BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19689_g4_i1 len=653 path=[2309:0-54 1228:55-91 2400:92-652]

Length=653
                                                                      Score     E

ref|XP_008456459.1|  PREDICTED: pectate lyase-like                      188   2e-53   
gb|KGN47799.1|  hypothetical protein Csa_6G404140                       185   2e-52   
ref|XP_004162547.1|  PREDICTED: probable pectate lyase P59-like         186   2e-52   
gb|KHG07401.1|  putative pectate lyase P59                              186   2e-52   
ref|XP_004146792.1|  PREDICTED: probable pectate lyase P59-like         185   3e-52   
ref|XP_006477525.1|  PREDICTED: pectate lyase-like                      184   5e-52   
gb|KDO76053.1|  hypothetical protein CISIN_1g013757mg                   184   5e-52   
ref|XP_006439649.1|  hypothetical protein CICLE_v10020193mg             184   5e-52   
gb|AAB69758.1|  putative pectate lyase Nt59                             175   7e-50   Nicotiana tabacum [American tobacco]
ref|XP_010066949.1|  PREDICTED: pectate lyase                           178   1e-49   
ref|XP_007046218.1|  Pectate lyase family protein, putative             177   2e-49   
ref|XP_008339935.1|  PREDICTED: probable pectate lyase 3                177   3e-49   
ref|XP_008389523.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    176   7e-49   
ref|XP_008221660.1|  PREDICTED: probable pectate lyase 3                176   9e-49   
ref|XP_007227702.1|  hypothetical protein PRUPE_ppa005744mg             176   1e-48   
ref|XP_008357758.1|  PREDICTED: pectate lyase-like                      175   2e-48   
ref|XP_009148818.1|  PREDICTED: probable pectate lyase 3                174   6e-48   
gb|EPS66620.1|  hypothetical protein M569_08154                         174   6e-48   
ref|XP_009599825.1|  PREDICTED: probable pectate lyase P59 isofor...    174   7e-48   
ref|XP_010033216.1|  PREDICTED: pectate lyase-like                      172   2e-47   
emb|CDY45254.1|  BnaA06g09240D                                          173   2e-47   
ref|XP_009599826.1|  PREDICTED: probable pectate lyase P59 isofor...    172   2e-47   
ref|XP_011085777.1|  PREDICTED: probable pectate lyase P59              172   2e-47   
ref|XP_011085780.1|  PREDICTED: probable pectate lyase P59              172   2e-47   
gb|KCW52797.1|  hypothetical protein EUGRSUZ_J02132                     172   2e-47   
emb|CDY39314.1|  BnaC05g10650D                                          172   3e-47   
ref|XP_010242445.1|  PREDICTED: pectate lyase                           172   4e-47   
ref|XP_008339934.1|  PREDICTED: probable pectate lyase 3                172   5e-47   
ref|XP_009342871.1|  PREDICTED: pectate lyase-like                      172   5e-47   
ref|XP_011098576.1|  PREDICTED: probable pectate lyase P56              171   7e-47   
ref|XP_009360393.1|  PREDICTED: probable pectate lyase 3                171   8e-47   
ref|XP_007037229.1|  Pectate lyase family protein                       171   8e-47   
ref|XP_004234779.1|  PREDICTED: probable pectate lyase P59              171   8e-47   
ref|XP_009779191.1|  PREDICTED: probable pectate lyase P59              171   1e-46   
ref|XP_007224275.1|  hypothetical protein PRUPE_ppa019055mg             170   2e-46   
sp|P15722.1|PLY59_SOLLC  RecName: Full=Probable pectate lyase P59...    170   2e-46   Solanum lycopersicum
ref|XP_004165454.1|  PREDICTED: pectate lyase-like                      170   2e-46   
ref|XP_004152537.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    169   2e-46   
ref|XP_007032453.1|  Pectate lyase family protein                       170   2e-46   
gb|KHG08055.1|  putative pectate lyase P59                              169   3e-46   
ref|XP_008221658.1|  PREDICTED: pectate lyase-like                      169   4e-46   
ref|XP_009369346.1|  PREDICTED: pectate lyase-like                      168   8e-46   
ref|XP_010496063.1|  PREDICTED: probable pectate lyase 3                168   9e-46   
ref|XP_010476496.1|  PREDICTED: probable pectate lyase 3                168   1e-45   
ref|XP_002520133.1|  Pectate lyase precursor, putative                  167   1e-45   Ricinus communis
gb|EYU22437.1|  hypothetical protein MIMGU_mgv1a006496mg                167   1e-45   
ref|XP_008374522.1|  PREDICTED: pectate lyase-like                      167   1e-45   
ref|XP_010112093.1|  putative pectate lyase 7                           167   2e-45   
ref|XP_006354795.1|  PREDICTED: pectate lyase-like                      166   4e-45   
ref|XP_010256490.1|  PREDICTED: pectate lyase-like                      166   5e-45   
ref|XP_002323835.1|  hypothetical protein POPTR_0017s11450g             166   7e-45   Populus trichocarpa [western balsam poplar]
emb|CAN79927.1|  hypothetical protein VITISV_042447                     166   8e-45   Vitis vinifera
ref|XP_002892805.1|  hypothetical protein ARALYDRAFT_471616             166   9e-45   
ref|XP_002282500.3|  PREDICTED: pectate lyase                           166   9e-45   Vitis vinifera
ref|XP_009117903.1|  PREDICTED: probable pectate lyase 3                166   1e-44   
emb|CDY53552.1|  BnaA09g57110D                                          166   1e-44   
ref|XP_006374492.1|  hypothetical protein POPTR_0015s07590g             165   1e-44   
ref|XP_010322971.1|  PREDICTED: probable pectate lyase P59              162   1e-44   
ref|XP_009587689.1|  PREDICTED: probable pectate lyase P59              165   1e-44   
gb|AES91206.2|  pectate lyase P59-like protein                          165   1e-44   
ref|XP_003609009.1|  Pectate lyase                                      165   1e-44   
emb|CBI22159.3|  unnamed protein product                                165   1e-44   
emb|CDP14850.1|  unnamed protein product                                165   2e-44   
ref|XP_011098575.1|  PREDICTED: probable pectate lyase P59              164   2e-44   
ref|XP_002311599.2|  pectate lyase family protein                       164   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_010105747.1|  putative pectate lyase P59                         163   3e-44   
ref|XP_010527872.1|  PREDICTED: probable pectate lyase 3 isoform X2     164   3e-44   
ref|XP_002270089.1|  PREDICTED: pectate lyase                           164   4e-44   Vitis vinifera
ref|XP_009598230.1|  PREDICTED: pectate lyase-like                      163   4e-44   
gb|AAQ62997.1|  oil palm polygalacturonase allergen PEST411             164   5e-44   Elaeis guineensis
ref|XP_002511525.1|  Pectate lyase precursor, putative                  163   5e-44   Ricinus communis
ref|XP_009789921.1|  PREDICTED: probable pectate lyase P59              163   5e-44   
ref|XP_011005067.1|  PREDICTED: probable pectate lyase P59              163   6e-44   
ref|XP_010925369.1|  PREDICTED: pectate lyase                           163   6e-44   
gb|EYU34111.1|  hypothetical protein MIMGU_mgv1a006386mg                163   6e-44   
ref|XP_006361835.1|  PREDICTED: probable pectate lyase P59-like         163   6e-44   
ref|XP_009617495.1|  PREDICTED: probable pectate lyase P59              163   7e-44   
ref|XP_009802165.1|  PREDICTED: probable pectate lyase P59              163   9e-44   
ref|XP_008341537.1|  PREDICTED: pectate lyase-like                      163   9e-44   
ref|XP_011013803.1|  PREDICTED: pectate lyase-like                      162   1e-43   
emb|CAN69905.1|  hypothetical protein VITISV_001007                     161   1e-43   Vitis vinifera
ref|XP_004298448.1|  PREDICTED: probable pectate lyase 3-like           162   1e-43   
ref|XP_008446316.1|  PREDICTED: probable pectate lyase P59              162   1e-43   
ref|XP_010096345.1|  putative pectate lyase 7                           161   1e-43   
ref|XP_009788285.1|  PREDICTED: pectate lyase-like                      162   1e-43   
ref|XP_011025954.1|  PREDICTED: probable pectate lyase P59              162   2e-43   
ref|XP_004508770.1|  PREDICTED: probable pectate lyase P59-like         160   5e-43   
ref|XP_006306515.1|  hypothetical protein CARUB_v10012514mg             160   7e-43   
ref|XP_008443432.1|  PREDICTED: probable pectate lyase 19               160   8e-43   
emb|CBI15265.3|  unnamed protein product                                159   8e-43   
ref|XP_002270112.1|  PREDICTED: pectate lyase                           160   9e-43   Vitis vinifera
gb|KFK43687.1|  hypothetical protein AALP_AA1G160000                    160   9e-43   
ref|XP_004490003.1|  PREDICTED: probable pectate lyase 3-like iso...    160   1e-42   
emb|CAN69904.1|  hypothetical protein VITISV_001006                     160   1e-42   Vitis vinifera
ref|XP_009110541.1|  PREDICTED: probable pectate lyase 3                160   1e-42   
ref|XP_002272638.2|  PREDICTED: pectate lyase-like                      160   1e-42   Vitis vinifera
ref|XP_007209148.1|  hypothetical protein PRUPE_ppa005859mg             160   1e-42   
emb|CDX96854.1|  BnaA08g23970D                                          160   1e-42   
gb|EYU36839.1|  hypothetical protein MIMGU_mgv1a006379mg                159   1e-42   
ref|XP_002306040.1|  hypothetical protein POPTR_0004s12300g             159   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_008230729.1|  PREDICTED: pectate lyase                           159   2e-42   
ref|XP_009381244.1|  PREDICTED: pectate lyase-like                      159   2e-42   
ref|XP_004155392.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    159   3e-42   
ref|XP_004135462.1|  PREDICTED: probable pectate lyase P59-like         159   3e-42   
emb|CDY68729.1|  BnaCnng60280D                                          159   3e-42   
ref|XP_006842121.1|  hypothetical protein AMTR_s00078p00106380          158   3e-42   
gb|KGN59593.1|  hypothetical protein Csa_3G827350                       159   3e-42   
ref|XP_007215366.1|  hypothetical protein PRUPE_ppa005602mg             159   3e-42   
ref|XP_008239834.1|  PREDICTED: pectate lyase-like                      158   3e-42   
gb|AAQ62996.1|  oil palm polygalacturonase allergen PEST361             159   4e-42   Elaeis guineensis
ref|XP_009389712.1|  PREDICTED: pectate lyase-like                      158   5e-42   
gb|AAB69759.1|  putative pectate lyase                                  158   6e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004489168.1|  PREDICTED: pectate lyase-like                      158   6e-42   
ref|NP_172894.1|  putative pectate lyase 3                              158   6e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010915114.1|  PREDICTED: LOW QUALITY PROTEIN: pectate lyas...    157   8e-42   
ref|XP_009403112.1|  PREDICTED: pectate lyase-like                      157   9e-42   
ref|XP_006338480.1|  PREDICTED: probable pectate lyase P59-like         157   1e-41   
ref|XP_004232242.1|  PREDICTED: probable pectate lyase P59              157   1e-41   
ref|XP_011009454.1|  PREDICTED: pectate lyase-like                      157   2e-41   
emb|CDX81636.1|  BnaC08g39650D                                          157   2e-41   
ref|XP_009615547.1|  PREDICTED: probable pectate lyase P59              156   2e-41   
ref|XP_010502279.1|  PREDICTED: probable pectate lyase 6                156   2e-41   
emb|CDP00293.1|  unnamed protein product                                156   2e-41   
ref|XP_004147462.1|  PREDICTED: probable pectate lyase 7-like           156   2e-41   
ref|XP_003563707.1|  PREDICTED: pectate lyase-like                      156   3e-41   
ref|XP_003552513.1|  PREDICTED: pectate lyase-like                      155   4e-41   
ref|XP_007153840.1|  hypothetical protein PHAVU_003G069100g             155   4e-41   
gb|KHN13652.1|  Pectate lyase                                           155   4e-41   
ref|XP_006357122.1|  PREDICTED: probable pectate lyase P59-like         155   5e-41   
ref|XP_008793504.1|  PREDICTED: pectate lyase-like                      155   7e-41   
ref|XP_009129128.1|  PREDICTED: probable pectate lyase 6                155   8e-41   
emb|CDY09356.1|  BnaA02g26540D                                          155   8e-41   
ref|XP_007137422.1|  hypothetical protein PHAVU_009G125800g             154   1e-40   
gb|KHN08855.1|  Putative pectate lyase P59                              154   1e-40   
ref|XP_010514040.1|  PREDICTED: probable pectate lyase 6                154   2e-40   
ref|XP_003530685.1|  PREDICTED: probable pectate lyase 3-like           154   2e-40   
gb|KEH24975.1|  pectate lyase P59-like protein                          154   2e-40   
ref|XP_002517472.1|  pectate lyase, putative                            154   2e-40   Ricinus communis
ref|XP_010678579.1|  PREDICTED: pectate lyase-like                      154   2e-40   
ref|XP_010068708.1|  PREDICTED: pectate lyase-like                      153   2e-40   
ref|XP_010683249.1|  PREDICTED: pectate lyase-like                      153   3e-40   
ref|XP_007151201.1|  hypothetical protein PHAVU_004G026400g             152   6e-40   
ref|XP_010320663.1|  PREDICTED: probable pectate lyase 3                151   8e-40   
ref|XP_011087217.1|  PREDICTED: pectate lyase-like                      152   1e-39   
ref|XP_004302354.1|  PREDICTED: probable pectate lyase P59-like         152   1e-39   
ref|XP_008365507.1|  PREDICTED: pectate lyase-like                      150   1e-39   
ref|NP_178375.1|  putative pectate lyase 6                              152   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KHN45481.1|  Putative pectate lyase 3                                150   1e-39   
ref|XP_006480843.1|  PREDICTED: probable pectate lyase 19-like          151   1e-39   
ref|XP_006428983.1|  hypothetical protein CICLE_v10013750mg             151   2e-39   
ref|XP_003613595.1|  Pectate lyase                                      151   2e-39   
emb|CDY41679.1|  BnaC02g34750D                                          151   2e-39   
ref|XP_009758350.1|  PREDICTED: pectate lyase-like                      151   2e-39   
ref|XP_003554335.1|  PREDICTED: pectate lyase-like                      151   2e-39   
gb|KHG16093.1|  hypothetical protein F383_07683                         151   2e-39   
ref|XP_009761969.1|  PREDICTED: probable pectate lyase P59              150   2e-39   
ref|XP_006357289.1|  PREDICTED: probable pectate lyase 3-like           151   2e-39   
gb|KDP45476.1|  hypothetical protein JCGZ_09725                         150   3e-39   
ref|XP_004514773.1|  PREDICTED: probable pectate lyase 3-like           150   4e-39   
ref|XP_009599232.1|  PREDICTED: pectate lyase-like                      150   4e-39   
ref|XP_009408830.1|  PREDICTED: pectate lyase-like                      150   5e-39   
ref|XP_006292606.1|  hypothetical protein CARUB_v10018855mg             150   5e-39   
ref|XP_010670318.1|  PREDICTED: pectate lyase-like                      150   7e-39   
ref|XP_010425041.1|  PREDICTED: probable pectate lyase 6                149   8e-39   
ref|XP_006363934.1|  PREDICTED: pectate lyase-like                      149   1e-38   
ref|XP_004228388.1|  PREDICTED: pectate lyase                           149   1e-38   
ref|XP_007138209.1|  hypothetical protein PHAVU_009G189800g             148   2e-38   
ref|XP_006484673.1|  PREDICTED: probable pectate lyase 19-like          148   3e-38   
gb|KHN08706.1|  Putative pectate lyase 3                                147   4e-38   
ref|XP_004234780.1|  PREDICTED: probable pectate lyase P56              147   4e-38   
ref|XP_006344502.1|  PREDICTED: probable pectate lyase P59-like         147   4e-38   
emb|CDP02198.1|  unnamed protein product                                148   4e-38   
ref|XP_003519771.2|  PREDICTED: probable pectate lyase 3-like           147   4e-38   
gb|EYU28712.1|  hypothetical protein MIMGU_mgv1a006498mg                147   4e-38   
gb|KDO49230.1|  hypothetical protein CISIN_1g036607mg                   147   5e-38   
ref|XP_010523445.1|  PREDICTED: probable pectate lyase 3                147   5e-38   
ref|XP_002437204.1|  hypothetical protein SORBIDRAFT_10g022830          147   6e-38   Sorghum bicolor [broomcorn]
gb|KHG05193.1|  hypothetical protein F383_30875                         146   6e-38   
gb|KFK33456.1|  hypothetical protein AALP_AA5G015800                    147   6e-38   
ref|XP_004966014.1|  PREDICTED: pectate lyase-like                      147   6e-38   
ref|XP_010528323.1|  PREDICTED: probable pectate lyase 19               147   7e-38   
ref|XP_011086389.1|  PREDICTED: pectate lyase-like                      146   9e-38   
ref|XP_004490004.1|  PREDICTED: probable pectate lyase 3-like iso...    145   9e-38   
ref|XP_008366366.1|  PREDICTED: pectate lyase-like                      147   1e-37   
dbj|BAK06965.1|  predicted protein                                      146   1e-37   
ref|XP_002875142.1|  pectate lyase family protein                       146   1e-37   
ref|NP_001150723.1|  pectate lyase precursor                            146   1e-37   Zea mays [maize]
gb|AFW87059.1|  pectate lyase                                           146   1e-37   
ref|XP_004236194.1|  PREDICTED: probable pectate lyase P59              146   1e-37   
ref|XP_003543726.1|  PREDICTED: pectate lyase                           145   2e-37   
ref|XP_007157384.1|  hypothetical protein PHAVU_002G065800g             145   2e-37   
gb|KHG23093.1|  hypothetical protein F383_29772                         144   2e-37   
ref|XP_006361836.1|  PREDICTED: probable pectate lyase P56-like         145   2e-37   
ref|XP_006482544.1|  PREDICTED: probable pectate lyase 19-like          145   4e-37   
ref|XP_006431087.1|  hypothetical protein CICLE_v10011762mg             145   4e-37   
ref|XP_008446067.1|  PREDICTED: pectate lyase-like                      144   4e-37   
ref|XP_009114192.1|  PREDICTED: probable pectate lyase 6                145   5e-37   
emb|CDY17432.1|  BnaC09g21050D                                          145   5e-37   
ref|XP_007139601.1|  hypothetical protein PHAVU_008G043600g             144   5e-37   
emb|CDY04133.1|  BnaA09g19110D                                          145   5e-37   
gb|ACU23277.1|  unknown                                                 144   6e-37   Glycine max [soybeans]
ref|XP_006656188.1|  PREDICTED: pectate lyase-like                      144   8e-37   
ref|XP_009797403.1|  PREDICTED: pectate lyase-like                      144   1e-36   
ref|XP_008786760.1|  PREDICTED: pectate lyase-like                      144   1e-36   
ref|NP_186776.1|  putative pectate lyase 7                              143   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002453531.1|  hypothetical protein SORBIDRAFT_04g007450          143   2e-36   Sorghum bicolor [broomcorn]
emb|CDX70590.1|  BnaC03g06740D                                          143   2e-36   
ref|XP_010527871.1|  PREDICTED: probable pectate lyase 3 isoform X1     145   2e-36   
ref|NP_001057945.1|  Os06g0583900                                       143   2e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EPS73633.1|  hypothetical protein M569_01123                         142   3e-36   
ref|XP_006573090.1|  PREDICTED: probable pectate lyase 3-like           142   4e-36   
ref|XP_004489374.1|  PREDICTED: pectate lyase-like                      142   4e-36   
gb|KHN01171.1|  Putative pectate lyase 3                                142   5e-36   
ref|XP_006437462.1|  hypothetical protein CICLE_v10031653mg             141   6e-36   
gb|AAM60924.1|  putative pectate lyase                                  142   7e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299938.1|  hypothetical protein CARUB_v10016149mg             142   7e-36   
ref|XP_009757256.1|  PREDICTED: pectate lyase                           140   9e-36   
gb|AFW76465.1|  hypothetical protein ZEAMMB73_776134                    141   1e-35   
dbj|BAK05605.1|  predicted protein                                      140   1e-35   
ref|XP_002437815.1|  hypothetical protein SORBIDRAFT_10g003090          140   2e-35   Sorghum bicolor [broomcorn]
ref|XP_010513594.1|  PREDICTED: probable pectate lyase 7                140   2e-35   
ref|XP_009627245.1|  PREDICTED: pectate lyase-like                      140   2e-35   
gb|KHN13490.1|  Putative pectate lyase 3                                138   3e-35   
gb|KEH19822.1|  pectate lyase-like protein                              140   3e-35   
ref|XP_009101245.1|  PREDICTED: probable pectate lyase 6                139   4e-35   
ref|XP_002871648.1|  pectate lyase family protein                       139   5e-35   
ref|XP_006826355.1|  hypothetical protein AMTR_s00004p00123190          139   5e-35   
emb|CDY45202.1|  BnaA06g34060D                                          139   5e-35   
ref|XP_010485518.1|  PREDICTED: probable pectate lyase 7                139   6e-35   
gb|KHN13240.1|  Putative pectate lyase 3                                139   7e-35   
ref|XP_011071024.1|  PREDICTED: pectate lyase-like                      138   8e-35   
ref|XP_010420164.1|  PREDICTED: probable pectate lyase 19 isoform X2    139   9e-35   
ref|NP_001150425.1|  LOC100284055 precursor                             138   1e-34   Zea mays [maize]
ref|XP_004301165.1|  PREDICTED: probable pectate lyase P59-like         138   1e-34   
ref|XP_008679844.1|  PREDICTED: pectate lyase                           138   1e-34   
ref|XP_010317101.1|  PREDICTED: probable pectate lyase P59              137   1e-34   
ref|XP_003613596.1|  Pectate lyase                                      138   1e-34   
ref|XP_010463548.1|  PREDICTED: probable pectate lyase 7                138   2e-34   
gb|ACN96380.1|  hypothetical protein                                    134   2e-34   Tripsacum sp. JRI-2009
ref|XP_004951474.1|  PREDICTED: pectate lyase-like                      137   2e-34   
sp|P40973.1|PLY_LILLO  RecName: Full=Pectate lyase; Flags: Precursor    137   2e-34   Lilium longiflorum [Easter lily]
emb|CDY03043.1|  BnaC07g21840D                                          137   3e-34   
ref|XP_009131435.1|  PREDICTED: probable pectate lyase 19               137   3e-34   
emb|CDY28691.1|  BnaCnng05770D                                          137   3e-34   
sp|Q9LFP5.1|PLY19_ARATH  RecName: Full=Probable pectate lyase 19;...    137   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006579282.1|  PREDICTED: probable pectate lyase P59-like         136   4e-34   
ref|XP_002882189.1|  pectate lyase family protein                       137   4e-34   
ref|NP_197015.4|  putative pectate lyase 19                             137   4e-34   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28696.1|  unknown                                                 137   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001046281.1|  Os02g0214400                                       136   5e-34   Oryza sativa Japonica Group [Japonica rice]
gb|EPS62426.1|  hypothetical protein M569_12361                         135   6e-34   
gb|ACF87417.1|  unknown                                                 136   6e-34   Zea mays [maize]
emb|CDX85564.1|  BnaA02g02490D                                          136   8e-34   
ref|XP_009125036.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    135   1e-33   
gb|KDO72488.1|  hypothetical protein CISIN_1g039754mg                   129   1e-33   
gb|AAA86241.1|  pectate lyase homolog                                   135   1e-33   Medicago sativa [alfalfa]
gb|EAY99621.1|  hypothetical protein OsI_21600                          135   1e-33   Oryza sativa Indica Group [Indian rice]
ref|NP_001056784.1|  Os06g0144900                                       135   1e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EAY85003.1|  hypothetical protein OsI_06363                          135   1e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_010453638.1|  PREDICTED: probable pectate lyase 19               135   1e-33   
ref|XP_006482669.1|  PREDICTED: probable pectate lyase 9-like           131   2e-33   
ref|XP_009380431.1|  PREDICTED: pectate lyase-like                      134   3e-33   
gb|ACN96342.1|  hypothetical protein                                    131   3e-33   Zea luxurians [Florida teosinte]
gb|AGT16687.1|  pectate lyase                                           134   4e-33   
emb|CDX74293.1|  BnaA03g27540D                                          134   4e-33   
gb|ACN96341.1|  hypothetical protein                                    130   4e-33   Zea luxurians [Florida teosinte]
ref|XP_009134622.1|  PREDICTED: probable pectate lyase 7                134   4e-33   
gb|ACN96356.1|  hypothetical protein                                    130   4e-33   Zea mays subsp. mexicana [annual teosinte]
gb|ACN96346.1|  hypothetical protein                                    130   4e-33   Zea luxurians [Florida teosinte]
emb|CDX91953.1|  BnaC03g32550D                                          134   5e-33   
ref|XP_003621115.1|  Pectate lyase                                      134   5e-33   
gb|ACN96360.1|  hypothetical protein                                    130   6e-33   Zea mays subsp. mexicana [annual teosinte]
gb|ACN96354.1|  hypothetical protein                                    130   6e-33   Zea mays subsp. mexicana [annual teosinte]
gb|EAY99626.1|  hypothetical protein OsI_21605                          133   6e-33   Oryza sativa Indica Group [Indian rice]
gb|ACN96358.1|  hypothetical protein                                    130   6e-33   Zea mays subsp. mexicana [annual teosinte]
gb|ACN96372.1|  hypothetical protein                                    130   6e-33   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACN96359.1|  hypothetical protein                                    130   6e-33   Zea mays subsp. mexicana [annual teosinte]
gb|ACN96355.1|  hypothetical protein                                    130   7e-33   Zea mays subsp. mexicana [annual teosinte]
gb|ACN96379.1|  hypothetical protein                                    130   7e-33   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACN96364.1|  hypothetical protein                                    130   7e-33   
gb|ACN96362.1|  hypothetical protein                                    130   7e-33   
ref|NP_001056781.1|  Os06g0144200                                       133   7e-33   
dbj|BAD68402.1|  putative pectate lyase homolog                         133   8e-33   
gb|ACN96353.1|  hypothetical protein                                    130   8e-33   
gb|ACN96320.1|  hypothetical protein                                    130   9e-33   
gb|ACN96322.1|  hypothetical protein                                    130   9e-33   
gb|ACN96319.1|  hypothetical protein                                    130   1e-32   
gb|KFK37588.1|  hypothetical protein AALP_AA3G002600                    133   1e-32   
gb|EAY99627.1|  hypothetical protein OsI_21606                          132   1e-32   
ref|XP_011087066.1|  PREDICTED: pectate lyase                           132   2e-32   
ref|XP_002436463.1|  hypothetical protein SORBIDRAFT_10g003080          132   2e-32   
emb|CDY63769.1|  BnaCnng42620D                                          132   3e-32   
gb|EMS45831.1|  Pectate lyase                                           132   3e-32   
ref|XP_006495480.1|  PREDICTED: probable pectate lyase 19-like          126   3e-32   
ref|XP_010492335.1|  PREDICTED: probable pectate lyase 19               131   4e-32   
ref|XP_009126031.1|  PREDICTED: probable pectate lyase 19               131   5e-32   
ref|XP_004964534.1|  PREDICTED: pectate lyase-like                      130   5e-32   
gb|KDO55843.1|  hypothetical protein CISIN_1g010437mg                   129   8e-32   
ref|XP_006420566.1|  hypothetical protein CICLE_v10004783mg             130   9e-32   
ref|XP_006357121.1|  PREDICTED: pectate lyase-like                      129   9e-32   
ref|XP_004143054.1|  PREDICTED: probable pectate lyase 5-like           129   9e-32   
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           130   1e-31   
ref|XP_006420567.1|  hypothetical protein CICLE_v10004783mg             130   1e-31   
gb|AAY85180.1|  pectate lyase                                           129   1e-31   
ref|XP_010420163.1|  PREDICTED: probable pectate lyase 19 isoform X1    130   1e-31   
gb|AAM12784.1|  putative pectate-lyase                                  127   2e-31   
gb|KHG22990.1|  hypothetical protein F383_28754                         129   2e-31   
ref|XP_004233352.1|  PREDICTED: pectate lyase-like                      129   2e-31   
gb|AAA16476.1|  pectate lyase homolog                                   129   2e-31   
ref|XP_010683248.1|  PREDICTED: pectate lyase-like                      129   2e-31   
ref|XP_010672089.1|  PREDICTED: probable pectate lyase 1                128   3e-31   
gb|KDO49831.1|  hypothetical protein CISIN_1g044170mg                   127   4e-31   
emb|CDP02199.1|  unnamed protein product                                127   4e-31   
ref|XP_002518146.1|  Pectate lyase precursor, putative                  127   4e-31   
gb|KHG06252.1|  hypothetical protein F383_10745                         128   4e-31   
ref|XP_001784519.1|  predicted protein                                  127   4e-31   
emb|CAN78491.1|  hypothetical protein VITISV_004934                     127   5e-31   
gb|AEN70981.1|  pectate lyase                                           127   5e-31   
gb|KHG30349.1|  hypothetical protein F383_15991                         128   5e-31   
ref|XP_009628975.1|  PREDICTED: probable pectate lyase 18               127   5e-31   
emb|CBI33346.3|  unnamed protein product                                127   6e-31   
ref|XP_002870357.1|  pectate lyase family protein                       128   6e-31   
gb|KHG19997.1|  hypothetical protein F383_02891                         127   7e-31   
ref|XP_002285639.2|  PREDICTED: probable pectate lyase 8                127   8e-31   
gb|AEN70977.1|  pectate lyase                                           127   8e-31   
ref|XP_006351443.1|  PREDICTED: probable pectate lyase 18-like          127   8e-31   
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             127   8e-31   
gb|ADB90479.1|  pectate lyase                                           127   8e-31   
gb|AEN70964.1|  pectate lyase                                           127   8e-31   
gb|AEN70963.1|  pectate lyase                                           127   8e-31   
gb|ADB90476.1|  pectate lyase                                           127   8e-31   
gb|ADB90475.1|  pectate lyase                                           127   8e-31   
gb|AEN70985.1|  pectate lyase                                           127   8e-31   
gb|ADB90478.1|  pectate lyase                                           127   8e-31   
gb|AEN70968.1|  pectate lyase                                           127   8e-31   
ref|XP_006286712.1|  hypothetical protein CARUB_v10002862mg             127   9e-31   
gb|ADB90477.1|  pectate lyase                                           127   9e-31   
emb|CDY01151.1|  BnaA04g06680D                                          127   1e-30   
ref|XP_009762540.1|  PREDICTED: probable pectate lyase 18               127   1e-30   
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               127   1e-30   
ref|XP_008360481.1|  PREDICTED: probable pectate lyase 8                127   1e-30   
ref|XP_008391438.1|  PREDICTED: probable pectate lyase 8                127   1e-30   
ref|XP_004304764.1|  PREDICTED: probable pectate lyase 15-like          127   1e-30   
gb|AEN70965.1|  pectate lyase                                           126   1e-30   
ref|XP_004236303.1|  PREDICTED: probable pectate lyase 18               126   1e-30   
emb|CDY53564.1|  BnaC04g55760D                                          127   1e-30   
ref|XP_001757625.1|  predicted protein                                  125   1e-30   
ref|XP_009624534.1|  PREDICTED: probable pectate lyase 8                126   1e-30   
dbj|BAF43573.1|  pectate lyase                                          126   2e-30   
ref|XP_008367255.1|  PREDICTED: probable pectate lyase 1                126   2e-30   
ref|XP_011042354.1|  PREDICTED: probable pectate lyase 5                126   2e-30   
emb|CAN76500.1|  hypothetical protein VITISV_004734                     126   2e-30   
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             126   2e-30   
ref|XP_007037817.1|  Pectate lyase family protein isoform 3             124   2e-30   
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                126   2e-30   
ref|XP_011005597.1|  PREDICTED: probable pectate lyase 18               126   2e-30   
gb|KDO69410.1|  hypothetical protein CISIN_1g015569mg                   124   2e-30   
ref|XP_010550068.1|  PREDICTED: probable pectate lyase 19               126   2e-30   
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         126   2e-30   
gb|AEN70984.1|  pectate lyase                                           125   2e-30   
ref|XP_011040439.1|  PREDICTED: probable pectate lyase 18               125   2e-30   
ref|XP_002318694.1|  pectate lyase 22 precursor family protein          125   3e-30   
ref|XP_010481247.1|  PREDICTED: uncharacterized protein LOC104760096    125   3e-30   
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          125   3e-30   
ref|XP_009804999.1|  PREDICTED: probable pectate lyase 8                125   3e-30   
gb|AAK66161.1|  pectate lyase                                           125   3e-30   
ref|XP_010420165.1|  PREDICTED: probable pectate lyase 19 isoform X3    126   3e-30   
ref|XP_002515037.1|  Pectate lyase precursor, putative                  125   3e-30   
ref|XP_009362042.1|  PREDICTED: probable pectate lyase 8                125   3e-30   
ref|XP_006350301.1|  PREDICTED: probable pectate lyase 20-like          125   3e-30   
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                125   3e-30   
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18               125   3e-30   
emb|CDX86615.1|  BnaC08g00880D                                          125   4e-30   
gb|KDO69409.1|  hypothetical protein CISIN_1g015569mg                   124   4e-30   
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like          125   4e-30   
ref|XP_002322215.1|  pectate lyase 22 precursor family protein          125   4e-30   
ref|XP_009775177.1|  PREDICTED: probable pectate lyase 8                125   4e-30   
ref|XP_008444399.1|  PREDICTED: probable pectate lyase 5                125   4e-30   
ref|XP_002314576.1|  pectate lyase 5 precursor family protein           125   4e-30   
ref|XP_009111089.1|  PREDICTED: probable pectate lyase 1                125   4e-30   
ref|XP_009121613.1|  PREDICTED: probable pectate lyase 19               125   4e-30   
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                125   4e-30   
gb|KDP26717.1|  hypothetical protein JCGZ_17875                         125   4e-30   
gb|EPS58564.1|  hypothetical protein M569_16249                         124   4e-30   
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                      125   5e-30   
emb|CDY66593.1|  BnaCnng51570D                                          125   5e-30   
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    125   5e-30   
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    125   5e-30   
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    125   5e-30   
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    125   5e-30   
ref|NP_567409.1|  probable pectate lyase 15                             125   5e-30   
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               125   5e-30   
ref|XP_006307575.1|  hypothetical protein CARUB_v10009197mg             125   5e-30   
gb|KEH35002.1|  pectate lyase family protein                            123   6e-30   
ref|XP_008796023.1|  PREDICTED: probable pectate lyase 5                124   6e-30   
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               125   6e-30   
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                125   6e-30   
ref|XP_011097774.1|  PREDICTED: pectate lyase-like                      125   6e-30   
gb|KFK42808.1|  hypothetical protein AALP_AA1G041400                    124   6e-30   
gb|KFK39718.1|  hypothetical protein AALP_AA3G279700                    124   6e-30   
gb|KFK39719.1|  hypothetical protein AALP_AA3G279700                    124   6e-30   
gb|EYU46355.1|  hypothetical protein MIMGU_mgv1a007094mg                124   6e-30   
ref|XP_010484103.1|  PREDICTED: probable pectate lyase 1                124   7e-30   
ref|NP_001190720.1|  probable pectate lyase 15                          125   7e-30   
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                124   7e-30   
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  124   7e-30   
ref|XP_004497128.1|  PREDICTED: probable pectate lyase 13-like is...    125   7e-30   
ref|XP_002892236.1|  pectate lyase family protein                       124   7e-30   
ref|XP_004497129.1|  PREDICTED: probable pectate lyase 13-like is...    125   8e-30   
ref|XP_009587688.1|  PREDICTED: pectate lyase-like                      124   8e-30   
ref|XP_006347419.1|  PREDICTED: probable pectate lyase 18-like          124   8e-30   
gb|KDO69408.1|  hypothetical protein CISIN_1g015569mg                   124   8e-30   
ref|XP_004250039.1|  PREDICTED: probable pectate lyase 13 isoform X1    125   8e-30   
ref|NP_001289258.1|  probable pectate lyase 18 precursor                124   8e-30   
ref|XP_010522431.1|  PREDICTED: probable pectate lyase 1                124   8e-30   
ref|XP_004247105.1|  PREDICTED: probable pectate lyase 8                124   9e-30   
gb|KDO69407.1|  hypothetical protein CISIN_1g015569mg                   124   9e-30   
ref|XP_006439991.1|  hypothetical protein CICLE_v10020423mg             124   9e-30   
ref|XP_009761365.1|  PREDICTED: probable pectate lyase 13 isoform X1    124   9e-30   
ref|XP_010475133.1|  PREDICTED: probable pectate lyase 1                124   1e-29   
ref|XP_010102919.1|  hypothetical protein L484_018936                   124   1e-29   
ref|XP_003523121.1|  PREDICTED: probable pectate lyase 18-like          124   1e-29   
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           124   1e-29   
emb|CBI17713.3|  unnamed protein product                                123   1e-29   
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    124   1e-29   
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          124   1e-29   
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     124   1e-29   
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5                124   1e-29   
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          124   1e-29   
gb|KDP29183.1|  hypothetical protein JCGZ_16572                         124   1e-29   
gb|AAF19195.1|AF206319_1  pectate lyase 1                               124   1e-29   
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     123   1e-29   
emb|CDP21395.1|  unnamed protein product                                124   1e-29   
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22               124   1e-29   
ref|XP_002522747.1|  Pectate lyase precursor, putative                  124   1e-29   
ref|XP_010556943.1|  PREDICTED: probable pectate lyase 1                124   1e-29   
ref|XP_004143279.1|  PREDICTED: probable pectate lyase 12-like          124   1e-29   
ref|XP_006476937.1|  PREDICTED: probable pectate lyase 18-like          124   1e-29   
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     124   1e-29   
ref|XP_010033351.1|  PREDICTED: pectate lyase-like                      124   1e-29   
gb|AAN60248.1|  unknown                                                 119   1e-29   
emb|CDY12666.1|  BnaA02g13340D                                          123   1e-29   
ref|XP_004242391.1|  PREDICTED: probable pectate lyase 8                124   1e-29   
ref|XP_010106682.1|  hypothetical protein L484_004616                   123   2e-29   
ref|NP_001280839.1|  probable pectate lyase 18 precursor                123   2e-29   
ref|XP_002297822.1|  pectate lyase family protein                       124   2e-29   
emb|CDY32557.1|  BnaC02g17500D                                          123   2e-29   
ref|XP_008339288.1|  PREDICTED: probable pectate lyase 8                124   2e-29   
gb|KDP30994.1|  hypothetical protein JCGZ_11370                         123   2e-29   
ref|XP_007155507.1|  hypothetical protein PHAVU_003G207400g             123   2e-29   
gb|EYU39648.1|  hypothetical protein MIMGU_mgv1a005520mg                124   2e-29   
ref|XP_009127577.1|  PREDICTED: probable pectate lyase 5                123   2e-29   
ref|XP_009406385.1|  PREDICTED: probable pectate lyase 18               123   2e-29   
emb|CDY18738.1|  BnaC08g08780D                                          124   2e-29   
ref|XP_007137977.1|  hypothetical protein PHAVU_009G170500g             123   2e-29   
ref|NP_001268051.1|  pectate lyase precursor                            123   2e-29   
ref|XP_010457526.1|  PREDICTED: probable pectate lyase 1                123   2e-29   
gb|ACJ83349.1|  unknown                                                 119   2e-29   
ref|XP_009112069.1|  PREDICTED: probable pectate lyase 22               123   2e-29   
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like          123   2e-29   
ref|XP_009761366.1|  PREDICTED: probable pectate lyase 13 isoform X2    123   2e-29   
gb|KEH41255.1|  pectate lyase family protein                            123   2e-29   
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              123   2e-29   
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    123   2e-29   
dbj|BAH20311.1|  AT3G01270                                              122   2e-29   
emb|CDY16732.1|  BnaA09g06500D                                          123   2e-29   
ref|XP_010312593.1|  PREDICTED: probable pectate lyase 13 isoform X4    123   2e-29   
ref|XP_003638513.1|  Pectate lyase                                      123   2e-29   
ref|XP_004173744.1|  PREDICTED: probable pectate lyase 12-like          123   2e-29   
ref|XP_010312592.1|  PREDICTED: probable pectate lyase 13 isoform X3    123   2e-29   
ref|XP_001785953.1|  predicted protein                                  122   2e-29   
emb|CDX89799.1|  BnaA10g02830D                                          123   2e-29   
ref|XP_006352706.1|  PREDICTED: probable pectate lyase 10-like          123   3e-29   
ref|XP_010322529.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    122   3e-29   
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                122   3e-29   
ref|XP_009105327.1|  PREDICTED: probable pectate lyase 5                122   3e-29   
ref|XP_011002172.1|  PREDICTED: probable pectate lyase 8                123   3e-29   
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             123   3e-29   
ref|NP_001268017.1|  probable pectate lyase 12-like precursor           123   3e-29   
ref|XP_009614672.1|  PREDICTED: probable pectate lyase 13 isoform X1    123   3e-29   
ref|XP_011072008.1|  PREDICTED: probable pectate lyase 18               122   3e-29   
emb|CDY56220.1|  BnaAnng14170D                                          122   3e-29   
emb|CDY34149.1|  BnaA02g28910D                                          122   3e-29   
ref|XP_010918903.1|  PREDICTED: probable pectate lyase 5                123   3e-29   
emb|CAN77957.1|  hypothetical protein VITISV_021245                     122   3e-29   
ref|XP_010312591.1|  PREDICTED: probable pectate lyase 13 isoform X2    123   3e-29   
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     123   3e-29   
gb|AAL06861.1|  At1g04680/T1G11_6                                       122   3e-29   
ref|XP_006360328.1|  PREDICTED: probable pectate lyase 15-like          122   3e-29   
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               122   3e-29   
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                122   3e-29   
ref|XP_006291220.1|  hypothetical protein CARUB_v10017351mg             122   3e-29   
ref|XP_008458848.1|  PREDICTED: pectate lyase-like                      122   3e-29   
emb|CDY61137.1|  BnaC05g48970D                                          122   3e-29   
ref|XP_008439105.1|  PREDICTED: probable pectate lyase 22               122   3e-29   
emb|CBI31413.3|  unnamed protein product                                123   3e-29   
ref|XP_010929962.1|  PREDICTED: probable pectate lyase 5                122   3e-29   
ref|XP_001774203.1|  predicted protein                                  122   4e-29   
ref|XP_004247823.1|  PREDICTED: probable pectate lyase 8                122   4e-29   
ref|XP_007027462.1|  Pectin lyase-like superfamily protein isoform 3    122   4e-29   



