L+L+   P   VG ITKFAG L C  G+PC
Sbjct  366  QDLNLIPAEPSYKVGIITKFAGSLACTAGRPC  397



>ref|XP_006357121.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=397

 Score =   100 bits (249),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 50/92 (54%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF A    L KEVTHR+  ++S WK WTW+S  D   NGAFFR SGDQ   +K 
Sbjct  306  IISQGNRFIAQASLLIKEVTHREKAEESEWKNWTWLSIDDDMQNGAFFRTSGDQDALRKL  365

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             +L+L+   P   VG +TKFAG L C  G+PC
Sbjct  366  KNLNLIPAEPSYKVGILTKFAGSLSCTAGRPC  397



>ref|XP_004155392.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=432

 Score =   100 bits (249),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 62/92 (67%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP     KEVT R+  P+  WK WTW S+GD+ +NGAFF  SGDQ   + +
Sbjct  341  IVSQGNRFIAPPNVYAKEVTKREYSPEQVWKSWTWRSEGDLMMNGAFFVTSGDQSKRRPF  400

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              +D+++  PG  V ++T+FAG L C +G+PC
Sbjct  401  SRMDMISYKPGTYVKRMTRFAGSLACFVGRPC  432



>ref|XP_004135462.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
 gb|KGN51889.1| hypothetical protein Csa_5G604340 [Cucumis sativus]
Length=432

 Score =   100 bits (249),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 62/92 (67%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP     KEVT R+  P+  WK WTW S+GD+ +NGAFF  SGDQ   + +
Sbjct  341  IVSQGNRFIAPPNVYAKEVTKREYSPEQVWKSWTWRSEGDLMMNGAFFVTSGDQSKRRPF  400

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              +D+++  PG  V ++T+FAG L C +G+PC
Sbjct  401  SRMDMISYKPGTYVKRMTRFAGSLACFVGRPC  432



>ref|XP_009757256.1| PREDICTED: pectate lyase [Nicotiana sylvestris]
 sp|P40972.1|PLY_TOBAC RecName: Full=Pectate lyase; Flags: Precursor [Nicotiana tabacum]
 emb|CAA47630.1| pectate lyase [Nicotiana tabacum]
 emb|CAA43414.1| pectate lyase [Nicotiana tabacum]
Length=397

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 59/94 (63%), Gaps = 3/94 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS---WKKWTWVSDGDVFLNGAFFRPSGDQKGAQ  181
            IISQGNRF A    L KEVT+R+    S   W KWTW+SDGD   NGA F PSGDQ    
Sbjct  304  IISQGNRFIAEDELLVKEVTYREKLTASVAEWMKWTWISDGDDMENGATFTPSGDQNLLD  363

Query  180  KYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            K  HL+L+ P P   VG +TKF+G L C  G+PC
Sbjct  364  KIDHLNLIKPEPSSKVGILTKFSGALSCVKGRPC  397



>ref|XP_009599824.1| PREDICTED: pectate lyase [Nicotiana tomentosiformis]
Length=397

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 59/94 (63%), Gaps = 3/94 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS---WKKWTWVSDGDVFLNGAFFRPSGDQKGAQ  181
            IISQGNRF A    L KEVT+R+    S   W KWTW+SDGD   NGA F PSGDQ    
Sbjct  304  IISQGNRFIAEDELLVKEVTYREKLTASVAEWMKWTWISDGDDMENGATFTPSGDQNLLD  363

Query  180  KYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            K  HL+L+ P P   VG +TKF+G L C  G+PC
Sbjct  364  KIDHLNLIKPEPSSKVGILTKFSGALSCVKGRPC  397



>ref|XP_009389712.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=438

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNR+ AP  P  KEVT RD   +S WK+WTW S+GD+ LNGAFF  SG   G QKY
Sbjct  347  IISQGNRYIAPSNPFAKEVTKRDYATESVWKQWTWRSEGDLMLNGAFFVKSGGGGGLQKY  406

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  V ++T+++G L C   +PC
Sbjct  407  DKTDIIKAKPGSFVTRLTRYSGALDCFPQRPC  438



>ref|XP_010683249.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/91 (49%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKYG  172
            IISQGNRF AP  P  KEVT R+ P+  WK WTW+SD D FLNGAFFR SG         
Sbjct  354  IISQGNRFVAPFNPFAKEVTKREAPESEWKSWTWLSDKDWFLNGAFFRDSGRGNAIDSKN  413

Query  171  HLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               + + + G  VG++T+ +G  +C  GKPC
Sbjct  414  KAQMFSAMAGTKVGELTRCSGPRKCTPGKPC  444



>ref|XP_004964534.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=438

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 50/92 (54%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP  P  KEVT R+  P   +K W W S GDV +NGAFF  SG Q   +KY
Sbjct  348  IISQGNRFIAPDDPNAKEVTKREYTPYSEYKDWVWKSQGDVMMNGAFFNESGGQN-ERKY  406

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LD +    G  VG++TKFAG L C+ GKPC
Sbjct  407  DQLDFIPARHGSYVGELTKFAGTLNCRAGKPC  438



>ref|XP_008341537.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=454

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD  P+  WK W W S+GD+ +NGAFF  SG       +
Sbjct  363  IISQGNRFIAPPNQAAKEVTKRDYAPESVWKSWQWRSEGDLMINGAFFVQSGVPSKNHGF  422

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G LD++   PG  V ++T+FAG L CK+G PC
Sbjct  423  GRLDVMKARPGTYVTRLTRFAGSLNCKVGHPC  454



>emb|CDY66593.1| BnaCnng51570D [Brassica napus]
Length=499

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKG-PLFKEVTHRDCP-DDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P +KEVT RD   +D WK WTW S+ D+F+NGAFFR SGD      
Sbjct  407  ILSHGNRFIAPPHLPYYKEVTKRDYALEDEWKHWTWRSEKDIFMNGAFFRQSGDPHYKSA  466

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  467  HTRKQMIKPKNGYAVSKLTKYAGALDCRVGKRC  499



>ref|XP_009342871.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=454

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD  P+  WK W W S+GD+ +NGAFF  SG       +
Sbjct  363  IISQGNRFIAPPNQAAKEVTKRDYAPESVWKSWQWRSEGDLMMNGAFFVQSGVPNRKHGF  422

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G LD++   PG  V ++T+FAG L CK+GK C
Sbjct  423  GKLDMIKAKPGTFVTRLTRFAGSLNCKVGKKC  454



>ref|XP_008357758.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=459

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD  P+  WK W W S+GD+ +NGAFF  SG       +
Sbjct  368  IISQGNRFIAPPNQAAKEVTKRDYAPESVWKSWQWRSEGDLMMNGAFFVQSGVPNKKHGF  427

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G LD++   PG  V ++T+FAG L CK+GK C
Sbjct  428  GKLDMIKAKPGTFVRRLTRFAGSLNCKVGKKC  459



>ref|XP_009121613.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX69550.1| BnaA10g18990D [Brassica napus]
Length=499

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKG-PLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P +KEVT RD   +D WK WTW S+ D+F+NGAFFR SGD      
Sbjct  407  ILSHGNRFIAPPHLPYYKEVTKRDYASEDEWKHWTWRSEKDIFMNGAFFRQSGDPHYKSA  466

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++G+ C
Sbjct  467  HTRKQMIKPKNGYAVSKLTKYAGALDCRVGRRC  499



>ref|XP_008446316.1| PREDICTED: probable pectate lyase P59 [Cucumis melo]
Length=432

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 62/92 (67%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP     KEVT R+  P+  WK WTW S+GD+ +NGAFF  SGDQ+  + +
Sbjct  341  IVSQGNRFIAPPNVYAKEVTKREYSPEQVWKSWTWRSEGDLMMNGAFFVTSGDQRKRRPF  400

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D+++  PG  V ++T+F+G L C +G+PC
Sbjct  401  SSKDMISYKPGTYVKRMTRFSGALACFVGRPC  432



>ref|XP_002282500.3| PREDICTED: pectate lyase [Vitis vinifera]
Length=443

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD    D WK WTW+S GD+  NGAFF  SGD K    +
Sbjct  352  IISQGNRFIAPPNMACKEVTKRDYASPDEWKSWTWISQGDLLQNGAFFVQSGDPKKKHPF  411

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  V ++T+F+G L CK+ +PC
Sbjct  412  TRYDMIKAKPGTFVNRLTRFSGSLGCKVNQPC  443



>emb|CAN79927.1| hypothetical protein VITISV_042447 [Vitis vinifera]
Length=439

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD    D WK WTW+S GD+  NGAFF  SGD K    +
Sbjct  348  IISQGNRFIAPPNMACKEVTKRDYASPDEWKSWTWISQGDLLQNGAFFVQSGDPKKKHPF  407

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  V ++T+F+G L CK+ +PC
Sbjct  408  TRYDMIKAKPGTFVNRLTRFSGSLGCKVNQPC  439



>ref|XP_006363934.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=439

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 50/95 (53%), Positives = 61/95 (64%), Gaps = 6/95 (6%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQ---KGA  184
            IISQGNRF+A   P  K+VT RD  P+  WKKW WVS+GD FLNGA+F  SG Q   K A
Sbjct  347  IISQGNRFKAADNPNTKQVTKRDYAPESEWKKWQWVSEGDSFLNGAYFVESGPQDKKKTA  406

Query  183  QKYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                H   +   PG   G++T+FAG+L+CK G PC
Sbjct  407  LTKNH--KIKFKPGSHAGRLTRFAGVLKCKPGIPC  439



>ref|XP_006573090.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=448

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IIS+GNRF AP     KE+T R+  P+  WK W W S  D ++NGAFFR  G Q   + +
Sbjct  357  IISEGNRFIAPNNVYAKEITKREYSPEQEWKNWQWRSINDEYMNGAFFREGGSQITDRPF  416

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  VG++T++AG LRC +GKPC
Sbjct  417  SRQDMITAKPGSYVGRLTRYAGSLRCIVGKPC  448



>ref|XP_010551866.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=475

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKG-PLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P +KEVT RD  P+  W+KW W S+ DVF+NGAFFR SG+ K    
Sbjct  383  ILSHGNRFIAPPHIPQYKEVTKRDYAPESEWRKWNWRSEKDVFMNGAFFRQSGNPKFRCT  442

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV  +TK+AG L CK+G+PC
Sbjct  443  HTRQQMIRPKHGMAVSMLTKYAGSLDCKVGRPC  475



>emb|CBI22159.3| unnamed protein product [Vitis vinifera]
Length=468

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD    D WK WTW+S GD+  NGAFF  SGD K    +
Sbjct  377  IISQGNRFIAPPNMACKEVTKRDYASPDEWKSWTWISQGDLLQNGAFFVQSGDPKKKHPF  436

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  V ++T+F+G L CK+ +PC
Sbjct  437  TRYDMIKAKPGTFVNRLTRFSGSLGCKVNQPC  468



>ref|NP_001056781.1| Os06g0144200 [Oryza sativa Japonica Group]
 dbj|BAF18695.1| Os06g0144200 [Oryza sativa Japonica Group]
Length=450

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 49/92 (53%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT R+  P D +K+W W S GDV +NGAFF  SG Q   + Y
Sbjct  360  IISQGNRFIAPDDLNAKEVTKREYTPYDEYKEWVWKSQGDVMMNGAFFNESGGQN-ERSY  418

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LD +    GK VG++TKFAG L C +G PC
Sbjct  419  DQLDFIPAKHGKYVGQLTKFAGTLNCHVGMPC  450



>gb|KHN01171.1| Putative pectate lyase 3 [Glycine soja]
Length=433

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IIS+GNRF AP     KE+T R+  P+  WK W W S  D ++NGAFFR  G Q   + +
Sbjct  342  IISEGNRFIAPNNVYAKEITKREYSPEQEWKNWQWRSINDEYMNGAFFREGGSQITDRPF  401

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  VG++T++AG LRC +GKPC
Sbjct  402  SRQDMITAKPGSYVGRLTRYAGSLRCIVGKPC  433



>gb|EAZ35814.1| hypothetical protein OsJ_20107 [Oryza sativa Japonica Group]
Length=193

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT R+  P D +K+W W S GDV +NGAFF  SG Q   + Y
Sbjct  103  IISQGNRFIAPDDLNAKEVTKREYTPYDEYKEWVWKSQGDVMMNGAFFNESGGQN-ERSY  161

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LD +    GK VG++TKFAG L C +G PC
Sbjct  162  DQLDFIPAKHGKYVGQLTKFAGTLNCHVGMPC  193



>gb|EAY99626.1| hypothetical protein OsI_21605 [Oryza sativa Indica Group]
Length=441

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 49/92 (53%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT R+  P D +K+W W S GDV +NGAFF  SG Q   + Y
Sbjct  351  IISQGNRFIAPDDVNAKEVTKREYTPYDEYKEWVWKSQGDVMMNGAFFNESGGQN-ERSY  409

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LD +    GK VG++TKFAG L C +G PC
Sbjct  410  DQLDFIPAKHGKYVGQLTKFAGALNCHVGMPC  441



>ref|XP_004302354.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHR--DCPDDSWKKWTWVSDGDVFLNGAFFRPSGD-QKGAQ  181
            IISQGNR+ AP  P  KE+T R    P+  WK W W S+GD+  NGA+FR SG+ +KG  
Sbjct  354  IISQGNRYVAPPDPKLKEITSRAYSTPEAVWKTWQWRSEGDLMENGAYFRESGEPRKGRG  413

Query  180  KYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             +   D++N  PG  V ++T+FAG L C++GK C
Sbjct  414  HFSRFDVINAKPGSFVRRLTRFAGTLGCRVGKAC  447



>dbj|BAD68402.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
Length=438

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 49/92 (53%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT R+  P D +K+W W S GDV +NGAFF  SG Q   + Y
Sbjct  348  IISQGNRFIAPDDLNAKEVTKREYTPYDEYKEWVWKSQGDVMMNGAFFNESGGQN-ERSY  406

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LD +    GK VG++TKFAG L C +G PC
Sbjct  407  DQLDFIPAKHGKYVGQLTKFAGTLNCHVGMPC  438



>gb|AAA16476.1| pectate lyase homolog [Zea mays]
 gb|AFW85884.1| hypothetical protein ZEAMMB73_308319 [Zea mays]
Length=438

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP  P  KEVT R+  P   +K+W W S GDV +NGAFF  SG Q   +KY
Sbjct  348  IISQGNRFIAPDDPNAKEVTKREYTPYKDYKEWVWKSQGDVMMNGAFFNESGGQN-ERKY  406

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D +    G+ VG++T+FAG L+C +G+PC
Sbjct  407  DRFDFIPAKHGRYVGQLTRFAGPLKCIVGQPC  438



>ref|XP_003552513.1| PREDICTED: pectate lyase-like [Glycine max]
Length=440

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP     KE+THRD  P + W KW W S+ D+F+NGA F  SG   G   +
Sbjct  349  ILSQGNRFIAPNNNAAKEITHRDYAPPEEWSKWQWKSENDLFMNGATFLQSGSPLGKLPF  408

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                ++ P PG    ++T+FAG L CK+GKPC
Sbjct  409  NKGLMMKPRPGAEANRLTRFAGALNCKVGKPC  440



>ref|XP_008443432.1| PREDICTED: probable pectate lyase 19 [Cucumis melo]
Length=441

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP  P  +++T+R+  P+  WK WTW S+GD+ +NGA+F  SG+    + Y
Sbjct  350  IISQGNRFIAPPNPAARQITNRNYAPESVWKTWTWRSEGDLMMNGAYFIQSGNPSKRRPY  409

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  V ++T+F+G L C +G+PC
Sbjct  410  SRFDMIKAKPGTFVRRLTRFSGSLNCFVGRPC  441



>ref|XP_009131435.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX78607.1| BnaA03g05190D [Brassica napus]
Length=475

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKG-PLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+SQGNRF AP   P ++EVT RD  P++ WK W W S+ D+F+NGA+FR SGD      
Sbjct  383  ILSQGNRFIAPPHLPHYREVTKRDYAPEEEWKHWNWRSEKDIFMNGAYFRQSGDPNYETD  442

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +   +++ P  G AV K+TK+AG L C++G+ C
Sbjct  443  HTRRNMIKPKNGYAVSKLTKYAGALDCRVGRRC  475



>ref|XP_010096345.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXB63820.1| putative pectate lyase 7 [Morus notabilis]
Length=399

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     K+VT RD  P+  WK W W S+GD+ +NGAFF  SG +   +++
Sbjct  308  IISQGNRFIAPPNDAAKQVTKRDYAPESEWKNWQWRSEGDLLMNGAFFVQSGKRLSKRRF  367

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LD++   PG  V ++T++AG L C +G+PC
Sbjct  368  SRLDMIKYKPGTFVTRLTRYAGTLLCGVGRPC  399



>ref|XP_011085777.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=446

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKYG  172
            IISQGNR+ A   P  K+VT R+CP+  W+ WTWV+DGD+FLNGA+FR SGDQ    K+ 
Sbjct  356  IISQGNRYIADH-PYAKQVTKRECPESEWRHWTWVTDGDIFLNGAYFRASGDQDWHHKHP  414

Query  171  H-LDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D + P P   V ++T+FAG L CK    C
Sbjct  415  EKSDGIKPGPATLVAQMTQFAGRLDCKKKYAC  446



>gb|AGT16687.1| pectate lyase [Saccharum hybrid cultivar R570]
Length=441

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP  P  KEVT R+  P   +K+W W S GDV +NGAFF  SG Q   +KY
Sbjct  351  IISQGNRFIAPDDPNAKEVTKREYTPYKDYKEWVWKSQGDVMMNGAFFNESGGQN-ERKY  409

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D +    G+ VG++T+FAG L+C +G+PC
Sbjct  410  DKFDFIPAKHGRYVGQLTRFAGPLKCIVGQPC  441



>gb|KHN13652.1| Pectate lyase [Glycine soja]
Length=440

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP     KE+THRD  P + W KW W S+ D+F+NGA F  SG   G   +
Sbjct  349  ILSQGNRFIAPNNNAAKEITHRDYAPPEEWSKWQWKSENDLFMNGATFLQSGAPLGKLPF  408

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                ++ P PG    ++T+FAG L CK+GKPC
Sbjct  409  NKGLMMKPRPGAEANRLTRFAGALNCKVGKPC  440



>ref|XP_010492335.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=499

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P ++EVT RD  P+D WK WTW S+ DVF+NGA+FR SG+      
Sbjct  407  ILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWTWRSEKDVFMNGAYFRQSGNPHFKSA  466

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  467  HTRKQMIKPKNGMAVSKLTKYAGALDCRVGKRC  499



>gb|EMS65801.1| hypothetical protein TRIUR3_32637 [Triticum urartu]
Length=273

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT R+  P   +K W W S GDV +NGAFF  SG Q   ++Y
Sbjct  183  IISQGNRFIAPDDGNAKEVTKREYAPYTEYKDWVWKSQGDVMVNGAFFNESGGQN-ERRY  241

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G++D +    G+ VG++T+FAG+L C IGKPC
Sbjct  242  GNMDFIPAKHGRYVGQLTRFAGVLDCGIGKPC  273



>ref|XP_006842121.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
 gb|ERN03796.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
Length=438

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 49/92 (53%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNR+ AP     KEVT RD   +D WK+WTW S+GDV  NGAFFR SG      KY
Sbjct  348  IISQGNRYIAPTANYAKEVTKRDYASEDVWKQWTWRSEGDVMKNGAFFRESG-PPSTDKY  406

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D +   PG  VG++T+FAG L CK   PC
Sbjct  407  TRQDKITAKPGTFVGRLTRFAGALVCKRKSPC  438



>ref|XP_004147462.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
 ref|XP_004163529.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
Length=431

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP  P  +++T+R+   +S WK WTW S+GD+ +NGA+F  SG+    + Y
Sbjct  340  IISQGNRFIAPPNPAARQITNRNYATESVWKTWTWRSEGDLMMNGAYFVQSGNPSKRRPY  399

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  V ++T+F+G L C +G+PC
Sbjct  400  SRFDMIKAKPGTFVRRLTRFSGSLNCYVGRPC  431



>gb|KGN59593.1| hypothetical protein Csa_3G827350 [Cucumis sativus]
Length=441

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP  P  +++T+R+   +S WK WTW S+GD+ +NGA+F  SG+    + Y
Sbjct  350  IISQGNRFIAPPNPAARQITNRNYATESVWKTWTWRSEGDLMMNGAYFVQSGNPSKRRPY  409

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  V ++T+F+G L C +G+PC
Sbjct  410  SRFDMIKAKPGTFVRRLTRFSGSLNCYVGRPC  441



>ref|XP_007215366.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
 gb|EMJ16565.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
Length=452

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD  P D WK W W S+GD+ LNGAFF  SG  K    +
Sbjct  361  IISQGNRFIAPPNHAAKEVTKRDYAPVDVWKNWQWRSEGDLMLNGAFFVESGVAKKNHGF  420

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G LD++   PG  V ++T+FAG L C++G+ C
Sbjct  421  GKLDMMTAKPGTFVTRLTRFAGTLGCRVGQKC  452



>ref|XP_009797403.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=439

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 48/95 (51%), Positives = 61/95 (64%), Gaps = 6/95 (6%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQ---KGA  184
            IISQGNRF+A   P  K+VT RD  P+  WK W WVS+GD+FLNGA+F  SG Q   K A
Sbjct  347  IISQGNRFKAANNPNTKQVTKRDYAPESVWKNWQWVSEGDLFLNGAYFVESGPQNKKKSA  406

Query  183  QKYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                H   +   PG   G++T++AG+ +CKIG PC
Sbjct  407  LTKPH--RIKFKPGSYAGRLTRYAGVRKCKIGTPC  439



>ref|XP_008389523.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 3 [Malus 
domestica]
Length=452

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     K+VTHR+  P+  WK W W S+GD+ +NGAFF  SG  + +Q  
Sbjct  362  IISQGNRFIAPVNEATKQVTHREHTPESEWKNWEWRSEGDLMMNGAFFVESG-SRASQNP  420

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LD++   PG    K+TKF+G L C +GKPC
Sbjct  421  AKLDMMPFQPGTFATKLTKFSGALSCVVGKPC  452



>ref|XP_004236194.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=435

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP  P  KEVT RD  P++ WK W W S GD+ +NGAFF  SGD K A   
Sbjct  345  ILSQGNRFIAPPNPNAKEVTKRDYAPENVWKNWVWKSQGDLMMNGAFFVESGDPKHAFLK  404

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G  D++   PG +V  +T+F+G L+C  G+PC
Sbjct  405  GP-DMITSKPGSSVSSLTQFSGSLKCIEGRPC  435



>ref|XP_008365507.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=396

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD  P+  WK W W S+GD+ +NGAFF  SG       +
Sbjct  305  IISQGNRFIAPPNQAAKEVTKRDYAPESVWKSWQWRSEGDLMMNGAFFVQSGVPNKKHGF  364

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G LD++   PG  V ++T+FAG L CK+GK C
Sbjct  365  GKLDMIKAKPGTFVRRLTRFAGSLNCKVGKKC  396



>emb|CDP14850.1| unnamed protein product [Coffea canephora]
Length=435

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 59/93 (63%), Gaps = 4/93 (4%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP+ P  KEVT RD  P+  WK W W S GD+ +NGAFF  SGD      +
Sbjct  345  ILSQGNRFIAPENPYAKEVTKRDYAPESVWKDWVWKSQGDLMMNGAFFVQSGDPN--HNF  402

Query  174  G-HLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G + DL+ P PG+   ++T+FAG L C   +PC
Sbjct  403  GSNADLIGPKPGEFANRLTRFAGALNCIAKRPC  435



>emb|CDX70590.1| BnaC03g06740D [Brassica napus]
Length=475

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKG-PLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+SQGNRF AP   P ++EVT RD  P++ WK W W S+ D+F+NGA+FR SG+      
Sbjct  383  ILSQGNRFIAPPHLPHYREVTKRDYAPEEEWKHWNWRSEKDIFMNGAYFRQSGNPNYETD  442

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +   +++ P  G AV K+TK+AG L C++G+ C
Sbjct  443  HTRRNMIKPKNGYAVSKLTKYAGALDCRVGRRC  475



>ref|XP_009617495.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=451

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 49/93 (53%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KE+T RD  P+  WK+WTW S GD+F+NGAFF  SGD    +K+
Sbjct  359  IISQGNRFIAPPEMFKKEITKRDYAPESVWKQWTWRSQGDLFMNGAFFVESGDPDWTKKH  418

Query  174  GHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             +L D ++  PG+ V  IT+FAG L CK G  C
Sbjct  419  QNLFDGISSAPGEQVTWITRFAGALNCKQGHAC  451



>ref|XP_002437815.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
 gb|EER89182.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
Length=444

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP  P  KEVT R+      +K+W W S GDV +NGAFF  SG Q   +KY
Sbjct  354  IISQGNRFIAPDDPNAKEVTKREYTAYKDYKEWVWKSQGDVMMNGAFFNESGGQN-ERKY  412

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LD +    G+ VG++T+FAG L+C +G+PC
Sbjct  413  DELDFIPAKHGRYVGQLTRFAGPLKCIVGQPC  444



>ref|NP_001056786.1| Os06g0145100 [Oryza sativa Japonica Group]
 dbj|BAD68408.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAD68763.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAF18700.1| Os06g0145100 [Oryza sativa Japonica Group]
 gb|EAZ35810.1| hypothetical protein OsJ_20102 [Oryza sativa Japonica Group]
Length=348

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT R+  P D +K+W W S GDV +NGAFF  SG Q   + Y
Sbjct  258  IISQGNRFIAPDDLNAKEVTKREYTPYDEYKEWVWKSQGDVMMNGAFFNESGGQN-ERSY  316

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LD +    GK VG++TKFAG L C +G PC
Sbjct  317  DQLDFIPAKHGKYVGQLTKFAGTLNCHVGMPC  348



>ref|XP_004228388.1| PREDICTED: pectate lyase [Solanum lycopersicum]
Length=439

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 50/95 (53%), Positives = 61/95 (64%), Gaps = 6/95 (6%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQ---KGA  184
            IISQGNRF+A   P  K+VT RD   +S WKKW WVS+GD FLNGA+F  SG Q   K A
Sbjct  347  IISQGNRFKASDNPNTKQVTKRDYATESEWKKWQWVSEGDSFLNGAYFVESGPQDKKKTA  406

Query  183  QKYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                H   +   PG   G++T+FAG+L+CK G PC
Sbjct  407  LTKNH--KIKFKPGSHAGRLTRFAGVLKCKPGIPC  439



>ref|XP_003613595.1| Pectate lyase [Medicago truncatula]
 gb|AES96553.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IIS+GNRF AP     KE+T R+  D+S WK W W S  DV+LNGAFFR  G +   + +
Sbjct  358  IISEGNRFIAPNNGHAKEITKREYVDESVWKSWQWRSINDVYLNGAFFRQGGPELKDRPF  417

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  VG++T+++G LRC +GKPC
Sbjct  418  SRKDMIKSRPGTYVGRLTRYSGSLRCIVGKPC  449



>ref|XP_009360393.1| PREDICTED: probable pectate lyase 3 [Pyrus x bretschneideri]
Length=452

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     K+VTHR+  P+  WK W W S+GD+ +NGAFF  SG    +Q  
Sbjct  362  IISQGNRFIAPANAATKQVTHREHTPESEWKNWEWRSEGDLMMNGAFFVESG-SGASQHP  420

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LD++   PG    K+TKF+G L C +GKPC
Sbjct  421  AKLDMMPFQPGTFATKLTKFSGALNCVVGKPC  452



>ref|XP_009802165.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=451

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KE+T RD  P+  WK+WTW S GD+F+NGAFF  SGD    +K+
Sbjct  359  IISQGNRFIAPPDMFKKEITKRDYAPESVWKQWTWRSQGDLFMNGAFFVESGDPDWTKKH  418

Query  174  GHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             +L D ++  PG+ V  IT+FAG L C+ G  C
Sbjct  419  QNLFDGISSAPGEQVTWITRFAGALNCRPGHAC  451



>ref|XP_006344502.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=435

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP  P  KEVT RD  P++ WK W W S GD+ +NGAFF  SGD K A   
Sbjct  345  ILSQGNRFIAPPNPNAKEVTKRDYAPENVWKNWVWKSQGDLMMNGAFFVESGDPKHAFLK  404

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G  D++   PG  V  +T+F+G L+C  G+PC
Sbjct  405  GP-DMITSKPGSFVSSLTRFSGSLKCIEGRPC  435



>ref|XP_006655782.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=351

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRFRAP     KEVT R+    + +K+W W S GD+FLNGAFF  SG  +  ++Y
Sbjct  261  IISQGNRFRAPDDGELKEVTKREYTAYEEYKEWVWKSQGDLFLNGAFFNQSGG-RNERRY  319

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LD +    G  VG++T+FAG L C++G PC
Sbjct  320  DQLDFIPAKHGSYVGQLTQFAGTLNCRVGHPC  351



>ref|XP_010550068.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=469

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKG-PLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P +KEVT RD  P+  WK W W S+ D+F+NGAFFR SG+      
Sbjct  377  ILSHGNRFIAPPHIPQYKEVTKRDYAPEAEWKNWNWRSERDIFMNGAFFRQSGNPNFRCT  436

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV  +TK+AG L CK+G+PC
Sbjct  437  HTRQQMIKPKHGLAVSMLTKYAGALDCKVGRPC  469



>ref|NP_001056784.1| Os06g0144900 [Oryza sativa Japonica Group]
 dbj|BAD68407.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAD68762.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAF18698.1| Os06g0144900 [Oryza sativa Japonica Group]
 gb|EAZ35811.1| hypothetical protein OsJ_20103 [Oryza sativa Japonica Group]
 dbj|BAG91996.1| unnamed protein product [Oryza sativa Japonica Group]
Length=448

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPD-DSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRFRA      KEVT R+    D +K+W W S  D+FLNGAFF  SG  +  ++Y
Sbjct  358  IISQGNRFRASDDMKLKEVTKREYTSYDEYKEWVWKSQDDLFLNGAFFNESGG-RNERRY  416

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LDL+    G+ VG++T+FAG L C++GK C
Sbjct  417  NRLDLIQARNGRYVGRMTRFAGTLPCRVGKKC  448



>gb|EAY99621.1| hypothetical protein OsI_21600 [Oryza sativa Indica Group]
Length=448

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPD-DSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRFRA      KEVT R+    D +K+W W S  D+FLNGAFF  SG  +  ++Y
Sbjct  358  IISQGNRFRASDDMKLKEVTKREYTSYDEYKEWVWKSQDDLFLNGAFFNESGG-RNERRY  416

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LDL+    G+ VG++T+FAG L C++GK C
Sbjct  417  NRLDLIQARNGRYVGRMTRFAGTLPCRVGKKC  448



>emb|CDX74293.1| BnaA03g27540D [Brassica napus]
Length=471

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKG-PLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP     ++EVT RD  P+  WK W W SD D+F+N A+FR SG+ K    
Sbjct  379  ILSHGNRFIAPPHIQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNAYFRQSGNPKFMCS  438

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GKPC
Sbjct  439  HSRQQMIKPKHGSAVSKLTKYAGALDCRVGKPC  471



>ref|XP_006431087.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 ref|XP_006431088.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
 gb|ESR44327.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 gb|ESR44328.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
Length=435

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 49/92 (53%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHR-DCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF A      KEVT R DC  +    W W S+GDVFLNGA+F  SGD K   KY
Sbjct  344  ILSQGNRFFASDNKNAKEVTKRMDCSPEEGNGWIWRSEGDVFLNGAYFNASGDPKKQIKY  403

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++ P PG  V +ITKFAG L CK G+ C
Sbjct  404  ELNDVIKPAPGTEVQRITKFAGALVCKPGQQC  435