>ref|XP_008456459.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=434

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 118/174 (68%), Gaps = 18/174 (10%)
 Frame = -1

Query  524  NTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNS  345
            + D YW TR  EA + AK A+NP PE+VT  L   +S+ M                  NS
Sbjct  23   DEDEYWNTRATEAKKVAKSAFNPNPEIVTDNLNAAVSRAM---------------VGRNS  67

Query  344  TRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVV  165
            TRRSL   K+YRGPC  TNPIDRCWRCDRNWAKNRKKLA C LGFG  T GGKRGP YVV
Sbjct  68   TRRSL---KKYRGPCLATNPIDRCWRCDRNWAKNRKKLAECPLGFGHQTIGGKRGPIYVV  124

Query  164  TNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            T+  DDD+V PK GTLR+ VIQ GPLWI F +SM IRL  EL+++SDKTID RG
Sbjct  125  TDASDDDLVNPKPGTLRYGVIQKGPLWIIFGRSMIIRLSQELMISSDKTIDARG  178



>gb|KGN47799.1| hypothetical protein Csa_6G404140 [Cucumis sativus]
Length=415

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 117/174 (67%), Gaps = 17/174 (10%)
 Frame = -1

Query  524  NTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNS  345
            + D YW TR  EA + A+ A+N  PE+VT  L   +S+ M                 HNS
Sbjct  23   DEDEYWQTRATEAKKVAQGAFNANPEIVTDTLNAAVSRTM---------------LGHNS  67

Query  344  TRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVV  165
            TRRSL   K+YRGPC  TNPIDRCWRCDRNWAKNR+KLA C LGFG  T GGKRGP YVV
Sbjct  68   TRRSL--RKKYRGPCLATNPIDRCWRCDRNWAKNRRKLAECPLGFGHQTIGGKRGPIYVV  125

Query  164  TNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            T+  DDD+V PK GTLRH VIQ GPLWI F +SM IRL  EL+++S KTID RG
Sbjct  126  TDASDDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQELMISSHKTIDARG  179



>ref|XP_004162547.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
Length=435

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 117/174 (67%), Gaps = 17/174 (10%)
 Frame = -1

Query  524  NTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNS  345
            + D YW TR  EA + A+ A+N  PE+VT  L   +S+ M                 HNS
Sbjct  23   DEDEYWETRATEAKKVAQGAFNANPEIVTDTLNAAVSRTM---------------LGHNS  67

Query  344  TRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVV  165
            TRRSL   K+YRGPC  TNPIDRCWRCDRNWAKNR+KLA C LGFG  T GGKRGP YVV
Sbjct  68   TRRSL--RKKYRGPCLATNPIDRCWRCDRNWAKNRRKLAECPLGFGHQTIGGKRGPIYVV  125

Query  164  TNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            T+  DDD+V PK GTLRH VIQ GPLWI F +SM IRL  EL+++S KTID RG
Sbjct  126  TDASDDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQELMISSHKTIDARG  179



>gb|KHG07401.1| putative pectate lyase P59 [Gossypium arboreum]
Length=442

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 131/197 (66%), Gaps = 19/197 (10%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            +++    L   IP + AH A++   D YW  R+ +A +  ++AYNP PE VT     H++
Sbjct  11   LILYFLCLGVIIPSLEAHIAEY---DDYWRERELQAKENLEKAYNPNPEEVTQHFNDHVA  67

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
            +++   R              NSTRR  M  KR  GPC+ TNPID+CWRCDRNW KNRKK
Sbjct  68   RILMGFRT-------------NSTRR--MLKKRKGGPCEATNPIDQCWRCDRNWEKNRKK  112

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA CALGFG GTTGGK GP YVVT+   DDV+ P RGTLRHAVIQ  PLWITFA+ M IR
Sbjct  113  LADCALGFGRGTTGGKDGPIYVVTDP-TDDVLNPSRGTLRHAVIQNRPLWITFARGMIIR  171

Query  53   LKNELLVTSDKTIDGRG  3
            LK ELL+TS+KTIDGRG
Sbjct  172  LKEELLMTSNKTIDGRG  188



>ref|XP_004146792.1| PREDICTED: probable pectate lyase P59-like, partial [Cucumis 
sativus]
Length=442

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 117/174 (67%), Gaps = 17/174 (10%)
 Frame = -1

Query  524  NTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNS  345
            + D YW TR  EA + A+ A+N  PE+VT  L   +S+ M                 HNS
Sbjct  30   DEDEYWQTRATEAKKVAQGAFNANPEIVTDTLNAAVSRTM---------------LGHNS  74

Query  344  TRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVV  165
            TRRSL   K+YRGPC  TNPIDRCWRCDRNWAKNR+KLA C LGFG  T GGKRGP YVV
Sbjct  75   TRRSL--RKKYRGPCLATNPIDRCWRCDRNWAKNRRKLAECPLGFGHQTIGGKRGPIYVV  132

Query  164  TNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            T+  DDD+V PK GTLRH VIQ GPLWI F +SM IRL  EL+++S KTID RG
Sbjct  133  TDASDDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQELMISSHKTIDARG  186



>ref|XP_006477525.1| PREDICTED: pectate lyase-like [Citrus sinensis]
Length=437

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 124/200 (62%), Gaps = 19/200 (10%)
 Frame = -1

Query  602  NWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTK  423
            N  I++ L+ LA+  P++ A+  D    D  W  R   A ++A  AY+P PE V S   K
Sbjct  5    NAGILLTLFGLASISPILKANIHDF---DEVWQKRAENARRHALEAYHPNPEEVVSSFNK  61

Query  422  HISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKN  243
            H+  M                   NSTRR L R + Y G C  TNPID+CWRCDRNWA N
Sbjct  62   HVHMMFENG---------------NSTRRYL-RGRPYTGRCAATNPIDQCWRCDRNWANN  105

Query  242  RKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSM  63
            RK+LA CA GFG GT GGK GPFYVVTN  DDD+V PK GTLRHAVIQ  PLWITFA  M
Sbjct  106  RKRLADCAQGFGRGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDM  165

Query  62   TIRLKNELLVTSDKTIDGRG  3
             IRL  ELL+TSDKTID RG
Sbjct  166  VIRLSEELLITSDKTIDARG  185



>gb|KDO76053.1| hypothetical protein CISIN_1g013757mg [Citrus sinensis]
Length=437

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 125/200 (63%), Gaps = 19/200 (10%)
 Frame = -1

Query  602  NWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTK  423
            N  I++ L+ LA+  P++ A+T D    D  W  R   A ++A  AY+P PE V S   K
Sbjct  5    NAGILLTLFGLASISPILKANTHDF---DEVWQKRAENARRHALEAYHPNPEEVVSSFNK  61

Query  422  HISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKN  243
            H+  M                   +STRR L R + Y G C  TNPID+CWRCDRNWA N
Sbjct  62   HVHMMFENG---------------SSTRRYL-RGRPYTGRCAATNPIDQCWRCDRNWANN  105

Query  242  RKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSM  63
            RK+LA CA GFG GT GGK GPFYVVTN  DDD+V PK GTLRHAVIQ  PLWITFA  M
Sbjct  106  RKRLADCAQGFGRGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDM  165

Query  62   TIRLKNELLVTSDKTIDGRG  3
             IRL  ELL+TSDKTID RG
Sbjct  166  VIRLSEELLITSDKTIDARG  185



>ref|XP_006439649.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
 gb|ESR52889.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
Length=437

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 125/200 (63%), Gaps = 19/200 (10%)
 Frame = -1

Query  602  NWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTK  423
            N  I++ L+ LA+  P++ A+T D    D  W  R   A ++A  AY+P PE V S   K
Sbjct  5    NAGILLTLFGLASISPILKANTHDF---DEVWQKRAENARRHALEAYHPNPEEVVSSFNK  61

Query  422  HISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKN  243
            H+  M                   +STRR L R + Y G C  TNPID+CWRCDRNWA N
Sbjct  62   HVHMMFENG---------------SSTRRYL-RGRPYTGRCAATNPIDQCWRCDRNWANN  105

Query  242  RKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSM  63
            RK+LA CA GFG GT GGK GPFYVVTN  DDD+V PK GTLRHAVIQ  PLWITFA  M
Sbjct  106  RKRLADCAQGFGRGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDM  165

Query  62   TIRLKNELLVTSDKTIDGRG  3
             IRL  ELL+TSDKTID RG
Sbjct  166  VIRLSEELLITSDKTIDARG  185



>gb|AAB69758.1| putative pectate lyase Nt59 [Nicotiana tabacum]
Length=274

 Score =   175 bits (443),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 123/202 (61%), Gaps = 16/202 (8%)
 Frame = -1

Query  608  KMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKL  429
            K+ +    +    A  IP +MAH  D +     W  R  EA +YA++ Y P PE VT   
Sbjct  5    KLMYSFFFLFIIFATIIPCLMAHIGDFDEV---WRRRAEEAREYARQIYEPNPENVTLAF  61

Query  428  TKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWA  249
             + +   M E               +NSTRR L  +K+Y+GPC VTNPIDRCWRCD NWA
Sbjct  62   NQKVRDSMKEV-----------TVSNNSTRRGL-GTKKYKGPCMVTNPIDRCWRCDPNWA  109

Query  248  KNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAK  69
             NRK+LA CA+GFG+  TGGK G  Y+VT+   DD  EPK GTLR+AVIQ  PLWI F +
Sbjct  110  DNRKRLADCAMGFGSKATGGKDGEIYIVTDN-SDDYAEPKPGTLRYAVIQKEPLWIIFER  168

Query  68   SMTIRLKNELLVTSDKTIDGRG  3
            SMTIRL  EL++ SDKTID RG
Sbjct  169  SMTIRLHQELIMQSDKTIDARG  190



>ref|XP_010066949.1| PREDICTED: pectate lyase [Eucalyptus grandis]
 gb|KCW65002.1| hypothetical protein EUGRSUZ_G02541 [Eucalyptus grandis]
Length=436

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 130/203 (64%), Gaps = 23/203 (11%)
 Frame = -1

Query  605  MNWWIVVMLY--ALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSK  432
            MN  +   L+  + A  +P + A+  +    D YW  R  EA + A +AY+P+PE VTS 
Sbjct  1    MNRHVCFFLFFSSFAVLVPSLQANIEEF---DEYWAKRAEEAQKDALKAYDPHPETVTSL  57

Query  431  LTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNW  252
                + K +                 +NSTRR L   K+Y+GPC  TNPIDRCWRC+RNW
Sbjct  58   FNAKVDKAV---------------RGNNSTRRQL---KKYKGPCLATNPIDRCWRCNRNW  99

Query  251  AKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFA  72
            A+NRK+LA+C LGFG  T GGKRG FYVVT+  D+D+V PK GTLRHAV+Q GPLWI FA
Sbjct  100  ARNRKRLANCVLGFGRKTRGGKRGWFYVVTDSSDNDMVNPKPGTLRHAVVQKGPLWIIFA  159

Query  71   KSMTIRLKNELLVTSDKTIDGRG  3
             SM IRL  EL++TSDKTID RG
Sbjct  160  GSMVIRLNQELIMTSDKTIDARG  182



>ref|XP_007046218.1| Pectate lyase family protein, putative [Theobroma cacao]
 gb|EOY02050.1| Pectate lyase family protein, putative [Theobroma cacao]
Length=441

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 125/186 (67%), Gaps = 19/186 (10%)
 Frame = -1

Query  560  IPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlled  381
            IP + AH A++   D YW  R+AEA ++  +AYNP PE VT     H+++ +        
Sbjct  21   IPTLHAHIAEY---DDYWRQREAEAKEHFNKAYNPNPEEVTQHFNHHVARTL--------  69

Query  380  veydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgag  201
                      NSTRRSL R KR  GPC+ TNPID+CWRCD NW +NRK+LA C+LGFG G
Sbjct  70   -------MGFNSTRRSL-RGKRRTGPCQATNPIDQCWRCDPNWHRNRKRLADCSLGFGRG  121

Query  200  ttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDK  21
            T GGK G +Y+VT+  D+D+V PK GTLRHAVIQ  PLWI FA+SM I+L  EL++TSDK
Sbjct  122  TIGGKNGRYYIVTDPSDNDMVNPKPGTLRHAVIQKRPLWIIFARSMIIKLNQELIMTSDK  181

Query  20   TIDGRG  3
            TID RG
Sbjct  182  TIDARG  187



>ref|XP_008339935.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 111/172 (65%), Gaps = 15/172 (9%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D YW  R  EA + A  +YN  PE VT +    + K+M++                N+TR
Sbjct  43   DAYWKERAEEAEKVAMESYNKNPEKVTEEFNTEVGKLMSK---------------ENTTR  87

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
            R+L  +K Y GPC  TNP+D CWRCD NWA NRKK+  CA GFG  TTGGK GPFYVVT 
Sbjct  88   RNLRGNKAYTGPCMATNPMDACWRCDPNWANNRKKIVGCAQGFGKKTTGGKDGPFYVVTM  147

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              DDDV  PK GTLRHAVIQ GPLWI F KSM IRL+ EL+VTSDKTID RG
Sbjct  148  GTDDDVQNPKPGTLRHAVIQKGPLWIIFTKSMVIRLQQELMVTSDKTIDARG  199



>ref|XP_008389523.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 3 [Malus 
domestica]
Length=452

 Score =   176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 113/172 (66%), Gaps = 15/172 (9%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D YW  R  EA++ A  +Y+  PE VT +    +++++++                N+TR
Sbjct  43   DAYWKERAQEALKEAMESYHKNPEQVTEEFNTGVAELLSK---------------ENTTR  87

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
            R+L  +K Y GPC  TNPID CWRCD NWA NRKK+  CA GFG   TGGK GP YVVT 
Sbjct  88   RNLRGNKGYNGPCMATNPIDACWRCDPNWADNRKKIVGCAQGFGKKATGGKDGPIYVVTV  147

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              DDDV  PK GTLRHAVIQ GPLWI FA+SM IRL+ EL+VTSDKTIDGRG
Sbjct  148  GTDDDVQNPKPGTLRHAVIQKGPLWIIFARSMVIRLQQELMVTSDKTIDGRG  199



>ref|XP_008221660.1| PREDICTED: probable pectate lyase 3 [Prunus mume]
Length=443

 Score =   176 bits (446),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 116/172 (67%), Gaps = 15/172 (9%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D YW  R  EA + A +++   PELVT +   ++ +++ +                N TR
Sbjct  34   DAYWKQRAEEAEKVAMQSFQTDPELVTEEFNSNVGELLMKL---------------NGTR  78

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
            R+L   K+Y GPC  TNPID CWRCD+NWAKNRK+LA+C  GFG  TTGGK GP YVVT+
Sbjct  79   RNLRGVKKYNGPCMATNPIDACWRCDKNWAKNRKRLANCVQGFGRKTTGGKGGPIYVVTD  138

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              D D+V PK GTLRHAVIQ GPLWI FA+SM IRL+ EL+VTSDKTIDGRG
Sbjct  139  PSDLDLVNPKPGTLRHAVIQKGPLWIIFARSMVIRLQQELIVTSDKTIDGRG  190



>ref|XP_007227702.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
 gb|EMJ28901.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
Length=446

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 115/172 (67%), Gaps = 15/172 (9%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            DIYW  R  EA + A +++   PE VT +   ++ +++                + N TR
Sbjct  37   DIYWKQRAEEAKKEAMQSFETDPEQVTEEFNSNVGELL---------------MKQNGTR  81

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
            R L  +K+Y GPC  TNP+D CWRCD+NWAKNRK+LA C  GFG  TTGGK GP YVVT+
Sbjct  82   RHLRGNKKYNGPCMATNPMDACWRCDKNWAKNRKRLADCVQGFGKKTTGGKAGPIYVVTD  141

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              D D+V PK GTLRHAVIQ GPLWI FA++M IRL+ ELLVTSDKTIDGRG
Sbjct  142  PSDLDLVNPKPGTLRHAVIQKGPLWIIFARNMVIRLQQELLVTSDKTIDGRG  193



>ref|XP_008357758.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=459

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 132/209 (63%), Gaps = 13/209 (6%)
 Frame = -1

Query  617  MHSKMNWWIVVMLYALAAAIPVVMAHTADHN----NTDIYWVTRKAEAMQYAKRAYNPYP  450
            M SK+N  +V+ + +    +P + A TA+      N D  W  R  +A + A +AY P P
Sbjct  6    MASKLN--LVLFMISFCMLVPSLKAETANDTLNIANFDAVWQERAMKAQKAALKAYQPNP  63

Query  449  ELVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCW  270
            E VT    + + + + E  L +D          NSTRR+L R K Y+GPCK TNPIDRCW
Sbjct  64   EQVTEDFNESVEQTVVEEDLEDDQSAG------NSTRRNL-RGKXYKGPCKATNPIDRCW  116

Query  269  RCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGP  90
            RC  NWA NRKKLASC  GFG  T GGK+G +Y+VT+  DD+V +PK GTLRHAVIQ  P
Sbjct  117  RCRANWANNRKKLASCVKGFGRKTRGGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQP  176

Query  89   LWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            LWI FA+SM IRL  EL+VTS KTID RG
Sbjct  177  LWIIFARSMVIRLSQELIVTSHKTIDARG  205



>ref|XP_009148818.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 132/205 (64%), Gaps = 20/205 (10%)
 Frame = -1

Query  602  NWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTK  423
            ++  V +L +LA   P V A+ A     D YW  R+ +A++    +++PYP  VT+ L  
Sbjct  10   SYIFVFLLSSLATLAPQVQANIAVF---DDYWTQRQGDALKQTLASFDPYPLNVTNHLNY  66

Query  422  HISKMMNETRlledveydelddEHNSTRRSLMRSKRYR-----GPCKVTNPIDRCWRCDR  258
            H++  ++ T               NSTRR L +++R R     G C   NPID+CWRCDR
Sbjct  67   HVALALDTTEST------------NSTRRELSQARRGRKMQNRGKCVAHNPIDKCWRCDR  114

Query  257  NWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWIT  78
            +W KNRKKLA CALGFG  TTGGK GP YVVT+  DD+++ P+ GTLRHAV + GPLWI 
Sbjct  115  DWEKNRKKLAVCALGFGRRTTGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWII  174

Query  77   FAKSMTIRLKNELLVTSDKTIDGRG  3
            FA+SM I+L+ EL++TSDKTIDGRG
Sbjct  175  FARSMVIKLQQELMMTSDKTIDGRG  199



>gb|EPS66620.1| hypothetical protein M569_08154, partial [Genlisea aurea]
Length=451

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 123/199 (62%), Gaps = 11/199 (6%)
 Frame = -1

Query  584  MLYALA---AAIPVVMAHTADHN--NTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKH  420
            + +ALA    AI   +  T+D      D +W  R+AEA      +Y P P  + + L  H
Sbjct  1    LFFALALSVVAISSCLVPTSDARIAEYDDFWKKRRAEAWNRTLLSYEPNPAKIVTHLNLH  60

Query  419  ISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNR  240
              ++++E    +           N TRRSL R +RY GPC VTNPIDRCWRC  +WA NR
Sbjct  61   SHRLLHELNATDHFHLVG-----NHTRRSL-RGRRYNGPCTVTNPIDRCWRCRSDWATNR  114

Query  239  KKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMT  60
             +LA C LGFG    GGK GP YVVT+  D+D+V PK GTLRHAVIQ GPLWI FA+SM 
Sbjct  115  FRLADCGLGFGYKAKGGKNGPIYVVTDSSDNDMVNPKPGTLRHAVIQPGPLWIVFARSMV  174

Query  59   IRLKNELLVTSDKTIDGRG  3
            IRL  ELLVTSDKTIDGRG
Sbjct  175  IRLSQELLVTSDKTIDGRG  193



>ref|XP_009599825.1| PREDICTED: probable pectate lyase P59 isoform X1 [Nicotiana tomentosiformis]
Length=445

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 123/202 (61%), Gaps = 16/202 (8%)
 Frame = -1

Query  608  KMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKL  429
            K+ +    +    A  IP +MAH  D    D  W  R  EA +YA++ Y P PE VT   
Sbjct  5    KLMYSFFFLFIIFATIIPCLMAHIGDF---DEVWRRRAEEAREYARQIYEPNPENVTLAF  61

Query  428  TKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWA  249
             + +   M E               +NSTRR L  +K+Y+GPC VTNPIDRCWRCD NWA
Sbjct  62   NQKVRDSMKEV-----------TVSNNSTRRGL-GTKKYKGPCMVTNPIDRCWRCDPNWA  109

Query  248  KNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAK  69
             NRK+LA CA+GFG+  TGGK G  Y+VT+   DD  EPK GTLR+AVIQ  PLWI F +
Sbjct  110  DNRKRLADCAMGFGSKATGGKDGEIYIVTDN-SDDYAEPKPGTLRYAVIQKEPLWIIFER  168

Query  68   SMTIRLKNELLVTSDKTIDGRG  3
            SMTIRL  EL++ SDKTID RG
Sbjct  169  SMTIRLHQELIMQSDKTIDARG  190



>ref|XP_010033216.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
Length=435

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 125/195 (64%), Gaps = 19/195 (10%)
 Frame = -1

Query  587  VMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKM  408
            ++  +LA  +P + AH  +    D YW  R  EA Q A  A+NP PE VT++   +++K+
Sbjct  7    ILALSLAVLVPSLEAHIKEF---DEYWQKRAEEASQAALEAFNPEPENVTAQFNANVNKV  63

Query  407  MNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLA  228
            ++                +NSTRR L   K Y GPC  TNPIDRCWRC +NWAK+RK+LA
Sbjct  64   LD---------------GNNSTRRQLHMHK-YSGPCLATNPIDRCWRCRKNWAKDRKRLA  107

Query  227  SCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLK  48
             C LGFG  TTGG +G +YVV +  D+DVV PK GTLRHAVIQ  PLWI FA+SM IRL 
Sbjct  108  KCVLGFGRKTTGGLKGKYYVVYDCSDNDVVNPKPGTLRHAVIQKRPLWIIFARSMVIRLN  167

Query  47   NELLVTSDKTIDGRG  3
             EL+V S KTIDGRG
Sbjct  168  QELMVASHKTIDGRG  182



>emb|CDY45254.1| BnaA06g09240D [Brassica napus]
Length=458

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 132/205 (64%), Gaps = 20/205 (10%)
 Frame = -1

Query  602  NWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTK  423
            ++  V +L + A   P V A+ A     D YW  R+ +A++    +++PYP  VT+ L  
Sbjct  10   SYIFVFLLSSFATLAPQVQANIAVF---DDYWTQRQGDALKQTLASFDPYPLNVTNHLNY  66

Query  422  HISKMMNETRlledveydelddEHNSTRRSLMRSKRYR-----GPCKVTNPIDRCWRCDR  258
            H++  ++ T  +            NSTRR L +++R R     G C   NPID+CWRCDR
Sbjct  67   HVALALDTTESI------------NSTRRELSQARRGRKMQNRGKCVAHNPIDKCWRCDR  114

Query  257  NWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWIT  78
            +W KNRKKLA CALGFG  TTGGK GP YVVT+  DD+++ P+ GTLRHAV + GPLWI 
Sbjct  115  DWEKNRKKLAVCALGFGRRTTGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWII  174

Query  77   FAKSMTIRLKNELLVTSDKTIDGRG  3
            FA+SM I+L+ EL++TSDKTIDGRG
Sbjct  175  FARSMVIKLQQELMMTSDKTIDGRG  199



>ref|XP_009599826.1| PREDICTED: probable pectate lyase P59 isoform X2 [Nicotiana tomentosiformis]
Length=444

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 123/202 (61%), Gaps = 17/202 (8%)
 Frame = -1

Query  608  KMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKL  429
            K+ +    +    A  IP +MAH  D    D  W  R  EA +YA++ Y P PE VT   
Sbjct  5    KLMYSFFFLFIIFATIIPCLMAHIGDF---DEVWRRRAEEAREYARQIYEPNPENVTLAF  61

Query  428  TKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWA  249
             + +  M   T              +NSTRR L  +K+Y+GPC VTNPIDRCWRCD NWA
Sbjct  62   NQKVRDMKEVT------------VSNNSTRRGL-GTKKYKGPCMVTNPIDRCWRCDPNWA  108

Query  248  KNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAK  69
             NRK+LA CA+GFG+  TGGK G  Y+VT+   DD  EPK GTLR+AVIQ  PLWI F +
Sbjct  109  DNRKRLADCAMGFGSKATGGKDGEIYIVTDN-SDDYAEPKPGTLRYAVIQKEPLWIIFER  167

Query  68   SMTIRLKNELLVTSDKTIDGRG  3
            SMTIRL  EL++ SDKTID RG
Sbjct  168  SMTIRLHQELIMQSDKTIDARG  189



>ref|XP_011085777.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=446

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 135/208 (65%), Gaps = 15/208 (7%)
 Frame = -1

Query  626  MEGMHSKMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPE  447
            MEG  +K+NW + ++ + +A+ +PV+ A+ A++   D  W  R AEA     +AY P P 
Sbjct  1    MEG--TKVNW-LPILFFVVASILPVLRANIAEY---DEVWRRRAAEAYNRTLQAYEPDPL  54

Query  446  LVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWR  267
             V     +++ + + E+  ++ +         NSTRR L   K+YRGPCKVTNPID CWR
Sbjct  55   KVVMHFNENVHRHIKESGGVDMMML-------NSTRRRL--GKKYRGPCKVTNPIDACWR  105

Query  266  CDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPL  87
            CD NW  NR KLA C+LGFG   TGGK G  YVVT+  DDD++ PK GTLRHAVIQ  PL
Sbjct  106  CDPNWHLNRFKLADCSLGFGRKATGGKGGRIYVVTDPSDDDILTPKPGTLRHAVIQEEPL  165

Query  86   WITFAKSMTIRLKNELLVTSDKTIDGRG  3
            WITF +SM I L  EL++TSDKTIDGRG
Sbjct  166  WITFKRSMVITLAQELIMTSDKTIDGRG  193



>ref|XP_011085780.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=447

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 137/208 (66%), Gaps = 14/208 (7%)
 Frame = -1

Query  626  MEGMHSKMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPE  447
            MEG  +K+NW ++  L A A+ +P++ A  A++   D  W  R AEA     +AY+P P 
Sbjct  1    MEG--TKLNWLLISFL-AFASILPLLRADIAEY---DEVWRRRAAEAYNRTVQAYHPDPL  54

Query  446  LVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWR  267
             V     KH++K + E+  L+DV         N+TRR L   K Y+GPCKVTNPID CWR
Sbjct  55   KVVMHFNKHVNKHVEESGGLDDVMML------NTTRRHL--GKAYKGPCKVTNPIDACWR  106

Query  266  CDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPL  87
            C+  W  NR +LA C +GFG+  TGGK G  Y+VT++ DDDV+ PK GTLRHAVIQ  PL
Sbjct  107  CNPKWHLNRFRLADCGMGFGSKATGGKGGRIYMVTDKSDDDVLNPKPGTLRHAVIQEEPL  166

Query  86   WITFAKSMTIRLKNELLVTSDKTIDGRG  3
            WITF ++M I+LK EL+VTSDKTIDGRG
Sbjct  167  WITFRRNMVIKLKQELMVTSDKTIDGRG  194



>gb|KCW52797.1| hypothetical protein EUGRSUZ_J02132 [Eucalyptus grandis]
Length=451

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 125/195 (64%), Gaps = 19/195 (10%)
 Frame = -1

Query  587  VMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKM  408
            ++  +LA  +P + AH  +    D YW  R  EA Q A  A+NP PE VT++   +++K+
Sbjct  10   ILALSLAVLVPSLEAHIKEF---DEYWQKRAEEASQAALEAFNPEPENVTAQFNANVNKV  66

Query  407  MNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLA  228
            ++                +NSTRR L   K Y GPC  TNPIDRCWRC +NWAK+RK+LA
Sbjct  67   LD---------------GNNSTRRQLHMHK-YSGPCLATNPIDRCWRCRKNWAKDRKRLA  110

Query  227  SCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLK  48
             C LGFG  TTGG +G +YVV +  D+DVV PK GTLRHAVIQ  PLWI FA+SM IRL 
Sbjct  111  KCVLGFGRKTTGGLKGKYYVVYDCSDNDVVNPKPGTLRHAVIQKRPLWIIFARSMVIRLN  170

Query  47   NELLVTSDKTIDGRG  3
             EL+V S KTIDGRG
Sbjct  171  QELMVASHKTIDGRG  185



>emb|CDY39314.1| BnaC05g10650D [Brassica napus]
Length=459

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 130/203 (64%), Gaps = 21/203 (10%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
             V  L +LA   P V A+ A     D YW  R+ +A++    +++PYP  VT+ L  H++
Sbjct  13   FVFFLSSLATLAPQVQANIAVF---DDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHVA  69

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYR------GPCKVTNPIDRCWRCDRNW  252
              ++ T  +            NSTRR L +++R R      G C   NPID+CWRCDR+W
Sbjct  70   LALDTTGSI------------NSTRRELSQARRGRKMQNRRGKCVAHNPIDKCWRCDRDW  117

Query  251  AKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFA  72
             KNRKKLA CALGFG  T+GGK GP YVVT+  DD+++ P+ GTLRHAV + GPLWI FA
Sbjct  118  EKNRKKLAVCALGFGRRTSGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFA  177

Query  71   KSMTIRLKNELLVTSDKTIDGRG  3
            +SM I+L+ EL++TSDKTIDGRG
Sbjct  178  RSMVIKLQQELMMTSDKTIDGRG  200



>ref|XP_010242445.1| PREDICTED: pectate lyase [Nelumbo nucifera]
Length=443

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 115/189 (61%), Gaps = 15/189 (8%)
 Frame = -1

Query  569  AAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRl  390
            AA IP + AH  D    D  W  R  EA   A  AY+P P+ V +    H+     E R 
Sbjct  20   AAIIPTLRAHIGDF---DEVWQKRAEEAKSNALEAYHPDPDEVINHFNHHVHLATAEVRS  76

Query  389  ledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgf  210
                        ++STRRSL R+K Y+GPC  TNPIDRCWRC   W KNRKKLA C LGF
Sbjct  77   G-----------NSSTRRSL-RNKEYKGPCMATNPIDRCWRCRSKWGKNRKKLADCVLGF  124

Query  209  gagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVT  30
            G  T GGK G FYVVT+  DDD+  PK GTLRHAVIQ  PLWI F   M IRLK EL++T
Sbjct  125  GRKTVGGKYGKFYVVTDGSDDDMENPKPGTLRHAVIQTEPLWIIFEHDMIIRLKQELIMT  184