>ref|XP_006826355.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
 gb|ERM93592.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
Length=479

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/91 (49%), Positives = 56/91 (62%), Gaps = 3/91 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKYG  172
            I+SQGNRF AP  P FKE+T R  PD  W  W W S+GD+F NGA F  SG+    +KY 
Sbjct  392  ILSQGNRFVAPLDPYFKEITKRFGPDLDWGSWNWKSEGDLFKNGAIFTQSGN---GRKYE  448

Query  171  HLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                +   PG  VG +T+F+G L+CK G PC
Sbjct  449  RKISIRAKPGSYVGILTRFSGALKCKTGTPC  479



>ref|XP_006482544.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=435

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 49/92 (53%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHR-DCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF A      KEVT R DC  +    W W S+GDVFLNGA+F  SGD K   KY
Sbjct  344  ILSQGNRFFASDNKNAKEVTKRMDCSPEEGNGWIWRSEGDVFLNGAYFNASGDPKKQIKY  403

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++ P PG  V +ITKFAG L CK G+ C
Sbjct  404  ELNDVIKPAPGTEVQRITKFAGALVCKPGQQC  435



>ref|XP_011085780.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=447

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY-  175
            IISQGNR+ A   P  K+VT R+CP+  WK WTWV+DGD+FL GA+F PSGDQ    K+ 
Sbjct  357  IISQGNRYIADH-PYAKQVTKRECPESEWKHWTWVTDGDLFLRGAYFIPSGDQDWPSKHP  415

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D + P   K V ++TKFAG L CK+   C
Sbjct  416  EKSDNIKPASAKLVSQMTKFAGRLGCKLKYAC  447



>ref|XP_003519771.2| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=447

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IIS+GNRF AP     KE+T R+  P+  WK W W S  D +LNG FFR  G Q   + Y
Sbjct  356  IISEGNRFIAPDNINAKEITKREYSPEQEWKSWQWRSINDEYLNGGFFREGGAQLTDRPY  415

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  VG++T++AG L+C +GKPC
Sbjct  416  SRHDMMTARPGSYVGRLTRYAGSLKCMVGKPC  447



>ref|XP_008339934.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 61/93 (66%), Gaps = 4/93 (4%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP   + K+VTHR+  P+  WK W W S+GD+ +NGAFF  SG   GA K+
Sbjct  362  IISQGNRFIAPINGVTKQVTHRENTPEAEWKNWEWRSEGDLMMNGAFFVESG--SGASKH  419

Query  174  -GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               LD++   PG  V  +TKF+G L C +GKPC
Sbjct  420  PAKLDMMPFKPGTFVATLTKFSGALNCAVGKPC  452



>gb|KHN08706.1| Putative pectate lyase 3 [Glycine soja]
Length=444

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IIS+GNRF AP     KE+T R+  P+  WK W W S  D +LNG FFR  G Q   + Y
Sbjct  353  IISEGNRFIAPDNINAKEITKREYSPEQEWKSWQWRSINDEYLNGGFFREGGAQLTDRPY  412

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  VG++T++AG L+C +GKPC
Sbjct  413  SRHDMMTARPGSYVGRLTRYAGSLKCMVGKPC  444



>ref|XP_010420165.1| PREDICTED: probable pectate lyase 19 isoform X3 [Camelina sativa]
Length=506

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P ++EVT RD  P+D WK W W S+ DVF+NGA+FR SG+      
Sbjct  414  ILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWIWRSEKDVFMNGAYFRQSGNPHFKCA  473

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  474  HTRKQMIKPKNGMAVSKLTKYAGALDCRVGKRC  506



>emb|CDX91953.1| BnaC03g32550D [Brassica napus]
Length=471

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKG-PLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP     ++EVT RD  P+  WK W W SD D+F+N A+FR SG+ K    
Sbjct  379  ILSHGNRFIAPPHIQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNAYFRQSGNPKFMCS  438

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GKPC
Sbjct  439  HSRQQMIKPKHGSAVSKLTKYAGALDCRVGKPC  471



>gb|EYU34111.1| hypothetical protein MIMGU_mgv1a006386mg [Erythranthe guttata]
Length=446

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 50/97 (52%), Positives = 60/97 (62%), Gaps = 9/97 (9%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGD----QK  190
            IISQGNRF AP   P  KEVT R+  P+  W +W W S+GD+FL GAFF  SGD     K
Sbjct  353  IISQGNRFIAPPDNPFAKEVTKREYSPESVWSQWIWRSEGDIFLRGAFFVQSGDATYTSK  412

Query  189  GAQKYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              +KY   DL+       VG +TKFAG L CK+G+PC
Sbjct  413  HPEKY---DLIQAASATQVGIMTKFAGALGCKVGQPC  446



>ref|XP_004490003.1| PREDICTED: probable pectate lyase 3-like isoform X1 [Cicer arietinum]
Length=450

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IIS+GNRF AP     KE+T R+  P+  WK W W S  DV++NGAFFR  G +   + +
Sbjct  359  IISEGNRFIAPDNGYAKEITKREYSPESEWKNWQWRSINDVYMNGAFFRQGGSELTNRPF  418

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  VG++T+++G L+C +GKPC
Sbjct  419  SKKDMITAKPGAYVGRLTRYSGSLKCIVGKPC  450



>ref|XP_004490004.1| PREDICTED: probable pectate lyase 3-like isoform X2 [Cicer arietinum]
Length=376

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IIS+GNRF AP     KE+T R+  P+  WK W W S  DV++NGAFFR  G +   + +
Sbjct  285  IISEGNRFIAPDNGYAKEITKREYSPESEWKNWQWRSINDVYMNGAFFRQGGSELTNRPF  344

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  VG++T+++G L+C +GKPC
Sbjct  345  SKKDMITAKPGAYVGRLTRYSGSLKCIVGKPC  376



>ref|XP_008230729.1| PREDICTED: pectate lyase [Prunus mume]
Length=452

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD  P   WK W W S+GD+ LNGAFF  SG  K    +
Sbjct  361  IISQGNRFIAPPNQAAKEVTKRDYAPMGVWKNWQWRSEGDLMLNGAFFVESGVAKKNHGF  420

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G LD++   PG  V ++T+FAG L C++G+ C
Sbjct  421  GKLDMMTAKPGTFVSRLTRFAGTLGCRVGQKC  452



>ref|XP_008456459.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=434

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 60/94 (64%), Gaps = 3/94 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP  P  K+VT R+   +D WK W+W S+GD  +NGA F PSGDQ   +K 
Sbjct  341  IVSQGNRFIAPPNPNAKQVTKREYAMEDEWKHWSWRSEGDELMNGAVFIPSGDQTKGKKK  400

Query  174  G--HLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    D+++  PG  V ++ +F+G L C  GKPC
Sbjct  401  GLSRYDMISFKPGTYVRRLARFSGTLECTPGKPC  434



>ref|XP_006428983.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
 gb|ESR42223.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
Length=438

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 48/92 (52%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHR-DCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF A      KEVT R +C  +  K W W S+GDVFLNGA+F  SGD K   +Y
Sbjct  347  ILSQGNRFFASDNQNTKEVTKRMNCSPEEGKSWIWRSEGDVFLNGAYFNSSGDPKKQIEY  406

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++ P PG  V +ITKFAG L CK G+ C
Sbjct  407  QMDDVIKPKPGTEVERITKFAGALVCKPGQKC  438



>ref|XP_010915114.1| PREDICTED: LOW QUALITY PROTEIN: pectate lyase-like [Elaeis guineensis]
Length=444

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 62/92 (67%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP+    KEVT RD   +D WK+WTW S+GD+  NGAFFR SG+   A+K+
Sbjct  354  IISQGNRFVAPRMLFSKEVTKRDYATEDVWKQWTWRSEGDLMQNGAFFRESGN-PNARKF  412

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D +   PG  V ++T+FAG L C+ G+PC
Sbjct  413  DRKDFIKAKPGTWVRRLTRFAGPLGCRAGRPC  444



>ref|XP_006286712.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
 gb|EOA19610.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
Length=512

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P ++EVT RD   +D WK W W S+ DVF+NGA+FR SGD K    
Sbjct  420  ILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSEKDVFMNGAYFRQSGDPKYKCA  479

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  480  HTRQQMIKPKHGLAVSKLTKYAGALDCRVGKRC  512



>ref|XP_009758350.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=445

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF+A   P  KEVT+R+  P+  W+ W W S+GD+FLNGA+FR SG       +
Sbjct  354  IISQGNRFKASNNPNTKEVTNRNGAPESLWRNWQWRSEGDLFLNGAYFRESGPDIKHTPF  413

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 +   P K VG++T+ AG+++CKIGK C
Sbjct  414  TEHTSIKFEPAKFVGRLTRKAGVIKCKIGKAC  445



>ref|XP_009599232.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=445

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF+A   P  KEVT+R+  P+  W+ W W S+GD+FLNGA+FR SG       +
Sbjct  354  IISQGNRFKASNNPNTKEVTNRNGAPESLWRNWQWRSEGDLFLNGAYFRESGPDIKHTPF  413

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 +   P K VG++T+ AG+++CKIGK C
Sbjct  414  TEHTSIKFEPAKFVGRLTRKAGVIKCKIGKAC  445



>ref|XP_009789922.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=396

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF A      KEVTHR+   +S W+ WTW+S  D   NGAFFR SGD     K+
Sbjct  305  IISQGNRFIAQHNVDIKEVTHREKAQESEWRHWTWLSQDDDMQNGAFFRTSGDPNALSKF  364

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             +L+L+   P   VG +TKF+G L C +G+PC
Sbjct  365  KNLNLMPAEPSYRVGILTKFSGSLGCTVGRPC  396



>ref|XP_008339935.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 60/93 (65%), Gaps = 4/93 (4%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP   + K+VTHR+  P+  WK W W S+GD+ +NGAFF  SG   GA K+
Sbjct  362  IISQGNRFIAPINGVTKQVTHRENTPEAEWKNWEWRSEGDLMMNGAFFVESG--SGASKH  419

Query  174  -GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               LD +   PG  V  +TKF+G L C +GKPC
Sbjct  420  PAKLDXMPFKPGTXVXTLTKFSGALNCAVGKPC  452



>ref|XP_006480843.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 48/92 (52%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHR-DCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF A      KEVT R +C  +  K W W S+GDVFLNGA+F  SGD K   +Y
Sbjct  345  ILSQGNRFFASDNQNTKEVTKRMNCSPEEGKNWIWRSEGDVFLNGAYFNSSGDPKKQIEY  404

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++ P PG  V +ITKFAG L CK G+ C
Sbjct  405  QMDDVIKPKPGTEVERITKFAGALVCKPGQKC  436



>gb|EAY99627.1| hypothetical protein OsI_21606 [Oryza sativa Indica Group]
Length=403

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPD-DSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRFRA      KEVT R+    D +K+W W S  D+FLNGAFF  SG  +  ++Y
Sbjct  313  IISQGNRFRASDDMKLKEVTKREYTSYDEYKEWVWKSQDDLFLNGAFFNESGG-RNERRY  371

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LDL+    G+ VG++T+FAG L C++GK C
Sbjct  372  NRLDLIQARNGRYVGRMTRFAGTLPCRVGKKC  403



>ref|XP_010256490.1| PREDICTED: pectate lyase-like [Nelumbo nucifera]
Length=441

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD  P+  WK WTW S+ D+ +NGAFF  SG+      +
Sbjct  350  IISQGNRFIAPPTLAAKEVTKRDYAPESEWKHWTWRSEDDLMMNGAFFVQSGNPSRKHPF  409

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  V  +T+F+G L CKI KPC
Sbjct  410  SKKDMIPAKPGTYVSTLTRFSGALGCKINKPC  441



>ref|XP_010317101.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=389

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KE+T R+  P+  W +WTW S+GD+++NGA+F  +GD   ++K+
Sbjct  297  IISQGNRFIAPPDIFKKEITKREYSPESVWMQWTWRSEGDLYMNGAYFVQAGDPDWSKKH  356

Query  174  GHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             +L D + P P   V  IT+FAG L CK+G PC
Sbjct  357  QNLYDGIAPAPADQVTWITRFAGALNCKVGLPC  389



>ref|XP_006357289.1| PREDICTED: probable pectate lyase 3-like [Solanum tuberosum]
Length=459

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF+A   P  KEVT+R+  P+  W+ W W S+GD+F NGAFFR SG +  +  +
Sbjct  368  IISQGNRFKAADNPNTKEVTNRNGAPEALWRNWQWRSEGDLFKNGAFFRESGPEIKSTPF  427

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 +   P K VG++T+ AG+++CKIGK C
Sbjct  428  TEHTTIQFEPAKFVGRLTRKAGVIQCKIGKAC  459



>ref|XP_011098575.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=449

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 50/97 (52%), Positives = 60/97 (62%), Gaps = 9/97 (9%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGD----QK  190
            IISQGNR+ AP   P  KEVT R+  P+  WK W W S+GD+F  GAFF  SGD     K
Sbjct  356  IISQGNRYIAPPTNPYAKEVTKREYSPESVWKSWVWRSEGDIFQGGAFFVQSGDPTYTSK  415

Query  189  GAQKYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              +KY   DL+   P + V +ITKFAG L CK+G PC
Sbjct  416  HPEKY---DLIQAAPAQNVAEITKFAGALGCKVGVPC  449



>ref|XP_010420163.1| PREDICTED: probable pectate lyase 19 isoform X1 [Camelina sativa]
Length=499

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P ++EVT RD  P+D WK W W S+ DVF+NGA+FR SG+      
Sbjct  407  ILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWIWRSEKDVFMNGAYFRQSGNPHFKCA  466

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  467  HTRKQMIKPKNGMAVSKLTKYAGALDCRVGKRC  499



>ref|XP_010420164.1| PREDICTED: probable pectate lyase 19 isoform X2 [Camelina sativa]
Length=472

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P ++EVT RD  P+D WK W W S+ DVF+NGA+FR SG+      
Sbjct  380  ILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWIWRSEKDVFMNGAYFRQSGNPHFKCA  439

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  440  HTRKQMIKPKNGMAVSKLTKYAGALDCRVGKRC  472



>ref|XP_009587688.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=396

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF A      KEVTHR+   +S W+ WTW+S  D   NGAFFR SGD     K+
Sbjct  305  IISQGNRFIAQHNVDIKEVTHREKAQESEWRHWTWLSRDDDMQNGAFFRTSGDPNALSKF  364

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             +L+L+   P   VG +TKF+G L C +G+PC
Sbjct  365  KNLNLMPAEPSYRVGILTKFSGSLGCTVGRPC  396



>ref|XP_006354795.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=435

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP  P  KEVT RD  P+  WK W W S GD+ +NGAFF  SG++      
Sbjct  345  ILSQGNRFIAPPNPNAKEVTKRDYSPESVWKNWVWRSQGDLMMNGAFFVESGNRNHKFMT  404

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G  D+++P  G   G++T+F+G L C  GKPC
Sbjct  405  GP-DMIHPRAGSDAGRLTRFSGSLNCIEGKPC  435



>ref|XP_011097774.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=435

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/95 (51%), Positives = 59/95 (62%), Gaps = 4/95 (4%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSG---DQKGA  184
            I+SQGNRFRA   P  KEVT RD    + W KW W S+GD+F NGA+FR SG    Q  A
Sbjct  341  IVSQGNRFRASNYPYTKEVTKRDYATKEEWMKWQWRSEGDLFKNGAYFRESGPPLSQNKA  400

Query  183  QKYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                  +L+   PG  VGK+T++AG LRC+ GK C
Sbjct  401  NPLEGQNLIKYRPGSFVGKLTRWAGALRCRKGKLC  435



>gb|KDO49831.1| hypothetical protein CISIN_1g044170mg, partial [Citrus sinensis]
Length=372

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHR-DCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF A      KEVT R +C  +  K W W S+GDVFLNGA+F  SGD K   +Y
Sbjct  281  ILSQGNRFFASDNQNTKEVTKRMNCSPEEGKSWIWRSEGDVFLNGAYFNSSGDPKKQIEY  340

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++ P PG  V +ITKFAG L CK G+ C
Sbjct  341  QMDDVIKPKPGTEVERITKFAGALVCKPGQKC  372



>gb|KEH24975.1| pectate lyase P59-like protein [Medicago truncatula]
Length=453

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP     KEVTHRD  P D WK W W S+ DVF+NGA F PSG     + +
Sbjct  362  ILSQGNRFIAPDNGAAKEVTHRDYAPPDVWKNWQWSSELDVFMNGAKFVPSGAPINRKPF  421

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                ++ P  G  V ++T+ AG L C +GKPC
Sbjct  422  KKAYMMQPRDGSHVSRLTRNAGALNCVVGKPC  453



>ref|XP_008221660.1| PREDICTED: probable pectate lyase 3 [Prunus mume]
Length=443

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 48/92 (52%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD  P+  WKKW W S+GD+ +NGA F  SG  K     
Sbjct  353  IISQGNRFIAPPNQGAKEVTKRDHTPEAEWKKWEWRSEGDLMMNGAIFVQSGSGKSNHP-  411

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              +DL+   PG  V ++TKFAG L C +GKPC
Sbjct  412  AKMDLMPFKPGTYVAELTKFAGALDCFVGKPC  443



>ref|XP_009134622.1| PREDICTED: probable pectate lyase 7 [Brassica rapa]
Length=471

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKG-PLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP     ++EVT RD  P+  WK W W SD D+F+N A+FR SG+ K    
Sbjct  379  ILSHGNRFIAPPHLQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNAYFRQSGNPKFMCS  438

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV  +TK+AG L C++GKPC
Sbjct  439  HSRQQMIKPKHGSAVSTLTKYAGALDCRVGKPC  471



>gb|ABK28696.1| unknown [Arabidopsis thaliana]
Length=473

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P ++EVT RD   +D WK W W SD DVF+NGA+FR SG+ +    
Sbjct  380  ILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSDKDVFMNGAYFRQSGNPQYKCA  439

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++G+ C
Sbjct  440  HTRQQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>ref|NP_197015.4| putative pectate lyase 19 [Arabidopsis thaliana]
 gb|AED92118.1| putative pectate lyase 19 [Arabidopsis thaliana]
Length=472

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P ++EVT RD   +D WK W W SD DVF+NGA+FR SG+ +    
Sbjct  380  ILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSDKDVFMNGAYFRQSGNPQYKCA  439

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++G+ C
Sbjct  440  HTRQQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>gb|EMT27253.1| hypothetical protein F775_20306 [Aegilops tauschii]
Length=352

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNR+RAP     KE T R+   +S WK W WVS+GD+ +N A+F  SG + G QK 
Sbjct  262  ILSQGNRYRAPPNMAAKEATKREYAAESEWKNWVWVSEGDLMVNDAYFTTSGGKIG-QKL  320

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               DL+ P PG+ V ++T+FAG L C  G PC
Sbjct  321  NGKDLIKPKPGEYVRRLTRFAGPLDCNQGSPC  352



>ref|XP_009125036.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 7 [Brassica 
rapa]
Length=470

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKG-PLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP     ++EVT RD  P+  WK W W S+ D+F+N A+FR SG+ K    
Sbjct  378  ILSHGNRFIAPPHIQHYREVTKRDSAPESEWKNWNWRSEKDIFMNNAYFRQSGNPKFMCS  437

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GKPC
Sbjct  438  HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKPC  470



>ref|XP_003613596.1| Pectate lyase [Medicago truncatula]
 gb|AES96554.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IIS+GN+F AP     KE+T R   P+  WK W W S  D++LNGAFFR SG +   + +
Sbjct  358  IISEGNKFIAPNNGHAKEITKRTLVPEAEWKTWQWRSINDLYLNGAFFRQSGAELINRPF  417

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             + D++   PG  VG++T+++  LRC++GKPC
Sbjct  418  SNKDMIKAKPGSYVGRLTRYSRSLRCRVGKPC  449



>ref|XP_010066949.1| PREDICTED: pectate lyase [Eucalyptus grandis]
 gb|KCW65002.1| hypothetical protein EUGRSUZ_G02541 [Eucalyptus grandis]
Length=436

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD   +D WK W W S+GD+ +NGAFF  SG+ +    +
Sbjct  345  IISQGNRFIAPPNIAAKEVTKRDYATEDQWKNWLWKSEGDLMMNGAFFVNSGNPRARFPF  404

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  V ++T+FAG L C++G+PC
Sbjct  405  SRRDVIKAKPGTYVRRLTRFAGKLGCRVGRPC  436



>sp|Q9LFP5.1|PLY19_ARATH RecName: Full=Probable pectate lyase 19; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC01830.1| pectate lyase-like protein [Arabidopsis thaliana]
Length=472

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P ++EVT RD   +D WK W W SD DVF+NGA+FR SG+ +    
Sbjct  380  ILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSDKDVFMNGAYFRQSGNPQYKCA  439

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++G+ C
Sbjct  440  HTRQQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>ref|XP_004165454.1| PREDICTED: pectate lyase-like [Cucumis sativus]
 gb|KGN64253.1| hypothetical protein Csa_1G045510 [Cucumis sativus]
Length=439

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 60/92 (65%), Gaps = 3/92 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHR-DCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP  P  KEVT R   P+  W+ W W S+GD+ +NGAFF  SG+    ++Y
Sbjct  350  IISQGNRFIAPPNPNCKEVTKRVYAPESEWRSWNWRSEGDLMMNGAFFIQSGNP--IKRY  407

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D+++  PG  V ++T+FAG L+CK  +PC
Sbjct  408  SKKDVIHSKPGTFVTRLTRFAGPLKCKKNQPC  439



>emb|CDY28691.1| BnaCnng05770D [Brassica napus]
Length=469

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKG-PLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP     ++EVT RD  P+  WK W W S+ D+F+N A+FR SG+ K    
Sbjct  377  ILSHGNRFIAPPHLQHYREVTKRDSAPESEWKNWNWRSEKDIFMNNAYFRQSGNPKFMCS  436

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GKPC
Sbjct  437  HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKPC  469



>ref|XP_002270089.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32015.3| unnamed protein product [Vitis vinifera]
Length=443

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 47/96 (49%), Positives = 60/96 (63%), Gaps = 5/96 (5%)
 Frame = -3

Query  351  IISQGNRFRAPK--GPLF--KEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKG  187
            IISQGNR+ AP    P    K+VT RD   +S WKKWTW S+GD+  NGAFF PSG+   
Sbjct  348  IISQGNRYTAPHLVDPKHDAKQVTKRDYAMESEWKKWTWRSEGDLMRNGAFFVPSGNPSK  407

Query  186  AQKYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               Y  LD++   PG  V ++T+F+G L C+ G PC
Sbjct  408  RMPYSRLDMIKAKPGTYVSRLTRFSGALTCRRGGPC  443



>ref|XP_009788285.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=434

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP  P  KEVT R+  P+  WK W W S GD+ +NGAFF  SG+       
Sbjct  344  ILSQGNRFIAPPNPNAKEVTKREYSPESVWKNWVWRSQGDLMMNGAFFVESGNPNHIFMK  403

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G  D+++P PG    ++T+F+G L C  GKPC
Sbjct  404  GP-DMIHPRPGSYASRLTRFSGSLNCIEGKPC  434



>ref|XP_002871648.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47907.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P ++EVT RD   +D WK W W S+ DVF+NGA+FR SG+ +    
Sbjct  380  ILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSEKDVFMNGAYFRQSGNPQYKCA  439

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  440  HTRQQMIKPKHGLAVSKLTKYAGALDCRVGKRC  472



>ref|XP_004298448.1| PREDICTED: probable pectate lyase 3-like [Fragaria vesca subsp. 
vesca]
Length=443

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 61/92 (66%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP+  + KEVT R+  D+S WK W W S+GDV  NGAFF  SG+   A K 
Sbjct  353  IISQGNRFIAPESHVAKEVTKREYTDESEWKNWNWRSEGDVMENGAFFVESGNPNCA-KS  411

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             +++++   PGK   ++T FAG L C +G+PC
Sbjct  412  TNIEMMPFKPGKLAPQLTSFAGALECFVGRPC  443



>ref|XP_009627245.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=440

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 61/96 (64%), Gaps = 7/96 (7%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQ---KGA  184
            IISQGNRF+A   P  K+VT RD  P+  WK W WVS+GD+FLNGA+F  SG Q   K A
Sbjct  347  IISQGNRFKAANNPNTKQVTKRDYAPESVWKNWQWVSEGDLFLNGAYFVESGPQNKKKSA  406

Query  183  QKYGHLDLVNPLPGKAVGKITKFAG-LLRCKIGKPC  79
                H   +   PG   G++T++AG L++CK G PC
Sbjct  407  LTKPH--RIKFKPGSYAGRLTRYAGVLIKCKAGTPC  440



>ref|XP_009598230.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=434

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP  P  KEVT R+  P+  WK W W S GD+ +NGAFF  SG+       
Sbjct  344  ILSQGNRFIAPPNPNAKEVTKREYSPESVWKNWVWRSQGDLMMNGAFFVESGNPNHIFMK  403

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G  D+++P PG    ++T+F+G L C  GKPC
Sbjct  404  GP-DMIHPRPGSYASRLTRFSGSLNCIEGKPC  434



>ref|XP_010112093.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXC32626.1| putative pectate lyase 7 [Morus notabilis]
Length=437

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDD-SWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     K+VT RD   +  WK+WTW S+GD+ +NGAFF  SG++   + +
Sbjct  346  IISQGNRFIAPPNNAAKQVTKRDYAAEWEWKRWTWRSEGDLMMNGAFFVQSGNRSKKRPF  405

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  V ++T+FAG L C  GK C
Sbjct  406  TRHDMIKAKPGTFVTRLTRFAGALNCYAGKKC  437



>ref|XP_010105747.1| putative pectate lyase P59 [Morus notabilis]
 gb|EXC05967.1| putative pectate lyase P59 [Morus notabilis]
Length=421

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     K+VT RD  P+  WK W W S+GD+ +NGAFF  SG +   ++Y
Sbjct  330  IISQGNRFIAPLDLNAKQVTKRDYAPESDWKNWRWRSEGDLLMNGAFFVQSGKRLSKRRY  389

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                ++   PG  V ++T++AG L C IG+PC
Sbjct  390  SRPGMIKYKPGTFVTRLTRYAGTLVCGIGRPC  421



>gb|EPS66620.1| hypothetical protein M569_08154, partial [Genlisea aurea]
Length=451

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 58/96 (60%), Gaps = 5/96 (5%)
 Frame = -3

Query  351  IISQGNRFRAPKGPL---FKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGA  184
            IISQGNR+ AP   +    KEVT RD  P+  W+ WTW SDGDVF+ GA+F  SGD    
Sbjct  356  IISQGNRYIAPPDDVNMYAKEVTKRDYAPESVWQSWTWRSDGDVFMRGAYFTQSGDPNYM  415

Query  183  QKYGH-LDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             K+    DL+    G  V  IT+FAG L CK+G PC
Sbjct  416  SKHPERYDLMQAADGSNVAAITRFAGALLCKVGAPC  451



>ref|XP_010453638.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=490

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P ++EVT RD  P+D WK W W S+ DVF+NGA+FR SG+      
Sbjct  398  ILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWNWRSEKDVFMNGAYFRQSGNPHFKCT  457

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++    G AV K+TK+AG L C++GK C
Sbjct  458  HTRKQMIKHKNGMAVSKLTKYAGALDCRVGKRC  490



>ref|XP_010417138.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=169

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP     ++EVT RD  P+  WK W W S+ D FLNGA+FR SG+      
Sbjct  77   ILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSEKDYFLNGAYFRQSGNPHFKCS  136

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  137  HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  169



>ref|XP_008446067.1| PREDICTED: pectate lyase-like, partial [Cucumis melo]
Length=381

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 60/92 (65%), Gaps = 3/92 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHR-DCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP  P  KEVT R    +  W+ W W S+GD+ +NGAFF  SG+    ++Y
Sbjct  292  IISQGNRFIAPPNPNSKEVTKRVYASEREWRSWNWRSEGDLMMNGAFFIQSGNP--IRRY  349

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D+++  PG  V ++T+FAG L+CK+ +PC
Sbjct  350  SKKDVIHSKPGTFVTRLTRFAGPLKCKMNQPC  381



>ref|XP_010678579.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=443

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            II QGNRF AP     KEVT R+  P   WK W W S+ D+ +NGAFF  SGD      Y
Sbjct  352  IICQGNRFIAPPNIFAKEVTKREYAPYSVWKDWLWTSEDDIMMNGAFFNQSGDTSKKPSY  411

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  V  +T+FAG L CK G  C
Sbjct  412  AKKDMIKAKPGSEVTHLTRFAGALNCKEGTAC  443



>ref|XP_011087217.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=436

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP  P  KEVT RD   +S WK W W S+GDV  NGAFF  SGD    +  
Sbjct  345  ILSQGNRFVAPDNPFAKEVTKRDYATESVWKNWVWKSEGDVMNNGAFFVQSGDVAHHKFA  404

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D+V P PG    K+++FAG L C  GKPC
Sbjct  405  KGPDMVTPKPGGFASKLSQFAGPLNCIPGKPC  436



>ref|XP_009761969.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=434

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP  P  KEVT RD  P+  WK W W S GD+ +NGAFF  SG+   A   
Sbjct  344  ILSQGNRFIAPPNPNAKEVTKRDYAPESVWKNWVWKSQGDLMMNGAFFVESGNPNHAFLR  403

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D+++  PG  V  +T+F+G L C  GKPC
Sbjct  404  SP-DMISSKPGSFVSSLTRFSGSLNCIEGKPC  434



>ref|XP_009139602.1| PREDICTED: probable pectate lyase 15 [Brassica rapa]
Length=451

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNR+ APK P  KEVT R   D S W+KW W S+GD+ LNGAFF+ SG +  A  Y
Sbjct  361  INSQGNRYAAPKNPFAKEVTKRVETDASEWQKWNWRSEGDLLLNGAFFKASGAEASAS-Y  419

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    +   P   V  IT  AG L C+ G+PC
Sbjct  420  GRASSLAAKPSSMVHTITSTAGALGCRRGRPC  451



>emb|CDY01151.1| BnaA04g06680D [Brassica napus]
Length=452

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNR+ APK P  KEVT R   D S W+KW W S+GD+ LNGAFF+ SG +  A  Y
Sbjct  362  INSQGNRYAAPKNPFAKEVTKRVETDASEWQKWNWRSEGDLLLNGAFFKASGAEASAS-Y  420

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    +   P   V  IT  AG L C+ G+PC
Sbjct  421  GRASSLAAKPSSMVHTITSTAGALGCRRGRPC  452



>ref|XP_010485518.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPL-FKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP     ++EVT RD  P+  WK W W SD D FLNGA+FR SG+      
Sbjct  381  ILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSDKDYFLNGAYFRQSGNPHFKCS  440

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  441  HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>emb|CDY53564.1| BnaC04g55760D [Brassica napus]
Length=455

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNR+ APK P  KEVT R   D S W+KW W S+GD+ LNGAFF+ SG +  A  Y
Sbjct  365  INSQGNRYAAPKNPFAKEVTKRVETDASEWQKWNWRSEGDLLLNGAFFKASGAEASAS-Y  423

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    +   P   V  IT  AG L C+ G+PC
Sbjct  424  GRASSLAAKPSSMVHTITSTAGALGCRRGRPC  455



>ref|XP_006484673.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHR-DCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF A      KEVT R +C  +  K W W S+GDVFLNGA+F  SGD K   +Y
Sbjct  345  ILSQGNRFFASNNQNTKEVTKRMNCSPEEGKSWIWRSEGDVFLNGAYFNSSGDPKKQIQY  404

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               +++ P  G  V +ITKFAG L CK G+ C
Sbjct  405  QMDNVIKPESGTEVERITKFAGALVCKPGQEC  436