Query  29   SDKTIDGRG  3
            SDKT+DGRG
Sbjct  185  SDKTLDGRG  193



>ref|XP_008339934.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 110/172 (64%), Gaps = 15/172 (9%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D YW  R  EA + A  +YN  PE VT +    + K+M                + N+TR
Sbjct  43   DAYWKQRAEEAEKEALESYNKNPEQVTEEFNNEVGKLM---------------LKENTTR  87

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
            R+L  +K Y+GPC  TNPID CWRCD  WA NRKK+  CA GFG   TGGK GPFYVVT 
Sbjct  88   RNLRGNKAYKGPCMATNPIDACWRCDPYWANNRKKIVGCAQGFGKKATGGKDGPFYVVTM  147

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              DDDV  PK GTLRHAVIQ GPLWI FAKSM IRL+ EL+VTSDKTID RG
Sbjct  148  GTDDDVQNPKPGTLRHAVIQKGPLWIIFAKSMVIRLQQELMVTSDKTIDARG  199



>ref|XP_009342871.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=454

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 130/209 (62%), Gaps = 13/209 (6%)
 Frame = -1

Query  617  MHSKMNWWIVVMLYALAAAIPVVMAHTADHN----NTDIYWVTRKAEAMQYAKRAYNPYP  450
            M SK+N  +V+ + +    +P + A TA+      N D  W  R  +A + A +AY P P
Sbjct  1    MASKLN--LVLFMISFCMLVPSLKAETANDTLNIANFDAVWQERGMKAQKAALKAYQPNP  58

Query  449  ELVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCW  270
            E VT    + + + + E  L +D          NSTRR L R K  +GPCK TNPIDRCW
Sbjct  59   EQVTEDFNESVEQTVVEEDLEDDQSAG------NSTRRHL-RGKHNKGPCKATNPIDRCW  111

Query  269  RCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGP  90
            RC  NWA NRKKLASC  GFG  T GGK+G +Y+VT+  DD+V +PK GTLRHAVIQ  P
Sbjct  112  RCRANWANNRKKLASCVKGFGRKTRGGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQP  171

Query  89   LWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            LWI FA+SM IRL  EL+VTS KTID RG
Sbjct  172  LWIIFARSMVIRLSQELIVTSHKTIDARG  200



>ref|XP_011098576.1| PREDICTED: probable pectate lyase P56 [Sesamum indicum]
Length=465

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 126/205 (61%), Gaps = 12/205 (6%)
 Frame = -1

Query  617  MHSKMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVT  438
            M    +   + + +  AA IP   A+  D +  D+YW  R A A     +AYNP PE + 
Sbjct  18   MEKNFSITFLFLFFISAAFIPTSGANYTDSH--DVYWQERAALARARILQAYNPNPEAIV  75

Query  437  SKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDR  258
            +   +   + +  +++            HN TRR+L R  +Y GPC  TNPIDRCWRC+ 
Sbjct  76   TDFNQKTKEALEHSQVNRAP--------HNGTRRNLGR--KYMGPCVATNPIDRCWRCNP  125

Query  257  NWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWIT  78
            NWA NR+KLA CA GFGA  TGGK GP YVV +  D+D++ PK GTLRHAVIQ GPLWI 
Sbjct  126  NWALNRQKLADCAQGFGAAATGGKFGPIYVVRDPSDNDMMNPKPGTLRHAVIQPGPLWII  185

Query  77   FAKSMTIRLKNELLVTSDKTIDGRG  3
            F+ SM I+L  EL++TSDKTIDGRG
Sbjct  186  FSHSMNIKLNQELIMTSDKTIDGRG  210



>ref|XP_009360393.1| PREDICTED: probable pectate lyase 3 [Pyrus x bretschneideri]
Length=452

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 111/172 (65%), Gaps = 15/172 (9%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D YW  R  EA++ A  +Y+  PE    +    +++++++                N+TR
Sbjct  43   DAYWKERAQEALKEAMESYHKNPEQAAEEFHTGVAELLSK---------------ENTTR  87

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
            R+L  +K Y GPC  TNPID CWRCD NWA NRKK+  CA GFG   TGGK GP YVVT 
Sbjct  88   RNLRGNKGYNGPCMATNPIDACWRCDANWANNRKKIVGCAQGFGKKATGGKDGPIYVVTV  147

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              D+DV  PK GTLRHAVIQ GPLWI FA+SM IRL+ EL+VTSDKTIDGRG
Sbjct  148  GTDNDVQNPKPGTLRHAVIQKGPLWIIFARSMVIRLEQELMVTSDKTIDGRG  199



>ref|XP_007037229.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY21730.1| Pectate lyase family protein [Theobroma cacao]
Length=434

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 118/185 (64%), Gaps = 21/185 (11%)
 Frame = -1

Query  557  PVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledv  378
            P+V A+  +    D  W  R  EA + A RAY P PE VT  L K   K +  +      
Sbjct  19   PIVKANIGEF---DEVWQKRAEEAKKAALRAYEPNPEKVTDNLNKETGKALKGS------  69

Query  377  eydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagt  198
                     NSTRR+L    RYRGPC  TNPIDRCWRCD +WA+NRKKLA+C LGFG  T
Sbjct  70   ---------NSTRRNL---GRYRGPCLATNPIDRCWRCDPHWAENRKKLATCVLGFGRRT  117

Query  197  tggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKT  18
            TGGK G FYVVT+  D+D++ PK GT+RHAVIQ  PLWI FA  M IRL  EL++TSDKT
Sbjct  118  TGGKDGRFYVVTDPSDNDMINPKPGTIRHAVIQKEPLWIIFAHDMVIRLNEELIMTSDKT  177

Query  17   IDGRG  3
            IDGRG
Sbjct  178  IDGRG  182



>ref|XP_004234779.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=449

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 125/202 (62%), Gaps = 12/202 (6%)
 Frame = -1

Query  608  KMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKL  429
            K+ +  + +    A  IP +MAH   +   D  W  R  EA +YA++ Y P+PE VT   
Sbjct  5    KIKYSFLFLCITFATIIPSLMAHIGHY---DEVWRRRAEEAKEYARKIYEPHPENVTLAF  61

Query  428  TKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWA  249
             + +   M E + ++          +NSTRR L  +K+Y GPC VTNPID+CWRCD NWA
Sbjct  62   NQKLRDTMKELKKVKGTH-------NNSTRRGL-GTKKYTGPCMVTNPIDKCWRCDPNWA  113

Query  248  KNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAK  69
             NRKKLA CA+GFG+   GGK G FYVVT+   DD  +PK GTLRHAVIQ  PLWI F +
Sbjct  114  DNRKKLADCAMGFGSKAIGGKDGEFYVVTDN-SDDYNDPKPGTLRHAVIQKEPLWIIFKR  172

Query  68   SMTIRLKNELLVTSDKTIDGRG  3
             M IRL  E+++ SDKTID RG
Sbjct  173  GMNIRLHQEMIMQSDKTIDARG  194



>ref|XP_009779191.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 122/202 (60%), Gaps = 14/202 (7%)
 Frame = -1

Query  608  KMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKL  429
            K+ +    +    A  I  +MAH  D    D  W  R  EA +YA++ Y P PE VT   
Sbjct  5    KLKYSFFFLFIIFATIIRNLMAHIGDF---DEVWRRRAEEAREYARQIYEPNPENVTLAF  61

Query  428  TKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWA  249
             + +   M E R +            NSTRR L  +K+Y+GPC VTNPIDRCWRCD NWA
Sbjct  62   NQKVRDTMKELRQVTVS---------NSTRRGL-GTKKYKGPCMVTNPIDRCWRCDPNWA  111

Query  248  KNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAK  69
             NRK+LA CA+GFG   TGGK G  Y+VT+   DD  EPK GTLR+AVIQ  PLWI F +
Sbjct  112  DNRKRLADCAMGFGYKATGGKDGEIYIVTDN-SDDYAEPKPGTLRYAVIQKEPLWIIFER  170

Query  68   SMTIRLKNELLVTSDKTIDGRG  3
            SMTIRL  E+++ SDKTID RG
Sbjct  171  SMTIRLHQEMIMQSDKTIDARG  192



>ref|XP_007224275.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
 gb|EMJ25474.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
Length=443

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 122/205 (60%), Gaps = 15/205 (7%)
 Frame = -1

Query  617  MHSKMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVT  438
            M    N +I++  + L+ A  +  A +      D YW  R  +A  Y   +Y P P+ VT
Sbjct  1    MAKLFNSYILLFFFFLSFAAIIANAESDQPQQLDEYWKKRAEQAENYTMESYEPNPQRVT  60

Query  437  SKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDR  258
             +    + +++                  N TRR+L   K+Y GPCKVTNPID CWRCD 
Sbjct  61   DEFNAEVGELI---------------MGKNETRRNLKGQKKYVGPCKVTNPIDSCWRCDP  105

Query  257  NWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWIT  78
            NWA NR K+  C  GFG  TTGGK GP YVVT+  D D+V P+ GTLRHAVIQ GPLWIT
Sbjct  106  NWANNRMKIVDCIQGFGRKTTGGKGGPIYVVTDPSDGDLVNPRPGTLRHAVIQKGPLWIT  165

Query  77   FAKSMTIRLKNELLVTSDKTIDGRG  3
            FA++M I+L+ EL+V SDKTIDGRG
Sbjct  166  FARNMVIKLQQELMVASDKTIDGRG  190



>sp|P15722.1|PLY59_SOLLC RecName: Full=Probable pectate lyase P59; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33523.1| P59 protein [Solanum lycopersicum]
Length=449

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 124/202 (61%), Gaps = 12/202 (6%)
 Frame = -1

Query  608  KMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKL  429
            K+ +  + +    A  IP +MAH   +   D  W  R  EA +YA+  Y P+PE VT   
Sbjct  5    KIKYSFLFLCITFATIIPSLMAHIGHY---DEVWRRRAEEAKEYARNIYEPHPENVTLAF  61

Query  428  TKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWA  249
             + +   M E + ++          +NSTRR L  +K+Y GPC VTNPID+CWRCD NWA
Sbjct  62   NQKLRDTMKELKKVKGTH-------NNSTRRGL-GTKKYTGPCMVTNPIDKCWRCDPNWA  113

Query  248  KNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAK  69
             NRKKLA CA+GFG+   GGK G FYVVT+   DD  +PK GTLRHAVIQ  PLWI F +
Sbjct  114  DNRKKLADCAMGFGSKAIGGKDGEFYVVTDN-SDDYNDPKPGTLRHAVIQKEPLWIIFKR  172

Query  68   SMTIRLKNELLVTSDKTIDGRG  3
             M IRL  E+++ SDKTID RG
Sbjct  173  GMNIRLHQEMIMQSDKTIDARG  194



>ref|XP_004165454.1| PREDICTED: pectate lyase-like [Cucumis sativus]
 gb|KGN64253.1| hypothetical protein Csa_1G045510 [Cucumis sativus]
Length=439

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 120/196 (61%), Gaps = 21/196 (11%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            ++M++      P + A+ AD    D  W  R  EA + +  AY P+PE  T+   K + +
Sbjct  13   LLMIFGFVMIFPTLKANIADF---DEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHR  69

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
             ++                 N+TRR L   ++Y GPC  TNPIDRCWRCDRNWA+NRKKL
Sbjct  70   SLDGG---------------NNTRRHL---RKYTGPCLATNPIDRCWRCDRNWARNRKKL  111

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A CALGFG  TTGGK G  YVV +  D+D+V PK GTLRHAVIQ  PLWI FA  M IRL
Sbjct  112  ADCALGFGRRTTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRL  171

Query  50   KNELLVTSDKTIDGRG  3
              EL+VT DKT+DGRG
Sbjct  172  SEELIVTDDKTLDGRG  187



>ref|XP_004152537.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=434

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 120/196 (61%), Gaps = 21/196 (11%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            ++M++      P + A+ AD    D  W  R  EA + +  AY P+PE  T+   K + +
Sbjct  13   LLMIFGFVMIFPTLKANIADF---DEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHR  69

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
             ++                 N+TRR L   ++Y GPC  TNPIDRCWRCDRNWA+NRKKL
Sbjct  70   SLDGG---------------NNTRRHL---RKYTGPCLATNPIDRCWRCDRNWARNRKKL  111

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A CALGFG  TTGGK G  YVV +  D+D+V PK GTLRHAVIQ  PLWI FA  M IRL
Sbjct  112  ADCALGFGRRTTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRL  171

Query  50   KNELLVTSDKTIDGRG  3
              EL+VT DKT+DGRG
Sbjct  172  SEELIVTDDKTLDGRG  187



>ref|XP_007032453.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY03379.1| Pectate lyase family protein [Theobroma cacao]
Length=454

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 131/197 (66%), Gaps = 6/197 (3%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            +V L++ AA IP + A  A+    D  W  R  +A + A  AY P PE VTS L  +++K
Sbjct  8    LVFLFSFAALIPSLWADIAEF---DEVWKQRAEQAWKNALEAYEPMPENVTSNLNYNVNK  64

Query  410  MMNETRlledveydelddEHNSTRRSLMRS-KRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
             + + R  +   ++ +    NSTRR+L  + K+Y GPC  TNPIDRCWRC +NWA+NRK+
Sbjct  65   ALLKGRANKTRAFEGVTT--NSTRRNLRGNHKKYIGPCMATNPIDRCWRCRKNWARNRKQ  122

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA+C LGFG  T GGK+G +Y+VT+  DD+V+ P+ GTLRHAVIQ  PLWI FA  M I+
Sbjct  123  LANCVLGFGHKTEGGKQGGYYLVTDNSDDNVLNPRPGTLRHAVIQKEPLWIIFAHDMNIK  182

Query  53   LKNELLVTSDKTIDGRG  3
            L  EL+V S KTIDGRG
Sbjct  183  LSQELIVQSKKTIDGRG  199



>gb|KHG08055.1| putative pectate lyase P59 [Gossypium arboreum]
 gb|KHG08558.1| putative pectate lyase P59 [Gossypium arboreum]
Length=440

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 128/205 (62%), Gaps = 19/205 (9%)
 Frame = -1

Query  617  MHSKMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVT  438
            M +  N    ++L+  AA IP +  H  ++   D  W  R+ EA +  ++AYNP PE VT
Sbjct  1    MDAAGNRSFKLLLFLFAAIIPALQGHIGEY---DENWKQRELEAKENTEQAYNPNPEEVT  57

Query  437  SKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDR  258
              +   +S+ +                  NSTRR L R+++  GPC  TNPID+CWRCDR
Sbjct  58   QHVNHLVSRSL---------------MGLNSTRRHL-RARKKGGPCDPTNPIDQCWRCDR  101

Query  257  NWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWIT  78
            NW KNR++LA CA+GF  GT GGK G  YVVT+  DDD++ PK GTLRHAVIQ  PLWI 
Sbjct  102  NWEKNRQRLADCAIGFARGTIGGKYGRIYVVTDPSDDDLLNPKPGTLRHAVIQKEPLWII  161

Query  77   FAKSMTIRLKNELLVTSDKTIDGRG  3
            FA++M IRLK EL+++ +KTID RG
Sbjct  162  FARAMIIRLKEELIMSGNKTIDARG  186



>ref|XP_008221658.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=443

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 114/188 (61%), Gaps = 16/188 (9%)
 Frame = -1

Query  566  AAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRll  387
            AAI +  A T      D YW  R  +A  Y   +Y P PE VT +    + +++      
Sbjct  19   AAI-IANAETDQPQELDEYWKKRADQAENYTMESYEPNPERVTDEFNAQVGELI------  71

Query  386  edveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfg  207
                        N TRR+L   K+Y GPC VTNPID CWRCD NWA NR K+  C  GFG
Sbjct  72   ---------MGKNETRRNLKGQKKYVGPCTVTNPIDACWRCDPNWANNRMKIVDCIQGFG  122

Query  206  agttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTS  27
              TTGGK GP YVVT+  D D+V P+ GTLRHAVIQ GPLWITFA++M I+L+ EL+V S
Sbjct  123  RKTTGGKGGPIYVVTDPSDGDLVNPRPGTLRHAVIQKGPLWITFARNMVIKLQQELMVAS  182

Query  26   DKTIDGRG  3
            DKTIDGRG
Sbjct  183  DKTIDGRG  190



>ref|XP_009369346.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=441

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 123/202 (61%), Gaps = 20/202 (10%)
 Frame = -1

Query  608  KMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKL  429
            K+N +I+  ++ +A  IP  +  TA+    D +W  R  EA Q A +AYN  P  VT   
Sbjct  8    KLNVFILC-IFIVAITIPATV--TANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTGSF  64

Query  428  TKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWA  249
             K +    +                 N+TRR+L   ++Y+GPC  TNPIDRCWRCD NW 
Sbjct  65   NKEVHNTFDSM---------------NNTRRNL--KEKYKGPCLATNPIDRCWRCDPNWE  107

Query  248  KNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAK  69
             NRKKLA CA GFG  TTGGK G  YVVT+  D+D+V PK GTLRHAVIQ GPLWI FA 
Sbjct  108  TNRKKLADCAQGFGHKTTGGKAGEIYVVTDNSDNDLVNPKPGTLRHAVIQTGPLWIIFAH  167

Query  68   SMTIRLKNELLVTSDKTIDGRG  3
             M I+L  EL+VTSDKTID RG
Sbjct  168  DMKIKLSEELMVTSDKTIDARG  189



>ref|XP_010496063.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 128/200 (64%), Gaps = 21/200 (11%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
             L  LA   P V AH A     D YW+ RK++A++    +Y+P P  VT+    H++  +
Sbjct  12   FLSLLAIVAPQVGAHVAVF---DSYWMQRKSDALKQTFGSYDPNPLNVTNHFNYHVNLAV  68

Query  404  NETRlledveydelddEHNSTRRSL--MRSKR----YRGPCKVTNPIDRCWRCDRNWAKN  243
            + T  +            N TRR L  +RS+R    + G C   NPID+CWRCDRNWA N
Sbjct  69   DATESI------------NDTRRELTQVRSRRKLQKHGGKCVAYNPIDKCWRCDRNWANN  116

Query  242  RKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSM  63
            RKKLA CALGFG  TTGGK GP YVVT+  D+D++ PK GTLR+AV + GPLWI FA+SM
Sbjct  117  RKKLADCALGFGRKTTGGKDGPIYVVTDASDNDLINPKPGTLRYAVTRDGPLWIIFARSM  176

Query  62   TIRLKNELLVTSDKTIDGRG  3
             I+L+ EL++TSDKTIDGRG
Sbjct  177  IIKLQQELMITSDKTIDGRG  196



>ref|XP_010476496.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 127/200 (64%), Gaps = 21/200 (11%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
             L  LA   P V AH A     D YW+ RK +A++    +Y+P P  VT+    H++  +
Sbjct  12   FLSLLAIVAPQVGAHVAVF---DSYWMQRKTDALKQTFGSYDPNPLNVTNHFNYHVNLAV  68

Query  404  NETRlledveydelddEHNSTRRSL--MRSKR----YRGPCKVTNPIDRCWRCDRNWAKN  243
            + T  +            N TRR L  +RS+R    + G C   NPID+CWRCDRNWA N
Sbjct  69   DATESI------------NDTRRELTQVRSRRKLQKHGGKCVAYNPIDKCWRCDRNWANN  116

Query  242  RKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSM  63
            RKKLA CALGFG  TTGGK GP YVVT+  D+D++ PK GTLR+AV + GPLWI FA+SM
Sbjct  117  RKKLAECALGFGRKTTGGKDGPIYVVTDASDNDLINPKPGTLRYAVTRDGPLWIIFARSM  176

Query  62   TIRLKNELLVTSDKTIDGRG  3
             I+L+ EL++TSDKTIDGRG
Sbjct  177  IIKLQQELMITSDKTIDGRG  196



>ref|XP_002520133.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF42188.1| Pectate lyase precursor, putative [Ricinus communis]
Length=440

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 124/198 (63%), Gaps = 19/198 (10%)
 Frame = -1

Query  596  WIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHI  417
            +  V+  + A   P + A+  D    D YW  +   A + A R+YNP P  V+++L   +
Sbjct  9    FTFVLFASFAVIFPTLHANIGDF---DEYWKQKADIAREAAYRSYNPNPFNVSNQLNYQV  65

Query  416  SKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRK  237
            +K ++ T               NSTRR+LMR K   GPCK TNPIDRCWRCD  WA NRK
Sbjct  66   NKAVSGT---------------NSTRRNLMRRKG-GGPCKATNPIDRCWRCDPKWALNRK  109

Query  236  KLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTI  57
            +L  C LGFG  TTGGK G FY+VT+  D+D+V PK GTLRHAVIQ  PLWI FA+SM I
Sbjct  110  RLVECVLGFGHSTTGGKDGKFYIVTDPSDNDMVNPKPGTLRHAVIQNEPLWIIFARSMII  169

Query  56   RLKNELLVTSDKTIDGRG  3
            RL  EL+++S+KTID RG
Sbjct  170  RLNQELMISSNKTIDARG  187



>gb|EYU22437.1| hypothetical protein MIMGU_mgv1a006496mg [Erythranthe guttata]
Length=442

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 127/198 (64%), Gaps = 20/198 (10%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNT-DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHI  417
            + ++ + +A A+ V +      N T D Y   +  EA Q + +AYNP+PE    +LT+  
Sbjct  8    LSLLFFCIALALAVTLPRAHAQNATMDEYLQKKAEEAYQESLQAYNPHPE----ELTEEF  63

Query  416  SKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRK  237
            ++++ ET               N+TRR L ++    G C  TNPIDRCWRCDRNWAKNRK
Sbjct  64   NELVGET-----------LIGQNATRRQLKQT----GECMATNPIDRCWRCDRNWAKNRK  108

Query  236  KLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTI  57
            KLA CA GFG  TTGGK+G +Y+VT+  D+D+  PK GTLRHAVIQ  PLWI FA SM I
Sbjct  109  KLADCARGFGHQTTGGKKGRYYLVTDPSDNDMDHPKPGTLRHAVIQTEPLWIIFAHSMVI  168

Query  56   RLKNELLVTSDKTIDGRG  3
            RLK EL+ TSDKT+DGRG
Sbjct  169  RLKQELIFTSDKTVDGRG  186



>ref|XP_008374522.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=441

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 119/197 (60%), Gaps = 19/197 (10%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
             ++ ++ +A  IP  +  TA+    D +W  R  EA Q A +AYN  P  VT    K + 
Sbjct  12   FILCIFIVAITIPATV--TANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTGSFNKEVH  69

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
               +                 N+TRR+L   ++Y+GPC  TNPIDRCWRCD NW  NRKK
Sbjct  70   NTFDSM---------------NNTRRNL--KEKYKGPCVATNPIDRCWRCDPNWETNRKK  112

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA CA GFG  TTGGK G  YVVT+  D+D+V PK GTLRHAVIQ GPLWI FA  M I+
Sbjct  113  LADCAKGFGHKTTGGKAGEIYVVTDNSDNDLVNPKPGTLRHAVIQTGPLWIIFAHDMKIK  172

Query  53   LKNELLVTSDKTIDGRG  3
            L  EL+VTSDKTID RG
Sbjct  173  LSEELMVTSDKTIDARG  189



>ref|XP_010112093.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXC32626.1| putative pectate lyase 7 [Morus notabilis]
Length=437

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 118/196 (60%), Gaps = 21/196 (11%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            +V L      IP + A+  D + +   W  R  EA + A  AY+P PE VT    + + K
Sbjct  9    LVFLIGFVVLIPSLQANIGDFDES---WQQRAEEAHKAALEAYDPNPEEVTDSFNEEVDK  65

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
            +++ +               NSTRR L   +RY GPC  TNPIDRCWRC  NWA NRK+L
Sbjct  66   VIDGS---------------NSTRREL---RRYSGPCAATNPIDRCWRCRSNWASNRKRL  107

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A C LGFG  TTGG+ G +YVVT+  D+DV  P+ GTLRHAVIQ  PLWI FA SM IRL
Sbjct  108  ARCVLGFGRKTTGGRSGRYYVVTDPSDNDVQNPRPGTLRHAVIQKQPLWIIFAHSMIIRL  167

Query  50   KNELLVTSDKTIDGRG  3
              ELL+TS KTID RG
Sbjct  168  SQELLITSHKTIDARG  183



>ref|XP_006354795.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=435

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 116/184 (63%), Gaps = 18/184 (10%)
 Frame = -1

Query  554  VVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledve  375
            +V +  A+    D  W TR  +A + AK +YNP+PE V + L KH+ +    +       
Sbjct  17   LVFSIEANIGEFDEVWRTRATQANKNAKESYNPHPEKVAANLNKHVHRSEEGS-------  69

Query  374  ydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagtt  195
                    NSTRR L    +Y GPC  TNPIDRCWRCD +WAKNR+KLA C LGFG  TT
Sbjct  70   --------NSTRRDL---HKYNGPCVATNPIDRCWRCDPHWAKNRQKLADCVLGFGHHTT  118

Query  194  ggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTI  15
            GGK G  Y+VT+  D+D+V PK GTLRHAVIQ GPLWI FA  M I+L  EL++T DKTI
Sbjct  119  GGKGGKIYIVTDPGDNDMVNPKPGTLRHAVIQPGPLWIIFAHHMVIKLNQELIMTGDKTI  178

Query  14   DGRG  3
            D RG
Sbjct  179  DARG  182



>ref|XP_010256490.1| PREDICTED: pectate lyase-like [Nelumbo nucifera]
Length=441

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 121/197 (61%), Gaps = 19/197 (10%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            + ++ + LA   P + AH A+    D  W  R  EA + A  AY+P P+ V + L  ++ 
Sbjct  10   LFLLAFNLAVITPTLRAHIAEF---DEVWQKRAEEAKKNAMDAYHPNPDEVINHLNMNVH  66

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
              M E+               N TRRSL ++K Y GPC  TNPIDRCWRC +NW++NRKK
Sbjct  67   LAMQES---------------NGTRRSL-KTKPYGGPCLATNPIDRCWRCQKNWSRNRKK  110

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA C +GFG  T GGK G FYVVT+  D+D++ PK GTLRHAVIQ  PLWI FA+ M IR
Sbjct  111  LADCVVGFGRKTIGGKLGKFYVVTDGSDNDMLNPKPGTLRHAVIQKEPLWIIFARDMVIR  170

Query  53   LKNELLVTSDKTIDGRG  3
            L  ELL+  DKTID RG
Sbjct  171  LNQELLMAGDKTIDARG  187



>ref|XP_002323835.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
 gb|EEF03968.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
Length=452

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 123/197 (62%), Gaps = 6/197 (3%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            ++    LA  IP ++A  A     D  W  R  EA +    +Y P PE  T      ++ 
Sbjct  8    LIFAITLATLIPGLLADIAFF---DEVWQKRAEEAKKVTLNSYIPNPEDATDDFNFEVNN  64

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKR-YRGPCKVTNPIDRCWRCDRNWAKNRKK  234
             + +     +    EL    NSTRR+L + K+ Y GPCKVTNPID+CWRC RNWA+NRK+
Sbjct  65   TLVDFDDDRNDAGFELHA--NSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRKR  122

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA CALGFG   TGG +G  YVVT   DDDV+ PK GTLRHAVIQ GPLWI F+K+M IR
Sbjct  123  LAKCALGFGRRATGGLKGRVYVVTENSDDDVMNPKPGTLRHAVIQKGPLWIIFSKNMNIR  182

Query  53   LKNELLVTSDKTIDGRG  3
            L  EL++TS KTIDGRG
Sbjct  183  LSKELIMTSHKTIDGRG  199



>emb|CAN79927.1| hypothetical protein VITISV_042447 [Vitis vinifera]
Length=439

 Score =   166 bits (419),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 117/185 (63%), Gaps = 21/185 (11%)
 Frame = -1

Query  557  PVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledv  378
            P + AH  +    D  W  R  EA + A  AY P PE VT++  K++ K M  T      
Sbjct  22   PSIRAHIGEF---DEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQGT------  72

Query  377  eydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagt  198
                     N+TRR+L   +   GPC  TNPIDRCWRC ++WAKNRKKLA C LGFG  T
Sbjct  73   ---------NTTRRNL---RSNNGPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRT  120

Query  197  tggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKT  18
            TGGK G FYVVT+  D+D+++PK GTLRHAVIQ  PLWI FA+ M IRLK EL++  +KT
Sbjct  121  TGGKDGEFYVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKT  180

Query  17   IDGRG  3
            IDGRG
Sbjct  181  IDGRG  185



>ref|XP_002892805.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69064.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 131/215 (61%), Gaps = 22/215 (10%)
 Frame = -1

Query  626  MEGMHSKMNWWIVVMLYA-LAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP  450
            M  +   +  ++ V   + LA   P V A+ A     D YW  R+++A++    +Y+P P
Sbjct  1    MAAVFLNLGGYVFVFFSSFLAIVAPQVRANVAVF---DSYWTQRQSDALKQTMGSYDPNP  57

Query  449  ELVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLM------RSKRYRGPCKVTN  288
              VT+    H++  ++ +              +N TRR L       ++K++ G C   N
Sbjct  58   INVTNHFNYHVNIAVDVSES------------NNDTRRELTQVRSGRKTKKHSGKCLAYN  105

Query  287  PIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHA  108
            PID+CWRCDRNWAKNRKKLA C LGFG  TTGGK GP YVV +  DDD++ PK GTLRHA
Sbjct  106  PIDKCWRCDRNWAKNRKKLADCVLGFGRRTTGGKDGPIYVVKDASDDDLINPKPGTLRHA  165

Query  107  VIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            V + GPLWI FA+SM I+L+ EL++TSDKTIDGRG
Sbjct  166  VTRNGPLWIIFARSMIIKLQQELMITSDKTIDGRG  200



>ref|XP_002282500.3| PREDICTED: pectate lyase [Vitis vinifera]
Length=443

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 117/185 (63%), Gaps = 21/185 (11%)
 Frame = -1

Query  557  PVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledv  378
            P + AH  +    D  W  R  EA + A  AY P PE VT++  K++ K M  T      
Sbjct  26   PSIRAHIGEF---DEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQGT------  76

Query  377  eydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagt  198
                     N+TRR+L   +   GPC  TNPIDRCWRC ++WAKNRKKLA C LGFG  T
Sbjct  77   ---------NTTRRNL---RSNNGPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRT  124

Query  197  tggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKT  18
            TGGK G FYVVT+  D+D+++PK GTLRHAVIQ  PLWI FA+ M IRLK EL++  +KT
Sbjct  125  TGGKDGEFYVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKT  184

Query  17   IDGRG  3
            IDGRG
Sbjct  185  IDGRG  189



>ref|XP_009117903.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=452

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 124/196 (63%), Gaps = 17/196 (9%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
            +++ LA  +P V ++ A  +N   YW  R+ +A++    +Y+P P  VT  L  H++  +
Sbjct  13   LVFLLAILVPHVQSNVAVFDN---YWTQRQGDALKQTIASYDPNPLNVTDHLNYHVALAV  69

Query  404  NETRlledveydelddEHNSTRRSLM--RSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
            + T               N+TRR L+  +++   G C   NPID+CWRCD NW KNRKKL
Sbjct  70   DATEST------------NNTRRELIGRKTQEGSGKCIAYNPIDKCWRCDPNWEKNRKKL  117

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A C LGFG  TTGGK GP YVV +  DDD+V PK GTLRHAV + GPLWI FA SM I+L
Sbjct  118  AECVLGFGRKTTGGKDGPIYVVNDSSDDDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKL  177

Query  50   KNELLVTSDKTIDGRG  3
            + EL++TS+KTIDGRG
Sbjct  178  QQELMITSNKTIDGRG  193



>emb|CDY53552.1| BnaA09g57110D [Brassica napus]
Length=495

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 124/196 (63%), Gaps = 17/196 (9%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
            +++ LA  +P V A+ A  +N   YW  R+ +A++    +Y+P P  VT  L  H++  +
Sbjct  13   LVFLLAILVPHVQANVAVFDN---YWTQRQGDALKQTIASYDPNPLNVTDHLNYHVALAV  69

Query  404  NETRlledveydelddEHNSTRRSLM--RSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
            + T               N+TRR L+  +++   G C   NPID+CWRCD NW KNRKKL
Sbjct  70   DATEST------------NNTRRELIGRKTQEGSGKCIAHNPIDKCWRCDPNWEKNRKKL  117

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A C LGFG  TTGGK GP YVV +  DDD+V PK GTLRHAV + GPLWI FA SM I+L
Sbjct  118  AECVLGFGRKTTGGKDGPIYVVNDSSDDDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKL  177

Query  50   KNELLVTSDKTIDGRG  3
            + EL++TS+KTIDGRG
Sbjct  178  QQELMITSNKTIDGRG  193



>ref|XP_006374492.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
 gb|ERP52289.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
Length=435

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 126/198 (64%), Gaps = 21/198 (11%)
 Frame = -1

Query  596  WIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHI  417
            +++++ +ALA     + A  A   N D YW  R  EA + ++ AY P P    +K+TKH 
Sbjct  7    YMLLVFFALAMQTSTLKAGIA---NFDEYWKKRAEEAKEASREAYEPNP----AKVTKHF  59

Query  416  SKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRK  237
            +  ++++            +  NSTRR+L ++K   GPC  TNPIDRCWRCD+NWAKNRK
Sbjct  60   NDEVHKS-----------LEGGNSTRRNLGKNK---GPCLATNPIDRCWRCDKNWAKNRK  105

Query  236  KLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTI  57
            KL  CALGFG  T GGK G +Y VT+  D+D+V PK GTLR+ VIQ  PLWI FA  M I
Sbjct  106  KLGGCALGFGRKTIGGKHGKYYRVTDPSDNDMVNPKAGTLRYGVIQDKPLWIIFAHDMVI  165

Query  56   RLKNELLVTSDKTIDGRG  3
            RL  EL+V S+KTIDGRG
Sbjct  166  RLSEELMVASNKTIDGRG  183



>ref|XP_010322971.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=302

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 113/176 (64%), Gaps = 7/176 (4%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM----NETRlledveydelddEH  351
            D  W TR  +A + AK +YNP PE V +   KH+ + +    ++      +     ++  
Sbjct  29   DEVWRTRATQANKNAKESYNPNPEKVAANFNKHVHRQVFSWYSQPSHFHLILICRSEEGS  88

Query  350  NSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFY  171
            NSTRR L    +Y GPC  TNPIDRCWRCD +WAKNR+KLA C LGFG  TTGGK G  Y
Sbjct  89   NSTRRDL---HKYNGPCVATNPIDRCWRCDPHWAKNRQKLADCVLGFGHHTTGGKGGKIY  145

Query  170  VVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
             VT+  D D+V PK+GTLRHAVIQ GPLWI FA  M I+L  EL++T DKTID RG
Sbjct  146  EVTDPGDTDMVNPKQGTLRHAVIQPGPLWIIFAHHMVIKLNQELIMTGDKTIDARG  201



>ref|XP_009587689.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=447

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 119/203 (59%), Gaps = 14/203 (7%)
 Frame = -1

Query  611  SKMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSK  432
            SK+     V+ +  AA IP  +AH  +    D  W  R  EA + A + Y   PE VT  
Sbjct  4    SKVTHSFFVLFFIFAAIIPSFLAHIGEF---DEVWRRRAEEARKVALQTYESEPENVTLA  60

Query  431  LTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNW  252
              K +   M E   +            N TRR L  +K+Y GPC VTNPID+CWRCD NW
Sbjct  61   FNKQVRDAMKELSEVIPK---------NDTRREL-GTKKYTGPCMVTNPIDKCWRCDPNW  110

Query  251  AKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFA  72
            A NRKKLA CA+GFG+  TGGK G FYVV N   DD  +PK GTLRHAVIQ  PLWI F 
Sbjct  111  ADNRKKLADCAMGFGSKATGGKAGRFYVV-NDPSDDYTDPKPGTLRHAVIQKEPLWIIFD  169

Query  71   KSMTIRLKNELLVTSDKTIDGRG  3
            + MTIRL  EL++ SDKTID RG
Sbjct  170  RGMTIRLHQELIMQSDKTIDARG  192



>gb|AES91206.2| pectate lyase P59-like protein [Medicago truncatula]
Length=434

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 120/194 (62%), Gaps = 18/194 (9%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
            +L+     + +V    A+  + D YW  R  +A + A++AY P P+ +TS L  H+ K +
Sbjct  8    LLFGCVFFLAIVPIFEANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVHKAL  67

Query  404  NETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLAS  225
            + +               NSTRR L +   Y+GPC  TNPID CWRCD NW KNRKKLA 
Sbjct  68   SGS---------------NSTRRELAK---YKGPCSATNPIDSCWRCDPNWEKNRKKLAD  109