>ref|XP_009615547.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=434

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP  P  KEVT RD  P+  WK W W S GD+ +NGAFF  SG+   A   
Sbjct  344  ILSQGNRFIAPPNPNAKEVTKRDYAPESVWKNWVWKSQGDLMMNGAFFVESGNPNHAFLR  403

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D+++  PG  V  +T+F+G L C  GKPC
Sbjct  404  SP-DMISSKPGSFVSSLTRFSGSLNCIEGKPC  434



>dbj|BAJ99909.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNR+ AP     K+VT RD  P+  WK W W S+GD+ +N AFF+ SG Q  +QK 
Sbjct  212  IISQGNRYIAPPNMAAKQVTKRDYAPEAVWKNWVWRSEGDLMMNNAFFQTSGGQI-SQKL  270

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               DL+ P PG+ V ++T+F+G L CK G  C
Sbjct  271  NGKDLIKPKPGEYVTRLTRFSGTLACKPGCAC  302



>gb|KFK25747.1| hypothetical protein AALP_AA8G154300 [Arabis alpina]
Length=504

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P ++EVT RD   +D WK W W S+ D+F+NGA+FR SG       
Sbjct  412  ILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSEKDIFMNGAYFRQSGTPGYKCA  471

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  472  HTRKQMIKPKNGMAVSKLTKYAGALDCRVGKRC  504



>ref|XP_006361835.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=447

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDC-PDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            II+QGNRF AP     K+VT R+  P+  W +WTW S+G++F+NGA+F  SGD   ++K+
Sbjct  355  IITQGNRFIAPPDIFKKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPDWSKKH  414

Query  174  GHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              L D ++  P + V  +T+FAG+L CK GKPC
Sbjct  415  KDLYDGISAAPAEDVTWMTRFAGVLACKPGKPC  447



>ref|NP_001150425.1| LOC100284055 precursor [Zea mays]
 gb|ACG39044.1| pectate lyase precursor [Zea mays]
 gb|ACR35178.1| unknown [Zea mays]
 gb|AFW75496.1| pectate lyase [Zea mays]
Length=453

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRFRA     FKEVT R+    S +K W W S  D+FLNGAFF  SG Q   +KY
Sbjct  363  IISQGNRFRAVDDSRFKEVTKREYTQYSEYKNWVWKSQDDLFLNGAFFNQSGGQN-ERKY  421

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LDL+    G+    +T++AG L C++G+ C
Sbjct  422  DRLDLIQAKGGQYAESLTRYAGALNCRVGRKC  453



>ref|XP_008793504.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=446

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD   +D WK+WTW S+GD+  NGAFFR SG     + +
Sbjct  356  IISQGNRFIAPLMQFAKEVTKRDYATEDVWKQWTWRSEGDLMQNGAFFRESG-SPNTKSF  414

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D +   PG  V ++T+FAG L C+ G+PC
Sbjct  415  HRKDFIKAKPGTWVRRLTRFAGPLGCRAGRPC  446



>ref|XP_004232242.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=446

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 49/93 (53%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD  P+  WK+W+W S GD+F+NGAFF  SGD    QK+
Sbjct  354  IISQGNRFIAPPDMFKKEVTKRDYSPESVWKQWSWRSQGDLFMNGAFFVESGDPDWTQKH  413

Query  174  GHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              L D V    G  V  IT+F+G L CK G+ C
Sbjct  414  IQLFDGVVSASGDQVTWITRFSGALNCKPGEAC  446



>dbj|BAD95093.1| pectate lyase like protein [Arabidopsis thaliana]
Length=174

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP     ++EVT RD   +S WK W W S+ DVF+N A+FR SG+      
Sbjct  82   ILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMNNAYFRQSGNPHFKCS  141

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  142  HSRQQMIKPKNGMAVSKLTKYAGALDCRVGKAC  174



>gb|EYU24412.1| hypothetical protein MIMGU_mgv1a011674mg [Erythranthe guttata]
Length=274

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 58/94 (62%), Gaps = 6/94 (6%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGD--QKGAQ  181
            I+SQGN F AP+    KEVT RD  P+  WK W W S+GDV  NGAFF+ SGD   K A 
Sbjct  184  ILSQGNNFVAPQDRFAKEVTKRDYAPESVWKNWVWKSEGDVMKNGAFFKQSGDPKHKFAL  243

Query  180  KYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             YG    + P PG  V  +TKFAG L+C  G+PC
Sbjct  244  GYG---TIAPKPGGYVPSLTKFAGPLKCIKGRPC  274



>gb|KDO49230.1| hypothetical protein CISIN_1g036607mg [Citrus sinensis]
Length=436

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHR-DCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF A      KEVT R +C  +  K W W S+GDV LNGA+F  SGD K   +Y
Sbjct  345  ILSQGNRFFASNNQNAKEVTKRMNCSPEEGKSWIWRSEGDVLLNGAYFNSSGDPKKQIQY  404

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++ P  G  V +ITKFAG L CK G+ C
Sbjct  405  QMDDVIKPESGTEVERITKFAGALVCKPGQEC  436



>ref|XP_009599826.1| PREDICTED: probable pectate lyase P59 isoform X2 [Nicotiana tomentosiformis]
Length=444

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDC-PDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            II+QGNRF AP     K+VT R+  P++ WK WTW S+G++F+NGA+F  SGD   ++K+
Sbjct  352  IITQGNRFIAPPDIFKKQVTKREYNPEEVWKHWTWRSEGNLFMNGAYFIESGDPDWSKKH  411

Query  174  GHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              L D ++  P + V  IT+FAG L CK GK C
Sbjct  412  KELYDGISAAPAEEVTWITRFAGALGCKKGKAC  444



>ref|XP_009599825.1| PREDICTED: probable pectate lyase P59 isoform X1 [Nicotiana tomentosiformis]
Length=445

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDC-PDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            II+QGNRF AP     K+VT R+  P++ WK WTW S+G++F+NGA+F  SGD   ++K+
Sbjct  353  IITQGNRFIAPPDIFKKQVTKREYNPEEVWKHWTWRSEGNLFMNGAYFIESGDPDWSKKH  412

Query  174  GHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              L D ++  P + V  IT+FAG L CK GK C
Sbjct  413  KELYDGISAAPAEEVTWITRFAGALGCKKGKAC  445



>ref|XP_002437204.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
 gb|EER88571.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
Length=454

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNR+ AP     K VT H D P+  WK W W S+ D+F+ GA F  SG QK  + +
Sbjct  363  IISQGNRYIAPPNLAAKLVTKHHDAPESEWKNWVWHSENDLFMEGANFTVSGGQKINRNF  422

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               DL+ P  G  V ++T++AG L C+ GKPC
Sbjct  423  HKKDLIKPKNGSYVTRLTRYAGALACRPGKPC  454



>ref|XP_007046218.1| Pectate lyase family protein, putative [Theobroma cacao]
 gb|EOY02050.1| Pectate lyase family protein, putative [Theobroma cacao]
Length=441

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD  P + WK W+W S+GD+ +NGAFF  SGD + ++++
Sbjct  350  IISQGNRFVAPPNAAAKEVTKRDYAPPEVWKNWSWRSEGDLMVNGAFFTQSGDPRASRRF  409

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                +++  PG+ V  +T+++G L C   +PC
Sbjct  410  LGNFMISAKPGQMVSLLTRYSGSLDCVRRRPC  441



>ref|XP_002511525.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF52127.1| Pectate lyase precursor, putative [Ricinus communis]
Length=433

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDC-PDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP  P  K+VT R+  P+  WK W W S+GD+ LNGAFF  SG     + +
Sbjct  345  IISQGNRFLAPPDPDCKQVTKRNVEPESEWKSWNWRSEGDLMLNGAFFVESGSP--IETH  402

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G  + V+ +PG  V ++T++AG L CK  KPC
Sbjct  403  GK-EEVHAMPGTLVHRLTRYAGALHCKKQKPC  433



>ref|XP_002517472.1| pectate lyase, putative [Ricinus communis]
 gb|EEF45014.1| pectate lyase, putative [Ricinus communis]
Length=431

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD   ++ WKKWTW S+GD+ +NGAFF  SGD K   K 
Sbjct  340  IISQGNRFIAPDNQYLKEVTKRDYATEAEWKKWTWRSEGDLLMNGAFFVQSGDPKLKVKP  399

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                L+   PG    ++T+FAG L C  G+ C
Sbjct  400  SKKYLIKAKPGIYATRLTRFAGALNCIPGRKC  431



>ref|XP_004234779.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=449

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDC-PDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            II+QGNRF AP     K+VT R+  P+  W +WTW S+G++F+NGA+F  SGD + + K+
Sbjct  357  IITQGNRFIAPPDIFKKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPEWSSKH  416

Query  174  GHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              L D ++  P + V  +T+FAG+L CK GKPC
Sbjct  417  KDLYDGISAAPAEDVTWMTRFAGVLGCKPGKPC  449



>gb|EYU36839.1| hypothetical protein MIMGU_mgv1a006379mg [Erythranthe guttata]
Length=446

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 58/97 (60%), Gaps = 9/97 (9%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGD----QK  190
            IISQGNRF AP   P  KEVT R+  P+  W +W W S+GD+FL GAFF  SGD     K
Sbjct  353  IISQGNRFIAPPDNPFAKEVTKREYSPESVWSQWIWRSEGDIFLRGAFFVQSGDPTYTSK  412

Query  189  GAQKYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              +KY   DL+       V  +TKFAG L CKIG+ C
Sbjct  413  HPEKY---DLIQAASATQVEIMTKFAGALGCKIGQVC  446



>emb|CDY01846.1| BnaC06g28860D [Brassica napus]
Length=406

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP   +FKEVT + D P   WK W W S+GD+FLNGAFF PSG  + +  Y
Sbjct  316  INSQGNRFLAPNNKVFKEVTKYEDAPQSKWKNWNWRSEGDLFLNGAFFTPSGG-RASSMY  374

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   V  +T  AG L CK G  C
Sbjct  375  AKASSLSARPSSLVASVTGNAGALSCKKGSRC  406



>gb|AAB69766.1| putative pectate lyase Nt59 [Nicotiana tabacum]
Length=171

 Score = 85.1 bits (209),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDC-PDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            II+QGNRF AP     ++VT R+  P++ WK WTW S+G++F+NGA+F  SGD   ++K+
Sbjct  79   IITQGNRFIAPPDIFKEQVTKREYNPEEVWKHWTWRSEGNLFMNGAYFIESGDPDWSKKH  138

Query  174  GHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              L D ++  P + V  IT+FAG L CK GK C
Sbjct  139  KELYDGISAAPAEEVTWITRFAGALGCKKGKAC  171



>ref|XP_010445460.1| PREDICTED: probable pectate lyase 15 [Camelina sativa]
Length=170

 Score = 85.1 bits (209),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNR+ AP     KEVT R   D S WKKW W S+GD+ LNGA+FR SG++  A  Y
Sbjct  80   INSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAYFRSSGEEASAS-Y  138

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    +   P   V  IT  AG L C+ G+PC
Sbjct  139  GRASSLAAKPSSMVDTITSTAGALGCRKGRPC  170



>ref|XP_010513594.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPL-FKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP     ++EVT RD  P+  WK W W S+ D FLNGA+FR SG+      
Sbjct  381  ILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSEKDYFLNGAYFRQSGNPHFKCS  440

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  441  HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>gb|AGT16685.1| pectate lyase precursor [Saccharum hybrid cultivar R570]
Length=326

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRFRA     FKEVT R+  P   +K W W S  D+FLNGAFF  SG Q   +++
Sbjct  236  IISQGNRFRAVDDRNFKEVTKREYTPYSQYKDWVWKSQDDLFLNGAFFNQSGGQN-ERRF  294

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LDL+    G+    +T++AG L C++GK C
Sbjct  295  DRLDLIQAKGGQYAESLTRYAGALNCRVGKKC  326



>ref|XP_004162547.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
Length=435

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 58/94 (62%), Gaps = 3/94 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP  P  K+VT R+   +D WK W+W S+GD  +NGA F  SGDQ   +K 
Sbjct  342  IVSQGNRFIAPPNPNAKQVTKREYAMEDEWKHWSWRSEGDELMNGAVFIASGDQTKGKKK  401

Query  174  G--HLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    D+++  PG  V ++ + +G + C  GKPC
Sbjct  402  GLSRYDMISFKPGTYVRRLVRLSGTIECTPGKPC  435



>ref|XP_009789921.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     K++T R+  P+  W +WTW S+GD+++NGA+F  SGD   ++K+
Sbjct  355  IISQGNRFIAPPDIFKKQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQSGDPDWSKKH  414

Query  174  GHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             +L D ++  P   V  IT+FAG L CK+G+ C
Sbjct  415  QNLYDGISAAPADQVTWITRFAGALGCKVGQAC  447



>ref|XP_009105327.1| PREDICTED: probable pectate lyase 5 [Brassica rapa]
Length=406

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP   +FKEVT + D P   WK W W S+GD+FLNGAFF PSG  + + KY
Sbjct  316  INSQGNRFLAPNDKVFKEVTKYEDAPQSKWKNWNWRSEGDLFLNGAFFTPSGG-RASSKY  374

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   V  +T  AG L CK G  C
Sbjct  375  AKASSLSARPSSLVASVTGNAGALSCKKGSRC  406



>emb|CDY56220.1| BnaAnng14170D [Brassica napus]
Length=406

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP   +FKEVT + D P   WK W W S+GD+FLNGAFF PSG  + + KY
Sbjct  316  INSQGNRFLAPNDKVFKEVTKYEDAPQSKWKNWNWRSEGDLFLNGAFFTPSGG-RASSKY  374

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   V  +T  AG L CK G  C
Sbjct  375  AKASSLSARPSSLVASVTGNAGALSCKKGSRC  406



>ref|XP_003530685.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=451

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IIS+GNRF AP     K++T R+  P++ W  W W S  DV++NGAFF  SG +  ++ +
Sbjct  359  IISEGNRFIAPDNQFAKQITKREYAPENVWANWQWRSINDVYMNGAFFVQSGPELASRPF  418

Query  174  GHLDLVNPLPGKAVGKITKFAG-LLRCKIGKPC  79
               D++    G  VG++T+++G LL+C++G+PC
Sbjct  419  SREDMITAKVGNYVGRLTRYSGNLLKCRVGRPC  451



>ref|XP_004489168.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=444

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP     K +THRD    D W KW W S+ D+F+NGA F  SG       +
Sbjct  353  ILSQGNRFIAPNNNAAKTITHRDYASQDVWSKWQWRSENDLFMNGATFIESGAPIKNLPF  412

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                L+ P PG    ++T++AG L C+IG+PC
Sbjct  413  KKGYLMKPRPGTQANRLTRYAGALNCQIGRPC  444



>ref|XP_011013803.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=419

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 60/93 (65%), Gaps = 5/93 (5%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQ-KGAQK  178
            IISQGNRF AP     KEVT RD   +S WK W W S+GD+ LNGAFF  SG+  K   K
Sbjct  330  IISQGNRFIAPPDLACKEVTKRDYAVESVWKSWNWRSEGDLMLNGAFFVQSGNAIKTMNK  389

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             G   ++N +PG+ V ++T+F+G L C  G+PC
Sbjct  390  QG---VINAMPGRHVSRLTRFSGALDCVRGRPC  419



>ref|XP_009380431.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score = 87.4 bits (215),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF  P     KEVTHR+  P+  WK W W S+ D F +GAFF  SG  K   K+
Sbjct  346  IISQGNRFVGPPIQFAKEVTHREYAPESEWKNWIWTSEDDEFKSGAFFIQSG-HKYQGKH  404

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG   G++T+F+G L+C   +PC
Sbjct  405  SRYDVIKAKPGSIAGRLTRFSGALQCSPNRPC  436



>ref|XP_010463548.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPL-FKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP     ++EVT RD  P+  WK W W S+ D FLNGA+FR SG+      
Sbjct  381  ILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSEKDYFLNGAYFRQSGNPHFKCS  440

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  441  HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>ref|XP_006338480.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=446

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD  P+  WK+W+W S GD+F+NGAFF  SGD    +K+
Sbjct  354  IISQGNRFIAPPDMFKKEVTKRDYSPESVWKQWSWRSQGDLFMNGAFFVESGDPDWTKKH  413

Query  174  GHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              L D +    G  V  IT+F+G L CK G+ C
Sbjct  414  TELFDGIVSASGDQVTWITRFSGALNCKPGEAC  446



>sp|P15722.1|PLY59_SOLLC RecName: Full=Probable pectate lyase P59; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33523.1| P59 protein [Solanum lycopersicum]
Length=449

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDC-PDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            II QGNRF AP     K+VT R+  P+  W +WTW S+G++F+NGA+F  SGD + + K+
Sbjct  357  IIHQGNRFIAPPDIFKKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPEWSSKH  416

Query  174  GHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              L D ++  P + V  +T+FAG+L CK GKPC
Sbjct  417  KDLYDGISAAPAEDVTWMTRFAGVLGCKPGKPC  449



>ref|XP_006374492.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
 gb|ERP52289.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
Length=435

 Score = 87.4 bits (215),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 58/92 (63%), Gaps = 3/92 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP  P  KEVT RD   +S WK W W S+GD+ LNGAFF  SG+    +  
Sbjct  346  IISQGNRFVAPPDPACKEVTKRDYAVESVWKSWNWRSEGDLMLNGAFFVQSGN--AIKTM  403

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                +++  PG+ V ++T+F+G L C  G+PC
Sbjct  404  NKQAVISAKPGRYVSRLTRFSGALNCVRGRPC  435



>ref|XP_002870357.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46616.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=484

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNR+ AP     KEVT R   D S WKKW W S+GD+ LNGAFFRPSG    A  Y
Sbjct  394  INSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAFFRPSGAGASAS-Y  452

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    +   P   V  IT  AG L C+ G+PC
Sbjct  453  GRASSLAAKPSSMVDTITSTAGALGCRKGRPC  484



>gb|KHN13490.1| Putative pectate lyase 3, partial [Glycine soja]
Length=364

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IIS+GNRF AP     K++T R+  P++ W  W W S  DV++NGAFF  SG +  ++ +
Sbjct  272  IISEGNRFIAPDNQFAKQITKREYAPENVWANWQWRSINDVYMNGAFFVQSGPELASRPF  331

Query  174  GHLDLVNPLPGKAVGKITKFAG-LLRCKIGKPC  79
               D++    G  VG++T+++G LL+C++G+PC
Sbjct  332  SREDMITAKVGNYVGRLTRYSGNLLKCRVGRPC  364



>gb|EYU28712.1| hypothetical protein MIMGU_mgv1a006498mg [Erythranthe guttata]
Length=442

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGD--QKGAQK  178
            IISQGNRF+A   P  K+VT R+  +  WKKW W S+GD F+NGA+FR SG   +     
Sbjct  350  IISQGNRFKASDNPFTKQVTKRESTESEWKKWQWRSEGDKFVNGAYFRESGPKVKHTISP  409

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                +L+   PG   G++T++AG L C  GK C
Sbjct  410  LKEKNLIKFKPGSYAGRLTRYAGALNCVAGKSC  442



>ref|XP_006291220.1| hypothetical protein CARUB_v10017351mg [Capsella rubella]
 gb|EOA24118.1| hypothetical protein CARUB_v10017351mg [Capsella rubella]
Length=411

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP     KEVT H D P+  W+ W W S+GD+ LNGA+FR SG +     Y
Sbjct  321  IYSQGNRFLAPNTRFNKEVTKHEDAPESQWRDWNWRSEGDMLLNGAYFRESGAE-APSTY  379

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   VG IT  AG L C+ G+PC
Sbjct  380  ARASSLSARPSSLVGSITTTAGTLGCRRGRPC  411



>ref|XP_011071024.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=441

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/94 (49%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGD--QKGAQ  181
            IISQGNRFRA      KEVT RD    D W KW W S+GD+F NGAFF  SG   +    
Sbjct  348  IISQGNRFRASNYRYTKEVTKRDYATKDQWMKWQWRSEGDLFKNGAFFTESGQPLEHSKS  407

Query  180  KYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                ++L+   PG  VG +TK+AG L+C+ GK C
Sbjct  408  PLVGMNLIRYRPGSFVGTLTKYAGALKCRKGKLC  441



>ref|XP_006357122.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=448

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     K++T R+  P+  W +WTW S+GD+++NGA+F  +GD   ++K+
Sbjct  356  IISQGNRFIAPPDIFKKQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQAGDPDWSKKH  415

Query  174  GHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             +L D +   P   V  +T+FAG L CK+GK C
Sbjct  416  QNLYDGIAAAPADQVTWMTRFAGALNCKVGKAC  448



>ref|NP_567409.1| probable pectate lyase 15 [Arabidopsis thaliana]
 sp|Q944R1.1|PLY15_ARATH RecName: Full=Probable pectate lyase 15; AltName: Full=Pectate 
lyase A11; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL11586.1|AF424592_1 AT4g13710/F18A5_100 [Arabidopsis thaliana]
 gb|AAM98277.1| At4g13710/F18A5_100 [Arabidopsis thaliana]
 gb|AEE83315.1| probable pectate lyase 15 [Arabidopsis thaliana]
Length=470

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNR+ AP     KEVT R   D S WKKW W S+GD+ LNGAFFRPSG    A  Y
Sbjct  380  INSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAFFRPSGAGASAS-Y  438

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    +   P   V  IT  AG L C+ G+PC
Sbjct  439  GRASSLAAKPSSMVDTITSTAGALGCRKGRPC  470



>gb|KGN47799.1| hypothetical protein Csa_6G404140 [Cucumis sativus]
Length=415

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/94 (44%), Positives = 58/94 (62%), Gaps = 3/94 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP  P  K++T R+   +D WK W+W S+GD  +NGA F  SGDQ   +K 
Sbjct  322  IVSQGNRFIAPPNPNAKQITKREYAMEDEWKHWSWRSEGDELMNGAVFIASGDQTKGKKK  381

Query  174  G--HLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    D+++  PG  V ++ + +G + C  GKPC
Sbjct  382  GLSRYDMISFKPGTYVRRLVRLSGTIECTPGKPC  415



>ref|XP_009381244.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=423

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 8/95 (8%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP     KEVT R+  P++ WK W W S+GD+  NGAFF PS    GA K 
Sbjct  333  ILSQGNRFIAPPTLFAKEVTKREYSPEEVWKSWQWRSEGDLLKNGAFFVPS----GAGKL  388

Query  174  GHL---DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G++   DL+   PG  V ++T+F+G L+C   +PC
Sbjct  389  GNVSYKDLIKAKPGTFVTRLTRFSGALKCVPNRPC  423



>ref|XP_004966014.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=486

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNR+ AP     K+VT   D P+  WK W W S+ D+F+ GA+F  +G Q   Q +
Sbjct  396  IISQGNRYIAPPNLAAKQVTKQHDAPESEWKNWVWHSEDDLFMEGAYFTVTGGQINRQ-F  454

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               DL+ P PG  V ++T+FAG L CK GKPC
Sbjct  455  NKKDLIKPKPGSYVTRLTRFAGSLDCKPGKPC  486



>emb|CDY03964.1| BnaC02g36790D [Brassica napus]
Length=412

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP     KEVT H D P+  W+ W W S+GD+ LNGA+FR SG  + +  Y
Sbjct  322  IFSQGNRFLAPNTRFNKEVTKHEDAPESKWRHWNWRSEGDILLNGAYFRQSG-ARSSSTY  380

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   VG IT  AG L C+ G+ C
Sbjct  381  ARASSLSARPSSLVGSITTTAGTLSCRRGRRC  412



>ref|XP_004152537.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=434

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/89 (46%), Positives = 57/89 (64%), Gaps = 3/89 (3%)
 Frame = -3

Query  342  QGNRFRAPKGPLFKEVTHR-DCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKYGHL  166
            QGNRF AP  P  KEVT R   P+  W+ W W S+GD+ +NGAFF  SG+    ++Y   
Sbjct  348  QGNRFIAPPNPNCKEVTKRVYAPESEWRSWNWRSEGDLMMNGAFFIQSGNP--IKRYSKK  405

Query  165  DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            D+++  PG  V ++T+FAG L+CK  +PC
Sbjct  406  DVIHSKPGTFVTRLTRFAGPLKCKKNQPC  434



>ref|NP_001190720.1| probable pectate lyase 15 [Arabidopsis thaliana]
 gb|AEE83316.1| probable pectate lyase 15 [Arabidopsis thaliana]
Length=451

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNR+ AP     KEVT R   D S WKKW W S+GD+ LNGAFFRPSG    A  Y
Sbjct  361  INSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAFFRPSGAGASAS-Y  419

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    +   P   V  IT  AG L C+ G+PC
Sbjct  420  GRASSLAAKPSSMVDTITSTAGALGCRKGRPC  451



>ref|XP_004146792.1| PREDICTED: probable pectate lyase P59-like, partial [Cucumis 
sativus]
Length=442

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/94 (44%), Positives = 58/94 (62%), Gaps = 3/94 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP  P  K++T R+   +D WK W+W S+GD  +NGA F  SGDQ   +K 
Sbjct  349  IVSQGNRFIAPPNPNAKQITKREYAMEDEWKHWSWRSEGDELMNGAVFIASGDQTKGKKK  408

Query  174  G--HLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    D+++  PG  V ++ + +G + C  GKPC
Sbjct  409  GLSRYDMISFKPGTYVRRLVRLSGTIECTPGKPC  442



>ref|XP_007227702.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
 gb|EMJ28901.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
Length=446

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD   +  WK W W S+GD+ +NGA F  SG  K ++  
Sbjct  356  IISQGNRFIAPPNQGAKEVTKRDHTAEAEWKNWEWRSEGDLMMNGAVFVQSGSGK-SKHP  414

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              +DL+   PG  V K+TKF+G L C +GKPC
Sbjct  415  AKMDLMPFKPGTYVAKLTKFSGALDCFVGKPC  446



>ref|XP_009126031.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
Length=481

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P ++EVT RD   +  WK W W SD D+F+NGA+FR SG+      
Sbjct  389  ILSHGNRFIAPPHKPHYREVTKRDYASEHEWKHWNWRSDKDMFMNGAYFRQSGNPHFKCH  448

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV  +TK+AG L C++GK C
Sbjct  449  HTRKQMIKPKHGIAVSMLTKYAGALDCRVGKRC  481



>emb|CAN77957.1| hypothetical protein VITISV_021245 [Vitis vinifera]
Length=407

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 57/94 (61%), Gaps = 7/94 (7%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQK--GAQ  181
            I+SQGNRF AP     KEVT RD  P+  WK WTW S GD+ +NGAFF  SGD     + 
Sbjct  318  ILSQGNRFIAPPDINCKEVTKRDYSPESVWKSWTWRSQGDLMMNGAFFVESGDPNFDFSN  377

Query  180  KYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            KY    ++   PG  V ++T+F+G L C+ G PC
Sbjct  378  KY----VIRAKPGAFVTRLTRFSGALSCREGMPC  407



>ref|XP_010488478.1| PREDICTED: probable pectate lyase 9 [Camelina sativa]
Length=452

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHR-DCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNR+ APK    KEVT R    ++ WKKW W S+ D+ +NGAFF PSGD   A+K 
Sbjct  361  IISQGNRYAAPKNRFAKEVTKRVGTEENEWKKWNWRSENDLLVNGAFFTPSGDGASAKKA  420

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              L L    P   V  IT  AG L C+ GK C
Sbjct  421  HDLSL-PARPASMVDSITATAGALGCRRGKRC  451



>ref|XP_006437462.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
 gb|ESR50702.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
Length=419

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHR-DCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF A      KEVT R +C  +  K W W S+GDV LNGA+F  SGD K   +Y
Sbjct  328  ILSQGNRFFASNNQNAKEVTKRMNCSPEEGKSWIWRSEGDVLLNGAYFNSSGDPKKQIQY  387

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               +++ P  G  V +ITKFAG L CK G+ C
Sbjct  388  QMDNVIKPESGTEVERITKFAGALVCKPGQEC  419



>emb|CBI15265.3| unnamed protein product [Vitis vinifera]
Length=398

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 57/94 (61%), Gaps = 7/94 (7%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQK--GAQ  181
            I+SQGNRF AP     KEVT RD  P+  WK WTW S GD+ +NGAFF  SGD     + 
Sbjct  309  ILSQGNRFIAPPDINCKEVTKRDYSPESVWKSWTWRSQGDLMMNGAFFVESGDPNFDFSN  368

Query  180  KYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            KY    ++   PG  V ++T+F+G L C+ G PC
Sbjct  369  KY----VIRAKPGAFVTRLTRFSGALSCREGMPC  398



>emb|CAB36835.1| putative pectate lyase A11 (fragment) [Arabidopsis thaliana]
 emb|CAB78413.1| putative pectate lyase A11 (fragment) [Arabidopsis thaliana]
Length=374

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNR+ AP     KEVT R   D S WKKW W S+GD+ LNGAFFRPSG    A  Y
Sbjct  284  INSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAFFRPSGAGASAS-Y  342

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    +   P   V  IT  AG L C+ G+PC
Sbjct  343  GRASSLAAKPSSMVDTITSTAGALGCRKGRPC  374



>ref|XP_004514773.1| PREDICTED: probable pectate lyase 3-like [Cicer arietinum]
Length=454

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 60/99 (61%), Gaps = 8/99 (8%)
 Frame = -3

Query  351  IISQGNRFRAPKGPL-------FKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGD  196
            IIS+GNRF  P   +        KEVT R+  D+S WK W W S  D FLNGA+F  SG 
Sbjct  356  IISEGNRFIGPDNVMVGGNQLNLKEVTKREYTDESVWKNWQWRSINDEFLNGAYFIQSGP  415

Query  195  QKGAQKYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +   + +   D++   PG  VG++T+++G L+C++GKPC
Sbjct  416  ELKNRPFSKKDMITAKPGSYVGRLTRYSGNLQCRVGKPC  454



>emb|CDY63769.1| BnaCnng42620D [Brassica napus]
Length=479

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P ++EVT RD   +  WK W W SD D+F+NGA+FR SG+      
Sbjct  387  ILSHGNRFVAPPHKPHYREVTKRDYASEHEWKHWNWRSDKDMFMNGAYFRQSGNPHFKCH  446

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV  +TK+AG L C++GK C
Sbjct  447  HTRKQMIKPKHGIAVSMLTKYAGALDCRVGKRC  479



>ref|XP_009129418.1| PREDICTED: putative pectate lyase 11 [Brassica rapa]
Length=412

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP     KEVT H D P+  W+ W W S+GD+ LNGA+FR SG  + +  Y
Sbjct  322  IFSQGNRFLAPNTRFNKEVTKHEDAPESKWRHWNWRSEGDILLNGAYFRQSG-ARSSSTY  380

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   VG IT  AG L C+ G+ C
Sbjct  381  ARASSLSARPSSLVGSITTTAGTLSCRRGRRC  412



>ref|XP_010033216.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
Length=435

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPD-DSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD    D W+ WTW S GD+ +NGAFF  SG Q   +KY
Sbjct  345  IISQGNRFIAPPNLAAKEVTKRDYATPDVWRSWTWRSQGDLLINGAFFVQSG-QPLKKKY  403

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G  D++   PG  V ++T+F+G L CK  K C
Sbjct  404  GRKDMIKAKPGTFVRRLTRFSGTLNCKPKKRC  435



>ref|XP_002272638.2| PREDICTED: pectate lyase-like [Vitis vinifera]
Length=434

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 57/94 (61%), Gaps = 7/94 (7%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQK--GAQ  181
            I+SQGNRF AP     KEVT RD  P+  WK WTW S GD+ +NGAFF  SGD     + 
Sbjct  345  ILSQGNRFIAPPDINCKEVTKRDYSPESVWKSWTWRSQGDLMMNGAFFVESGDPNFDFSN  404