Query  224  CALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKN  45
            C LGFG GTTGGK G  YVVT+  D+D+V PK GTLR A IQ  PLWI F  +M I+LK 
Sbjct  110  CVLGFGHGTTGGKAGKIYVVTDSSDNDLVTPKPGTLRFAAIQKEPLWIIFKHNMNIKLKA  169

Query  44   ELLVTSDKTIDGRG  3
            ELL+TSDKTID RG
Sbjct  170  ELLLTSDKTIDARG  183



>ref|XP_003609009.1| Pectate lyase [Medicago truncatula]
Length=445

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 120/194 (62%), Gaps = 18/194 (9%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
            +L+     + +V    A+  + D YW  R  +A + A++AY P P+ +TS L  H+ K +
Sbjct  8    LLFGCVFFLAIVPIFEANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVHKAL  67

Query  404  NETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLAS  225
            + +               NSTRR L +   Y+GPC  TNPID CWRCD NW KNRKKLA 
Sbjct  68   SGS---------------NSTRRELAK---YKGPCSATNPIDSCWRCDPNWEKNRKKLAD  109

Query  224  CALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKN  45
            C LGFG GTTGGK G  YVVT+  D+D+V PK GTLR A IQ  PLWI F  +M I+LK 
Sbjct  110  CVLGFGHGTTGGKAGKIYVVTDSSDNDLVTPKPGTLRFAAIQKEPLWIIFKHNMNIKLKA  169

Query  44   ELLVTSDKTIDGRG  3
            ELL+TSDKTID RG
Sbjct  170  ELLLTSDKTIDARG  183



>emb|CBI22159.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 117/185 (63%), Gaps = 21/185 (11%)
 Frame = -1

Query  557  PVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledv  378
            P + AH  +    D  W  R  EA + A  AY P PE VT++  K++ K M  T      
Sbjct  51   PSIRAHIGEF---DEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQGT------  101

Query  377  eydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagt  198
                     N+TRR+L   +   GPC  TNPIDRCWRC ++WAKNRKKLA C LGFG  T
Sbjct  102  ---------NTTRRNL---RSNNGPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRT  149

Query  197  tggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKT  18
            TGGK G FYVVT+  D+D+++PK GTLRHAVIQ  PLWI FA+ M IRLK EL++  +KT
Sbjct  150  TGGKDGEFYVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKT  209

Query  17   IDGRG  3
            IDGRG
Sbjct  210  IDGRG  214



>emb|CDP14850.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 122/196 (62%), Gaps = 21/196 (11%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            +++ +AL A +  + AH A+    D  W  R  EA + A++AY+P PE VTS   + + +
Sbjct  8    LILAFALIALVYTIEAHIAE---FDEVWQKRAEEAKKAARQAYHPNPENVTSHFNEEVHR  64

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
             ++                HNS RR L    +Y GPC  TNPID+CWRC +NW KNR KL
Sbjct  65   SID---------------GHNSRRRDL---HKYNGPCTATNPIDQCWRCQKNWRKNRMKL  106

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A CALGFG   TGGK G  Y VT+  D+D+V PK GTLRHA+IQ  PLW+ F K+M IRL
Sbjct  107  ADCALGFGRHATGGKGGRIYKVTDPSDNDLVNPKPGTLRHALIQPEPLWVIFTKNMVIRL  166

Query  50   KNELLVTSDKTIDGRG  3
              EL++TS+KTIDGRG
Sbjct  167  SQELIMTSNKTIDGRG  182



>ref|XP_011098575.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=449

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 118/197 (60%), Gaps = 14/197 (7%)
 Frame = -1

Query  590  VVMLYALAAAIP-VVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            V+ L+A A+ +P  V AH A+    D  W  R  EA      +Y P P  + S L  ++ 
Sbjct  10   VLFLFAFASTLPGAVRAHIAEF---DEVWQRRAEEAWNRTLESYEPAPAKIVSHLNLNVH  66

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
            + + E +  E           NSTRR L  S  Y GPC+VTNPIDRCWRC  NWA+NR +
Sbjct  67   RALKEVKEEELSL--------NSTRRQL--SHGYDGPCRVTNPIDRCWRCQANWAQNRFR  116

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA C LGFG    GGK G  YVVT+  D+D+V PK GTLRHAVIQ  PLWI F + M IR
Sbjct  117  LADCVLGFGYKAKGGKNGKIYVVTDPSDNDMVNPKPGTLRHAVIQKEPLWIIFQRDMLIR  176

Query  53   LKNELLVTSDKTIDGRG  3
            L  EL+V SDKTIDGRG
Sbjct  177  LSQELIVQSDKTIDGRG  193



>ref|XP_002311599.2| pectate lyase family protein [Populus trichocarpa]
 gb|EEE88966.2| pectate lyase family protein [Populus trichocarpa]
Length=441

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 122/194 (63%), Gaps = 20/194 (10%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
            +  +LAA +P +  H  +    D YW  +  EA++ A+ A+ P P  VT++    ++K+M
Sbjct  13   LFVSLAAFVPTLQGHIGEF---DEYWKKKADEALKAAQEAFYPDPMNVTNQFNFQVNKVM  69

Query  404  NETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLAS  225
             ET               NSTRRSL+ SKR  G C  TNPIDRCWRCD NWA +R+KLA 
Sbjct  70   TET---------------NSTRRSLV-SKR-GGRCMATNPIDRCWRCDPNWASHRQKLAD  112

Query  224  CALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKN  45
            C LGFG  T GGK G  YVVT+  D+D++ PK GTLRHAVIQ  PLWI F+ SM IRL  
Sbjct  113  CVLGFGHKTVGGKYGKIYVVTDASDNDMLNPKPGTLRHAVIQKEPLWIIFSGSMVIRLNQ  172

Query  44   ELLVTSDKTIDGRG  3
            EL+V S+KTID RG
Sbjct  173  ELMVASNKTIDSRG  186



>ref|XP_010105747.1| putative pectate lyase P59 [Morus notabilis]
 gb|EXC05967.1| putative pectate lyase P59 [Morus notabilis]
Length=421

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 116/182 (64%), Gaps = 19/182 (10%)
 Frame = -1

Query  545  AHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveyde  366
            AH A+    D YW +R  +A + A +AY+P+PE VT++L   + + +             
Sbjct  4    AHIAEF---DDYWKSRAEQAQKDALQAYHPHPEEVTNQLNYDVEEALT------------  48

Query  365  lddEHNSTRRSLMRSKRYRG-PCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttgg  189
                 NSTRR L   K  +G PC  TNPIDRCWRCD NWA NRK+LA CA GFG  + GG
Sbjct  49   ---VKNSTRRVLRGKKNKKGGPCMATNPIDRCWRCDPNWASNRKRLADCARGFGRNSVGG  105

Query  188  krGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDG  9
            K G +YVVT+  D D+V PK GTLRHAVIQ  PLWI FA+SM IRL  EL++T DKTIDG
Sbjct  106  KFGRYYVVTDSSDTDLVNPKPGTLRHAVIQKAPLWIIFARSMIIRLSEELIMTGDKTIDG  165

Query  8    RG  3
            RG
Sbjct  166  RG  167



>ref|XP_010527872.1| PREDICTED: probable pectate lyase 3 isoform X2 [Tarenaya hassleriana]
Length=461

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 128/207 (62%), Gaps = 24/207 (12%)
 Frame = -1

Query  590  VVMLYALAA-AIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            +V+L+A+++ A   V  H A     D YW  R+ +A++   R Y+P P  VT     H++
Sbjct  9    LVILFAISSWASSSVRGHVAVF---DEYWTQRQDKALRQTLRFYDPNPFNVTDHFNYHVN  65

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYRGP----------CKVTNPIDRCWRC  264
              + ET          +   +N TRR L++  + RG           C   NPIDRCWRC
Sbjct  66   LAVEET----------MKTGNNGTRRELLQVGQSRGQHPKRRNLGGKCVAYNPIDRCWRC  115

Query  263  DRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLW  84
            D  W+KNRKKLA CALGFG  TTGGK GP+YVVT+  DDD++ PK GTLRHAV +  PLW
Sbjct  116  DPGWSKNRKKLADCALGFGRKTTGGKAGPYYVVTDASDDDLLNPKAGTLRHAVTREEPLW  175

Query  83   ITFAKSMTIRLKNELLVTSDKTIDGRG  3
            I FAKSM I+L+ EL++TSDKTIDGRG
Sbjct  176  IVFAKSMVIKLQQELIMTSDKTIDGRG  202



>ref|XP_002270089.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32015.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 116/189 (61%), Gaps = 21/189 (11%)
 Frame = -1

Query  569  AAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRl  390
            A   P + AH A++   D YW  R+ EA + A  A++P P+ V      H+   +  +  
Sbjct  18   AVIAPTIRAHIAEY---DDYWKEREEEAKKAALEAFHPTPQEVNDHFNLHVEDELTGS--  72

Query  389  ledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgf  210
                         N TRRSL  +K   GPCK TNPIDRCWRC  NWA  RK+LA C LGF
Sbjct  73   -------------NGTRRSLRVNK---GPCKATNPIDRCWRCRPNWASQRKRLADCVLGF  116

Query  209  gagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVT  30
            G  T GGK G +Y VT+  D+D+V PK+GTLRHAVIQ  PLWI FA+SM IRL  EL++T
Sbjct  117  GRNTVGGKYGKYYFVTDPSDNDMVNPKKGTLRHAVIQPRPLWIVFARSMIIRLNQELIMT  176

Query  29   SDKTIDGRG  3
            SDKTIDGRG
Sbjct  177  SDKTIDGRG  185



>ref|XP_009598230.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=434

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 115/186 (62%), Gaps = 18/186 (10%)
 Frame = -1

Query  560  IPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlled  381
            + +V++  A+ +  D  W TR  +A + A+ +YNP+PE V   L KH+ K    +     
Sbjct  14   VTLVLSIEANISEFDEVWQTRATQAKKTAQDSYNPHPETVADNLNKHVHKWEEGS-----  68

Query  380  veydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgag  201
                      NSTRR L    +Y GPC  TNPIDRCWRCD NW KNR KLA C LGFG  
Sbjct  69   ----------NSTRRDL---HKYDGPCMSTNPIDRCWRCDPNWVKNRMKLADCVLGFGHH  115

Query  200  ttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDK  21
            TTGGK G  YVVT+  DDD+V PK GTLRHAVIQ  PLWI F   M IRL  EL++TS+K
Sbjct  116  TTGGKGGKIYVVTDPSDDDMVNPKPGTLRHAVIQPEPLWIIFKHHMVIRLNQELIMTSNK  175

Query  20   TIDGRG  3
            TID RG
Sbjct  176  TIDARG  181



>gb|AAQ62997.1| oil palm polygalacturonase allergen PEST411 [Elaeis guineensis]
Length=447

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 129/210 (61%), Gaps = 21/210 (10%)
 Frame = -1

Query  626  MEGMHSKMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPE  447
            MEG+ +K ++++  +++  +AA+       AD    D +W  +  EA+  ++ AY+P PE
Sbjct  1    MEGVRTKPSFFLCSLIFLASAALS-----GADIPELDDHWQKKAEEALARSRAAYHPDPE  55

Query  446  LVTSKLTKHISKMMNETRlledveydelddEHNSTRRSL--MRSKRYRGPCKVTNPIDRC  273
             VT+   K +   + E R              NSTRRSL  +  K+++G C  TNPIDRC
Sbjct  56   AVTNHFNKAVHLALAEAR--------------NSTRRSLRAVGVKKFKGKCVATNPIDRC  101

Query  272  WRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAG  93
            WRC +NW K+RKKLA+C  GFG   TGGK G FYVVT+  DDD+V PK GTLR  VIQ  
Sbjct  102  WRCQKNWIKHRKKLATCGKGFGRHATGGKAGDFYVVTDPSDDDLVNPKFGTLRWGVIQDR  161

Query  92   PLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            PLWI FA+ M IRL  EL++ S+KTID RG
Sbjct  162  PLWIVFARDMIIRLSEELMINSNKTIDARG  191



>ref|XP_002511525.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF52127.1| Pectate lyase precursor, putative [Ricinus communis]
Length=433

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 121/198 (61%), Gaps = 21/198 (11%)
 Frame = -1

Query  596  WIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHI  417
            +I +++ A A  IP + A+ A   + D  W  R  EA   A +AY+P PE + +   K +
Sbjct  6    YIKLLVIAFATIIPTLKANIA---HFDKVWQQRAKEASHAALQAYHPNPEDIVNHFNKEV  62

Query  416  SKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRK  237
            +K +N+                +ST   L + KR   PC  TNPIDRCWRCD NWA NRK
Sbjct  63   AKSLND---------------FSSTSSQLSQHKR---PCHATNPIDRCWRCDANWASNRK  104

Query  236  KLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTI  57
            KLA CALGFG  TTGGK G +YVVT+  DDD+V P+ GTLR+ VIQ  PLWITFA  M I
Sbjct  105  KLAGCALGFGRMTTGGKDGDYYVVTDPSDDDLVNPREGTLRYGVIQDRPLWITFAGDMVI  164

Query  56   RLKNELLVTSDKTIDGRG  3
             L  EL++ S+KTIDGRG
Sbjct  165  TLSQELIINSNKTIDGRG  182



>ref|XP_009789921.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 118/205 (58%), Gaps = 19/205 (9%)
 Frame = -1

Query  617  MHSKMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVT  438
            MHS       V+ +   A IP  +AH  +    D  W  R  EA + A + Y   PE VT
Sbjct  7    MHS-----FFVLFFIFTAIIPSFLAHIGEF---DEVWRRRAEEARKVALQTYESEPENVT  58

Query  437  SKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDR  258
                K +   M E   +            N TRR L  +K+Y GPC VTNPID+CWRCD 
Sbjct  59   LAFNKQVRDAMKELSEVIPK---------NDTRREL-GTKKYTGPCMVTNPIDKCWRCDP  108

Query  257  NWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWIT  78
            NWA NRKKLA CA+GFG+  TGGK G FYVV N   DD  +PK GTLRHAVIQ  PLWI 
Sbjct  109  NWADNRKKLADCAMGFGSKATGGKAGRFYVV-NDSSDDYTDPKPGTLRHAVIQKEPLWII  167

Query  77   FAKSMTIRLKNELLVTSDKTIDGRG  3
            F + MTIRL  EL++ SDKTID RG
Sbjct  168  FDRGMTIRLHQELIMQSDKTIDARG  192



>ref|XP_011005067.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=452

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 122/197 (62%), Gaps = 6/197 (3%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            ++    LA  IP ++A  A     D  W  R  EA +    +Y P PE  T      ++ 
Sbjct  8    LIFAITLATLIPALLADIAFF---DEVWQKRAEEAKKVTLNSYVPNPEDATDDFNFEVNN  64

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKR-YRGPCKVTNPIDRCWRCDRNWAKNRKK  234
             + +     +    EL    NSTRR+L + K+ Y GPCKVTNPID+CWRC RNWA+NRK+
Sbjct  65   TLVDFDDDGNDAGFELLA--NSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRKR  122

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA CALGFG   TGG +G  YVVT   DDDV+ PK GTLRHAVIQ  PLWI F+K+M IR
Sbjct  123  LAKCALGFGRRATGGLKGRVYVVTENSDDDVMNPKPGTLRHAVIQKEPLWIIFSKNMNIR  182

Query  53   LKNELLVTSDKTIDGRG  3
            L  EL++TS KTIDGRG
Sbjct  183  LSKELIMTSHKTIDGRG  199



>ref|XP_010925369.1| PREDICTED: pectate lyase [Elaeis guineensis]
Length=444

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 129/210 (61%), Gaps = 21/210 (10%)
 Frame = -1

Query  626  MEGMHSKMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPE  447
            MEG+ +K ++++  +++  +AA+       AD    D +W  +  EA+  ++ AY+P PE
Sbjct  1    MEGVRTKPSFFLCSLIFLASAALS-----GADIPELDDHWQKKAEEALARSRAAYHPDPE  55

Query  446  LVTSKLTKHISKMMNETRlledveydelddEHNSTRRSL--MRSKRYRGPCKVTNPIDRC  273
             VT+   K +   + E R              NSTRRSL  +  K+++G C  TNPIDRC
Sbjct  56   AVTNHFNKAVHLALAEAR--------------NSTRRSLRAVGVKKFKGKCVATNPIDRC  101

Query  272  WRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAG  93
            WRC +NW K+RKKLA+C  GFG   TGGK G FYVVT+  DDD+V PK GTLR  VIQ  
Sbjct  102  WRCQKNWIKHRKKLATCGKGFGRHATGGKAGDFYVVTDPSDDDLVNPKFGTLRWGVIQDR  161

Query  92   PLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            PLWI FA+ M IRL  EL++ S+KTID RG
Sbjct  162  PLWIVFARDMIIRLSEELMINSNKTIDARG  191



>gb|EYU34111.1| hypothetical protein MIMGU_mgv1a006386mg [Erythranthe guttata]
Length=446

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 119/197 (60%), Gaps = 13/197 (7%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            ++ +L A A+A+P + A+ AD ++   YW+ R  +A     ++Y  +P  + S L  H  
Sbjct  7    LLFLLIAFASALPSISANFADFDD---YWLKRSVQAWNNTLQSYESHPAKIVSHLNLHSK  63

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
            + + E + +  V         NS+RR L     Y GPC  TNPIDRCWRC  NWA NR +
Sbjct  64   RALKEIKDINLVS--------NSSRRQLAHG--YEGPCMATNPIDRCWRCQANWADNRFR  113

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA C LGFG    GGK G  YVV +  D D+V PK GTLRHAVIQ  PLWI F++SM IR
Sbjct  114  LADCGLGFGYKAKGGKGGRIYVVNDSSDGDMVNPKPGTLRHAVIQTEPLWIIFSRSMVIR  173

Query  53   LKNELLVTSDKTIDGRG  3
            L  EL++ SDKTIDGRG
Sbjct  174  LSQELIMQSDKTIDGRG  190



>ref|XP_006361835.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=447

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 124/202 (61%), Gaps = 14/202 (7%)
 Frame = -1

Query  608  KMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKL  429
            K+ +  + +    A  IP +MAH   +   D  W  R  EA +YA++ Y  +PE VT   
Sbjct  5    KIKYTFLFLCITFATIIPSLMAHIGHY---DEVWRRRAEEAKEYARQIYERHPENVTLAF  61

Query  428  TKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWA  249
             + +   M E + ++           NSTRR L  +K+Y GPC VTNPIDRCWRCD NWA
Sbjct  62   NQKLRNTMKELKEVKGT---------NSTRRGL-GTKKYCGPCIVTNPIDRCWRCDPNWA  111

Query  248  KNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAK  69
             NRK+LA CA+GFG+  TGGK G FYVVT+   DD  +PK GTLR+AVIQ  PLWI F +
Sbjct  112  DNRKRLADCAMGFGSKVTGGKNGEFYVVTDN-SDDYNDPKPGTLRYAVIQKEPLWIIFKR  170

Query  68   SMTIRLKNELLVTSDKTIDGRG  3
             M IRL  E+++ SDKTID RG
Sbjct  171  GMNIRLHQEMIMQSDKTIDARG  192



>ref|XP_009617495.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=451

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 118/197 (60%), Gaps = 12/197 (6%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            + +     A IP +  H  D    D  W  R  EA ++A +AY P P  VT    K   +
Sbjct  11   LFLFSTFLAIIPSLNGHIGDF---DEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQTKE  67

Query  410  MMNETRlledveydelddEHNSTRRSLMR-SKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
             M E + ++ +         N TRR L    K Y GPC VTNPIDRCWRC  NWA NRK+
Sbjct  68   SMKELKEVKKLAT-------NDTRRELRGFHKNYAGPCLVTNPIDRCWRCQGNWADNRKR  120

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA CALGFG GTTGGK G FYVVT+   DD   PK GTLRHAVIQ  PLWI FAKSM IR
Sbjct  121  LADCALGFGKGTTGGKAGRFYVVTDS-SDDSSNPKPGTLRHAVIQKEPLWIIFAKSMNIR  179

Query  53   LKNELLVTSDKTIDGRG  3
            L  EL++ SDKTIDGRG
Sbjct  180  LHQELIMQSDKTIDGRG  196



>ref|XP_009802165.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=451

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 118/197 (60%), Gaps = 12/197 (6%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            + +     A IP +  H     N D  W  R  EA ++A +AY P P  VT    K   +
Sbjct  11   LFLFSTFLAIIPSLNGHIG---NFDEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQTRE  67

Query  410  MMNETRlledveydelddEHNSTRRSLMR-SKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
             M E + +  +         N TRR L    K Y GPC VTNPIDRCWRC  NWA NRK+
Sbjct  68   SMKELKEVNKLST-------NETRRELRGFHKIYAGPCLVTNPIDRCWRCQGNWADNRKR  120

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA CA+GFG GTTGGK G FYVVT+   DD   PK GTLRHAVIQ  PLWI FAKSMTIR
Sbjct  121  LADCAMGFGKGTTGGKAGQFYVVTDS-SDDSSNPKPGTLRHAVIQKEPLWIIFAKSMTIR  179

Query  53   LKNELLVTSDKTIDGRG  3
            L  EL++ SDKTIDGRG
Sbjct  180  LHQELIMQSDKTIDGRG  196



>ref|XP_008341537.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=454

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 127/211 (60%), Gaps = 17/211 (8%)
 Frame = -1

Query  617  MHSKMNWWIVVMLYALAAAIPVVMAHTADHNNT------DIYWVTRKAEAMQYAKRAYNP  456
            M SK+N  + +++ +    +P + A T   N+T      D  W  R  +A + A +AY P
Sbjct  1    MASKLN--LALLMISFCMLVPSLKAET--QNDTLNIAEFDSVWQQRALKAQKAALKAYQP  56

Query  455  YPELVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDR  276
             PE VT    + +   + E    +D          NST R L+  KRY GPCK TNPIDR
Sbjct  57   NPEQVTEDFNESVEMTIIEDDHDDDHAAG------NSTGRHLL-GKRYTGPCKATNPIDR  109

Query  275  CWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQA  96
            CWRC  NWA NRK LASC  GFG  T GGK+G +Y+VT+  DD++ +PK GTLRHAVIQ 
Sbjct  110  CWRCQANWADNRKHLASCVKGFGRKTRGGKKGAYYIVTDSSDDNIHDPKPGTLRHAVIQK  169

Query  95   GPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
             PLWI FA+SM IRL  EL+VTS KTID RG
Sbjct  170  QPLWIIFARSMVIRLTQELIVTSHKTIDARG  200



>ref|XP_011013803.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=419

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 107/174 (61%), Gaps = 18/174 (10%)
 Frame = -1

Query  524  NTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNS  345
            N D YW  R  EA + ++ AY P PE V       + K +                  NS
Sbjct  12   NFDEYWKKRAEEAKEASREAYEPNPEKVAKHFNDEVHKSLEGG---------------NS  56

Query  344  TRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVV  165
            TRR+L    +Y+GPC  TNPIDRCWRCD+NWAKNRKKL  CALGFG  T GGK G +Y V
Sbjct  57   TRRNL---GKYKGPCLATNPIDRCWRCDKNWAKNRKKLGGCALGFGRKTIGGKNGKYYRV  113

Query  164  TNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            T+  D+D+V PK GTLR+ VIQ  PLWI FA  M IRL  EL+V S+KTIDGRG
Sbjct  114  TDPSDNDMVNPKPGTLRYGVIQDKPLWIIFAHDMVIRLSEELMVASNKTIDGRG  167



>emb|CAN69905.1| hypothetical protein VITISV_001007 [Vitis vinifera]
Length=358

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 116/189 (61%), Gaps = 21/189 (11%)
 Frame = -1

Query  569  AAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRl  390
            A   P + A+ A++   D YW  R+ EA + A  A++P P+ V      H+   +  +  
Sbjct  18   AVIAPTIRANIAEY---DDYWKEREEEAKKAALEAFHPTPQEVNDHFNLHVEDELTGS--  72

Query  389  ledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgf  210
                         N TRRSL  +K   GPCK TNPIDRCWRC  NWA  RK+LA C LGF
Sbjct  73   -------------NGTRRSLRVNK---GPCKATNPIDRCWRCRPNWASQRKRLADCVLGF  116

Query  209  gagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVT  30
            G  T GGK G +Y VT+  D+D+V PK+GTLRHAVIQ  PLWI FA+SM IRL  EL++T
Sbjct  117  GRNTVGGKYGKYYFVTDPSDNDMVNPKKGTLRHAVIQPRPLWIVFARSMIIRLNQELIMT  176

Query  29   SDKTIDGRG  3
            SDKTIDGRG
Sbjct  177  SDKTIDGRG  185



>ref|XP_004298448.1| PREDICTED: probable pectate lyase 3-like [Fragaria vesca subsp. 
vesca]
Length=443

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 109/172 (63%), Gaps = 15/172 (9%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D YW  R A+AM+ A  + +P PE VT +    + + +                  N TR
Sbjct  34   DEYWKQRAADAMRIANASVHPDPENVTEEFNAKVHEHI---------------MGQNRTR  78

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
            R+L   KRY GPC+ TNPID CWRCD  WA NR+KL  C++GFG  TTGGK GP YVVT+
Sbjct  79   RTLRGFKRYEGPCRATNPIDACWRCDPEWADNRQKLVDCSMGFGKKTTGGKGGPIYVVTD  138

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              DDD+V PK GTLR+AV +  PLWI FA SM IRL+ EL+VT DKTIDGRG
Sbjct  139  GSDDDIVNPKEGTLRYAVTRKRPLWIIFAHSMVIRLQQELMVTCDKTIDGRG  190



>ref|XP_008446316.1| PREDICTED: probable pectate lyase P59 [Cucumis melo]
Length=432

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 116/178 (65%), Gaps = 18/178 (10%)
 Frame = -1

Query  536  ADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydeldd  357
            AD  + D YW  R AEA Q A  AY P PE +   L   + + ++ +             
Sbjct  19   ADIGDFDDYWKARAAEAEQAAADAYEPNPETIADSLNAEVGQALSGS-------------  65

Query  356  EHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGP  177
              NSTRR+L   K+Y GPC+ TNPIDRCWRCD NWA+NRKKLA C LGFG  T GGK GP
Sbjct  66   --NSTRRNL---KKYTGPCRATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTIGGKLGP  120

Query  176  FYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            +YVV +  D D++ PK GTLRHAVIQ GPLWITF+ +M IRL  EL+VTSDKTID RG
Sbjct  121  YYVVNDSSDSDLMNPKPGTLRHAVIQKGPLWITFSTNMAIRLTQELIVTSDKTIDARG  178



>ref|XP_010096345.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXB63820.1| putative pectate lyase 7 [Morus notabilis]
Length=399

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 110/173 (64%), Gaps = 16/173 (9%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D YW +R  EA + A +AY+P+P  VT +L   + + +                  N+TR
Sbjct  10   DDYWKSRAEEARKDALQAYSPHPHEVTDQLNYDVQEALTAK---------------NNTR  54

Query  338  RSL-MRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVT  162
            R L  R  +  GPC  TNPIDRCWRCD NWA NRK+LA C LGFG  T GGK GP+Y+VT
Sbjct  55   RQLRGRKNKKGGPCMATNPIDRCWRCDPNWANNRKRLADCTLGFGRNTVGGKFGPYYIVT  114

Query  161  NRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            +  D D++ PK GTLRHAVIQ  PLWI FA+SM IRL  EL++T DKTID RG
Sbjct  115  DPSDTDLINPKPGTLRHAVIQKKPLWIIFARSMIIRLSEELIMTGDKTIDARG  167



>ref|XP_009788285.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=434

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 115/187 (61%), Gaps = 18/187 (10%)
 Frame = -1

Query  563  AIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlle  384
            ++ +V++  A+ +  D  W TR  +A + A+ +YNP+PE V   L KH+      +    
Sbjct  13   SVTLVLSIEANISEFDEVWQTRATQAKKTAQDSYNPHPETVADNLNKHVHTSEEGS----  68

Query  383  dveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfga  204
                       NSTRR L    +Y GPC  TNPIDRCWRCD NWAK R KLA C LGFG 
Sbjct  69   -----------NSTRRDL---HKYNGPCMSTNPIDRCWRCDPNWAKTRMKLADCVLGFGH  114

Query  203  gttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSD  24
             TTGGK G  YVVT+  DDD+V PK GTLRHAVIQ  PLWI F   M IRL  EL++TS+
Sbjct  115  HTTGGKGGKIYVVTDPSDDDMVNPKPGTLRHAVIQPEPLWIIFKHHMVIRLNQELIMTSN  174

Query  23   KTIDGRG  3
            KTID RG
Sbjct  175  KTIDARG  181



>ref|XP_011025954.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=441

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 119/194 (61%), Gaps = 20/194 (10%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
            +  +LA  +P +  H  +    D YW  +  EA + A+ A+ P P  VTS+    ++K++
Sbjct  13   LFVSLAVFVPTLQGHIGEF---DEYWKKKADEARKAAQEAFYPDPLNVTSQFNFQVNKVL  69

Query  404  NETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLAS  225
             ET               NSTRRSL+R +   G C  TNPIDRCWRCD NWA +R+KLA 
Sbjct  70   TET---------------NSTRRSLVRKRG--GRCIATNPIDRCWRCDPNWASHRQKLAD  112

Query  224  CALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKN  45
            C LGFG  T GGK G  YVVT+  D+D++ PK GTLRHAVIQ  PLWI F+ SM IRL  
Sbjct  113  CVLGFGHKTVGGKYGKIYVVTDASDNDMLNPKPGTLRHAVIQKEPLWIIFSGSMVIRLNQ  172

Query  44   ELLVTSDKTIDGRG  3
            EL+V S+KTID RG
Sbjct  173  ELMVASNKTIDSRG  186



>ref|XP_004508770.1| PREDICTED: probable pectate lyase P59-like [Cicer arietinum]
Length=434

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 114/197 (58%), Gaps = 24/197 (12%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
              V   AL   +   +AH A       +W TR  EA Q A++AY P P  +     KH+ 
Sbjct  11   FCVFYLALFPTLRASIAHDAQ------FWQTRAREAKQAAQKAYKPNPHDIALTFNKHVD  64

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
            K    +               N TRR L    +Y GPC  TNPID+CWRCD NW KNRKK
Sbjct  65   KSFKSS---------------NGTRRGL---SKYTGPCLATNPIDKCWRCDPNWEKNRKK  106

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA+CALGFG GTTGGK G  YVVT+  D D++ PK GTLRHAVIQ  PLWI F  SM I+
Sbjct  107  LANCALGFGHGTTGGKNGKIYVVTDSSDHDLINPKPGTLRHAVIQNEPLWIIFKHSMNIK  166

Query  53   LKNELLVTSDKTIDGRG  3
            L +EL+ T +KTID RG
Sbjct  167  LSSELIFTDNKTIDARG  183



>ref|XP_006306515.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
 gb|EOA39413.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
Length=455

 Score =   160 bits (406),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 120/202 (59%), Gaps = 21/202 (10%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            V  L  LA   P V AH A     D YW  R+++A++    +Y+P P  VT+ L  H++ 
Sbjct  10   VFFLSLLAIVAPQVKAHVAVF---DSYWTQRQSDALKRTMGSYDPNPLNVTNHLNYHVNL  66

Query  410  MMNETRlledveydelddEHNSTRRSLM------RSKRYRGPCKVTNPIDRCWRCDRNWA  249
             ++                 N TRR L       R  +  G C   NPID+CWRCDRNWA
Sbjct  67   AVDAAES------------FNDTRRELTQVRSGHRKLKRSGKCLAYNPIDKCWRCDRNWA  114

Query  248  KNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAK  69
             NRKKLA C LGFG  TTGGK GP YVV +  D+D+V PK GTLR+AV + GPLWI FA+
Sbjct  115  NNRKKLADCVLGFGRKTTGGKDGPIYVVNDASDNDLVNPKPGTLRYAVTRDGPLWIIFAR  174

Query  68   SMTIRLKNELLVTSDKTIDGRG  3
            SM I+L+ EL++ SDKTIDGRG
Sbjct  175  SMIIKLQQELMIASDKTIDGRG  196



>ref|XP_008443432.1| PREDICTED: probable pectate lyase 19 [Cucumis melo]
Length=441

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 122/197 (62%), Gaps = 18/197 (9%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            ++++L ++A  +P + A  A+    D Y + +  EA Q +  A++P P  VT    +H+ 
Sbjct  9    LLMVLVSMAVLMPTLRAGIAEF---DDYLLQKAEEAKQASLEAFHPDPMNVTDHFNQHVH  65

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
              +                  NSTRRSL    +Y+GPC  TNPIDRCWRCD NWAKNRKK
Sbjct  66   LALEGIEGS------------NSTRRSL---AKYKGPCLATNPIDRCWRCDPNWAKNRKK  110

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA C LGFG  TTGGK+G  YVVT+  D+DVV PK GTLR+  +Q  PLWI FA+SM IR
Sbjct  111  LAKCVLGFGRKTTGGKKGRIYVVTDPSDNDVVNPKPGTLRYGALQKRPLWIIFARSMIIR  170

Query  53   LKNELLVTSDKTIDGRG  3
            L  EL+VTS KTID RG
Sbjct  171  LSKELMVTSHKTIDARG  187



>emb|CBI15265.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 116/196 (59%), Gaps = 21/196 (11%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            +V+L      +P V A+  D    D  W TR  EA + A +AYNP+PE VT    K + K
Sbjct  8    LVILIPFLVIVPAVTANIGDF---DEVWQTRAEEARKAALQAYNPHPEKVTDNFNKKVHK  64

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
              + T               N TRR+L    ++ G C  TNPIDRCWRC  +WA NR KL
Sbjct  65   SFDST---------------NHTRRNL---SKFSGLCMATNPIDRCWRCRSDWASNRMKL  106

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A C LGFG  TTGGK G  YVVT+  D+D+V PK GTLRHA IQ  PLWI FA SM IRL
Sbjct  107  ADCVLGFGQKTTGGKGGKIYVVTDPSDNDMVNPKPGTLRHAAIQEEPLWIIFAHSMAIRL  166

Query  50   KNELLVTSDKTIDGRG  3
              EL++TS+KTID RG
Sbjct  167  NEELIMTSNKTIDARG  182



>ref|XP_002270112.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32014.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 116/185 (63%), Gaps = 21/185 (11%)
 Frame = -1

Query  557  PVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledv  378
            P + AH A++   D YW  R+ EA   A  A++P PE V     K++ K +         
Sbjct  22   PTIRAHIAEY---DDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEKSI---------  69

Query  377  eydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagt  198
                     N TRR+L   K  +GPCK TNPIDRCWRC RNWA +R++LA C LGFG  T
Sbjct  70   ------FGKNGTRRNL---KVNKGPCKATNPIDRCWRCRRNWAMDRRRLADCVLGFGRRT  120

Query  197  tggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKT  18
             GGK G  Y+VT+  D+D++ PK GTLR+AVIQ  PLWI F +SM I+LK EL+VTSDKT
Sbjct  121  VGGKHGRLYIVTDPSDNDMLNPKPGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKT  180

Query  17   IDGRG  3
            IDGRG
Sbjct  181  IDGRG  185



>gb|KFK43687.1| hypothetical protein AALP_AA1G160000 [Arabis alpina]
Length=460

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 120/204 (59%), Gaps = 22/204 (11%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
             V  L  +A   P   AH A  +N   YW  R+ +A++    +Y+P P  VT     H+S
Sbjct  13   FVFFLSFIATFPPESRAHVAVFDN---YWTQRQTDALRQTMNSYDPNPLNVTDHFNHHVS  69

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRY-------RGPCKVTNPIDRCWRCDRN  255
              M+ T              +N TRR L + ++         G C   N ID+CWRCDRN
Sbjct  70   LAMDATES------------NNGTRRELTQVRKSGRKIHKSSGKCLAYNAIDKCWRCDRN  117

Query  254  WAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITF  75
            WAKNRKKL  C LGFG  TTGGK GP YVV +  D+D+V PK GTLR+AV + GPLWI F
Sbjct  118  WAKNRKKLTDCVLGFGRKTTGGKDGPIYVVNDASDNDLVNPKPGTLRYAVTRDGPLWIIF  177

Query  74   AKSMTIRLKNELLVTSDKTIDGRG  3
            A+SM I+L+ EL++TSDKTIDGRG
Sbjct  178  ARSMIIKLQQELMITSDKTIDGRG  201



>ref|XP_004490003.1| PREDICTED: probable pectate lyase 3-like isoform X1 [Cicer arietinum]
Length=450

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 110/173 (64%), Gaps = 16/173 (9%)
 Frame = -1

Query  521  TDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNST  342
            +D YW  +   A +  + AY P P  V+  LT  IS+M+   +                 
Sbjct  40   SDSYWKEKAEIAAKANEEAYTPDPYAVSGNLTSTISEMIIGGK---------------KG  84

Query  341  RRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVT  162
            RR+L R ++  GPC  TNPIDRCWRCD NWA NRKKLA C  GFG  TTGGK GPFYVVT
Sbjct  85   RRNL-RGRKTAGPCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKAGPFYVVT  143

Query  161  NRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            +  D D+V P+ GTLRHAV + GPLWI FA+SM IRL  EL++TSDKTIDGRG
Sbjct  144  DPSDSDMVNPRPGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGRG  196



>emb|CAN69904.1| hypothetical protein VITISV_001006 [Vitis vinifera]
Length=443

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 116/185 (63%), Gaps = 21/185 (11%)
 Frame = -1

Query  557  PVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledv  378
            P + AH A++   D YW  R+ EA   A  A++P PE V     K++ K +         
Sbjct  22   PTIRAHIAEY---DDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEKSI---------  69

Query  377  eydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagt  198
                     N TRR+L   K  +GPCK TNPIDRCWRC RNWA +R++LA C LGFG  T
Sbjct  70   ------FGKNGTRRNL---KVNKGPCKATNPIDRCWRCRRNWAMDRRRLADCVLGFGRRT  120

Query  197  tggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKT  18
             GGK G  Y+VT+  D+D++ PK GTLR+AVIQ  PLWI F +SM I+LK EL+VTSDKT
Sbjct  121  VGGKHGRLYIVTDPSDNDMLNPKPGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKT  180

Query  17   IDGRG  3
            IDGRG
Sbjct  181  IDGRG  185



>ref|XP_009110541.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 121/205 (59%), Gaps = 20/205 (10%)
 Frame = -1

Query  602  NWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTK  423
             +  V  L  LA   P V A+ A  +N   YW+ R+ +A++    +++P P  VT  L  
Sbjct  10   GYLFVFCLSLLATLTPHVGANVAVFDN---YWLQRQGDALKQTIASFDPNPLNVTDHLNY  66

Query  422  HISKMMNETRlledveydelddEHNSTRRSLMRSKRYR-----GPCKVTNPIDRCWRCDR  258
            H++  ++ T               NSTRR L + +  R     G C   NPIDRCWRC+ 
Sbjct  67   HVALAVDATEST------------NSTRRELSQVRNGRKLKRSGKCVAYNPIDRCWRCNG  114

Query  257  NWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWIT  78
            +W KNRKKLA C LGFG  TTGGK GP YVV +  DDD++ PK GTLRHAV + GPLWI 
Sbjct  115  DWEKNRKKLADCVLGFGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLWII  174

Query  77   FAKSMTIRLKNELLVTSDKTIDGRG  3
            F  SM I L+ EL++TSDKTIDGRG
Sbjct  175  FGSSMIINLQQELIITSDKTIDGRG  199



>ref|XP_002272638.2| PREDICTED: pectate lyase-like [Vitis vinifera]
Length=434

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 116/196 (59%), Gaps = 21/196 (11%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            +V+L      +P V A+  D    D  W TR  EA + A +AYNP+PE VT    K + K
Sbjct  8    LVILIPFLVIVPAVTANIGDF---DEVWQTRAEEARKAALQAYNPHPEKVTDNFNKKVHK  64

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
              + T               N TRR+L    ++ G C  TNPIDRCWRC  +WA NR KL
Sbjct  65   SFDST---------------NHTRRNL---SKFSGLCMATNPIDRCWRCRSDWASNRMKL  106

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A C LGFG  TTGGK G  YVVT+  D+D+V PK GTLRHA IQ  PLWI FA SM IRL
Sbjct  107  ADCVLGFGQKTTGGKGGKIYVVTDPSDNDMVNPKPGTLRHAAIQEEPLWIIFAHSMAIRL  166

Query  50   KNELLVTSDKTIDGRG  3
              EL++TS+KTID RG
Sbjct  167  NEELIMTSNKTIDARG  182



>ref|XP_007209148.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
 gb|EMJ10347.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
Length=440

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 123/198 (62%), Gaps = 21/198 (11%)
 Frame = -1

Query  593  IVVMLYALAAAIPV-VMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHI  417
            +++ ++ +A  IP  V A+ AD    D +W  R AEA + A  AY+  P  VT    K +
Sbjct  11   VILCVFVIAITIPTTVRANIADF---DEHWQQRAAEAKKAAHEAYHDDPIAVTEHFNKQV  67

Query  416  SKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRK  237
                +                 N+TRR+L  +++Y+GPC  TNPIDRCWRCD NW KNRK
Sbjct  68   LDTFDYA---------------NNTRRNL--NQKYKGPCMATNPIDRCWRCDPNWEKNRK  110

Query  236  KLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTI  57
            +LA CALGFG   TGGK GP YVVT+  D D+V PK GTLRHAVIQ GPLWI FA+ M I
Sbjct  111  RLADCALGFGRKATGGKLGPIYVVTDNTDADLVNPKPGTLRHAVIQNGPLWIIFARDMRI  170

Query  56   RLKNELLVTSDKTIDGRG  3
            +L  ELLV SDKTID RG
Sbjct  171  KLTEELLVASDKTIDARG  188



>emb|CDX96854.1| BnaA08g23970D [Brassica napus]
Length=458

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 122/205 (60%), Gaps = 20/205 (10%)
 Frame = -1

Query  602  NWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTK  423
             +  V  L  LA   P V A+ A  +N   YW+ R+ +A++    +++P P  VT  L  
Sbjct  10   GYLFVFCLSLLATLTPHVGANVAVFDN---YWLQRQGDALKQTIASFDPNPLNVTDHLNY  66

Query  422  HISKMMNETRlledveydelddEHNSTRRSLMRSKRYR-----GPCKVTNPIDRCWRCDR  258
            H++  ++ T  +            NSTRR L + +  R     G C   NPIDRCWRC+ 
Sbjct  67   HVALAVDATESI------------NSTRRELSQVRNGRKLKRSGKCVAYNPIDRCWRCNG  114

Query  257  NWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWIT  78
            +W KNRKKLA C LGFG  TTGGK GP YVV +  DDD++ PK GTLRHAV + GPLWI 
Sbjct  115  DWEKNRKKLADCVLGFGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLWII  174

Query  77   FAKSMTIRLKNELLVTSDKTIDGRG  3
            F  SM I L+ EL++TSDKTIDGRG
Sbjct  175  FGSSMIINLQQELIITSDKTIDGRG  199



>gb|EYU36839.1| hypothetical protein MIMGU_mgv1a006379mg [Erythranthe guttata]
Length=446

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 117/197 (59%), Gaps = 13/197 (7%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            ++ +  A A A+P + A+  D   +D YWV R  +A      +Y P+P  + S L  H +
Sbjct  7    LLFLSIAFAYALPSISANFLD---SDEYWVKRSVQAWNNTLESYEPHPAKIVSHLNLHST  63

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
            + + E + LE V         NS+RR L     Y GPC  TNPIDRCWRC  NWA NR +
Sbjct  64   RALEEIKDLELVS--------NSSRRHLAHG--YDGPCMATNPIDRCWRCQANWADNRFR  113

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA C LGFG    GGK G  YVV +  D D+V P  GTLRHAVIQ  PLWI F++SM IR
Sbjct  114  LADCGLGFGYKAKGGKGGRIYVVNDSSDSDMVNPIPGTLRHAVIQTEPLWIIFSRSMVIR  173

Query  53   LKNELLVTSDKTIDGRG  3
            L  EL++ SDKTIDGRG
Sbjct  174  LSQELIMQSDKTIDGRG  190



>ref|XP_002306040.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
 gb|EEE86551.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
Length=432

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 121/198 (61%), Gaps = 26/198 (13%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            +++ ++ LA  IP ++A   D    D  W  R  +A +    AY P PE  T      + 
Sbjct  7    MLIFVFTLATLIPSLLA---DIGIFDDVWQKRAQDAKKMTLEAYVPDPEEATDAFNVEV-  62

Query  413  KMMNETRlledveydelddEHNSTRRSLMRS-KRYRGPCKVTNPIDRCWRCDRNWAKNRK  237
                                 N+TRR+L +  K+Y GPC+VTNPIDRCWRC RNWAKNRK
Sbjct  63   ---------------------NNTRRNLRQGRKKYAGPCQVTNPIDRCWRCQRNWAKNRK  101

Query  236  KLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTI  57
            +LA CALGFG  TTGG  G  YVVT+  D++V++PK GTLRHAVIQ  PLWI F+K+M I
Sbjct  102  QLAKCALGFGRRTTGGMAGRIYVVTDSSDNNVMKPKPGTLRHAVIQKEPLWIIFSKNMNI  161

Query  56   RLKNELLVTSDKTIDGRG  3
            +L  EL+++S KTIDGRG
Sbjct  162  KLSKELIMSSHKTIDGRG  179



>ref|XP_008230729.1| PREDICTED: pectate lyase [Prunus mume]
Length=452

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 134/208 (64%), Gaps = 13/208 (6%)
 Frame = -1

Query  617  MHSKMNWWIVVMLYALAAAIPVVMAHTADHNNT---DIYWVTRKAEAMQYAKRAYNPYPE  447
            M SK++  +V+ + +    +P + A  A+ +N    D  W  R+ +A + A +AY   PE
Sbjct  1    MASKLD--LVLFMISFCILVPSLRASIANDSNVGQFDAVWKERELKAEKTALKAYQRNPE  58

Query  446  LVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWR  267
             VT    + + ++ +       + +++ D   N T R L+  K+Y+GPCK TNPIDRCWR
Sbjct  59   KVTDDFNESVQEVDD-------LNFEDDDQVSNITGRHLL-GKKYKGPCKATNPIDRCWR  110

Query  266  CDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPL  87
            C ++WA +RKKLA+C  GFG  T GGKRG FYVVT+  D +VVEPK GTLRHAVIQ  PL
Sbjct  111  CRKDWANDRKKLANCVKGFGRRTRGGKRGEFYVVTDPSDSNVVEPKPGTLRHAVIQPQPL  170

Query  86   WITFAKSMTIRLKNELLVTSDKTIDGRG  3
            WI FA+SMTIRL  EL++TS KTID RG
Sbjct  171  WIIFARSMTIRLTQELIMTSHKTIDARG  198



>ref|XP_009381244.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=423

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 113/188 (60%), Gaps = 19/188 (10%)
 Frame = -1

Query  566  AAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRll  387
            AA     AH A+    D YW  ++A A    + AYNP PE VT      + K + +    
Sbjct  2    AAAAFCNAHIAEF---DEYWQKKEAMARANVQNAYNPNPESVTKHFNDAVLKDLEK----  54

Query  386  edveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfg  207
                        N+TRR L   +RY GPC  TNPIDRCWRC  NWA +RK+LA+CA GFG
Sbjct  55   ------------NNTRRGLRGKRRYDGPCMATNPIDRCWRCQENWAHHRKRLATCAKGFG  102

Query  206  agttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTS  27
               TGGK G FYVVT+  D D+V P++GTLR+ VIQ  PLWI FA+ M IRL  EL+V S
Sbjct  103  RHVTGGKNGDFYVVTDPSDLDLVNPRKGTLRYGVIQDRPLWIVFARDMVIRLTEELIVNS  162

Query  26   DKTIDGRG  3
            +KTIDGRG
Sbjct  163  NKTIDGRG  170



>ref|XP_004155392.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=432

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 113/178 (63%), Gaps = 18/178 (10%)
 Frame = -1

Query  536  ADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydeldd  357
            AD  + D YW  R A A + A  AY+P PE V + +   I+                   
Sbjct  19   ADIGDFDDYWKARAAAAEKAAADAYDPDPETVANSVNAEIAH---------------ASS  63

Query  356  EHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGP  177
              NSTRR+L   K+Y GPC  TNPIDRCWRCD NWA+NRKKLA C LGFG  TTGGK GP
Sbjct  64   GRNSTRRNL---KKYAGPCLATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTTGGKLGP  120

Query  176  FYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            +YVV +  D D++ PK GTLRHAVIQ GPLWI F+ +M IRL  EL++TSDKTID RG
Sbjct  121  YYVVNDSSDSDLMNPKPGTLRHAVIQKGPLWIIFSXNMAIRLSQELIMTSDKTIDARG  178



>ref|XP_004135462.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
 gb|KGN51889.1| hypothetical protein Csa_5G604340 [Cucumis sativus]
Length=432

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 113/178 (63%), Gaps = 18/178 (10%)
 Frame = -1

Query  536  ADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydeldd  357
            AD  + D YW  R A A + A  AY+P PE V + +   I+                   
Sbjct  19   ADIGDFDDYWKARAAAAEKAAADAYDPDPETVANSVNAEIAH---------------ASS  63

Query  356  EHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGP  177
              NSTRR+L   K+Y GPC  TNPIDRCWRCD NWA+NRKKLA C LGFG  TTGGK GP
Sbjct  64   GRNSTRRNL---KKYAGPCLATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTTGGKLGP  120

Query  176  FYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            +YVV +  D D++ PK GTLRHAVIQ GPLWI F+ +M IRL  EL++TSDKTID RG
Sbjct  121  YYVVNDSSDSDLMNPKPGTLRHAVIQKGPLWIIFSTNMAIRLSQELIMTSDKTIDARG  178



>emb|CDY68729.1| BnaCnng60280D [Brassica napus]
Length=458

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 120/205 (59%), Gaps = 20/205 (10%)
 Frame = -1

Query  602  NWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTK  423
             +  V  L  LA   P V A+ A  +N   YW+ R+ +A++    +++P P  VT  L  
Sbjct  10   GYLFVFSLLLLATLTPHVGANVAVFDN---YWLQRQGDALKQTIASFDPNPLNVTDHLNY  66

Query  422  HISKMMNETRlledveydelddEHNSTRRSLMRSKRYR-----GPCKVTNPIDRCWRCDR  258
            H++  +  T  +            NSTRR L + +  R     G C   NPIDRCWRC  
Sbjct  67   HVALAVGATESI------------NSTRRELSQVRNGRKLKRSGKCVAYNPIDRCWRCHG  114

Query  257  NWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWIT  78
            +W KNRKKLA C LGFG  TTGGK GP YVV +  DDD++ PK GTLRHAV + GPLWI 
Sbjct  115  DWEKNRKKLADCVLGFGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLWII  174

Query  77   FAKSMTIRLKNELLVTSDKTIDGRG  3
            F  SM I L+ EL++TSDKTIDGRG
Sbjct  175  FGSSMIINLQQELIITSDKTIDGRG  199



>ref|XP_006842121.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
 gb|ERN03796.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
Length=438

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 119/206 (58%), Gaps = 22/206 (11%)
 Frame = -1

Query  620  GMHSKMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELV  441
            G+      ++V++L + +  +P   AH AD + T   W  R A A Q A  AY   P  V
Sbjct  2    GLMGLFGLFVVLVLASSSFTVPKAEAHIADFDET---WQNRSAIARQVALEAYVHEPHNV  58

Query  440  TSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCD  261
            T  +   + K +                  NSTRR L    +Y G C  TNPIDRCWRC 
Sbjct  59   TDHVNHMVHKALEG----------------NSTRRHL---GKYTGACMATNPIDRCWRCQ  99

Query  260  RNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWI  81
            RNWA++RK+LA CALGFG  TTGG +G FYVVT+  D+ + +PK GTLRHAVIQ  PLWI
Sbjct  100  RNWARDRKRLAKCALGFGRKTTGGLKGRFYVVTDASDESLTDPKPGTLRHAVIQDRPLWI  159

Query  80   TFAKSMTIRLKNELLVTSDKTIDGRG  3
            TF   M IRL  ELLV S KTIDGRG
Sbjct  160  TFKHDMIIRLTEELLVNSHKTIDGRG  185



>gb|KGN59593.1| hypothetical protein Csa_3G827350 [Cucumis sativus]
Length=441

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 121/197 (61%), Gaps = 18/197 (9%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            +V++L ++A  +P + A  A+    D + + +  EA Q +  A++P P  VT    +H+ 
Sbjct  9    VVMVLVSMAVLMPTLRAGIAEF---DDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVH  65

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
              +                  NSTRRSL    +Y GPC  TNPIDRCWRCD NWAKNRKK
Sbjct  66   LALEGIEGS------------NSTRRSL---SKYNGPCLATNPIDRCWRCDPNWAKNRKK  110

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA C LGFG  TTGGK+G  YVVT+  D+DV+ P+ GTLR+  +Q  PLWI FA+SM IR
Sbjct  111  LAKCVLGFGRKTTGGKKGRIYVVTDPSDNDVINPRPGTLRYGALQKKPLWIIFARSMIIR  170

Query  53   LKNELLVTSDKTIDGRG  3
            L  EL++TS KTID RG
Sbjct  171  LSKELMITSHKTIDARG  187



>ref|XP_007215366.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
 gb|EMJ16565.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
Length=452

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 134/208 (64%), Gaps = 13/208 (6%)
 Frame = -1

Query  617  MHSKMNWWIVVMLYALAAAIPVVMAHTADHNNT---DIYWVTRKAEAMQYAKRAYNPYPE  447
            M SK++  +V+ + +    +P + A  A+ +N    D  W  R+ +A + A +AY P PE
Sbjct  1    MASKLD--LVLFMISFCILVPSLRASIANDSNVGQFDAVWKERELKAEKAALKAYQPNPE  58

Query  446  LVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWR  267
             VT    + + +  +       + +++ D   N T R L+  K+Y+GPCK TNPIDRCWR
Sbjct  59   KVTDDFNESVQEFDD-------LNFEDDDQVSNITGRHLL-GKKYKGPCKATNPIDRCWR  110

Query  266  CDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPL  87
            C ++WA +RKKLA+C  GFG  T GGKRG FYVVT+  D +VV+PK GTLRHAVIQ  PL
Sbjct  111  CRKDWANDRKKLANCVKGFGRRTRGGKRGGFYVVTDPSDSNVVDPKPGTLRHAVIQPQPL  170

Query  86   WITFAKSMTIRLKNELLVTSDKTIDGRG  3
            WI FA+SMTIRL  EL++TS KTID RG
Sbjct  171  WIIFARSMTIRLTQELILTSHKTIDARG  198



>ref|XP_008239834.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=438

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 122/198 (62%), Gaps = 21/198 (11%)
 Frame = -1

Query  593  IVVMLYALAAAIPV-VMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHI  417
            +++ ++  A  IP  V A+ AD    D +W  R AEA + A  AY+  P  VT    K +
Sbjct  9    VILCVFVTAITIPTTVRANIADF---DEHWQQRAAEAKKAAHEAYHDDPIAVTEHFNKQV  65

Query  416  SKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRK  237
                +                 N+TRR+L  +++Y+GPC  TNPIDRCWRCD NW KNRK
Sbjct  66   LDTFDYA---------------NNTRRNL--NQKYKGPCMATNPIDRCWRCDPNWEKNRK  108

Query  236  KLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTI  57
            +LA CALGFG   TGGK GP YVVT+  D D+V PK GTLRHAVIQ GPLWI FA+ M I
Sbjct  109  RLADCALGFGRKATGGKLGPIYVVTDNTDADLVNPKPGTLRHAVIQNGPLWIIFARDMRI  168

Query  56   RLKNELLVTSDKTIDGRG  3
            +L  ELLV SDKTID RG
Sbjct  169  KLTEELLVASDKTIDARG  186



>gb|AAQ62996.1| oil palm polygalacturonase allergen PEST361 [Elaeis guineensis]
Length=447

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 110/174 (63%), Gaps = 16/174 (9%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D +W  +  EA+  ++ AYNP PE VT    K +   ++E R              NSTR
Sbjct  32   DDHWQKKAEEALARSRAAYNPDPEAVTHDFNKAVHLALSEAR--------------NSTR  77

Query  338  RSL--MRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVV  165
            R+L  +   +++GPC  TNPIDRCWRC +NW  +RKKLA+CA GFG    GGK G FYVV
Sbjct  78   RTLRSVHRNKFKGPCVATNPIDRCWRCQKNWINHRKKLATCAKGFGRNAIGGKNGDFYVV  137

Query  164  TNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            T+  DDD+V PK GTLR  VIQ  PLWI FA+ M IRL  EL++ S+KTIDGRG
Sbjct  138  TDPSDDDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRG  191



>ref|XP_009389712.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=438

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 119/205 (58%), Gaps = 21/205 (10%)
 Frame = -1

Query  617  MHSKMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVT  438
            M S+   +   +++  +AA     AH AD    D YW  +   A   A+ +YNP PE VT
Sbjct  1    MESRPRLFFFSLVFLASAAF--ANAHIADF---DEYWQKKAEVAQSKARNSYNPDPESVT  55

Query  437  SKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDR  258
                +H ++ + E                N TRR L   KR  GPC  TNPIDRCWRC+ 
Sbjct  56   ----RHFNEAVYEDAQT------------NVTRRGLRGQKRSHGPCLATNPIDRCWRCNE  99

Query  257  NWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWIT  78
            NW  +RK+LA+CA GFG  T GGK G FYVVT+  DDD+V PK+GTLR+ VIQ  PLWI 
Sbjct  100  NWIHHRKQLATCAKGFGRHTIGGKNGKFYVVTDASDDDLVNPKKGTLRYGVIQDRPLWIV  159

Query  77   FAKSMTIRLKNELLVTSDKTIDGRG  3
            FA  M IRL  EL+V S KTIDGRG
Sbjct  160  FAHDMVIRLTEELIVNSYKTIDGRG  184



>gb|AAB69759.1| putative pectate lyase [Arabidopsis thaliana]
Length=459

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 119/196 (61%), Gaps = 21/196 (11%)
 Frame = -1

Query  572  LAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETR  393
            LA   P V  + A     D YW  R+++A++    +Y+P+P  VT+    H++  ++ + 
Sbjct  20   LAIVAPQVRGNVAVF---DSYWTQRQSDALKQTIGSYDPHPLNVTNHFNYHVNIAVDASE  76

Query  392  lledveydelddEHNSTRRSLMRSKRYR------GPCKVTNPIDRCWRCDRNWAKNRKKL  231
                          N TRR L + +  R      G C   NPID CWRCDRNWA NRKKL
Sbjct  77   S------------RNDTRRELTQVRSGRKTHKSSGKCLAYNPIDNCWRCDRNWANNRKKL  124

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A C LGFG  TTGGK GP YVV +  D+D++ PK GTLRHAV + GPLWI FA+SM I+L
Sbjct  125  ADCVLGFGRRTTGGKDGPIYVVKDASDNDLINPKPGTLRHAVTRDGPLWIIFARSMIIKL  184

Query  50   KNELLVTSDKTIDGRG  3
            + EL++TSDKTIDGRG
Sbjct  185  QQELMITSDKTIDGRG  200



>ref|XP_004489168.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=444

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 125/210 (60%), Gaps = 22/210 (10%)
 Frame = -1

Query  626  MEGMHSKMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPE  447
            M G+  K+ + +++    LA  IP + A  A+    D Y   +   A Q A ++Y P PE
Sbjct  1    MAGITRKITFIVLI----LAITIPCLEAGIAEF---DDYLKEQADLARQIALKSYVPNPE  53

Query  446  LVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGP--CKVTNPIDRC  273
             +T++L  H++  M E                NSTRR L + +++ G   C  +NPID C
Sbjct  54   NITTELNLHVNMAMEEAYS-------------NSTRRELRQRQKHGGSSACMSSNPIDNC  100

Query  272  WRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAG  93
            WRC ++WA+NR++LA C  GFG    GG  G FYVVT+  D+D+V PK GTLR+  +Q G
Sbjct  101  WRCKKDWAQNRQQLAQCGKGFGRKAVGGLGGKFYVVTDESDNDLVTPKFGTLRYGAVQKG  160

Query  92   PLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            PLWI FA+SM IRL  ELLV+SDKTIDGRG
Sbjct  161  PLWIIFARSMIIRLNQELLVSSDKTIDGRG  190



>ref|NP_172894.1| putative pectate lyase 3 [Arabidopsis thaliana]
 sp|Q9M9S2.1|PLY3_ARATH RecName: Full=Probable pectate lyase 3; AltName: Full=Pectate 
lyase A2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF43942.1|AC012188_19 Strong similarity to Pectate Lyase Precursor from Lilium longiflorum 
gi|730290 and contains a Pectate lyase PF|00544 domain. 
EST gb|AW004514 comes from this gene [Arabidopsis thaliana]
 gb|AAQ62871.1| At1g14420 [Arabidopsis thaliana]
 dbj|BAD43564.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43610.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43654.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43743.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43876.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43899.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29161.1| putative pectate lyase 3 [Arabidopsis thaliana]
Length=459

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 119/196 (61%), Gaps = 21/196 (11%)
 Frame = -1

Query  572  LAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETR  393
            LA   P V  + A     D YW  R+++A++    +Y+P+P  VT+    H++  ++ + 
Sbjct  20   LAIVAPQVRGNVAVF---DSYWTQRQSDALKQTIGSYDPHPLNVTNHFNYHVNIAVDASE  76

Query  392  lledveydelddEHNSTRRSLMRSKRYR------GPCKVTNPIDRCWRCDRNWAKNRKKL  231
                          N TRR L + +  R      G C   NPID CWRCDRNWA NRKKL
Sbjct  77   S------------RNDTRRELTQVRSGRKTHKSSGKCLAYNPIDNCWRCDRNWANNRKKL  124

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A C LGFG  TTGGK GP YVV +  D+D++ PK GTLRHAV + GPLWI FA+SM I+L
Sbjct  125  ADCVLGFGRRTTGGKDGPIYVVKDASDNDLINPKPGTLRHAVTRDGPLWIIFARSMIIKL  184

Query  50   KNELLVTSDKTIDGRG  3
            + EL++TSDKTIDGRG
Sbjct  185  QQELMITSDKTIDGRG  200



>ref|XP_010915114.1| PREDICTED: LOW QUALITY PROTEIN: pectate lyase-like [Elaeis guineensis]
Length=444

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 110/174 (63%), Gaps = 16/174 (9%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D +W  +  EA+  ++ AYNP PE VT    K +   ++E R              NSTR
Sbjct  32   DDHWQKKAEEALARSRAAYNPDPEGVTHDFNKAVHLALSEAR--------------NSTR  77

Query  338  RSL--MRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVV  165
            R+L  +   +++GPC  TNPIDRCWRC +NW  +RKKLA+CA GFG    GGK G FYVV
Sbjct  78   RTLRSVHRNKFKGPCVATNPIDRCWRCQKNWINHRKKLATCAKGFGRNAIGGKNGDFYVV  137

Query  164  TNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            T+  DDD+V PK GTLR  VIQ  PLWI FA+ M IRL  EL++ S+KTIDGRG
Sbjct  138  TDPSDDDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRG  191



>ref|XP_009403112.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=437

 Score =   157 bits (398),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 108/181 (60%), Gaps = 19/181 (10%)
 Frame = -1

Query  545  AHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveyde  366
            AH  D    D YW  +   A   A+ +YNP PE VT    + +SK +             
Sbjct  23   AHIGDF---DEYWQKKAEAARDRAQGSYNPDPESVTQSFNEAVSKDLEG-----------  68

Query  365  lddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggk  186
                 N TRRSL    ++ GPC  TNPIDRCWRC ++W +NRK+LA CA GFG  T GGK
Sbjct  69   -----NVTRRSLRGKHKFNGPCVATNPIDRCWRCKKDWMQNRKRLAKCAKGFGRHTIGGK  123

Query  185  rGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGR  6
             G  YVVT+  D+D++ PK+GTLR+ VIQ  PLWI FA  M IRL  ELLVTSDKTID R
Sbjct  124  NGDLYVVTDASDNDLISPKKGTLRYGVIQDRPLWIVFASDMIIRLNEELLVTSDKTIDAR  183

Query  5    G  3
            G
Sbjct  184  G  184



>ref|XP_006338480.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=446

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 108/173 (62%), Gaps = 10/173 (6%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D  W  R  EA ++A +AY P P  VT    K   + + E +  +           N TR
Sbjct  28   DEVWRRRAQEADEWAIKAYKPDPINVTLAFAKQTGQALKEIKEAKLAI--------NGTR  79

Query  338  RSL-MRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVT  162
            R L    K+Y GPC VTNPIDRCWRC  NWA NRK+LA CA+GF  GTTGGK G  YVVT
Sbjct  80   RELKGGGKKYNGPCLVTNPIDRCWRCQPNWADNRKRLADCAMGFAKGTTGGKAGEIYVVT  139

Query  161  NRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            +   DD  +PK GTLR+ VIQ  PLWI FAKSMTIRL  EL+V SDKTIDGRG
Sbjct  140  DS-SDDTSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRG  191



>ref|XP_004232242.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=446

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 112/185 (61%), Gaps = 13/185 (7%)
 Frame = -1

Query  554  VVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledve  375
            V+  H  +    D  W  R  EA ++A +AY P P  VT    K   + + E +  +   
Sbjct  19   VINGHIGEF---DEVWRRRAQEADEWAIKAYKPDPINVTLAFAKETGQALKEIKEAKLAV  75

Query  374  ydelddEHNSTRRSL-MRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagt  198
                    N TRR L    K+Y GPC VTNPIDRCWRC  +WA NRK+LA CA+GF  GT
Sbjct  76   --------NGTRRELKGGGKKYDGPCSVTNPIDRCWRCQPDWADNRKRLADCAMGFAKGT  127

Query  197  tggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKT  18
            TGGK G  YVVT+   DD  +PK GTLR+ VIQ  PLWI FAKSMTIRL  EL+V SDKT
Sbjct  128  TGGKAGEIYVVTDS-SDDTSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKT  186

Query  17   IDGRG  3
            IDGRG
Sbjct  187  IDGRG  191



>ref|XP_011009454.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=474

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 130/218 (60%), Gaps = 24/218 (11%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            +++ ++ LA  IP ++A   D    D  W  R  EA +    AY P PE  T      ++
Sbjct  7    MLIFVFTLATLIPSLLA---DLGIFDDVWRKRAEEAKKMTLEAYVPDPEEATDAFNVEVN  63

Query  413  K--------------------MMNETRlledveydelddEHNSTRRSLMRS-KRYRGPCK  297
            K                     ++   + ++    + +   NSTRR+L +  K+Y GPC+
Sbjct  64   KYSLAKNSSSLYGAFGSTNITNLDLDDIDDNDNDADFEQFANSTRRNLRQGRKKYAGPCQ  123

Query  296  VTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTL  117
            VTNPIDRCWRC RNWAKNRK+LA CALGFG  TTGG  G  YVVT+  D++V++PK GTL
Sbjct  124  VTNPIDRCWRCQRNWAKNRKQLAKCALGFGRRTTGGMAGRIYVVTDSSDNNVMKPKPGTL  183

Query  116  RHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            RHAVIQ  PLWI F+K+M I+L  EL+++S KTIDGRG
Sbjct  184  RHAVIQKEPLWIIFSKNMNIKLSKELIMSSHKTIDGRG  221



>emb|CDX81636.1| BnaC08g39650D [Brassica napus]
Length=484

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 120/196 (61%), Gaps = 17/196 (9%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
            +++     +P V A+ A  +N   YW  R+ +A++    +Y+P P  VT  L  H++  +
Sbjct  13   LVFLSVILVPHVQANVAIFDN---YWKQRQGDALKQTIASYDPNPLNVTDHLNYHVALAV  69

Query  404  NETRlledveydelddEHNSTRRSLM--RSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
            + T               N+TRR L+   ++   G C   NPID+CWRCD NW KNRKKL
Sbjct  70   DATEST------------NNTRRELIGRETQEGSGKCIAYNPIDKCWRCDPNWEKNRKKL  117

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
              C LGFG  TTGGK GP YVV +  D+D+V PK GTLRHAV + GPLWI FA SM I+L
Sbjct  118  VECVLGFGRKTTGGKDGPIYVVNDSSDEDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKL  177

Query  50   KNELLVTSDKTIDGRG  3
            + EL++TS+KTIDGRG
Sbjct  178  QQELMITSNKTIDGRG  193



>ref|XP_009615547.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=434

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 117/195 (60%), Gaps = 21/195 (11%)
 Frame = -1

Query  587  VMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKM  408
            + L+ +   +  + AH  +    D  W  R  +A + A+ AY+P P++V   L   + K 
Sbjct  8    LFLFVMFVLVLSIEAHIGEF---DEVWRKRAQQAKKAARHAYHPNPKIVADHLNNQVDKA  64

Query  407  MNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLA  228
            +  +               NS RR L    RY G CK TNPID+CWRCD NWA+NR KLA
Sbjct  65   VRGS---------------NSRRRDL---HRYNGQCKATNPIDQCWRCDPNWARNRMKLA  106

Query  227  SCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLK  48
             C LGFG  TTGGK G  YVVT+  D+D+V PK GTLRHAVIQ  PLWI FAK+M IRL 
Sbjct  107  DCVLGFGRKTTGGKGGKSYVVTDNSDNDLVNPKPGTLRHAVIQPQPLWIIFAKNMVIRLN  166

Query  47   NELLVTSDKTIDGRG  3
             EL++TS+KTID RG
Sbjct  167  EELIMTSNKTIDARG  181



>ref|XP_010502279.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 121/201 (60%), Gaps = 19/201 (9%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            IV +  +LA A+P V AH A++   D YW  R+ EA+     +Y+P P  VT     H +
Sbjct  9    IVFVSLSLAVAVPSVHAHVAEY---DEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAA  65

Query  413  KMMNETRlledveydelddEHNSTRRSLMR----SKRYRGPCKVTNPIDRCWRCDRNWAK  246
              M  T               N TRR L +     KR  G  +  N ID+CWR D+NW K
Sbjct  66   LAMETTGTA------------NETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGDKNWDK  113

Query  245  NRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKS  66
            NRKKLA C LGFG  TTGGK GP YVVT+  D+D+++PK GTLRHAV +  PLWI FA+ 
Sbjct  114  NRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLDPKPGTLRHAVTRDRPLWIIFARH  173

Query  65   MTIRLKNELLVTSDKTIDGRG  3
            M I+L+ EL++T+DKTIDGRG
Sbjct  174  MIIKLQQELIITNDKTIDGRG  194



>emb|CDP00293.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 104/172 (60%), Gaps = 20/172 (12%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D +   R  +A+Q + RAYNP PE VT   T+ + KM+                  N TR
Sbjct  40   DDFLRKRAEDALQASLRAYNPDPEAVTDNFTRQVGKMLEGG---------------NETR  84

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
            R L       G C  TNPIDRCWRCD NWAKNRK+LA CA GFG  T GG  G +YVV +
Sbjct  85   RQLKA-----GGCVATNPIDRCWRCDPNWAKNRKRLAKCARGFGRQTKGGMHGKYYVVVD  139

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              DD+V +P+ GTLRHAVIQ  PLWI F  SM I+L  ELL+ SDKTIDGRG
Sbjct  140  PSDDNVQDPEPGTLRHAVIQQEPLWIIFDTSMVIKLNQELLINSDKTIDGRG  191



>ref|XP_004147462.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
 ref|XP_004163529.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
Length=431

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 119/195 (61%), Gaps = 18/195 (9%)
 Frame = -1

Query  587  VMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKM  408
            ++L ++A  +P + A  A+    D + + +  EA Q +  A++P P  VT    +H+   
Sbjct  1    MVLVSMAVLMPTLRAGIAEF---DDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVHLA  57

Query  407  MNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLA  228
            +                  NSTRRSL    +Y GPC  TNPIDRCWRCD NWAKNRKKLA
Sbjct  58   LEGIEGS------------NSTRRSL---SKYNGPCLATNPIDRCWRCDPNWAKNRKKLA  102

Query  227  SCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLK  48
             C LGFG  TTGGK+G  YVVT+  D+DV+ P+ GTLR+  +Q  PLWI FA+SM IRL 
Sbjct  103  KCVLGFGRKTTGGKKGRIYVVTDPSDNDVINPRPGTLRYGALQKKPLWIIFARSMIIRLS  162

Query  47   NELLVTSDKTIDGRG  3
             EL++TS KTID RG
Sbjct  163  KELMITSHKTIDARG  177



>ref|XP_003563707.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=448

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 122/198 (62%), Gaps = 18/198 (9%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            + V+ + L+A+ PV  A+  D    D +W  RKA A   A+  Y   P  V + L + + 
Sbjct  15   LYVVFFFLSASAPVSQANIGDF---DEHWQQRKAAARAAAEAIYQSDPLEVANSLNRAVH  71