Query  180  KYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            KY    ++   PG  V ++T+F+G L C+ G PC
Sbjct  405  KY----VIRAKPGAFVTRLTRFSGALSCREGMPC  434



>gb|KCW52797.1| hypothetical protein EUGRSUZ_J02132 [Eucalyptus grandis]
Length=451

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPD-DSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD    D W+ WTW S GD+ +NGAFF  SG Q   +KY
Sbjct  361  IISQGNRFIAPPNLAAKEVTKRDYATPDVWRSWTWRSQGDLLINGAFFVQSG-QPLKKKY  419

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G  D++   PG  V ++T+F+G L CK  K C
Sbjct  420  GRKDMIKAKPGTFVRRLTRFSGTLNCKPKKRC  451



>emb|CDY34149.1| BnaA02g28910D [Brassica napus]
Length=359

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP     KEVT H D P+  W+ W W S+GD+ LNGA+FR SG  + +  Y
Sbjct  269  IFSQGNRFLAPNTRFNKEVTKHEDAPESKWRHWNWRSEGDIMLNGAYFRQSG-ARASSTY  327

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   VG IT  AG L C+ G+ C
Sbjct  328  ARASSLSARPSSLVGSITTTAGTLSCRRGRRC  359



>gb|AAM60924.1| putative pectate lyase [Arabidopsis thaliana]
Length=475

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPL-FKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP     ++EVT RD   +S WK W W S+ DVF+N A+FR SG+      
Sbjct  383  ILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMNNAYFRQSGNPHFKCS  442

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  443  HSRQQMIKPKNGMAVSKLTKYAGALDCRVGKAC  475



>emb|CDX85564.1| BnaA02g02490D [Brassica napus]
Length=473

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P ++EVT RD   +  WK W W SD D+F+NGA+FR SG+      
Sbjct  381  ILSHGNRFIAPPHKPHYREVTKRDYASEHEWKHWNWRSDKDMFMNGAYFRQSGNPHFKCH  440

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV  +TK+AG L C++GK C
Sbjct  441  HTRKQMIKPKHGIAVSMLTKYAGALDCRVGKRC  473



>ref|XP_008221658.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=443

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF A      KEVT R+   +  WK W W S+GD+F+NGAFF  SG      + 
Sbjct  353  IISQGNRFIAGLNSAAKEVTKREYTAEAEWKNWLWKSEGDLFMNGAFFVESGSPANL-RA  411

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LD++   PG  V K+TKFAG L C +GKPC
Sbjct  412  DKLDMIPFKPGTYVTKLTKFAGALDCFVGKPC  443



>ref|NP_186776.1| putative pectate lyase 7 [Arabidopsis thaliana]
 sp|Q9SRH4.1|PLY7_ARATH RecName: Full=Probable pectate lyase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF03499.1|AC010676_9 putative pectate lyase [Arabidopsis thaliana]
 gb|AAF26147.1|AC008261_4 putative pectate lyase [Arabidopsis thaliana]
 gb|ABI93918.1| At3g01270 [Arabidopsis thaliana]
 gb|AEE73631.1| putative pectate lyase 7 [Arabidopsis thaliana]
Length=475

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPL-FKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP     ++EVT RD   +S WK W W S+ DVF+N A+FR SG+      
Sbjct  383  ILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMNNAYFRQSGNPHFKCS  442

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  443  HSRQQMIKPKNGMAVSKLTKYAGALDCRVGKAC  475



>ref|XP_007224275.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
 gb|EMJ25474.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
Length=443

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF A      KEVT R+   +  WK W W S+GD+F+NGAFF  SG      + 
Sbjct  353  IISQGNRFIAGLNSATKEVTKREYTAEAEWKNWLWKSEGDLFMNGAFFVESGSPANL-RA  411

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LD++   PG  V K+TKFAG L C +GKPC
Sbjct  412  DKLDMIPFKPGTYVTKMTKFAGALDCFVGKPC  443



>ref|XP_010440536.1| PREDICTED: probable pectate lyase 15 isoform X2 [Camelina sativa]
Length=462

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNR+ AP     KEVT R   D S WKKW W S+GD+ LNGA+FR SG++  A  Y
Sbjct  372  INSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAYFRSSGEEASAS-Y  430

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    +   P   V  IT  AG L C+ G+PC
Sbjct  431  GRASSLAAKPSSMVDTITSTAGALGCRKGRPC  462



>ref|XP_010440534.1| PREDICTED: probable pectate lyase 15 isoform X1 [Camelina sativa]
Length=466

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNR+ AP     KEVT R   D S WKKW W S+GD+ LNGA+FR SG++  A  Y
Sbjct  376  INSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAYFRSSGEEASAS-Y  434

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    +   P   V  IT  AG L C+ G+PC
Sbjct  435  GRASSLAAKPSSMVDTITSTAGALGCRKGRPC  466



>ref|XP_010450167.1| PREDICTED: probable pectate lyase 15 isoform X1 [Camelina sativa]
Length=465

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNR+ AP     KEVT R   D S WKKW W S+GD+ LNGA+FR SG++  A  Y
Sbjct  375  INSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAYFRSSGEEASAS-Y  433

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    +   P   V  IT  AG L C+ G+PC
Sbjct  434  GRASSLAAKPSSMVDTITSTAGALGCRKGRPC  465



>ref|XP_009779191.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDC-PDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            II+QGNRF AP     K+VT R+  P++ WK+WTW S+G++F+NGA+F  SGD   ++K+
Sbjct  355  IITQGNRFIAPPDIFKKQVTKREYNPEEVWKQWTWRSEGNLFMNGAYFIESGDPDWSKKH  414

Query  174  GHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              L D ++    + V  IT+FAG L CK GK C
Sbjct  415  KELYDGISAASAEEVTWITRFAGALGCKEGKAC  447



>ref|XP_010450168.1| PREDICTED: probable pectate lyase 15 isoform X2 [Camelina sativa]
Length=461

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNR+ AP     KEVT R   D S WKKW W S+GD+ LNGA+FR SG++  A  Y
Sbjct  371  INSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAYFRSSGEEASAS-Y  429

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    +   P   V  IT  AG L C+ G+PC
Sbjct  430  GRASSLAAKPSSMVDTITSTAGALGCRKGRPC  461



>ref|XP_010435229.1| PREDICTED: probable pectate lyase 15 [Camelina sativa]
Length=461

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNR+ AP     KEVT R   D S WKKW W S+GD+ LNGA+FR SG++  A  Y
Sbjct  371  INSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAYFRSSGEEASAS-Y  429

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    +   P   V  IT  AG L C+ G+PC
Sbjct  430  GRASSLAAKPSSMVDTITSTAGALGCRKGRPC  461



>gb|KFK37588.1| hypothetical protein AALP_AA3G002600 [Arabis alpina]
Length=472

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF A    P + EVT RD   +S WK W W SD DVF+N A+FR SG+ K    
Sbjct  380  ILSHGNRFIASLHKPQYNEVTKRDYASESEWKNWNWRSDRDVFMNRAYFRQSGNPKFKCT  439

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G A   +TK+AG L C++GKPC
Sbjct  440  HTRQQMIKPKHGVAASMLTKYAGALDCRVGKPC  472



>ref|XP_007032453.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY03379.1| Pectate lyase family protein [Theobroma cacao]
Length=454

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQ-K  178
            IISQGNRF AP  P  KE+T+R+  P+  W+ W W S+GD+F+NGAFFR SG       K
Sbjct  362  IISQGNRFIAPNDPWAKEITNRNYAPESVWRHWVWRSEGDLFMNGAFFRTSGPPAPPHLK  421

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            Y  L ++   P   V ++T+F+G L CK    C
Sbjct  422  YNKLQMIKAKPATFVRRLTRFSGALNCKKRVKC  454



>ref|XP_010925369.1| PREDICTED: pectate lyase [Elaeis guineensis]
Length=444

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD   +D WK+WTW S+GD+  NGAFFR SG     + +
Sbjct  354  IISQGNRFIAPPLRFAKEVTKRDYATEDVWKQWTWRSEGDLMQNGAFFRESG-TPNTRTF  412

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D +   PG  V ++T+FAG L CK G+ C
Sbjct  413  HRKDFIRAKPGTWVRRLTRFAGPLGCKAGRAC  444



>gb|AES91206.2| pectate lyase P59-like protein [Medicago truncatula]
Length=434

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP  P  KEVT RD  P+  WK W+W S+ D+ +NGAFF+ SG +  A  +
Sbjct  346  ILSQGNRFIAPPNPNAKEVTKRDYAPESVWKAWSWRSENDLMMNGAFFKQSGTK--AANF  403

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D +   PG     +T+F+G L+C++GKPC
Sbjct  404  PKSD-IKAKPGSFAAALTRFSGCLKCEVGKPC  434



>ref|XP_006299938.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
 gb|EOA32836.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
Length=472

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAP-KGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP   P ++EVT RD   +  WK W W S+ D FLNGA FR SG+      
Sbjct  380  ILSHGNRFIAPPHKPHYREVTKRDYASEGEWKHWNWRSEKDYFLNGAHFRESGNPHFKCS  439

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  440  HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  472



>ref|XP_009587689.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=447

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     K++T R+  P+  W +WTW S+GD+++NGA+F  SGD   ++K+
Sbjct  355  IISQGNRFIAPPDIFKKQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQSGDPDWSKKH  414

Query  174  GHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             +L D ++  P   V  IT+FAG L C +G+ C
Sbjct  415  QNLYDGISAAPADQVTWITRFAGALGCMVGQAC  447



>ref|XP_003609009.1| Pectate lyase [Medicago truncatula]
Length=445

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP  P  KEVT RD  P+  WK W+W S+ D+ +NGAFF+ SG +  A  +
Sbjct  357  ILSQGNRFIAPPNPNAKEVTKRDYAPESVWKAWSWRSENDLMMNGAFFKQSGTK--AANF  414

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D +   PG     +T+F+G L+C++GKPC
Sbjct  415  PKSD-IKAKPGSFAAALTRFSGCLKCEVGKPC  445



>ref|XP_002436463.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
 gb|EER87830.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
Length=465

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRFRA     FKEVT R+  P   +K W W S  D+FLNGAFF  SG +   +++
Sbjct  375  IISQGNRFRAVDDGRFKEVTKREYTPYSEYKDWVWKSQDDLFLNGAFFNQSGGEN-ERRF  433

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              LDL+    G+    +T++AG L C++GK C
Sbjct  434  DRLDLIQAKGGQYAELLTRYAGALNCRVGKKC  465



>gb|AFK39232.1| unknown [Medicago truncatula]
Length=161

 Score = 82.4 bits (202),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (61%), Gaps = 8/99 (8%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLF-------KEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGD  196
            IIS+GNRF  P   +        KE+T R+  ++S WK W W S  D ++NGAFF  SG 
Sbjct  63   IISEGNRFIGPYNKMLGNDLINSKEITKREYTEESEWKTWQWRSINDEYINGAFFVQSGP  122

Query  195  QKGAQKYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +   + +   D++   PG  VG++T+++G LRC++G+PC
Sbjct  123  ELKDRPFSQKDMIKAKPGSFVGRLTRYSGNLRCRVGEPC  161



>ref|XP_002882189.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58448.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=475

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPL-FKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP     ++EVT RD   +S WK W W S+ DVF+N A+FR SG+      
Sbjct  383  ILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMNNAYFRQSGNPHFKCS  442

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  443  HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  475



>dbj|BAH20311.1| AT3G01270 [Arabidopsis thaliana]
Length=365

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPL-FKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQK  178
            I+S GNRF AP     ++EVT RD   +S WK W W S+ DVF+N A+FR SG+      
Sbjct  273  ILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMNNAYFRQSGNPHFKCS  332

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +    ++ P  G AV K+TK+AG L C++GK C
Sbjct  333  HSRQQMIKPKNGMAVSKLTKYAGALDCRVGKAC  365



>ref|XP_006852264.1| hypothetical protein AMTR_s00049p00173370 [Amborella trichopoda]
 gb|ERN13731.1| hypothetical protein AMTR_s00049p00173370 [Amborella trichopoda]
Length=409

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP     KEVT H D P+  WK W W S+GD+ LNGAFF PSG    +  Y
Sbjct  319  INSQGNRFLAPDDRFNKEVTKHEDAPESEWKNWNWRSEGDLMLNGAFFTPSG-AGASSSY  377

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   VG IT  AG L CK G  C
Sbjct  378  NRASSLSARPSSLVGGITVSAGALNCKKGSRC  409



>gb|EPS62426.1| hypothetical protein M569_12361, partial [Genlisea aurea]
Length=410

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 56/93 (60%), Gaps = 6/93 (6%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP     KEVT R+  P+  WK W W S GD F NGAFF  SGD    + +
Sbjct  322  ILSQGNRFHAPDNAAAKEVTKREYSPESVWKNWNWKSQGDSFSNGAFFVESGD----KNF  377

Query  174  GHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             ++ D V    GK VG++T+FAG L C  GK C
Sbjct  378  NYVSDSVGAKSGKEVGELTEFAGPLACFAGKAC  410



>gb|KHN08855.1| Putative pectate lyase P59 [Glycine soja]
Length=435

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 58/92 (63%), Gaps = 4/92 (4%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT RD  P+  WK W W S+GD+ +NGAFF  SG  K   K 
Sbjct  347  IISQGNRFIAPNDRNAKEVTKRDYAPESVWKNWNWRSEGDLLMNGAFFVQSG--KNVAKN  404

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               +++   PGKAV  +T+FAG L+C++ K C
Sbjct  405  PKAEII-AKPGKAVSSLTRFAGPLKCEVNKSC  435



>ref|XP_008365939.1| PREDICTED: probable pectate lyase 20 [Malus domestica]
Length=100

 Score = 80.5 bits (197),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKYG  172
            I SQGNR+ AP     KEVTHR  P+D W  W W S+GD+ LNGA+F  SG   GA  Y 
Sbjct  12   INSQGNRYLAPNNAFAKEVTHRVDPND-WTHWNWRSEGDLMLNGAYFIASGTGSGA-SYA  69

Query  171  HLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                +       VG IT  AG+L C+ G  C
Sbjct  70   RASSLGAKSXSLVGSITASAGVLSCRRGYQC  100



>ref|XP_010514446.1| PREDICTED: putative pectate lyase 11 isoform X1 [Camelina sativa]
 ref|XP_010514447.1| PREDICTED: putative pectate lyase 11 isoform X2 [Camelina sativa]
Length=415

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP     KEVT H D P+  W+ W W S+GD+ LNGA+FR SG +     Y
Sbjct  325  IYSQGNRFLAPNTRFNKEVTKHEDAPESQWRDWNWRSEGDMLLNGAYFRESGAE-APSTY  383

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   VG IT  AG L C+ G+ C
Sbjct  384  ARASSLSARPSSLVGSITTTAGTLSCRRGRRC  415



>ref|XP_009369346.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=441

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 55/92 (60%), Gaps = 3/92 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT R+   ++ WK W W S+ D+ +NGAFF  SG     +  
Sbjct  352  IISQGNRFIAPLNEASKEVTKREYAAENVWKSWNWRSENDLMMNGAFFVESGSP--IRNL  409

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  V K+T+FAG L+C  GKPC
Sbjct  410  PEADMIQAKPGTFVAKLTRFAGPLKCIKGKPC  441



>ref|XP_010425491.1| PREDICTED: putative pectate lyase 11 [Camelina sativa]
Length=415

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP     KEVT H D P+  W+ W W S+GD+ LNGA+FR SG +     Y
Sbjct  325  IYSQGNRFLAPNTRFNKEVTKHEDAPESQWRDWNWRSEGDMLLNGAYFRESGAE-APSTY  383

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   VG IT  AG L C+ G+ C
Sbjct  384  ARASSLSARPSSLVGSITTTAGTLSCRRGRRC  415



>ref|XP_010502717.1| PREDICTED: putative pectate lyase 11 [Camelina sativa]
Length=415