Query  413  KMMNETRlledveydelddEHNSTRRSLM-RSKRYRGPCKVTNPIDRCWRCDRNWAKNRK  237
            +   E                  TRRS++ + K++ GPC+ TNPIDRCWRC ++WA +RK
Sbjct  72   RATKEDDA--------------GTRRSMLGKHKKFAGPCRATNPIDRCWRCRKDWATDRK  117

Query  236  KLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTI  57
            +LA CA GFG   TGG  G FY+VT+  DDDV+ P+ GTLR AVIQA PLWI FA+SM I
Sbjct  118  RLARCAQGFGRNATGGLAGKFYIVTDGSDDDVLAPRPGTLRWAVIQAEPLWIIFARSMLI  177

Query  56   RLKNELLVTSDKTIDGRG  3
            +LK ELL+ SDKTIDGRG
Sbjct  178  KLKEELLIGSDKTIDGRG  195



>ref|XP_003552513.1| PREDICTED: pectate lyase-like [Glycine max]
Length=440

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 123/208 (59%), Gaps = 22/208 (11%)
 Frame = -1

Query  626  MEGMHSKMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPE  447
            M G  SK+ +   + L A A +IP + A  A+    D +   +  EA + A R+Y P P 
Sbjct  1    MAGSASKVTF---IFLVAFAISIPCLEAGIAEF---DDFLKAQADEAHEIALRSYEPDPI  54

Query  446  LVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWR  267
             VT++   H+ + + E                N TRR L   ++YRGPC  TNPIDRCWR
Sbjct  55   NVTAEFNIHVHRALMEES--------------NDTRREL--KQKYRGPCLATNPIDRCWR  98

Query  266  CDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPL  87
            C ++WA++R +LASC  GFG    GG  G  YVVT+  DD+ + P+ GTLR+ V+Q  PL
Sbjct  99   CRKDWAQDRYRLASCGKGFGRRAVGGLHGKIYVVTDSSDDEPINPRPGTLRYGVLQREPL  158

Query  86   WITFAKSMTIRLKNELLVTSDKTIDGRG  3
            WI FA+SM I LK ELL++SDKTIDGRG
Sbjct  159  WIIFAQSMVITLKFELLISSDKTIDGRG  186



>ref|XP_007153840.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
 gb|ESW25834.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
Length=447

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 114/194 (59%), Gaps = 25/194 (13%)
 Frame = -1

Query  560  IPVVMAHTAD--------HNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
            IP + A+T +         N  D YW  R   A      AY P P  V+  L+  +S+++
Sbjct  17   IPTLNANTLESEEYWQKHENEFDPYWKGRAETAAVDNNAAYFPDPYSVSGNLSSSVSELI  76

Query  404  NETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLAS  225
                                 +R  ++ +RY GPC  TNPIDRCWRCD NWA NR+KLA 
Sbjct  77   V-----------------GKDKRRNLKGQRYTGPCMATNPIDRCWRCDPNWANNRQKLAD  119

Query  224  CALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKN  45
            C  GFG  T GGK GPFYVVT+  DD++V+ K GTLRHAV + GPLWI F +SM I+LK 
Sbjct  120  CVQGFGRNTVGGKGGPFYVVTDPSDDNMVDLKPGTLRHAVTRTGPLWIIFERSMMIKLKQ  179

Query  44   ELLVTSDKTIDGRG  3
            EL++TSDKTIDGRG
Sbjct  180  ELIMTSDKTIDGRG  193



>gb|KHN13652.1| Pectate lyase [Glycine soja]
Length=440

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 123/208 (59%), Gaps = 22/208 (11%)
 Frame = -1

Query  626  MEGMHSKMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPE  447
            M G  SK+ +   + L A A +IP + A  A+    D +   +  EA + A R+Y P P 
Sbjct  1    MAGSASKVTF---IFLVAFAISIPCLEAGIAEF---DDFLKAQADEAHEIALRSYEPDPI  54

Query  446  LVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWR  267
             VT++   H+ + + E                N TRR L   ++YRGPC  TNPIDRCWR
Sbjct  55   NVTAEFNIHVHRALMEES--------------NDTRREL--KQKYRGPCLATNPIDRCWR  98

Query  266  CDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPL  87
            C ++WA++R +LASC  GFG    GG  G  YVVT+  DD+ + P+ GTLR+ V+Q  PL
Sbjct  99   CRKDWAQDRYRLASCGKGFGRRAVGGLHGKIYVVTDSSDDEPINPRPGTLRYGVLQREPL  158

Query  86   WITFAKSMTIRLKNELLVTSDKTIDGRG  3
            WI FA+SM I LK ELL++SDKTIDGRG
Sbjct  159  WIIFAQSMVITLKFELLISSDKTIDGRG  186



>ref|XP_006357122.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=448

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 115/202 (57%), Gaps = 14/202 (7%)
 Frame = -1

Query  608  KMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKL  429
            KM   + V+ +   A IP   AH  D    D  W  R  EAM++  + Y   P  +T   
Sbjct  6    KMTHSLFVLFFVFGAIIPAFNAHIGDF---DEVWRRRAEEAMKFTIQTYESEPANITLAF  62

Query  428  TKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWA  249
             +     + E   +            N TRR L  +K+Y GPC VTNPID+CWRCD NWA
Sbjct  63   NQKTRDSVKELSAVVSK---------NETRREL-GTKKYEGPCTVTNPIDKCWRCDPNWA  112

Query  248  KNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAK  69
             NRKKL  C++GFG  TTGG+ G +YVV++   DD   PK GTLRHAVIQ  PLWI F +
Sbjct  113  DNRKKLVECSMGFGYKTTGGRDGKYYVVSDS-SDDYTTPKPGTLRHAVIQKEPLWIIFDR  171

Query  68   SMTIRLKNELLVTSDKTIDGRG  3
            +M I+L  EL++  DKTIDGRG
Sbjct  172  NMKIKLHQELIMQGDKTIDGRG  193



>ref|XP_008793504.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=446

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 110/174 (63%), Gaps = 16/174 (9%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D +W  +  EA   ++ AY+P PE VT+K  K +   +++ R              NSTR
Sbjct  34   DDHWQKKAEEAFARSRAAYHPDPEAVTNKFNKAVHLAVSQAR--------------NSTR  79

Query  338  RSLMRS--KRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVV  165
            R+L  +   +++GPC  TNPIDRCWRC  NW +NRKKLA CA GFG    GGK G FYVV
Sbjct  80   RALRSAGVNKFKGPCVATNPIDRCWRCRENWMENRKKLAGCAKGFGRNAVGGKDGDFYVV  139

Query  164  TNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            T+  D+D+V PK GTLR  VIQ  PLWI FA+ M IRL  EL++ S+KTIDGRG
Sbjct  140  TDPSDNDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRG  193



>ref|XP_009129128.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=457

 Score =   155 bits (392),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 119/201 (59%), Gaps = 19/201 (9%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            IV +  ++A   P V AH A     D YW  R+A A++    +Y P P  VT+    H +
Sbjct  13   IVFVSLSIAIVAPSVQAHIAVF---DDYWTQRQANALRQTMESYEPNPLNVTNHFNYHAA  69

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYR----GPCKVTNPIDRCWRCDRNWAK  246
              M  T               N TRR L + K  +    G  K  N IDRCWR D+NWAK
Sbjct  70   LAMETT------------GADNGTRRELGQVKAGQKARGGRFKSLNAIDRCWRGDKNWAK  117

Query  245  NRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKS  66
            NRKKLA C LGFG  TTGGK GP YVVT+  DDD++ PK GTLRHAV +  PLWI FA++
Sbjct  118  NRKKLADCVLGFGLKTTGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFART  177

Query  65   MTIRLKNELLVTSDKTIDGRG  3
            M I+L+ EL++T+DKTIDGRG
Sbjct  178  MVIKLQQELMITNDKTIDGRG  198



>emb|CDY09356.1| BnaA02g26540D [Brassica napus]
Length=457

 Score =   155 bits (392),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 119/201 (59%), Gaps = 19/201 (9%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            IV +  ++A   P V AH A     D YW  R+A A++    +Y P P  VT+    H +
Sbjct  13   IVFVSLSIAIVAPSVQAHIAVF---DDYWTQRQANALRQTMESYEPNPLNVTNHFNYHAA  69

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYR----GPCKVTNPIDRCWRCDRNWAK  246
              M  T               N TRR L + K  +    G  K  N IDRCWR D+NWAK
Sbjct  70   LAMETT------------GADNGTRRELGQVKAGQKARGGRFKSLNAIDRCWRGDKNWAK  117

Query  245  NRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKS  66
            NRKKLA C LGFG  TTGGK GP YVVT+  DDD++ PK GTLRHAV +  PLWI FA++
Sbjct  118  NRKKLADCVLGFGLKTTGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFART  177

Query  65   MTIRLKNELLVTSDKTIDGRG  3
            M I+L+ EL++T+DKTIDGRG
Sbjct  178  MVIKLQQELMITNDKTIDGRG  198



>ref|XP_007137422.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
 gb|ESW09416.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
Length=439

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 118/209 (56%), Gaps = 24/209 (11%)
 Frame = -1

Query  626  MEGMHSKMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPE  447
            M G  SK+   +  +L  LA  IP + A  A+    D +   +  +A + A  +Y P PE
Sbjct  1    MAGSASKV---VFSLLVTLAITIPCLEAGIAEF---DDFLKAQSEKAHKIALESYVPTPE  54

Query  446  LVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRG-PCKVTNPIDRCW  270
             V S+L  H+   M                  NSTRR L       G PC  +NPID CW
Sbjct  55   FVASELNYHVHLSM-----------------LNSTRRGLKAGNNDAGAPCDSSNPIDNCW  97

Query  269  RCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGP  90
            RC+++WA +R +LA C  GFG    GG  GP YVVT+  D+D+V PK GTLR+ V Q GP
Sbjct  98   RCNKDWANDRYRLAKCGKGFGRRAVGGLGGPIYVVTDNSDEDMVNPKEGTLRYGVTQKGP  157

Query  89   LWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            LWITFA+SM I L+ ELL++SDKTIDGRG
Sbjct  158  LWITFARSMIITLQQELLISSDKTIDGRG  186



>gb|KHN08855.1| Putative pectate lyase P59 [Glycine soja]
Length=435

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 118/194 (61%), Gaps = 17/194 (9%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
            +L+     + +     A+  + D  W  R  EA + AK+AY P P  VT++   H+ + M
Sbjct  8    LLFFYVICLAIFPTLNANIGHFDHVWHRRLKEAREAAKQAYKPNPMKVTAEFNTHVIRAM  67

Query  404  NETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLAS  225
              +               N++RR L  S +Y GPCK TNPID+CWRCD NW KNRK+LA 
Sbjct  68   RGS---------------NNSRRGL--SNQYDGPCKATNPIDKCWRCDPNWEKNRKRLAD  110

Query  224  CALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKN  45
            CALGFG GTTGGK G  YVV +  D+D+V PK GTLRHA IQ  PLWI F ++M I+L  
Sbjct  111  CALGFGHGTTGGKDGKIYVVNDSSDNDLVNPKPGTLRHAAIQREPLWIIFDRNMNIKLHA  170

Query  44   ELLVTSDKTIDGRG  3
            EL++T +KTID RG
Sbjct  171  ELMLTDNKTIDARG  184



>ref|XP_010514040.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 120/201 (60%), Gaps = 19/201 (9%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            IV +  +LA  +P V AH A++   D YW  R+ EA+     +Y+P P  VT     H +
Sbjct  9    IVFVSLSLAVVVPTVHAHVAEY---DEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAA  65

Query  413  KMMNETRlledveydelddEHNSTRRSLMR----SKRYRGPCKVTNPIDRCWRCDRNWAK  246
              M  T +             N TRR L +     KR  G  +  N ID+CWR D+NW K
Sbjct  66   LAMETTGIA------------NETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGDKNWDK  113

Query  245  NRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKS  66
            NRKKLA C LGFG  TTGGK GP YVVT+  D+D++ PK GTLRHAV +  PLWI FA+ 
Sbjct  114  NRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTLRHAVTRDRPLWIIFARH  173

Query  65   MTIRLKNELLVTSDKTIDGRG  3
            M I+L+ EL++T+DKTIDGRG
Sbjct  174  MIIKLQQELIITNDKTIDGRG  194



>ref|XP_003530685.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=451

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 116/202 (57%), Gaps = 23/202 (11%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNN--------TDIYWVTRKAEAMQYAKRAYNPYPELVTSKL  429
            +L +LA  IP + A++ + +          D YW  R   A   ++ AY   P  V+S  
Sbjct  10   LLLSLAIFIPTLNANSLEKDEYWQSHVYEFDSYWQERAKAAKVDSQAAYFEDPYSVSSNF  69

Query  428  TKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWA  249
            T  +S++                      RR+L    R  GPC  TNPIDRCWRCD NWA
Sbjct  70   TSSVSEL---------------TIGKKDLRRNLKGKYRGDGPCIATNPIDRCWRCDPNWA  114

Query  248  KNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAK  69
             NR+KLA C  GFG  T GGK GPFYVVT+  DDD+V PK GTLRHAV + GPLWI FA+
Sbjct  115  NNRQKLADCVQGFGRNTVGGKGGPFYVVTDPSDDDMVNPKPGTLRHAVTRDGPLWIIFAR  174

Query  68   SMTIRLKNELLVTSDKTIDGRG  3
            SM I L+ EL++ S+KTIDGRG
Sbjct  175  SMFITLQQELIMNSNKTIDGRG  196



>gb|KEH24975.1| pectate lyase P59-like protein [Medicago truncatula]
Length=453

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 112/197 (57%), Gaps = 16/197 (8%)
 Frame = -1

Query  587  VMLYALAAAIPVV-MAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            ++L   A  IP +  AH       D +   R  EA + A   Y P PE V   L   +  
Sbjct  17   ILLVTFAITIPCLEAAHVLSPAEIDDFVKARAEEAHKVAVETYVPIPEGVAHDLNVAVHM  76

Query  410  MMNETRlledveydelddEHNSTRRSL-MRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
             M                  N+TRR +  + K++ GPC+ TNPID CWRC  +WA NR +
Sbjct  77   SMEAEE--------------NNTRREMRQKGKKHDGPCEATNPIDSCWRCKADWAANRFQ  122

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA C+ GFG  TTGG  GP YVVT+  D+D+V PK GTLR   +Q GPLWITFA+SM IR
Sbjct  123  LAKCSKGFGRKTTGGLGGPIYVVTDESDNDMVNPKPGTLRFGAVQKGPLWITFARSMVIR  182

Query  53   LKNELLVTSDKTIDGRG  3
            L  EL+V+SDKTIDGRG
Sbjct  183  LNQELMVSSDKTIDGRG  199



>ref|XP_002517472.1| pectate lyase, putative [Ricinus communis]
 gb|EEF45014.1| pectate lyase, putative [Ricinus communis]
Length=431

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 95/117 (81%), Gaps = 1/117 (1%)
 Frame = -1

Query  350  NSTRRSLMRSKR-YRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPF  174
            NSTRR+L + KR Y+GPC  TNPIDRCWRC +NWAKNRK+LA CALGFG  TTGGK G F
Sbjct  122  NSTRRNLRQGKRLYKGPCHTTNPIDRCWRCRKNWAKNRKRLARCALGFGRRTTGGKAGKF  181

Query  173  YVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            YVVT+  D +VV+PK GTLRHAVIQ  PLWI FA+ M I+L+ EL++ +DKTIDGRG
Sbjct  182  YVVTDNTDANVVDPKPGTLRHAVIQKAPLWIYFARDMNIKLQKELIINNDKTIDGRG  238



>ref|XP_010678579.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 122/196 (62%), Gaps = 15/196 (8%)
 Frame = -1

Query  587  VMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKM  408
            +ML+ +  +I  +    A+  N D +W  R+  A   A RAYN  P  +T +  + +  M
Sbjct  8    LMLFFMLVSIIFLQHVEANIGNYDDHWKQREQAAKANAARAYNTDPHGITHQTNQRVHNM  67

Query  407  -MNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
             MN T              +N  RR L    +Y GPC+  NPIDRCWRCD NW+K+R+KL
Sbjct  68   GMNRTNRT-----------NNYARRGL---GKYEGPCQADNPIDRCWRCDDNWSKDRQKL  113

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A C +GFG  TTGGK+G  YVVT+  D+++++PK GTLRHAVIQ GPLWI F   M I+L
Sbjct  114  ADCVVGFGHKTTGGKKGNIYVVTDDSDNELLDPKPGTLRHAVIQDGPLWIIFKHGMVIKL  173

Query  50   KNELLVTSDKTIDGRG  3
            K ELLV+S+KTIDGRG
Sbjct  174  KEELLVSSNKTIDGRG  189



>ref|XP_010068708.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
 gb|KCW64557.1| hypothetical protein EUGRSUZ_G02162 [Eucalyptus grandis]
Length=435

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 119/197 (60%), Gaps = 21/197 (11%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            +V     LA A+PV+ A+ AD    D  W  R  EA +   +AY P P  V       + 
Sbjct  8    LVFAFAFLAVAVPVLRANIADF---DEVWQKRAEEAKKATIKAYEPDPAKVAEDFNHRVH  64

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
            + M  +               N+TRRSL   KR +G C  TNPIDRCWRC ++WA +RK+
Sbjct  65   EDMQRS---------------NNTRRSL---KRTKGGCLATNPIDRCWRCRKDWASHRKR  106

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA+CALGFG GTTGGK G  Y VT+  DD+++ PK GTLRHAVIQ  PLWI FA +M IR
Sbjct  107  LANCALGFGRGTTGGKAGKIYKVTDPSDDNLMNPKPGTLRHAVIQPEPLWIIFAHNMVIR  166

Query  53   LKNELLVTSDKTIDGRG  3
            L  EL+VT +KTIDGRG
Sbjct  167  LSEELIVTDNKTIDGRG  183



>ref|XP_010683249.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 110/172 (64%), Gaps = 13/172 (8%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D YW  R+ EA++Y + AY+P P  VT+     +       + L            NSTR
Sbjct  33   DEYWHKRRLEAVKYFEEAYHPEPYNVTNHFNHQVHLHARNMKKL------------NSTR  80

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
            R L+  K + GPC  TNPID CWRC  NWA+NRK+LA CA+GFG GTTGGK G  YVVT+
Sbjct  81   RGLL-GKGHIGPCVATNPIDACWRCQPNWAENRKRLADCAIGFGKGTTGGKDGRIYVVTD  139

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              D+D+  PK GTLRHAVIQ  PLWI FA+SM IRL  EL++T DKTID RG
Sbjct  140  SSDNDMQNPKPGTLRHAVIQTEPLWIIFARSMNIRLTQELIMTGDKTIDARG  191



>ref|XP_007151201.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
 gb|ESW23195.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
Length=441

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 115/198 (58%), Gaps = 21/198 (11%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            +  +L  LA  IP + A  A+    D +   +  +A + A ++Y P PE VT+ L  H+ 
Sbjct  11   VFSLLATLAITIPCLEAGIAEF---DEFLRAQSEKAHEIALQSYVPTPEFVTNDLNYHVH  67

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYRG-PCKVTNPIDRCWRCDRNWAKNRK  237
              M                  N TRR L       G PC+ +NPID CWRC+++WAK+R 
Sbjct  68   LSM-----------------QNVTRRGLKEGNNAIGKPCESSNPIDNCWRCNKDWAKDRY  110

Query  236  KLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTI  57
            +LA C  GFG    GG  GP YVVT+  D+D++ PK GTLR+AV Q GPLWITF +SM I
Sbjct  111  RLAKCGKGFGRRAVGGLGGPIYVVTDNSDEDMINPKPGTLRYAVTQKGPLWITFERSMII  170

Query  56   RLKNELLVTSDKTIDGRG  3
             L+ EL+++SDKTIDGRG
Sbjct  171  SLQQELMISSDKTIDGRG  188



>ref|XP_010320663.1| PREDICTED: probable pectate lyase 3 [Solanum lycopersicum]
Length=386

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 119/194 (61%), Gaps = 8/194 (4%)
 Frame = -1

Query  581  LYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK-MM  405
            L+  ++ IP + A+ AD    D Y   R  EA+Q +  AYN  PE VT    K + + ++
Sbjct  16   LFCFSSIIPKLYANIADF---DPYLEKRAEEALQSSLAAYNENPEGVTQIFNKEVGETLL  72

Query  404  NETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLAS  225
            N TR     +  E      + +      ++    CK  NPID+CWRCD+NWA NRK LA 
Sbjct  73   NGTRRHLKEKDKEDK----NDKDDKEGDEKSVDGCKAYNPIDKCWRCDKNWANNRKALAD  128

Query  224  CALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKN  45
            CA GFG GTTGGK G FYVVT+  D++V EP  GTLRHAVIQ  PLWI F KSM IRLK 
Sbjct  129  CARGFGHGTTGGKDGRFYVVTDPSDNNVEEPVPGTLRHAVIQEEPLWIIFEKSMIIRLKQ  188

Query  44   ELLVTSDKTIDGRG  3
            EL++ S+KTIDGRG
Sbjct  189  ELMINSNKTIDGRG  202



>ref|XP_011087217.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=436

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 114/196 (58%), Gaps = 21/196 (11%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            +V L +L      V  +   H   D  W  R+  A + A++AY P P  V   L +++ K
Sbjct  8    LVFLISLFVVFTTVAGNIGVH---DAVWQERREAAKKAARQAYQPNPGEVLDHLNENVHK  64

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
             +  +               N+ RR L    +Y+G C  TNPID+CWRC  NWA NRKKL
Sbjct  65   SVEGS---------------NNQRRGL---SKYKGSCLATNPIDQCWRCQPNWANNRKKL  106

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
              CALGFG  TTGGK G  YVVT+  D D+V PK+GTLRHAVIQ  PLWI F  +M IRL
Sbjct  107  VDCALGFGRHTTGGKAGKMYVVTDPSDSDLVSPKKGTLRHAVIQPEPLWIIFKNNMNIRL  166

Query  50   KNELLVTSDKTIDGRG  3
              EL++TS+KTIDGRG
Sbjct  167  SEELIMTSNKTIDGRG  182



>ref|XP_004302354.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 121/205 (59%), Gaps = 21/205 (10%)
 Frame = -1

Query  605  MNWWIVVMLYALAAAIPVVMAHTADHNNT----DIYWVTRKAEAMQYAKRAYNPYPELVT  438
            M + +V+ + +    +P + A     + T    D     R+  A   A +AY P PE VT
Sbjct  4    MKFSLVLFMCSFCVILPCLKAGADSDDGTIAVFDPVLQEREKRAEIAALKAYQPDPESVT  63

Query  437  SKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDR  258
             +L K +   +  +               N+TRR L  +K+ +  C  TNPIDRCWRC+ 
Sbjct  64   DELIKDVETSIERS---------------NTTRRHL--AKKIKAECTATNPIDRCWRCNP  106

Query  257  NWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWIT  78
            +WAKNRK+LA+C LGFG  T GGKRGP YVV +  D+D+  PK GTLRHAVIQ GPLWI 
Sbjct  107  DWAKNRKQLANCVLGFGRRTRGGKRGPIYVVHDSSDNDMANPKPGTLRHAVIQTGPLWII  166

Query  77   FAKSMTIRLKNELLVTSDKTIDGRG  3
            F  SMTI+L  EL++TS KTIDGRG
Sbjct  167  FKHSMTIKLNKELIMTSHKTIDGRG  191



>ref|XP_008365507.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=396

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 92/116 (79%), Gaps = 1/116 (1%)
 Frame = -1

Query  350  NSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFY  171
            NSTRR+L R K+Y+GPCK TNPIDRCWRC  NWA NRKKLASC  GFG  T GGK+G +Y
Sbjct  28   NSTRRNL-RGKQYKGPCKATNPIDRCWRCRANWANNRKKLASCVKGFGRKTRGGKKGAYY  86

Query  170  VVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            +VT+  DD+V +PK GTLRHAVIQ  PLWI FA+SM IRL  EL+VTS KTID RG
Sbjct  87   IVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQELIVTSHKTIDARG  142



>ref|NP_178375.1| putative pectate lyase 6 [Arabidopsis thaliana]
 sp|O64510.1|PLY6_ARATH RecName: Full=Probable pectate lyase 6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC05350.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAO64162.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAV34776.1| At2g02720 [Arabidopsis thaliana]
 gb|AEC05615.1| putative pectate lyase 6 [Arabidopsis thaliana]
Length=455

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 122/203 (60%), Gaps = 21/203 (10%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
             V +  +L   +P V AH A++   D YW  R+  A++    +Y+P PE VT     H +
Sbjct  9    FVFVALSLTVVVPSVQAHIAEY---DEYWTQRQTNALRETLESYDPNPENVTDHFNYHAA  65

Query  413  KMMNETRlledveydelddEHNSTRRSL------MRSKRYRGPCKVTNPIDRCWRCDRNW  252
              M  T ++            N TRR L       ++ R  G  +  N ID+CWR D+NW
Sbjct  66   LAMETTGIV------------NETRRDLRQVGRGKKTTRRGGRFESLNAIDKCWRGDKNW  113

Query  251  AKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFA  72
             KNRKKLA C LGFG  TTGGK GP YVVT+  D+D+++PK GT+RHAV +  PLWI FA
Sbjct  114  DKNRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLKPKPGTIRHAVTRDRPLWIIFA  173

Query  71   KSMTIRLKNELLVTSDKTIDGRG  3
            +SM I+L+ EL++T+DKTIDGRG
Sbjct  174  RSMIIKLQQELIITNDKTIDGRG  196



>gb|KHN45481.1| Putative pectate lyase 3 [Glycine soja]
Length=379

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 112/195 (57%), Gaps = 21/195 (11%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
            +L   A  IP + A  A+    D +   +  EA + A  AY P PE VT +L  H+   +
Sbjct  12   LLVTFAIVIPCLEAGIAEF---DDFLKAQADEAQKIALEAYVPVPEDVTDELNFHVHLSL  68

Query  404  NETRlledveydelddEHNSTRRSLMRSKRYRGP-CKVTNPIDRCWRCDRNWAKNRKKLA  228
                              NSTRR L + K   G  C  +NPID CWRC++NWA +R +LA
Sbjct  69   -----------------ENSTRRELRQRKGRSGKKCVASNPIDTCWRCNKNWANDRYRLA  111

Query  227  SCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLK  48
             C  GFG G  GG  GP YVVT+  DDD+V PK GT+RHAV Q GPLWI F +SM I+L 
Sbjct  112  KCGKGFGRGARGGLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQRGPLWIIFQRSMMIKLN  171

Query  47   NELLVTSDKTIDGRG  3
             EL+++SDKTIDGRG
Sbjct  172  QELMISSDKTIDGRG  186



>ref|XP_006480843.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 114/196 (58%), Gaps = 21/196 (11%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            +  L++ AA IP + A+ ++    D  W  R  EAMQ  ++ Y+P P  + S L   +  
Sbjct  8    LFFLFSFAALIPCLSANISE---VDEVWRRRAEEAMQTTEQYYDPNPVAIASHLNMKVQD  64

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
            +  +T                + RR L+ ++   G C+ TNPID CWRC  NWA+NR+ L
Sbjct  65   LSKQT----------------AARRGLLNAES--GQCEATNPIDNCWRCKENWAENRQAL  106

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A CALGFG   TGGK G  Y VT+  D+D+  PK GTLRHAVIQ  PLWI FAK M I+L
Sbjct  107  AGCALGFGIKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKL  166

Query  50   KNELLVTSDKTIDGRG  3
            + EL+V   KTIDGRG
Sbjct  167  QQELIVQGKKTIDGRG  182



>ref|XP_006428983.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
 gb|ESR42223.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
Length=438

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 114/196 (58%), Gaps = 21/196 (11%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            +  L++ AA IP + A+ ++    D  W  R  EAMQ  ++ Y+P P  + S L   +  
Sbjct  10   LFFLFSFAALIPCLSANISE---VDEVWRRRAEEAMQTTEQYYDPNPVAIASHLNMKVQD  66

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
            +  +T                + RR L+ ++   G C+ TNPID CWRC  NWA+NR+ L
Sbjct  67   LSKQT----------------AARRGLLNAES--GQCEATNPIDNCWRCKENWAENRQAL  108

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A CALGFG   TGGK G  Y VT+  D+D+  PK GTLRHAVIQ  PLWI FAK M I+L
Sbjct  109  AGCALGFGIKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKL  168

Query  50   KNELLVTSDKTIDGRG  3
            + EL+V   KTIDGRG
Sbjct  169  QQELIVQGKKTIDGRG  184



>ref|XP_003613595.1| Pectate lyase [Medicago truncatula]
 gb|AES96553.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 105/170 (62%), Gaps = 17/170 (10%)
 Frame = -1

Query  512  YWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTRRS  333
            YW  + + A     +AY P P  V+  L+  +S+M+                  N  RR+
Sbjct  43   YWQQKASAAAMKNDKAYTPDPYAVSGNLSHSVSEMI----------------IGNQGRRN  86

Query  332  LMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRF  153
            L   K  RGPC  TNPIDRCWRCD NWA NR+KLA C  GFG  TTGGK GP YVVT+  
Sbjct  87   LAGGKA-RGPCMATNPIDRCWRCDPNWANNRQKLADCVKGFGRKTTGGKGGPIYVVTDPS  145

Query  152  DDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            D D+V P+ GTLR  V + GPLWITFA+SMTIRL  EL++TS KTIDGRG
Sbjct  146  DSDMVNPRPGTLRFGVTRNGPLWITFARSMTIRLNQELIMTSHKTIDGRG  195



>emb|CDY41679.1| BnaC02g34750D [Brassica napus]
Length=457

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 117/201 (58%), Gaps = 19/201 (9%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            IV +  ++A   P V AH A     D YW  R+A A++    +Y P P  VT+    H +
Sbjct  13   IVFVSLSIAIVAPSVQAHIAVF---DDYWTQRQANALRQTMESYEPNPLNVTNHFNYHAA  69

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYR----GPCKVTNPIDRCWRCDRNWAK  246
              M  T               N  RR L + K  +    G  +  N IDRCWR D+NWAK
Sbjct  70   LAMETT------------GADNGPRRELGQVKAGQKTRGGRFRSLNAIDRCWRGDKNWAK  117

Query  245  NRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKS  66
            NRKKLA C LGFG  T GGK GP YVVT+  DDD++ PK GTLRHAV +  PLWI FA++
Sbjct  118  NRKKLADCVLGFGLKTIGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFART  177

Query  65   MTIRLKNELLVTSDKTIDGRG  3
            M I+L+ EL++T+DKTIDGRG
Sbjct  178  MVIKLQQELMITNDKTIDGRG  198



>ref|XP_009758350.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=445

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 120/203 (59%), Gaps = 27/203 (13%)
 Frame = -1

Query  590  VVMLYAL---AAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKH  420
            V+ LY+L   A+ IP + A+ A+    D Y   +  EA++ +  AYN  PE +T    K 
Sbjct  9    VIFLYSLLCIASLIPNLHANIAEF---DPYLEKKAEEALKSSLAAYNENPEELTDTFNKE  65

Query  419  ISKMMNETRlledveydelddEHNSTRRSLMRSKRYRG----PCKVTNPIDRCWRCDRNW  252
            + + +                  N TRR L    +        CK  NPID+CWRCD+NW
Sbjct  66   VGETI-----------------FNGTRRHLKEEDKDDKDDNDGCKAYNPIDKCWRCDKNW  108

Query  251  AKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFA  72
            A NRK LA CA GFG GTTGGK G FYVVT+  DD+V EPK GTLRHAVIQ  PLWI F 
Sbjct  109  ANNRKALADCARGFGHGTTGGKDGKFYVVTDPSDDNVEEPKPGTLRHAVIQEEPLWIIFE  168

Query  71   KSMTIRLKNELLVTSDKTIDGRG  3
            KSM I+L+ EL++ +DKTIDGRG
Sbjct  169  KSMIIKLQQELMINNDKTIDGRG  191



>ref|XP_003554335.1| PREDICTED: pectate lyase-like [Glycine max]
Length=443

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 112/195 (57%), Gaps = 21/195 (11%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
            +L   A  IP + A  A+    D +   +  EA + A  AY P PE VT +L  H+   +
Sbjct  16   LLVTFAIVIPCLEAGIAEF---DDFLKAQADEAQKIALEAYVPVPEDVTDELNFHVHLSL  72

Query  404  NETRlledveydelddEHNSTRRSLMRSKRYRGP-CKVTNPIDRCWRCDRNWAKNRKKLA  228
                              NSTRR L + K   G  C  +NPID CWRC++NWA +R +LA
Sbjct  73   -----------------ENSTRRELRQRKGRSGKKCVASNPIDTCWRCNKNWANDRYRLA  115

Query  227  SCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLK  48
             C  GFG   TGG  GP YVVT+  DDD+V PK GT+RHAV Q GPLWI F +SM I+L 
Sbjct  116  KCGKGFGRRATGGLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQRGPLWIIFQRSMMIKLN  175

Query  47   NELLVTSDKTIDGRG  3
             EL+++SDKTIDGRG
Sbjct  176  QELMISSDKTIDGRG  190



>gb|KHG16093.1| hypothetical protein F383_07683 [Gossypium arboreum]
Length=454

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 118/197 (60%), Gaps = 6/197 (3%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            +V L++ A  IP +     +  + D  W  R  +A +    AY P PE VTSK  +++ K
Sbjct  8    LVFLFSFATLIPTLWGGGGNIADFDDVWKRRADQAWKNTLAAYEPSPENVTSKFNENVHK  67

Query  410  MMNETRlledveydelddEHNSTRRSL-MRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
             +   +  +  + +      +  RR+L  + K+Y GPC  TNPIDRCWRC  +WA+NRK+
Sbjct  68   ALVANKSNKTKDLEG-----SEDRRNLRGKHKKYTGPCMATNPIDRCWRCRPDWAENRKR  122

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            L  C +GFG  T GG++G +Y VT+  DDD V PK GTLR AVIQ  PLWI FA  M I+
Sbjct  123  LTQCVIGFGHRTEGGEKGKYYEVTDNSDDDPVNPKPGTLRFAVIQKRPLWIIFAHDMHIK  182

Query  53   LKNELLVTSDKTIDGRG  3
            L  EL+V S KTIDGRG
Sbjct  183  LSRELIVQSKKTIDGRG  199



>ref|XP_009761969.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=434

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 116/195 (59%), Gaps = 21/195 (11%)
 Frame = -1

Query  587  VMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKM  408
            + L+ +   +  + AH  +    D  W  R  +A + A+ AY+P P++V   L   + K 
Sbjct  8    LFLFVMVVLVLSIEAHIGEF---DEVWRKRAEKAKKAARHAYHPNPKIVADHLNNQVDKA  64

Query  407  MNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLA  228
            +  +               NS RR L    RY G CK TNPID+CWRCD NWA+NR KLA
Sbjct  65   VRGS---------------NSRRRDL---HRYNGQCKATNPIDQCWRCDPNWARNRMKLA  106

Query  227  SCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLK  48
             C LGFG  TTGGK G  YVVT+  D D+V PK GTLRHAVIQ  PLWI FAK+M IRL 
Sbjct  107  DCVLGFGRKTTGGKGGKIYVVTDNSDSDLVNPKPGTLRHAVIQPQPLWIIFAKNMVIRLN  166

Query  47   NELLVTSDKTIDGRG  3
             EL++TS+KTID RG
Sbjct  167  EELIMTSNKTIDARG  181



>ref|XP_006357289.1| PREDICTED: probable pectate lyase 3-like [Solanum tuberosum]
Length=459

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 120/197 (61%), Gaps = 2/197 (1%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            V+ L++L   I ++    A+  + D Y   R  EA+Q +  AYN  PE VT    K + +
Sbjct  10   VIFLFSLLCFISIIPKLYANIADFDPYLEKRAEEALQSSLAAYNENPEAVTQIFNKEVGE  69

Query  410  -MMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
             ++N TR     E  E  +     +      ++    CK  NPID+CWRCD+NWA NRK 
Sbjct  70   TILNGTRRHLKEEDKEDKN-EKVEKDDKEGDEKSVDICKAYNPIDKCWRCDKNWANNRKA  128

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA CA GFG GTTGGK G FYVVT+  D++V EP  GTLRHAVIQ  PLWI F KSM I+
Sbjct  129  LADCARGFGHGTTGGKDGKFYVVTDPSDNNVEEPVPGTLRHAVIQEEPLWIIFEKSMIIK  188

Query  53   LKNELLVTSDKTIDGRG  3
            LK EL++ +DKTIDGRG
Sbjct  189  LKQELMINNDKTIDGRG  205



>gb|KDP45476.1| hypothetical protein JCGZ_09725 [Jatropha curcas]
Length=462

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 113/186 (61%), Gaps = 8/186 (4%)
 Frame = -1

Query  536  ADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydeldd  357
            AD    D  W  R  EA +    AY+P P  VT+++ + ++  ++               
Sbjct  23   ADMKKYDKVWQERSEEARKNMMEAYDPDPIAVTAEVNEQVNHQIDGNAKTNSTINHTKGT  82

Query  356  EH-------NSTRRSLMRSK-RYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgag  201
             +       N+TRRSL + K +Y GPC+  NPID+CWRC +NW K+R++LASCALGFG  
Sbjct  83   NNFETGAEANNTRRSLKQKKQKYNGPCQANNPIDKCWRCRKNWVKDRQRLASCALGFGRR  142

Query  200  ttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDK  21
            TTGGK G  YVVT+  D D VEPK GTLRHAVIQ  PLWI FA  M I+L  EL++  +K
Sbjct  143  TTGGKGGKIYVVTDNSDHDCVEPKPGTLRHAVIQKEPLWIIFACDMNIKLSQELIMAHNK  202

Query  20   TIDGRG  3
            TIDGRG
Sbjct  203  TIDGRG  208



>ref|XP_004514773.1| PREDICTED: probable pectate lyase 3-like [Cicer arietinum]
Length=454

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 118/205 (58%), Gaps = 26/205 (13%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNN--------TDIYWVTRKAEAMQYAKRAYNPYPELVT  438
            I++ L  LA   P + A+  + N          D YW  R   A +  + AY   P  V+
Sbjct  7    IILFLLCLAVLTPTLNANPLEKNEYWEEHVPEFDSYWQERAKVAKEANQAAYFVDPYAVS  66

Query  437  SKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDR  258
               T  +S+++                   S RRSL  +    G C  TNPIDRCWRCD 
Sbjct  67   GNFTATVSEII----------------AAKSARRSLRGNNN--GTCMATNPIDRCWRCDP  108

Query  257  NWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWIT  78
            NWA NR+KLA C  GFG  T GGK GPFYVVT+  D+++++PK GTLRHAV + GPLWIT
Sbjct  109  NWANNRQKLADCVQGFGRNTRGGKGGPFYVVTDPSDNELLDPKPGTLRHAVTRNGPLWIT  168

Query  77   FAKSMTIRLKNELLVTSDKTIDGRG  3
            FA+SM I L+ EL+++SDKTIDGRG
Sbjct  169  FARSMVITLQQELIMSSDKTIDGRG  193



>ref|XP_009599232.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=445

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 119/203 (59%), Gaps = 27/203 (13%)
 Frame = -1

Query  590  VVMLYAL---AAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKH  420
            V+ L++L   A+ IP + A+ A+    D Y   +  EA++ +  AYN  PE +T    K 
Sbjct  9    VIFLFSLLCIASLIPNLHANIAEF---DPYLEKKAEEALKSSLAAYNENPEELTDTFNKE  65

Query  419  ISKMMNETRlledveydelddEHNSTRRSLMRSKRYRG----PCKVTNPIDRCWRCDRNW  252
            + + +                  N TRR L    +        CK  NPID+CWRCD+NW
Sbjct  66   VGETI-----------------FNGTRRHLKEEDKDDKDDNDGCKAYNPIDKCWRCDKNW  108

Query  251  AKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFA  72
            A NRK LA CA GFG GTTGGK G FYVVT+  DD+V EP  GTLRHAVIQ  PLWI F 
Sbjct  109  ANNRKALADCARGFGHGTTGGKDGKFYVVTDPSDDNVEEPNPGTLRHAVIQEEPLWIIFE  168

Query  71   KSMTIRLKNELLVTSDKTIDGRG  3
            KSM IRLK EL++ +DKTIDGRG
Sbjct  169  KSMIIRLKQELMINNDKTIDGRG  191



>ref|XP_009408830.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 108/182 (59%), Gaps = 20/182 (11%)
 Frame = -1

Query  545  AHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveyde  366
            AH AD+   D YW  + A A  +A  AYNP PE VT    + + + +             
Sbjct  23   AHIADY---DEYWQKKAALARSHANNAYNPNPESVTHHFNEAVMRDLAS-----------  68

Query  365  lddEHNSTRRSLMRSKRYR-GPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttgg  189
                 NSTRR L    R   G C+ TNPIDRC+RC  NW  +RKKLA+CA GFG   TGG
Sbjct  69   -----NSTRRGLRGKMRNEDGACQATNPIDRCFRCQSNWVHHRKKLATCAKGFGRHATGG  123

Query  188  krGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDG  9
            K G FYVVT+  D D+V P+ GTLRHAVIQ  PLWI FA  M IRL  EL++ S+KTIDG
Sbjct  124  KNGDFYVVTDSSDADLVNPRNGTLRHAVIQDRPLWIVFAHDMLIRLTEELIINSNKTIDG  183

Query  8    RG  3
            RG
Sbjct  184  RG  185



>ref|XP_006292606.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
 gb|EOA25504.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
Length=455

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 120/207 (58%), Gaps = 29/207 (14%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
             V +  +LA  +P V AH A H   D YW  R+ EA+Q    AY+P P  VT       +
Sbjct  9    FVFVSLSLAVVVPSVQAHIAVH---DEYWTQRQTEALQQTLEAYDPEPLNVTDHFNHQAA  65

Query  413  KMMNETRlledveydelddEHNSTRRSLM----------RSKRYRGPCKVTNPIDRCWRC  264
              M  T ++            N TRR L           R +RY    +  N ID+CWR 
Sbjct  66   LAMVPTGIV------------NETRRELRQVGRGNKKPRRGRRY----ESLNAIDKCWRG  109

Query  263  DRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLW  84
            D+NW KNRKKLA C LGFG  TTGGK GPFYVVT+  D D++ PK GTLR+AV +  PLW
Sbjct  110  DKNWDKNRKKLADCVLGFGRKTTGGKNGPFYVVTDPSDTDLMNPKPGTLRYAVTRDRPLW  169

Query  83   ITFAKSMTIRLKNELLVTSDKTIDGRG  3
            I FA+SM I+L+ EL++T+DKTIDGRG
Sbjct  170  IIFARSMIIKLQQELIITNDKTIDGRG  196



>ref|XP_010670318.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 122/211 (58%), Gaps = 27/211 (13%)
 Frame = -1

Query  608  KMNWWIVVMLYA-LAAAIPVVMA----HTADHNNTDIY---WVTRK-AEAMQYAKRAYNP  456
            K    I + ++A +  AIP + A    H  +H   D     W  RK AEA   +  AY+ 
Sbjct  5    KFKIQIPIFIFATIFVAIPTIQANTIGHVGNHTTKDTEHDEWFQRKLAEAYNASLLAYHH  64

Query  455  YPELVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDR  276
             P  V +    H+ + +  T               NSTRR L    +Y+G CK  NPIDR
Sbjct  65   DPIEVMNHFNYHVHRALEGT---------------NSTRRGL---NKYQGECKAQNPIDR  106

Query  275  CWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQA  96
            CWRC  +WA +RKKLA C  GFG  TTGGK+G +Y VT+  D+DVV PK GTLR AV+Q 
Sbjct  107  CWRCKADWAVDRKKLADCVKGFGRQTTGGKKGAYYTVTDPSDNDVVNPKPGTLRFAVLQP  166

Query  95   GPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
             PLWI FAK MTI+LK EL++TSDKTIDGRG
Sbjct  167  QPLWIIFAKDMTIKLKAELMITSDKTIDGRG  197



>ref|XP_010425041.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 120/201 (60%), Gaps = 19/201 (9%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            IV +  +LA  +P V AH A++   D YW  R+ EA+     +Y+P P  VT     H +
Sbjct  9    IVFVSLSLAVVVPSVHAHVAEY---DEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAA  65

Query  413  KMMNETRlledveydelddEHNSTRRSLMR----SKRYRGPCKVTNPIDRCWRCDRNWAK  246
              M  T +             N TRR L +     KR  G  +  N ID+CWR ++NW K
Sbjct  66   LAMETTGIS------------NETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGNKNWDK  113

Query  245  NRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKS  66
            NRKKLA C LGFG  TTGGK GP YVVT+  D+D++ PK GTLR+AV +  PLWI FA+ 
Sbjct  114  NRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTLRYAVTRDRPLWIIFARH  173

Query  65   MTIRLKNELLVTSDKTIDGRG  3
            M I+L+ EL++T+DKTIDGRG
Sbjct  174  MIIKLQQELIITNDKTIDGRG  194



>ref|XP_006363934.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=439

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 117/200 (59%), Gaps = 22/200 (11%)
 Frame = -1

Query  602  NWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTK  423
            N  ++++   LA+ +P + A  A+    D Y   +  E +  +  AY   PE VT+   K
Sbjct  7    NSILLILFIWLASLVPHIHARIAEF---DAYLEKQALEDLNSSLEAYTHNPEEVTNAFNK  63

Query  422  HISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKN  243
             +   + +                    +SL R+ + +  C  TNPIDRCWRCD+NWA+N
Sbjct  64   EVGNALLK-------------------YKSLRRNLKEKNKCMATNPIDRCWRCDKNWAEN  104

Query  242  RKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSM  63
            R  L  CA GFG  TTGGK G +YVVT+  DD+V EPK GTLRHAVIQ  PLWI F KSM
Sbjct  105  RMDLEECARGFGHKTTGGKNGKYYVVTDESDDNVQEPKPGTLRHAVIQEEPLWIIFEKSM  164

Query  62   TIRLKNELLVTSDKTIDGRG  3
             I+L+ EL++TSDKTIDGRG
Sbjct  165  VIKLQQELMITSDKTIDGRG  184



>ref|XP_004228388.1| PREDICTED: pectate lyase [Solanum lycopersicum]
Length=439

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 117/200 (59%), Gaps = 22/200 (11%)
 Frame = -1

Query  602  NWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTK  423
            N  ++V+   LA+ +P + A  A+    D Y   +  EA+  +  AY   PE +T+   K
Sbjct  7    NSILLVLFIWLASLVPHLHARIAEF---DPYLEKQALEALNSSLEAYTNNPEEITNAFNK  63

Query  422  HISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKN  243
             +   + +                    +SL R  + +  C  TNPIDRCWRCD+NWA+N
Sbjct  64   EVGNALLK-------------------YKSLRRHLKEKDKCMATNPIDRCWRCDKNWAEN  104

Query  242  RKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSM  63
            R  L  CA GFG  TTGGK G +YVVT+  DD+V EPK GTLRHAVIQ  PLWI F KSM
Sbjct  105  RMDLEECARGFGHKTTGGKNGKYYVVTDESDDNVQEPKPGTLRHAVIQEEPLWIIFEKSM  164

Query  62   TIRLKNELLVTSDKTIDGRG  3
             I+L+ EL++TSDKTIDGRG
Sbjct  165  VIKLRQELMITSDKTIDGRG  184



>ref|XP_007138209.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
 gb|ESW10203.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
Length=434

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 116/200 (58%), Gaps = 21/200 (11%)
 Frame = -1

Query  602  NWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTK  423
            N+ ++       A +P + A+       D  W  R  EA + AK+AY P P  VT++   
Sbjct  5    NFSLLFFYVIFLAILPTLQANIGQF---DHVWHRRLKEAREAAKQAYKPNPMKVTAEFNT  61

Query  422  HISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKN  243
            H+ + M  +               NSTRR L +       C+  NPID+CWRCD +W KN
Sbjct  62   HVMRAMKGS---------------NSTRRGLGKKND---ECEAANPIDKCWRCDPDWEKN  103

Query  242  RKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSM  63
            RKKLA CA+GFG GTTGGK G  YVV +  D D+V PK GTLRHAVIQ  PLWI F+++M
Sbjct  104  RKKLADCAIGFGHGTTGGKDGKIYVVGDNSDKDLVNPKPGTLRHAVIQTEPLWIIFSRNM  163

Query  62   TIRLKNELLVTSDKTIDGRG  3
             IRL  ELL+T +KTID RG
Sbjct  164  NIRLTAELLITDNKTIDARG  183



>ref|XP_006484673.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 114/196 (58%), Gaps = 21/196 (11%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            ++ L++ A  +P + AH A+ N     W  R  EAMQ  ++ Y+P P  V + L   +  
Sbjct  8    LIFLFSFATLMPCLSAHIAEVNEV---WRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQD  64

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
            +  +                   +R L+ ++   G C+ TNPID+CWRC  NWA++R+ L
Sbjct  65   LSKQA----------------IAKRGLLNAES--GQCEATNPIDKCWRCKENWAEDRQAL  106

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A CALGFG+  TGGK G  Y VT+  D+D+  PK GTLRHAVIQ  PLWI FAK M I+L
Sbjct  107  AGCALGFGSKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKL  166

Query  50   KNELLVTSDKTIDGRG  3
            + EL+V   KTIDGRG
Sbjct  167  QQELIVQGSKTIDGRG  182



>gb|KHN08706.1| Putative pectate lyase 3 [Glycine soja]
Length=444

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 105/172 (61%), Gaps = 18/172 (10%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D YW  + + A +  K+AY   P  +T  LT  +S+++                   + R
Sbjct  37   DSYWKQKASVAEKENKQAYTSDPYSLTKNLTYSVSEII---------------VGEQNGR  81

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
            R+L   K   G C  TNPIDRCWRCD NWA NRKKLA+C  GFG  T GGK GPFYVVT+
Sbjct  82   RNL---KGKGGNCMATNPIDRCWRCDPNWANNRKKLANCVQGFGRNTVGGKNGPFYVVTS  138

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              D+D+V P  GTLRHAV + GPLWI FA SM IRL  EL++ SDKTIDGRG
Sbjct  139  NLDNDMVNPVPGTLRHAVTRTGPLWIIFAHSMKIRLNQELIMASDKTIDGRG  190



>ref|XP_004234780.1| PREDICTED: probable pectate lyase P56 [Solanum lycopersicum]
 sp|P15721.2|PLY56_SOLLC RecName: Full=Probable pectate lyase P56; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33524.1| P56 protein [Solanum lycopersicum]
Length=398

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 91/116 (78%), Gaps = 2/116 (2%)
 Frame = -1

Query  350  NSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFY  171
            N+ RR L  +K+YRGPC   N ID+CWRCD  WA++R+K+A CALGFG    GGK GP+Y
Sbjct  29   NAPRRKL--TKKYRGPCMAVNSIDKCWRCDPFWAEDRQKMADCALGFGINAMGGKYGPYY  86

Query  170  VVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            +VT+  DDDVV+PK GTLR  VIQ GPLWITFA+SM IRL  EL+V+S+KTIDGRG
Sbjct  87   IVTDNSDDDVVDPKPGTLRFGVIQKGPLWITFARSMRIRLTRELIVSSNKTIDGRG  142



>ref|XP_006344502.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=435

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 105/172 (61%), Gaps = 18/172 (10%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D  W  R  +A + A+ AYNP P++V   L   + K +  +               NS R
Sbjct  29   DEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQVDKAVRGS---------------NSRR  73

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
            R L    RY G C  TNPID+CWRCD NWA+NR KL  C LGFG  TTGGK G  YVV +
Sbjct  74   RDL---HRYSGKCMATNPIDQCWRCDPNWARNRMKLTDCVLGFGRKTTGGKGGKIYVVMD  130

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              D+++V PK GTLRHAVIQ  PLWI FAK+M IRL  EL++TS+KTID RG
Sbjct  131  NSDNELVNPKPGTLRHAVIQPEPLWIIFAKNMVIRLNQELIMTSNKTIDARG  182



>emb|CDP02198.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 117/210 (56%), Gaps = 14/210 (7%)
 Frame = -1

Query  593  IVVMLYALA-AAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHI  417
            + V L A     +P ++      +  + YW  R  EA  +  +AY   P  V     K  
Sbjct  9    VCVFLCAFTIVVVPTLITAQGSGSAEEEYWRIRAEEAWNHTLKAYEANPHTVIGAFNKQA  68

Query  416  SK--MMNETRlledvey----------delddEHNSTRRSLMRSKRYRGPCKVTNPIDRC  273
            S+  M  +T   +D              +   E NSTRR L R K++ G C  TNPIDRC
Sbjct  69   SENEMPGKTAAQDDKLTKLNLPPCCHTQQFLSEKNSTRREL-RGKKWGGGCLATNPIDRC  127

Query  272  WRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAG  93
            WRC  NWA NRK+LA C +GFG GTTGGK G FYVVT+  DD ++ PK GTLRHAVIQ  
Sbjct  128  WRCQPNWADNRKRLADCVVGFGRGTTGGKNGAFYVVTDSSDDSILAPKPGTLRHAVIQKE  187

Query  92   PLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            PLWI F + M IRL  EL++  DKTIDGRG
Sbjct  188  PLWIIFERDMVIRLTQELIMQGDKTIDGRG  217



>ref|XP_003519771.2| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=447

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 105/172 (61%), Gaps = 18/172 (10%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D YW  + + A +  K+AY   P  +T  LT  +S+++                   + R
Sbjct  40   DSYWKQKASVAEKENKQAYTSDPYSLTKNLTYSVSEII---------------VGEQNGR  84

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
            R+L   K   G C  TNPIDRCWRCD NWA NRKKLA+C  GFG  T GGK GPFYVVT+
Sbjct  85   RNL---KGKGGNCMATNPIDRCWRCDPNWANNRKKLANCVQGFGRNTVGGKNGPFYVVTS  141

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              D+D+V P  GTLRHAV + GPLWI FA SM IRL  EL++ SDKTIDGRG
Sbjct  142  NLDNDMVNPVPGTLRHAVTRTGPLWIIFAHSMKIRLNQELIMASDKTIDGRG  193



>gb|EYU28712.1| hypothetical protein MIMGU_mgv1a006498mg [Erythranthe guttata]
Length=442

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 118/197 (60%), Gaps = 19/197 (10%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            I+++L ++   + ++    A     D Y   +  E+   + +A++P PE V  +L + + 
Sbjct  10   IILLLLSMIYFVTLIPKSHAAIAKYDDYLRKKANESFAESLKAFDPNPEKVADELNEQVG  69

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
            + +                  N +RR L    +    CK TNPIDRCWRCD +W+KNRKK
Sbjct  70   ETL---------------VHENLSRRHL----KEENDCKATNPIDRCWRCDGDWSKNRKK  110

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA C  GFG  TTGGK G +Y+VT+  DDD+ +PK GTLRHAVIQ+ PLWI FA+SM IR
Sbjct  111  LAECVRGFGHRTTGGKDGRYYLVTDPSDDDMDKPKNGTLRHAVIQSEPLWIIFARSMVIR  170

Query  53   LKNELLVTSDKTIDGRG  3
            LK EL+  SDKT+DGRG
Sbjct  171  LKQELIFASDKTVDGRG  187



>gb|KDO49230.1| hypothetical protein CISIN_1g036607mg [Citrus sinensis]
Length=436

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 113/196 (58%), Gaps = 21/196 (11%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            ++ L++ A  +P + AH A+ N     W  R  EAMQ  ++ Y+P P  V + L   +  
Sbjct  8    LIFLFSFATLMPCLSAHIAEVNEV---WRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQD  64

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
            +  +                   +R L+ ++   G C  TNPID+CWRC  NWA++R+ L
Sbjct  65   LSKQA----------------IAKRGLLNAES--GQCAATNPIDKCWRCKENWAEDRQAL  106

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A CALGFG+  TGGK G  Y VT+  D+D+  PK GTLRHAVIQ  PLWI FAK M I+L
Sbjct  107  AGCALGFGSKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKL  166

Query  50   KNELLVTSDKTIDGRG  3
            + EL+V   KTIDGRG
Sbjct  167  QQELIVQGSKTIDGRG  182



>ref|XP_010523445.1| PREDICTED: probable pectate lyase 3 [Tarenaya hassleriana]
Length=464

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 118/208 (57%), Gaps = 22/208 (11%)
 Frame = -1

Query  602  NWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTK  423
            N+ +  +  +++     V AH A     D YW  R+A A++   R Y+P P  VT     
Sbjct  12   NFVLCFLFSSISDVAQPVKAHVAVF---DEYWTQRQAHALRQTLRFYDPNPFNVTDHFNH  68

Query  422  HISKMMNETRlledveydelddEHNSTRRSLMR--------SKRYRGPCKVTNPIDRCWR  267
            H++  + E             +  N TRR L +         +R  G C   NPIDRCWR
Sbjct  69   HVNLAVEEA-----------TEASNGTRRELWQVGSGGKHLKRRNTGKCVAYNPIDRCWR  117

Query  266  CDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPL  87
            C  NWAK+RKKLA C LGFG  TTGGK G +YVVT+  D D++ P+ GTLRHAV +  PL
Sbjct  118  CQPNWAKDRKKLADCVLGFGRRTTGGKAGRYYVVTDASDTDLINPRPGTLRHAVTRDEPL  177

Query  86   WITFAKSMTIRLKNELLVTSDKTIDGRG  3
            WI F +SM IRL  EL++TS+KTIDGRG
Sbjct  178  WIVFERSMVIRLAQELIITSNKTIDGRG  205



>ref|XP_002437204.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
 gb|EER88571.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
Length=454

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 121/197 (61%), Gaps = 16/197 (8%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
            +L+ L   +   ++  A+  + D YW  RK  A   A+  Y   P  VT++L + + + +
Sbjct  15   VLFYLVLFLSAAVSSEANIGDFDDYWRQRKLMADAAAEATYKHDPLEVTNQLNRAVHRSV  74

Query  404  NETRlledveydelddEHNSTRRSLMRSKRYR---GPCKVTNPIDRCWRCDRNWAKNRKK  234
             +  +             ++ RR++M  K+ +   GPC+ TNPIDRCWRC ++WA +RK+
Sbjct  75   EKEDM-------------STRRRAMMGHKKGKLNNGPCEATNPIDRCWRCRQDWATDRKR  121

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA CA GFG  TTGG  G FYVVT+  DDDVV P+ GTLR AVIQ  PLWITFA++M I 
Sbjct  122  LARCAQGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWAVIQIEPLWITFARTMIIT  181

Query  53   LKNELLVTSDKTIDGRG  3
            LK EL++  DKTIDGRG
Sbjct  182  LKEELIIQGDKTIDGRG  198



>gb|KHG05193.1| hypothetical protein F383_30875 [Gossypium arboreum]
Length=385

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 89/117 (76%), Gaps = 1/117 (1%)
 Frame = -1

Query  350  NSTRRSL-MRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPF  174
            NSTRRSL  + K+Y GPC   NPIDRCWRC +NWAKNRK+LA C LGFG  T GGK+G +
Sbjct  14   NSTRRSLRGKHKKYTGPCMAINPIDRCWRCKKNWAKNRKRLAKCVLGFGHKTRGGKKGEY  73

Query  173  YVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            Y+VT+  DDDVV PK GTLRHAVIQ  PLWI FA  M I+L  EL+V S KTIDGRG
Sbjct  74   YLVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSKELMVQSHKTIDGRG  130



>gb|KFK33456.1| hypothetical protein AALP_AA5G015800 [Arabis alpina]
Length=460

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 115/198 (58%), Gaps = 22/198 (11%)
 Frame = -1

Query  575  ALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNET  396
            ALA   P V AH A +   D YW  R+ EA++    +Y P P  VT     H +  M  T
Sbjct  19   ALAIIAPSVQAHIAVY---DEYWTQRQTEALRRTLESYEPDPLNVTDHFNYHSALAMETT  75

Query  395  RlledveydelddEHNSTRRSL-------MRSKRYRGPCKVTNPIDRCWRCDRNWAKNRK  237
              +            N TRR L          K+  G  +  N ID+CWR D+NWAKNRK
Sbjct  76   EAV------------NGTRRELRVVGGGRKTIKKRGGRFQSLNAIDKCWRGDKNWAKNRK  123

Query  236  KLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTI  57
            KLA C LGFG  TTGGK GP Y VT+  D+DV+ P+ GTLRHAV +  PLWI FAKSM I
Sbjct  124  KLADCVLGFGRKTTGGKAGPIYEVTDASDNDVMNPRPGTLRHAVTRDRPLWIIFAKSMVI  183

Query  56   RLKNELLVTSDKTIDGRG  3
            +L+ EL++T+DKTIDGRG
Sbjct  184  KLQQELIITNDKTIDGRG  201



>ref|XP_004966014.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=486

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 119/196 (61%), Gaps = 17/196 (9%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
            +LYA+   +   ++  A+    D YW  RK  A   A+  Y   P  V ++L + + + +
Sbjct  51   VLYAVVLLLSAAVSE-ANIGEFDDYWRQRKLMADAAAEATYQHDPIEVPNQLNRAVHRSI  109

Query  404  NETRlledveydelddEHNSTRRSLMRSKRYR--GPCKVTNPIDRCWRCDRNWAKNRKKL  231
             +  +              STRR ++  K+ +  GPCK TNPIDRCWRC ++WA +RK+L
Sbjct  110  KKEDI--------------STRREMLGQKKGKMNGPCKATNPIDRCWRCRKDWATDRKRL  155

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A CA GFG  TTGG  G FYVVT+  DDDVV P+ GTLR AVIQ  PLWITFAK+M I L
Sbjct  156  ARCAQGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWAVIQIEPLWITFAKTMIITL  215

Query  50   KNELLVTSDKTIDGRG  3
            K EL++  DKTIDGRG
Sbjct  216  KEELIIRGDKTIDGRG  231



>ref|XP_010528323.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=458

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 117/198 (59%), Gaps = 8/198 (4%)
 Frame = -1

Query  587  VMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKM  408
            V L    + IP +     ++   D Y   ++AEA + A RAY+P  +    K   +    
Sbjct  11   VFLVCFVSQIPNLRGKIGEY---DDYLRKQEAEAQEQALRAYDPEFDQTVKKFDHNDPSH  67

Query  407  MNETRlledveydelddEHNSTRRSLMRS---KRYRGPCKVTNPIDRCWRCDRNWAKNRK  237
             N T  ++       +    STRRSL      K+  GPCK TNP+D+CWRC  +WA+NRK
Sbjct  68   QNATISIKGGYRPNKNT--TSTRRSLRGRGNWKKIAGPCKATNPVDKCWRCQADWAQNRK  125

Query  236  KLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTI  57
            +L SC  GFG  TTGG  G FY VT+  DDD+  PK GT+RHAVIQ  PLWI FA+SM I
Sbjct  126  RLVSCVRGFGHKTTGGFSGKFYKVTDPSDDDMQNPKPGTIRHAVIQKVPLWIIFARSMHI  185

Query  56   RLKNELLVTSDKTIDGRG  3
            RLK EL++TS+KTID RG
Sbjct  186  RLKQELMITSNKTIDARG  203



>ref|XP_011086389.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=442

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 118/202 (58%), Gaps = 24/202 (12%)
 Frame = -1

Query  608  KMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKL  429
            K +  +++++ +    +P   A  A +   D Y   R   +++ +++A+NP PE +   L
Sbjct  9    KFSILVLIIILSFVLLLPKSGAAIAKY---DEYLKKRAQASLEESRKAFNPNPEELADDL  65

Query  428  TKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWA  249
               +S+ +                    TR    R+ R +G CK TNPIDRCWRCD NW 
Sbjct  66   NDQVSETL--------------------TREGGKRNLR-QGGCKATNPIDRCWRCDPNWD  104

Query  248  KNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAK  69
            KNRK+LA CA GFG   TGGK G +YVVT+  D+D+ +PK GTLRHAVIQ  PLWI F +
Sbjct  105  KNRKQLAECARGFGHRATGGKSGRYYVVTDPSDNDMDKPKPGTLRHAVIQPQPLWIIFGR  164

Query  68   SMTIRLKNELLVTSDKTIDGRG  3
            +M I LK EL+  SDKT+DGRG
Sbjct  165  NMVITLKEELIFASDKTVDGRG  186



>ref|XP_004490004.1| PREDICTED: probable pectate lyase 3-like isoform X2 [Cicer arietinum]
Length=376

 Score =   145 bits (366),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -1

Query  341  RRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVT  162
            RR+L R ++  GPC  TNPIDRCWRCD NWA NRKKLA C  GFG  TTGGK GPFYVVT
Sbjct  11   RRNL-RGRKTAGPCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKAGPFYVVT  69

Query  161  NRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            +  D D+V P+ GTLRHAV + GPLWI FA+SM IRL  EL++TSDKTIDGRG
Sbjct  70   DPSDSDMVNPRPGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGRG  122



>ref|XP_008366366.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=479

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = -1

Query  350  NSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFY  171
            N TRR+L   ++Y+GPC  TNPIDRCWRCD NW  NRKKLA CA GFG  TTGGK G  Y
Sbjct  114  NKTRRNL--KQKYKGPCLATNPIDRCWRCDPNWETNRKKLADCAKGFGHKTTGGKAGKIY  171

Query  170  VVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            VVT+  D+D+V PK GTLRHAVIQ GPLWI FA+ M I+L+ EL+VTSDKTID RG
Sbjct  172  VVTDNSDNDMVNPKPGTLRHAVIQTGPLWIIFARDMRIKLREELMVTSDKTIDARG  227



>dbj|BAK06965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 114/197 (58%), Gaps = 15/197 (8%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            + ++LYA+   +       A+    D +W  RK EA   A+  Y+P P  V + L + + 
Sbjct  10   VSLLLYAVLF-LSAAAVSEANIGEFDEHWQRRKLEARARAEATYHPNPIEVANSLNRAVH  68

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
            + + +                 S R+ L   K++ GPC  TNPIDRCWRC ++WA +R +
Sbjct  69   RSLRDES--------------GSRRKLLGLHKKFAGPCTATNPIDRCWRCRKDWATDRMR  114

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA CA GFG   TGG  G  Y+VT+  DDDV+EP+ GTLR  VIQ  PLWI FA+ M I+
Sbjct  115  LARCAQGFGRNATGGLGGKIYIVTDGTDDDVLEPRPGTLRWGVIQNEPLWIIFARPMLIK  174

Query  53   LKNELLVTSDKTIDGRG  3
            LK ELLV SDKTIDGRG
Sbjct  175  LKEELLVGSDKTIDGRG  191



>ref|XP_002875142.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51401.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 120/203 (59%), Gaps = 21/203 (10%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
             V +  +L   +P V AH A +   D YW  R+  A++    +Y+P P+ VT     H +
Sbjct  9    FVFVSLSLTVVVPSVQAHIAVY---DDYWTQRQTIALRQTLESYDPNPDNVTDHFNYHAA  65

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSK------RYRGPCKVTNPIDRCWRCDRNW  252
              M  T ++            N TRR L + +      R  G  +  N ID+CWR D+NW
Sbjct  66   LAMETTGIV------------NETRRDLRQVRSGKKKPRRGGRFESLNAIDKCWRGDKNW  113

Query  251  AKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFA  72
             KNRKKLA C LGFG  TTGGK GP YVVT+  D+D++ PK GT+RHAV +  PLWI FA
Sbjct  114  DKNRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTIRHAVTRDRPLWIVFA  173

Query  71   KSMTIRLKNELLVTSDKTIDGRG  3
            +SM I+L+ EL++T+DKTIDGRG
Sbjct  174  RSMIIKLQQELIITNDKTIDGRG  196



>ref|NP_001150723.1| pectate lyase precursor [Zea mays]
 gb|ACG40127.1| pectate lyase precursor [Zea mays]
Length=451

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 119/201 (59%), Gaps = 23/201 (11%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            + ++ + L+AA+       A+  + D YW  RK  A   A+  Y   P  V ++L + + 
Sbjct  15   LYLVFFFLSAALS-----EANIGDFDEYWQQRKLMADAAAEATYKHDPVEVANQLNRAVH  69

Query  413  KMMNETRlledveydelddEHNSTRRSLM----RSKRYRGPCKVTNPIDRCWRCDRNWAK  246
            + + +  +               TRR +M    R  ++ GPC+ TNPIDRCWRC ++WA 
Sbjct  70   RSVEKDDI--------------GTRREMMGTTTRKSKFSGPCRATNPIDRCWRCRQDWAT  115

Query  245  NRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKS  66
            +RK+LA CA GFG  TTGG  G FYVVT+  DDDVV P+ GTLR  VIQ  PLWITFAK+
Sbjct  116  DRKRLARCAKGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKT  175

Query  65   MTIRLKNELLVTSDKTIDGRG  3
            M I LK EL++  DKTIDGRG
Sbjct  176  MIITLKEELIIRGDKTIDGRG  196



>gb|AFW87059.1| pectate lyase [Zea mays]
Length=451

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 119/201 (59%), Gaps = 23/201 (11%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            + ++ + L+AA+       A+  + D YW  RK  A   A+  Y   P  V ++L + + 
Sbjct  15   LYLVFFFLSAALS-----EANIGDFDEYWQQRKLMADAAAEATYKHDPVEVANQLNRAVH  69

Query  413  KMMNETRlledveydelddEHNSTRRSLM----RSKRYRGPCKVTNPIDRCWRCDRNWAK  246
            + + +  +               TRR +M    R  ++ GPC+ TNPIDRCWRC ++WA 
Sbjct  70   RSVEKEDI--------------GTRREMMGTTTRKSKFSGPCRATNPIDRCWRCRQDWAT  115

Query  245  NRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKS  66
            +RK+LA CA GFG  TTGG  G FYVVT+  DDDVV P+ GTLR  VIQ  PLWITFAK+
Sbjct  116  DRKRLARCAKGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKT  175

Query  65   MTIRLKNELLVTSDKTIDGRG  3
            M I LK EL++  DKTIDGRG
Sbjct  176  MIITLKEELIIRGDKTIDGRG  196



>ref|XP_004236194.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=435

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 106/172 (62%), Gaps = 18/172 (10%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D  W  R  +A + A+ AYNP P++V   L   + K +  ++               S R
Sbjct  29   DEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQVDKAVRGSK---------------SRR  73

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
            R L   +RY G C  TNPID+CWRCD NWA+NR KL  C LGFG  TTGGK G  YVV +
Sbjct  74   RDL---QRYSGKCMATNPIDQCWRCDPNWARNRMKLTDCVLGFGRKTTGGKGGKIYVVMD  130

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              D+++V PK GTLRHAVIQ  PLWI FAK+M I+L  EL++TS+KTID RG
Sbjct  131  NSDNELVNPKPGTLRHAVIQPEPLWIIFAKNMVIKLNQELIMTSNKTIDARG  182



>ref|XP_003543726.1| PREDICTED: pectate lyase [Glycine max]
Length=443

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 111/195 (57%), Gaps = 21/195 (11%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
            +L   A  IP + A  A+    D +   +  EA + A  +Y P P  V  +L  H+   +
Sbjct  16   LLATFAIVIPCLEAGIAEF---DDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVHMAL  72

Query  404  NETRlledveydelddEHNSTRRSLMRSK-RYRGPCKVTNPIDRCWRCDRNWAKNRKKLA  228
                              NSTRR L + K R  G C+ +NPID CWRC+++WA +R +LA
Sbjct  73   -----------------ENSTRRELRQRKLRGGGKCQASNPIDACWRCNKDWANDRFRLA  115

Query  227  SCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLK  48
             C  GFG   TGG  GP YVVT+  DDD+V PK GT+RHAV Q GPLWI F  SM I L+
Sbjct  116  KCGKGFGRRATGGLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQKGPLWIIFGHSMIISLR  175

Query  47   NELLVTSDKTIDGRG  3
             EL+++SDKTIDGRG
Sbjct  176  QELMISSDKTIDGRG  190



>ref|XP_007157384.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
 gb|ESW29378.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
Length=448

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 113/204 (55%), Gaps = 24/204 (12%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADH-----NNT---DIYWVTRKAEAMQYAKRAYNPYPELVTS  435
            + +L  L   IP   A+  +      N T   D YW  RK  A +  + AY   P   T 
Sbjct  7    IFLLTCLVVTIPTFYANVLEDEEFLDNQTKSFDGYWKGRKQVAEKQNQEAYITDPYSFTI  66

Query  434  KLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRN  255
             +T +IS ++                     RR+L   K+ +  C  TNPIDRCWRCD  
Sbjct  67   NMTNNISDLI---------------TGEEKGRRNLA-GKQSQDSCLATNPIDRCWRCDPK  110

Query  254  WAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITF  75
            W++NRKKLA C  GFG  T GGK+GPFYVVT+  D+D+V P  GTLRHAV + GPLWI F
Sbjct  111  WSENRKKLADCVQGFGRDTIGGKKGPFYVVTSNLDNDMVNPVPGTLRHAVTRNGPLWIIF  170