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP     KEVT H D P+  W+ W W S+GD+ LNGA+FR SG +     Y
Sbjct  325  IYSQGNRFLAPNTRFNKEVTKHEDAPESQWRDWNWRSEGDMLLNGAYFRESGAE-APSTY  383

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   VG IT  AG L C+ G+ C
Sbjct  384  ARASSLSARPSSLVGSITTTAGTLSCRRGRRC  415



>ref|XP_008374522.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=441

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 55/92 (60%), Gaps = 3/92 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP     KEVT R+   ++ WK W W S+ D+ +NGAFF  SG     +  
Sbjct  352  IISQGNRFIAPXNEASKEVTKREYAAENVWKSWNWRSENDLMVNGAFFIESGSP--IRNL  409

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  V K+T+FAG L+C  GKPC
Sbjct  410  PEADMIQAKPGTFVAKLTRFAGPLKCIKGKPC  441



>ref|XP_007153840.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
 gb|ESW25834.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
Length=447

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IIS+GNRF  P     KE+T R+  P+  W  W W S  D ++NGAFF  SG +   + +
Sbjct  356  IISEGNRFIGPDNVHAKEITKREYSPESEWSSWQWRSINDEYMNGAFFVQSGPELVDRPF  415

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D++   PG  VG++T++AG L C++G PC
Sbjct  416  SRQDMIKAKPGSYVGRLTRYAGSLSCRVGLPC  447



>ref|NP_001046281.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAD25039.1| putative pectate lyase precursor [Oryza sativa Japonica Group]
 dbj|BAF08195.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAG94880.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 56/91 (62%), Gaps = 1/91 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKYG  172
            I+SQGNR+ AP     K +T    P+  WK W W SDGD+F+NGA+F+ S      +  G
Sbjct  357  ILSQGNRYIAPPNIAAKLITRHYAPEWEWKNWAWRSDGDLFMNGAYFQASNGAINRKVKG  416

Query  171  HLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              D+V P PG  V ++T+FAG L C+ G+PC
Sbjct  417  S-DMVKPKPGSYVRRLTRFAGALSCRPGEPC  446



>gb|EAY85003.1| hypothetical protein OsI_06363 [Oryza sativa Indica Group]
Length=439

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 56/91 (62%), Gaps = 1/91 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKYG  172
            I+SQGNR+ AP     K +T    P+  WK W W SDGD+F+NGA+F+ S      +  G
Sbjct  350  ILSQGNRYIAPPNIAAKLITRHYAPEWEWKNWAWRSDGDLFMNGAYFQASNGAINRKVKG  409

Query  171  HLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              D+V P PG  V ++T+FAG L C+ G+PC
Sbjct  410  S-DMVKPKPGSYVRRLTRFAGALSCRPGEPC  439



>gb|EEE56553.1| hypothetical protein OsJ_05879 [Oryza sativa Japonica Group]
Length=410

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 56/91 (62%), Gaps = 1/91 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKYG  172
            I+SQGNR+ AP     K +T    P+  WK W W SDGD+F+NGA+F+ S      +  G
Sbjct  321  ILSQGNRYIAPPNIAAKLITRHYAPEWEWKNWAWRSDGDLFMNGAYFQASNGAINRKVKG  380

Query  171  HLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
              D+V P PG  V ++T+FAG L C+ G+PC
Sbjct  381  S-DMVKPKPGSYVRRLTRFAGALSCRPGEPC  410



>gb|KHG07401.1| putative pectate lyase P59 [Gossypium arboreum]
Length=442

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/92 (43%), Positives = 55/92 (60%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IIS GNRFRAP+    KEV  R+   +  WK W W S+GD+ LNGA F  SGD + A+K+
Sbjct  351  IISHGNRFRAPRNIAAKEVCKREYATEQEWKNWDWRSEGDLMLNGAIFTQSGDPRAAKKF  410

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G   ++   P   V  + +++G L C+  KPC
Sbjct  411  GGDKMIAYKPAHMVPLLVRWSGTLECRPNKPC  442



>dbj|BAA95715.1| pectate lyase-like protein [Arabidopsis thaliana]
Length=409

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP     KEVT H D P+  W+ W W S+GD+ LNGA+FR SG +     Y
Sbjct  319  IYSQGNRFLAPNTRFNKEVTKHEDAPESKWRDWNWRSEGDMLLNGAYFRESGAE-APSTY  377

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   VG IT  AG L C+ G+ C
Sbjct  378  ARASSLSARPSSLVGSITTTAGTLSCRRGRRC  409



>emb|CDP02198.1| unnamed protein product [Coffea canephora]
Length=476

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 60/97 (62%), Gaps = 6/97 (6%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEV----THRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKG  187
            IISQGNRF AP     KEV    T RD  +++ WK+WTW S+GD+F+NGAFF  SGD   
Sbjct  380  IISQGNRFIAPPDIFKKEVRRTVTKRDYAEEARWKEWTWRSEGDLFMNGAFFVQSGDPDF  439

Query  186  AQKYGHL-DLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
             +K+  + D + P     V  IT+FAG L C+ G PC
Sbjct  440  TKKHPEIFDGIAPADSSEVTWITRFAGALMCRPGSPC  476



>ref|NP_189376.1| putative pectate lyase 11 [Arabidopsis thaliana]
 sp|Q9LTZ0.2|PLY11_ARATH RecName: Full=Putative pectate lyase 11; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE77312.1| putative pectate lyase 11 [Arabidopsis thaliana]
Length=412

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP     KEVT H D P+  W+ W W S+GD+ LNGA+FR SG +     Y
Sbjct  322  IYSQGNRFLAPNTRFNKEVTKHEDAPESKWRDWNWRSEGDMLLNGAYFRESGAE-APSTY  380

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   VG IT  AG L C+ G+ C
Sbjct  381  ARASSLSARPSSLVGSITTTAGTLSCRRGRRC  412



>gb|KHN19379.1| Putative pectate lyase P59 [Glycine soja]
Length=240

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 58/92 (63%), Gaps = 4/92 (4%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF A   P  KEVT +D  P+  WK W   S+GD+ +NGAFF  SG  K   K+
Sbjct  152  IISQGNRFVASPNPNAKEVTKKDYAPESVWKNWNQRSEGDLMVNGAFFVQSG--KSIAKH  209

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               + +   PGKAV  +T+FAG L+C++ KPC
Sbjct  210  PKAE-ITAKPGKAVASLTRFAGPLKCELNKPC  240



>ref|XP_003621115.1| Pectate lyase [Medicago truncatula]
 gb|AES77333.1| pectate lyase P59-like protein [Medicago truncatula]
Length=451

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/92 (43%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP     K +THRD  P+  W KW W S+GD F+NGA F  SG    +  +
Sbjct  360  ILSQGNRFIAPHNNAAKTITHRDYAPEAVWSKWQWRSEGDHFMNGANFIQSGPPIKSLPF  419

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                L+ P  G    ++T+F+G L C +G+PC
Sbjct  420  KKGFLMKPRHGSQANRLTRFSGALNCVVGRPC  451



>ref|XP_009151965.1| PREDICTED: putative pectate lyase 11 isoform X2 [Brassica rapa]
Length=411

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP     KEVT H D P+  W+ W W S+GD+ LNGA+FR SG    +  Y
Sbjct  321  IYSQGNRFLAPNTRFNKEVTKHEDAPESEWRGWNWRSEGDMLLNGAYFRQSG-AGASSTY  379

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   VG IT  AG L C+ G+ C
Sbjct  380  ARASSLSARPSSLVGSITTTAGTLSCRRGRRC  411



>ref|XP_009151964.1| PREDICTED: putative pectate lyase 11 isoform X1 [Brassica rapa]
Length=412

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP     KEVT H D P+  W+ W W S+GD+ LNGA+FR SG    +  Y
Sbjct  322  IYSQGNRFLAPNTRFNKEVTKHEDAPESEWRGWNWRSEGDMLLNGAYFRQSG-AGASSTY  380

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   VG IT  AG L C+ G+ C
Sbjct  381  ARASSLSARPSSLVGSITTTAGTLSCRRGRRC  412



>ref|XP_002875382.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51641.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP     KEVT H D P+  W+ W W S+GD+ LNGA+FR SG       Y
Sbjct  322  IYSQGNRFLAPNTRFNKEVTKHEDAPESQWRDWNWRSEGDMLLNGAYFRESG-AGSPSTY  380

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   VG IT  AG L C+ G+ C
Sbjct  381  ARASSLSARPSSLVGSITTTAGTLSCRRGRRC  412



>emb|CDP00293.1| unnamed protein product [Coffea canephora]
Length=445

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF+A K    KEVT RD  + S W  W W S+GD FLNGAFF  SG       +
Sbjct  354  IISQGNRFKASKNQFTKEVTKRDYAEKSQWMGWQWRSEGDKFLNGAFFVESGPPLKKSPF  413

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               + +   PG   G++T++AG L+C+ GKPC
Sbjct  414  TGKNKLQFKPGSYAGRLTRYAGALKCREGKPC  445



>ref|XP_007139601.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
 gb|ESW11595.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
Length=444

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP     KEVTHRD  + S W+KW W S+ DVF+NGA F  SG   G   +
Sbjct  353  ILSQGNRFIAPNNNAAKEVTHRDYAEPSVWEKWQWRSENDVFMNGANFVQSGPPLGKLPF  412

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                L+ P  G    ++T+FAG L CK   PC
Sbjct  413  NKGFLMKPRHGSQANRLTRFAGALNCKANSPC  444



>ref|XP_007157384.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
 gb|ESW29378.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
Length=448

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCP-DDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IIS+GNRF AP     K++T R+   +  WKKW W S  D  +NGAFF  SG     + +
Sbjct  357  IISEGNRFVAPDSKDAKQITKREYSLEPEWKKWQWRSIKDEVINGAFFIESGPDLTNRPF  416

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               D+++  PG  VG++T+ AG LRC +GKPC
Sbjct  417  TRKDMISSRPGTYVGRLTRHAGSLRCIVGKPC  448



>gb|KEH19822.1| pectate lyase-like protein [Medicago truncatula]
Length=455

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 60/99 (61%), Gaps = 8/99 (8%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLF-------KEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGD  196
            IIS+GNRF  P   +        KE+T R+  ++S WK W W S  D ++NGAFF  SG 
Sbjct  357  IISEGNRFIGPYNKMLGNDLINSKEITKREYTEESEWKTWQWRSINDEYINGAFFVQSGP  416

Query  195  QKGAQKYGHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            +   + +   D++   PG  VG++T+++G LRC++G+PC
Sbjct  417  ELKDRPFSQKDMIKAKPGSFVGRLTRYSGNLRCRVGEPC  455



>gb|AAA86241.1| pectate lyase homolog [Medicago sativa]
Length=450

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 53/92 (58%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I+SQGNRF AP     K VTHRD  P+  W KW W S+GD F+NGA F  SG       +
Sbjct  359  ILSQGNRFIAPHNNAAKTVTHRDYAPESVWSKWQWRSEGDHFMNGATFIQSGPPIKNLPF  418

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                L+ P  G    ++T+F+G L C +G+PC
Sbjct  419  KKGFLMKPRHGSQANRLTRFSGALNCVVGRPC  450



>gb|AFK46866.1| unknown [Lotus japonicus]
Length=160

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP     KEVT H D P+  WK W W S+GD+ LNGAFF  +G    +  Y
Sbjct  70   INSQGNRFVAPNDRFSKEVTKHEDAPESEWKGWNWRSEGDLLLNGAFFTATG-AGASGSY  128

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   VG IT  AG L C+ G  C
Sbjct  129  ARASSLSARPSTLVGTITTGAGALNCRKGSHC  160



>ref|XP_009804999.1| PREDICTED: probable pectate lyase 8 [Nicotiana sylvestris]
Length=439

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDD-SWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNR+ AP  P  K+VTHR  P +  WK+W W SDGD+ LNGA+F PSG   GA  Y
Sbjct  349  INSQGNRYLAPANPFAKQVTHRVEPSEGEWKRWNWRSDGDLMLNGAYFTPSGRGAGAS-Y  407

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 +       VG +T  AG L C+ G+ C
Sbjct  408  ARASSLAAKSSSLVGTLTSSAGALTCRRGRQC  439



>dbj|BAF01663.1| pectate lyase like protein [Arabidopsis thaliana]
Length=274

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP  P  KEVT R+   +S WK W W S+GD+FLNGAFF  SG   GA  Y
Sbjct  184  INSQGNRFLAPVNPFAKEVTKREYTGESKWKHWNWRSEGDLFLNGAFFTRSGAGAGAN-Y  242

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++      VG +T ++G L C+ G+ C
Sbjct  243  ARASSLSAKSSSLVGTMTSYSGALNCRAGRRC  274



>ref|XP_010068708.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
 gb|KCW64557.1| hypothetical protein EUGRSUZ_G02162 [Eucalyptus grandis]
Length=435

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 56/92 (61%), Gaps = 3/92 (3%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            IISQGNRF AP  P  KEVT RD   +D WK W+W S+ D+ LNGAFF  SG     +  
Sbjct  346  IISQGNRFIAPLDPNCKEVTKRDYAAEDVWKSWSWRSEDDLMLNGAFFVQSGSP--IRNV  403

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
               +++   PG  V ++T+FAG L C  GKPC
Sbjct  404  NKNNVIKAKPGSFVTRLTRFAGALNCVKGKPC  435



>ref|XP_009107745.1| PREDICTED: probable pectate lyase 15 [Brassica rapa]
Length=451

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDDS-WKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNR+ AP     KEVT R   D S WKKW W S+GD+ LNGAFFR SG    A  Y
Sbjct  361  INSQGNRYAAPMDRFAKEVTKRVGTDASDWKKWNWRSEGDLLLNGAFFRASGAGTSAS-Y  419

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
            G    +   P   V  IT  AG L C+ G+PC
Sbjct  420  GRASSLAAKPSSMVRTITSTAGALGCRKGRPC  451



>ref|XP_006338637.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P18-like 
[Solanum tuberosum]
Length=403

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVT-HRDCPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNRF AP     KEVT H D P+  W+ W W S+GD+ LNGA+FR +G    +  Y
Sbjct  312  INSQGNRFLAPYEKYRKEVTKHEDAPESQWRSWNWRSEGDLMLNGAYFRQTGAGASSSTY  371

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 ++  P   VG IT  AG + CK G  C
Sbjct  372  ARASSLSARPSSLVGSITTNAGPINCKKGSRC  403



>gb|KHG08946.1| Pectate lyase [Gossypium arboreum]
Length=405

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 55/88 (63%), Gaps = 2/88 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRD-CPDDSWKKWTWVSDGDVFLNGAFFRPSGDQKGAQ-K  178
            IIS+GNR+ AP  P  KE+T+R+  P+  WK W W S+GD+++NGAFFR SG        
Sbjct  313  IISEGNRYIAPDDPNTKEITNRNYAPESEWKNWVWRSEGDLYMNGAFFRTSGPPSPPNLS  372

Query  177  YGHLDLVNPLPGKAVGKITKFAGLLRCK  94
            +   D++   P   V ++T+FAG L CK
Sbjct  373  FSEKDVIKAKPATFVRRLTRFAGTLNCK  400



>ref|XP_009624534.1| PREDICTED: probable pectate lyase 8 [Nicotiana tomentosiformis]
Length=438

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query  351  IISQGNRFRAPKGPLFKEVTHRDCPDD-SWKKWTWVSDGDVFLNGAFFRPSGDQKGAQKY  175
            I SQGNR+ AP  P  K+VTHR  P + +WK W W SDGD+ LNGA+F PSG   GA  Y
Sbjct  348  INSQGNRYLAPANPFAKQVTHRVEPSEGTWKSWNWRSDGDLMLNGAYFTPSGRGAGAS-Y  406

Query  174  GHLDLVNPLPGKAVGKITKFAGLLRCKIGKPC  79
                 +       VG +T  AG L C+ G+ C
Sbjct  407  ARASSLAAKSSSLVGTLTSNAGALTCRRGRQC  438



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506325383488