Query  74   AKSMTIRLKNELLVTSDKTIDGRG  3
            A SM IRL  EL+V  DKTIDGRG
Sbjct  171  AHSMNIRLSQELIVAGDKTIDGRG  194



>gb|KHG23093.1| hypothetical protein F383_29772 [Gossypium arboreum]
Length=385

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = -1

Query  350  NSTRRSL-MRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPF  174
            NSTRR L  + K+Y GPC   NPIDRCWRC +NWAKNRK+LA C LGFG  T GGK+G +
Sbjct  14   NSTRRDLRGKHKKYTGPCMAINPIDRCWRCRKNWAKNRKRLAKCVLGFGHKTRGGKKGEY  73

Query  173  YVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            Y+VT+  DDDVV PK GTLRHAVIQ  PLWI FA  M I+L  EL+V S KTIDGRG
Sbjct  74   YLVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSQELMVQSHKTIDGRG  130



>ref|XP_006361836.1| PREDICTED: probable pectate lyase P56-like [Solanum tuberosum]
Length=398

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = -1

Query  350  NSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFY  171
            N+ RR L  +K+Y+GPC   N ID+CWRCD  WA++R+K+A CALGFG    GGK GP+Y
Sbjct  29   NAPRRKL--TKKYKGPCMAVNSIDKCWRCDPFWAEDRQKMADCALGFGINAMGGKYGPYY  86

Query  170  VVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            +VT+  DDDV++PK GTLR  VIQ GPLWITFAKSM I L  EL+V+S+KTIDGRG
Sbjct  87   IVTDNSDDDVIDPKPGTLRFGVIQKGPLWITFAKSMRIELSRELIVSSNKTIDGRG  142



>ref|XP_006482544.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=435

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 113/196 (58%), Gaps = 22/196 (11%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            ++ L++    IP + A        D  W  R  EAMQ  ++ Y+P P  V S L   +  
Sbjct  8    LIFLFSFIILIPCLSAIA----EADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNMKVQD  63

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
            +  +T                + RR L+ ++   G C+ TNPID+CWRC  NWA++R+ L
Sbjct  64   LSKQT----------------AARRGLLNAES--GQCEATNPIDKCWRCKENWAEDRQAL  105

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A CALGFG+  TGGK G  Y VT+  D+++  PK GTLRHAVIQ  PLWI FAK M I+L
Sbjct  106  AGCALGFGSKATGGKGGKIYEVTDSSDNNMENPKVGTLRHAVIQKEPLWIIFAKDMNIKL  165

Query  50   KNELLVTSDKTIDGRG  3
            + EL+V  +KTIDGRG
Sbjct  166  QQELVVQGNKTIDGRG  181



>ref|XP_006431087.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 ref|XP_006431088.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
 gb|ESR44327.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 gb|ESR44328.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
Length=435

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 113/196 (58%), Gaps = 22/196 (11%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            ++ L++    IP + A        D  W  R  EAMQ  ++ Y+P P  V S L   +  
Sbjct  8    LIFLFSFIILIPCLSAIA----EADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNMKVQD  63

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
            +  +T                + RR L+ ++   G C+ TNPID+CWRC  NWA++R+ L
Sbjct  64   LSKQT----------------AARRGLLNAES--GQCEATNPIDKCWRCKENWAEDRQAL  105

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A CALGFG+  TGGK G  Y VT+  D+++  PK GTLRHAVIQ  PLWI FAK M I+L
Sbjct  106  AGCALGFGSKATGGKGGKIYEVTDSSDNNMENPKVGTLRHAVIQKEPLWIIFAKDMNIKL  165

Query  50   KNELLVTSDKTIDGRG  3
            + EL+V  +KTIDGRG
Sbjct  166  QQELVVQGNKTIDGRG  181



>ref|XP_008446067.1| PREDICTED: pectate lyase-like, partial [Cucumis melo]
Length=381

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 90/116 (78%), Gaps = 3/116 (3%)
 Frame = -1

Query  350  NSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFY  171
            N+TRR L   ++Y GPC  TNPIDRCWRCDRNWA+NRKKLA CALGFG GTTGGK G  Y
Sbjct  17   NNTRRHL---RKYTGPCLATNPIDRCWRCDRNWARNRKKLADCALGFGRGTTGGKDGKIY  73

Query  170  VVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            VV +  D+D+V PK GTLRHAVIQ  PLWI FA  M IRL  EL++T +KT+DGRG
Sbjct  74   VVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIMTDNKTLDGRG  129



>ref|XP_009114192.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 113/196 (58%), Gaps = 21/196 (11%)
 Frame = -1

Query  572  LAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETR  393
            LA   P + AH A     D YW  R+A A++    +Y+P P  VT  L  H +  M  T 
Sbjct  20   LAVVAPSIQAHVAVF---DEYWTQRQAAALRQTIESYDPNPFNVTDHLNYHAALAMETT-  75

Query  392  lledveydelddEHNSTRRSLM------RSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
                          N TRR L       ++KR  G     N ID+CWR  RNW KNRKKL
Sbjct  76   -----------GADNGTRRELGQVGGGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKL  124

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A C LGFG  TTGGK+GP YVVT+  DDD++ PK GTLR+AV +  PLWI F +SM I+L
Sbjct  125  ADCVLGFGRKTTGGKKGPMYVVTDASDDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKL  184

Query  50   KNELLVTSDKTIDGRG  3
            + EL++ SDKTIDGRG
Sbjct  185  QQELIINSDKTIDGRG  200



>emb|CDY17432.1| BnaC09g21050D [Brassica napus]
Length=459

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 114/196 (58%), Gaps = 21/196 (11%)
 Frame = -1

Query  572  LAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETR  393
            LA   P V AH A     D YW  R+++A++    +Y+P P  VT  L  H +  M  T 
Sbjct  20   LAVVAPSVQAHVAVF---DEYWTQRQSDALRQTIESYDPNPFNVTDHLNYHAALAMETT-  75

Query  392  lledveydelddEHNSTRRSLM------RSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
                          N TRR L       ++KR  G     N ID+CWR  RNW KNRKKL
Sbjct  76   -----------GADNGTRRKLGQVGDGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKL  124

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A C LGFG  TTGGK+GP YVVT+  DDD++ PK GTLR+AV +  PLWI F +SM I+L
Sbjct  125  ADCVLGFGRKTTGGKKGPIYVVTDAADDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKL  184

Query  50   KNELLVTSDKTIDGRG  3
            + EL++ SDKTIDGRG
Sbjct  185  QQELIINSDKTIDGRG  200



>ref|XP_007139601.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
 gb|ESW11595.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
Length=444

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 117/208 (56%), Gaps = 18/208 (9%)
 Frame = -1

Query  626  MEGMHSKMNWWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPE  447
            M G  SK++   +++L A A  IP +     +    D +   +  EA + A  +Y P P 
Sbjct  1    MVGSSSKVS---IIILVAFAITIPCLEGGIGEF---DDFLKGQALEAHEIALESYVPDPV  54

Query  446  LVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWR  267
             +T  L  ++   + E             +E N TRR L   ++Y GPC   NPIDRCWR
Sbjct  55   NMTDDLNINVHGALTEV----------FKEESNHTRREL--KQKYGGPCLALNPIDRCWR  102

Query  266  CDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPL  87
            C + WAKNR KLA CA GFG   TGG  G  Y+V +  DDD + PK GTLR  V+Q  PL
Sbjct  103  CKKGWAKNRFKLAHCAKGFGRKATGGLEGKMYIVNDPSDDDPINPKPGTLRFGVLQKEPL  162

Query  86   WITFAKSMTIRLKNELLVTSDKTIDGRG  3
            WI FA+SM I+L  ELL++SDKTIDGRG
Sbjct  163  WIIFARSMIIKLNYELLISSDKTIDGRG  190



>emb|CDY04133.1| BnaA09g19110D [Brassica napus]
 gb|AIS67292.1| pectate lyase-like protein 9 [Brassica rapa subsp. chinensis]
Length=459

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 113/196 (58%), Gaps = 21/196 (11%)
 Frame = -1

Query  572  LAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETR  393
            LA   P + AH A     D YW  R+A A++    +Y+P P  VT  L  H +  M  T 
Sbjct  20   LAVVAPSIQAHVAVF---DEYWTQRQAAALRQTIESYDPNPFNVTDHLNYHAALAMETT-  75

Query  392  lledveydelddEHNSTRRSLM------RSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
                          N TRR L       ++KR  G     N ID+CWR  RNW KNRKKL
Sbjct  76   -----------GADNGTRRELGQVGGGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKL  124

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A C LGFG  TTGGK+GP YVVT+  DDD++ PK GTLR+AV +  PLWI F +SM I+L
Sbjct  125  ADCVLGFGRKTTGGKKGPMYVVTDASDDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKL  184

Query  50   KNELLVTSDKTIDGRG  3
            + EL++ SDKTIDGRG
Sbjct  185  QQELIINSDKTIDGRG  200



>gb|ACU23277.1| unknown [Glycine max]
Length=443

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 110/195 (56%), Gaps = 21/195 (11%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
            +L   A  IP + A  A+    D +   +  EA + A  +Y P P  V  +L  H+   +
Sbjct  16   LLATFAIVIPCLEAGIAEF---DDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVHMAL  72

Query  404  NETRlledveydelddEHNSTRRSLMRSK-RYRGPCKVTNPIDRCWRCDRNWAKNRKKLA  228
                              NSTRR L + K R  G C+ +NPID CWRC+++WA +R +LA
Sbjct  73   -----------------ENSTRRELRQRKLRGGGKCQASNPIDACWRCNKDWANDRFRLA  115

Query  227  SCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLK  48
             C  GFG   TGG  GP Y VT+  DDD+V PK GT+RHAV Q GPLWI F  SM I L+
Sbjct  116  KCGKGFGRRATGGLGGPIYAVTDNSDDDMVNPKPGTIRHAVTQKGPLWIIFGHSMIISLR  175

Query  47   NELLVTSDKTIDGRG  3
             EL+++SDKTIDGRG
Sbjct  176  QELMISSDKTIDGRG  190



>ref|XP_006656188.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=446

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 116/199 (58%), Gaps = 23/199 (12%)
 Frame = -1

Query  587  VMLYA--LAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            ++LYA  L +A     A+  D+   D +W  RK  A   A+  Y   P  VT+   + + 
Sbjct  14   LVLYAVFLLSAAATSEANIGDY---DEHWQKRKLMADAAAEATYKRDPFEVTNDFNRAVH  70

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKR--YRGPCKVTNPIDRCWRCDRNWAKNR  240
            +   +                 + RRSLM SKR  + GPCK TNPIDRCWRC  +WA +R
Sbjct  71   RSEEK----------------ETARRSLMLSKRKKFAGPCKATNPIDRCWRCRDDWATDR  114

Query  239  KKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMT  60
            K+LA CA GFG  TTGG  G FYVVT+  DDDVV P+ GTLR  VIQ  PLWI F K+M 
Sbjct  115  KRLARCAQGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQDEPLWIIFGKNMI  174

Query  59   IRLKNELLVTSDKTIDGRG  3
            I LK EL++ +DKT+DGRG
Sbjct  175  INLKEELMIGNDKTVDGRG  193



>ref|XP_009797403.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=439

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 122/198 (62%), Gaps = 24/198 (12%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            +++++ +LA+ +P + A  A+    D Y   +  EA+  +  AYN +PE +T    + + 
Sbjct  10   LLILVISLASLVPNLHAGIAEF---DAYLEKQAKEALNSSLAAYNEHPEEITDTFNREVG  66

Query  413  K-MMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRK  237
              ++N T                    SL R  + +  C  TNPIDRCWRCD NWAKNRK
Sbjct  67   DTLLNIT--------------------SLRRHLKEKSSCMTTNPIDRCWRCDENWAKNRK  106

Query  236  KLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTI  57
            KLA CA GFG  TTGGK G +YVVT+  DDDV +PK GTLRHAVIQ  PLWI F KSM I
Sbjct  107  KLAECARGFGHKTTGGKAGRYYVVTDDSDDDVKDPKPGTLRHAVIQEEPLWIIFEKSMVI  166

Query  56   RLKNELLVTSDKTIDGRG  3
            +LK EL++TSDKTIDGRG
Sbjct  167  KLKEELMITSDKTIDGRG  184



>ref|XP_008786760.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=467

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 108/175 (62%), Gaps = 17/175 (10%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D +W  +  EA   ++ AY+P PE VT+   + +   + + R              NSTR
Sbjct  54   DDHWQKKAEEAFARSRAAYHPDPEGVTNHFNQAVHLALAQAR--------------NSTR  99

Query  338  RSL--MRSKRYR-GPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYV  168
            R L  +R+ ++R G C  +NPIDRCWRC ++W K+RKKLASC  GFG    GG+ G FYV
Sbjct  100  RGLKAVRADKFRQGQCVASNPIDRCWRCQKDWIKDRKKLASCGKGFGRNAVGGRDGDFYV  159

Query  167  VTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            VT+  D+D+V PK GTLR  VIQ  PLWI FA+ M IRL  EL++ S+KTID RG
Sbjct  160  VTDPSDNDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELIINSNKTIDARG  214



>ref|NP_186776.1| putative pectate lyase 7 [Arabidopsis thaliana]
 sp|Q9SRH4.1|PLY7_ARATH RecName: Full=Probable pectate lyase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF03499.1|AC010676_9 putative pectate lyase [Arabidopsis thaliana]
 gb|AAF26147.1|AC008261_4 putative pectate lyase [Arabidopsis thaliana]
 gb|ABI93918.1| At3g01270 [Arabidopsis thaliana]
 gb|AEE73631.1| putative pectate lyase 7 [Arabidopsis thaliana]
Length=475

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 125/214 (58%), Gaps = 20/214 (9%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP-ELVTSKLTKHI-  417
            +V +  +A+ IP + A+ AD   TD YWV +  EA ++   AY+P P E+V     +H  
Sbjct  9    LVCVICIASLIPTIRANVAD--ETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYD  66

Query  416  -SKMMNETRlledveydelddEH------NSTRRSLMRS---------KRYRGPCKVTNP  285
             S  +  T   + V  +E D         NSTRRSL             +  GPC  +NP
Sbjct  67   NSTDVEGTEEEKAVASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNP  126

Query  284  IDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAV  105
            ID+CWRC  +WA+ RKKL  C  GFG  TTGGKRG  YVVT+  DDD+V P+ GTLRHAV
Sbjct  127  IDKCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAV  186

Query  104  IQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            IQ  PLWI F   M+IRL  EL++TSDKTID RG
Sbjct  187  IQKEPLWIVFKHDMSIRLSQELMITSDKTIDARG  220



>ref|XP_002453531.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
 gb|EES06507.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
Length=445

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 105/179 (59%), Gaps = 16/179 (9%)
 Frame = -1

Query  539  TADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydeld  360
            TA+  + D +W  RK  A    +  Y P P  VT+     + +  +  R           
Sbjct  31   TANIADFDEHWQKRKELAEASVRETYRPDPYNVTNSFNVAVHRATSLRR-----------  79

Query  359  dEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrG  180
                 T R + R  + +GPC+ TNPID+CWRC  +WA +R +LA CA GFG  TTGG  G
Sbjct  80   -----TMREMPRKHKKKGPCRATNPIDKCWRCKNDWATDRFRLARCARGFGQATTGGLGG  134

Query  179  PFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            P Y+VT+  D DVV P+ GTLR  VIQ GPLWI FAKSM I+L  ELLV+SDKTIDGRG
Sbjct  135  PIYIVTDPSDGDVVNPRPGTLRWGVIQPGPLWIIFAKSMIIQLSQELLVSSDKTIDGRG  193



>emb|CDX70590.1| BnaC03g06740D [Brassica napus]
Length=475

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 119/216 (55%), Gaps = 24/216 (11%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP-ELVTSKLTKHIS  414
            +++++ +A  IP + A   D +  D YW  R  EA ++  +AY+  P E++     +H  
Sbjct  9    LMLVFCIAGLIPTIQA---DMSELDEYWSQRADEAREFTLQAYHSDPYEIIDHFHERHYD  65

Query  413  KMMN-------------ETRlledveydelddEHNSTRRSLMRSK------RYRGPCKVT  291
               +             E            D+  NSTRRSL R K      + +GPC  +
Sbjct  66   NSTDITPTEEASNAKPEEVENEVIEMVGSGDNSTNSTRRSL-RGKGKGKWSKLKGPCTAS  124

Query  290  NPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRH  111
            NPID+CWRC +NWAK RKKL  C  GFG  T GGK G  YVVT+  D+DVV P+ GTLRH
Sbjct  125  NPIDKCWRCRKNWAKRRKKLVKCVRGFGHMTVGGKHGRIYVVTSNLDEDVVNPEPGTLRH  184

Query  110  AVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            AVIQ  PLWI F   M+IRL  EL++ S KTID RG
Sbjct  185  AVIQEEPLWIIFKNDMSIRLNQELMINSFKTIDARG  220



>ref|XP_010527871.1| PREDICTED: probable pectate lyase 3 isoform X1 [Tarenaya hassleriana]
Length=709

 Score =   145 bits (366),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 82/151 (54%), Positives = 101/151 (67%), Gaps = 20/151 (13%)
 Frame = -1

Query  425  KHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRG----------PCKVTNPIDR  276
            +H++K + ET          +   +N TRR L++  + RG           C   NPIDR
Sbjct  310  RHVNKAVEET----------MKTGNNGTRRELLQVGQSRGQHPKRRNLGGKCVAYNPIDR  359

Query  275  CWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQA  96
            CWRCD  W+KNRKKLA CALGFG  TTGGK GP+YVVT+  DDD++ PK GTLRHAV + 
Sbjct  360  CWRCDPGWSKNRKKLADCALGFGRKTTGGKAGPYYVVTDASDDDLLNPKAGTLRHAVTRE  419

Query  95   GPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
             PLWI FAKSM I+L+ EL++TSDKTIDGRG
Sbjct  420  EPLWIVFAKSMVIKLQQELIMTSDKTIDGRG  450



>ref|NP_001057945.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAD68734.1| putative pectate lyase [Oryza sativa Japonica Group]
 dbj|BAF19859.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAG93046.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80871.1| hypothetical protein OsI_23497 [Oryza sativa Indica Group]
Length=448

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 109/197 (55%), Gaps = 19/197 (10%)
 Frame = -1

Query  587  VMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKM  408
            ++LYA+   +       A+    D YW  RK  A   A+  Y   P  VT+   + + + 
Sbjct  16   LVLYAVFLLLSAAATSEANIGEYDEYWQKRKLMADAAAEATYKRDPFEVTNSFNRAVHRS  75

Query  407  MNETRlledveydelddEHNSTRRSLMRSKR--YRGPCKVTNPIDRCWRCDRNWAKNRKK  234
              E                 S RR L  +KR  + GPCK TNPIDRCWRC  +W  +RK+
Sbjct  76   EEE-----------------SGRRELAMTKRKKFAGPCKATNPIDRCWRCRADWVTDRKR  118

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA CA GFG  TTGG  G FY+VT+  DDDV  P+ GTLR  VIQ  PLWI FAK M I 
Sbjct  119  LARCAQGFGRNTTGGLAGKFYLVTDGTDDDVENPRPGTLRWGVIQDEPLWIIFAKDMIIN  178

Query  53   LKNELLVTSDKTIDGRG  3
            LK E+++ SDKTIDGRG
Sbjct  179  LKEEMMINSDKTIDGRG  195



>gb|EPS73633.1| hypothetical protein M569_01123, partial [Genlisea aurea]
Length=455

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 104/172 (60%), Gaps = 18/172 (10%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D Y  +R  EA + + +AY   PE V  +  + +S  +                  NSTR
Sbjct  23   DEYMKSRAEEARRESLKAYKDNPEDVAEQFNQLVSDSL---------------IGANSTR  67

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
            R L   +   G C+ TNPIDRCWRCD +WAKNRKKLA C  GFG  TTGGK G +Y+VT+
Sbjct  68   RDL---RGVGGGCRATNPIDRCWRCDNDWAKNRKKLADCVRGFGHDTTGGKNGRYYLVTD  124

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              D+D+  PK GTLRHAVIQ  PLWI FA SM IRL  EL+ TS KTIDGRG
Sbjct  125  PSDNDMANPKPGTLRHAVIQKEPLWIIFAHSMIIRLNQELIFTSHKTIDGRG  176



>ref|XP_006573090.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=448

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 111/204 (54%), Gaps = 28/204 (14%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNN----------TDIYWVTRKAEAMQYAKRAYNPYPELVTS  435
            +L  L   IP + A+  +              D YW  R + A +  ++AY   P  +T 
Sbjct  9    LLTCLVVMIPTLYANVKEDEAYWKRQSEVLLVDSYWQERASIAEKENQQAYTSDPYSLTK  68

Query  434  KLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRN  255
             LT  +S+++                     +      +   G C  TNPIDRCWRCD N
Sbjct  69   NLTFSVSEIII------------------GEKSGRRNLRGRGGKCMATNPIDRCWRCDPN  110

Query  254  WAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITF  75
            WA NRKKLA C  GFG  T GGK GPFYVV +  D+D+V P  GTLRHAV ++GPLWI F
Sbjct  111  WANNRKKLADCVQGFGRNTIGGKNGPFYVVNSSLDNDMVNPAPGTLRHAVTRSGPLWIIF  170

Query  74   AKSMTIRLKNELLVTSDKTIDGRG  3
            A+SM IRL  EL++TSDKTIDGRG
Sbjct  171  ARSMNIRLSQELIMTSDKTIDGRG  194



>ref|XP_004489374.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=447

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 107/196 (55%), Gaps = 18/196 (9%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK  411
            +++L      IP + A  A+    D +   +  EA + A  +Y P P  V   L  H+  
Sbjct  16   LILLVTFTITIPCLEAGIAEF---DDFLRAQAEEAHKLALASYVPIPGDVAHDLNFHVHL  72

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKL  231
             +                  N TRR L +       C+ TNPID CWRC ++WA +R KL
Sbjct  73   ALEGA---------------NDTRRELKQKHAAGEACEATNPIDSCWRCQKDWANDRFKL  117

Query  230  ASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRL  51
            A C+ GFG   TGG  GP YVVT+  D+D+  PK GTLR+  +Q GPLWITF +SM IRL
Sbjct  118  AKCSKGFGRRATGGLGGPIYVVTDESDNDMQNPKPGTLRYGAVQKGPLWITFQRSMIIRL  177

Query  50   KNELLVTSDKTIDGRG  3
              ELLV+SDKTIDGRG
Sbjct  178  NQELLVSSDKTIDGRG  193



>gb|KHN01171.1| Putative pectate lyase 3 [Glycine soja]
Length=433

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 102/172 (59%), Gaps = 18/172 (10%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D YW  R + A +  ++AY   P  +T  LT  +S+++                     +
Sbjct  26   DSYWQERASIAEKENQQAYTSDPYSLTKNLTFSVSEIII------------------GEK  67

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
                  +   G C  TNPIDRCWRCD NWA NRKKLA C  GFG  T GGK GPFYVV +
Sbjct  68   NGRRNLRGRGGKCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRNTIGGKNGPFYVVNS  127

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              D+D+V P  GTLRHAV ++GPLWI FA+SM IRL  EL++TSDKTIDGRG
Sbjct  128  SLDNDMVNPAPGTLRHAVTRSGPLWIIFARSMNIRLSQELIMTSDKTIDGRG  179



>ref|XP_006437462.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
 gb|ESR50702.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
Length=419

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 108/186 (58%), Gaps = 21/186 (11%)
 Frame = -1

Query  560  IPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlled  381
            +P + AH A+    D  W  R  EAMQ  ++ Y+P P  V + L   +  +  +      
Sbjct  1    MPCLSAHIAE---VDEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQDLSKQA-----  52

Query  380  veydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgag  201
                         +R L+ ++   G C+ TNPID+CWRC  NWA++R+ LA CALGFG+ 
Sbjct  53   -----------IAKRGLLNAES--GQCEATNPIDKCWRCKENWAEDRQALAGCALGFGSK  99

Query  200  ttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDK  21
             TGGK G  Y VT+  D+D+  PK GTLRHAVIQ  PLWI FAK M I+L+ EL+V   K
Sbjct  100  ATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQGSK  159

Query  20   TIDGRG  3
            TIDGRG
Sbjct  160  TIDGRG  165



>gb|AAM60924.1| putative pectate lyase [Arabidopsis thaliana]
Length=475

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 125/214 (58%), Gaps = 20/214 (9%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP-ELVTSKLTKHI-  417
            +V +  +A+ IP + A+ A+   TD YWV +  EA ++   AY+P P E+V     +H  
Sbjct  9    LVCVICIASLIPTIRANVAE--ETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYD  66

Query  416  -SKMMNETRlledveydelddEH------NSTRRSLMRS---------KRYRGPCKVTNP  285
             S  +  T   + +  +E D         NSTRRSL             +  GPC  +NP
Sbjct  67   NSTDVEGTEEEKAIASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNP  126

Query  284  IDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAV  105
            ID+CWRC  +WA+ RKKL  C  GFG  TTGGKRG  YVVT+  DDD+V P+ GTLRHAV
Sbjct  127  IDKCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAV  186

Query  104  IQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            IQ  PLWI F   M+IRL  EL++TSDKTID RG
Sbjct  187  IQKEPLWIVFKHDMSIRLSQELMITSDKTIDARG  220



>ref|XP_006299938.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
 gb|EOA32836.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
Length=472

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 124/212 (58%), Gaps = 19/212 (9%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP-ELVTSKLTKHI-  417
            +V +  +A+ IP + A+  +   TD YWV +  EA ++   AY+P P ++V     +H  
Sbjct  9    LVCVICIASFIPTIRANVPE---TDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYD  65

Query  416  -SKMMNETRlledveydelddEH------NSTRRSLMRSKR-------YRGPCKVTNPID  279
             S  + ET   + V+  E +D        NSTRRSL   +R        RGPC  +NPID
Sbjct  66   NSTDVEETEEDKAVDSAEEEDIEMISSPTNSTRRSLSGKRRGRGKWSKLRGPCTASNPID  125

Query  278  RCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQ  99
            +CWRC  +WAK RKKL  C  GFG   TGGKRG  YVVT+  DDD V P+ GTLRHAVIQ
Sbjct  126  KCWRCQPDWAKRRKKLVHCVRGFGYKVTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQ  185

Query  98   AGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              PLWI F   M+IRL  EL++ S KTID RG
Sbjct  186  KEPLWIIFKHDMSIRLSQELMIASHKTIDARG  217



>ref|XP_009757256.1| PREDICTED: pectate lyase [Nicotiana sylvestris]
 sp|P40972.1|PLY_TOBAC RecName: Full=Pectate lyase; Flags: Precursor [Nicotiana tabacum]
 emb|CAA47630.1| pectate lyase [Nicotiana tabacum]
 emb|CAA43414.1| pectate lyase [Nicotiana tabacum]
Length=397

 Score =   140 bits (354),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 89/116 (77%), Gaps = 1/116 (1%)
 Frame = -1

Query  350  NSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFY  171
            N  RR L  +K+Y+GPC+  N ID+CWRCD NWA+NR+K+A CALGFG+   GGK G  Y
Sbjct  27   NIPRRQL-SNKKYKGPCRAENAIDKCWRCDPNWAENRQKMADCALGFGSNAIGGKLGRIY  85

Query  170  VVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            VVT+  DDDVV+PK GTLR+ VIQ  PLWI F K+M I+L  EL+VTS+KTIDGRG
Sbjct  86   VVTDNSDDDVVDPKPGTLRYGVIQKEPLWIIFGKNMKIKLSRELIVTSNKTIDGRG  141



>gb|AFW76465.1| hypothetical protein ZEAMMB73_776134 [Zea mays]
Length=449

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 115/198 (58%), Gaps = 12/198 (6%)
 Frame = -1

Query  587  VMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP-ELVTSKLTKHISK  411
            ++LY++   +    A  A+  + D YW  RK  A   A+  Y   P EL T K   +   
Sbjct  13   LVLYSVFLLLSAT-ASEANIGDFDDYWQQRKLMADAAAEATYKHDPLELRTLKTMMYRRT  71

Query  410  MMNETRlledveydelddEHNSTRRSLMRSKRYR--GPCKVTNPIDRCWRCDRNWAKNRK  237
                   +E            STRR +M  K+ +  GPC  TNPIDRCWRC ++WA +RK
Sbjct  72   RARSRTSIEKE--------DTSTRREMMEQKKSKLSGPCTATNPIDRCWRCRQDWATDRK  123

Query  236  KLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTI  57
            +LA CA GFG  TTGG  G FYVVT+  DDDVV P+ GTLR  VIQ  PLWITFAK+M I
Sbjct  124  RLARCAKGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKTMII  183

Query  56   RLKNELLVTSDKTIDGRG  3
             LK EL++  DKTIDGRG
Sbjct  184  TLKEELIIRGDKTIDGRG  201



>dbj|BAK05605.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=448

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 114/204 (56%), Gaps = 31/204 (15%)
 Frame = -1

Query  587  VMLYALAAAI-------PVVMAHTADHNNT--DIYWVTRKAEAMQYAKRAYNPYPELVTS  435
            ++LY LA  +       PV       +N T  + YW  R  EA +Y++ AY   P  V +
Sbjct  14   ILLYVLATVVVTAAAEAPVEKTPLPAYNLTADEEYWAKRAEEAREYSRDAYVSDPVAVLN  73

Query  434  KLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRN  255
            +  + + +                     + RRSL R  RY GPC  TNPIDRCWRC  +
Sbjct  74   RFNRDVHRA--------------------TERRSLAR--RYGGPCVATNPIDRCWRCRAD  111

Query  254  WAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITF  75
            WA +R++LA+CA GFG    GG  G  YVVT+  DD+++ PK+GTLR  VIQ  PLWI F
Sbjct  112  WASDRQRLATCARGFGHNAAGGAGGRTYVVTDPTDDELIVPKKGTLRFGVIQDRPLWIVF  171

Query  74   AKSMTIRLKNELLVTSDKTIDGRG  3
            A+ M IRL  EL+V S+KTIDGRG
Sbjct  172  ARPMVIRLSQELIVNSNKTIDGRG  195



>ref|XP_002437815.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
 gb|EER89182.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
Length=444

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 102/172 (59%), Gaps = 23/172 (13%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            ++YW  R   A    + AY   P    ++    + +                     +TR
Sbjct  44   EVYWAERAEAARSRNRAAYVSDPVAAMNRFNADVLRA--------------------TTR  83

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
            R+L    RY GPC  TNPIDRCWRC  +WA +RK+LA CA GFG  TTGG  G  YVVT+
Sbjct  84   RAL---ARYSGPCMATNPIDRCWRCRSDWAADRKRLARCARGFGHRTTGGAAGKLYVVTD  140

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              DD+++ P++GTLRHAVIQ  PLWI FA+ M IRL+ EL+VTSDKTIDGRG
Sbjct  141  PSDDEMIVPRKGTLRHAVIQDRPLWIVFARDMVIRLRQELIVTSDKTIDGRG  192



>ref|XP_010513594.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 124/215 (58%), Gaps = 24/215 (11%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP-ELVTSKLTKHI-  417
            +V +  +A+ IP ++A+ A+   TD YWV +  EA ++   AY+P P ++V     +H  
Sbjct  9    LVCVICIASLIPTILANVAE---TDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYD  65

Query  416  ----------SKMMNETRlledveydelddEHNSTRRSLMRSKRYR-------GPCKVTN  288
                       K ++ T   + +E        NSTRRSL   +R R       GPC  +N
Sbjct  66   NSTDVEGTEEDKAVDSTEDEDVIEMTSSPT--NSTRRSLSGKRRGRGKWSKLKGPCTASN  123

Query  287  PIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHA  108
            PID+CWRC  +WA+ RK+L  C  GFG  TTGGKRG  YVVT+  DDD V P+ GTLRHA
Sbjct  124  PIDKCWRCQPDWARRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHA  183

Query  107  VIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            VIQ  PLWI F   M+IRL  EL++ S KTID RG
Sbjct  184  VIQKEPLWIIFKHDMSIRLSQELMIASHKTIDARG  218



>ref|XP_009627245.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=440

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 114/187 (61%), Gaps = 24/187 (13%)
 Frame = -1

Query  560  IPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISK-MMNETRlle  384
            +P + A  A+    D Y   +  EA+  +  AYN +PE VT+   + +   ++N T    
Sbjct  21   VPNLHAQIAEF---DAYLENKAKEALNSSLAAYNEHPEQVTNTFNREVGDTLLNIT----  73

Query  383  dveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfga  204
                            SL R  + +  C  TNPIDRCWRCD NWAKNRKKLA CA GFG 
Sbjct  74   ----------------SLRRHLKEKSSCMATNPIDRCWRCDENWAKNRKKLADCARGFGH  117

Query  203  gttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSD  24
             TTGGK G +YVVT+  DDDV +PK GTLRHAVIQ  PLWI F KSM IRLK EL++TSD
Sbjct  118  KTTGGKAGRYYVVTDDSDDDVKDPKPGTLRHAVIQEEPLWIIFEKSMIIRLKQELMITSD  177

Query  23   KTIDGRG  3
            KTIDGRG
Sbjct  178  KTIDGRG  184



>gb|KHN13490.1| Putative pectate lyase 3, partial [Glycine soja]
Length=364

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -1

Query  317  RYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVV  138
            R  GPC  TNPIDRCWRCD NWA NR+KLA C  GFG  T GGK GPFYVVT+  DDD+V
Sbjct  5    RGDGPCIATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTVGGKGGPFYVVTDPSDDDMV  64

Query  137  EPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
             PK GTLRHAV + GPLWI FA+SM I L+ EL++ S+KTIDGRG
Sbjct  65   NPKPGTLRHAVTRDGPLWIIFARSMFITLQQELIMNSNKTIDGRG  109



>gb|KEH19822.1| pectate lyase-like protein [Medicago truncatula]
Length=455

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 113/205 (55%), Gaps = 25/205 (12%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNN--------TDIYWVTRKAEAMQYAKRAYNPYPELVT  438
            I++ +  LA   P + A+  ++N          D YW  R   A Q  K AY   P  ++
Sbjct  7    IILFVLCLAILTPTLNANKLENNEYWTEQRPEFDSYWQERAKVAKQENKAAYFKDPYAIS  66

Query  437  SKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDR  258
               T  IS+++                      R+L   K   G C  TNPIDRCWRCD 
Sbjct  67   GNFTASISEII----------------AVKEKGRNLGGLKD-DGTCLATNPIDRCWRCDP  109

Query  257  NWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWIT  78
            NWA NR+KLA C  GFG  T GG+ GP YVVT+  DDD++ PK GTLR+AV + G LWIT
Sbjct  110  NWANNRQKLADCVQGFGRNTRGGQGGPIYVVTDPSDDDMMNPKPGTLRYAVTRNGSLWIT  169

Query  77   FAKSMTIRLKNELLVTSDKTIDGRG  3
            FA+SM I L+ EL+++ DKTIDGRG
Sbjct  170  FARSMAITLQQELIMSGDKTIDGRG  194



>ref|XP_009101245.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 120/215 (56%), Gaps = 22/215 (10%)
 Frame = -1

Query  626  MEGMHSKMNWWIVVML-YALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP  450
            M   H  +  ++   +  +LA   P V  H A +   D YW  R+ +A++   ++Y+P P
Sbjct  1    MASAHLNLGSYVFAFVSLSLAVVAPSVQGHVAVY---DEYWTQRQTDALRETIKSYDPNP  57

Query  449  ELVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVT------N  288
              VT     H +  M  T               N TRR L + +R R   +        N
Sbjct  58   FNVTDHFNHHAALAMETT------------GADNGTRRELRQVRRGRKTRRRGGRHHSLN  105

Query  287  PIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHA  108
             ID+CWR D+NW KNRKKLA C LGFG  TTGGK+G FYVVT+  D D++ PK GTLRHA
Sbjct  106  AIDKCWRGDKNWHKNRKKLADCVLGFGRKTTGGKKGQFYVVTDASDHDLINPKPGTLRHA  165

Query  107  VIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            V +  PLWI F +SM I+L+ EL++T DKTIDGRG
Sbjct  166  VTRDRPLWIIFGRSMIIKLQQELIITHDKTIDGRG  200



>ref|XP_002871648.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47907.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 121/213 (57%), Gaps = 21/213 (10%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP-ELVTSKLTKHIS  414
            ++ ++ +A  IP +  + ++    D YW  R  EA ++  +AY+  P E+V     +H  
Sbjct  9    LMFMFCIAVLIPTIRGNISE---LDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYD  65

Query  413  KMMNETRlledveyd----------elddEHNSTRRSLMRSK------RYRGPCKVTNPI  282
               + T   E+ +             L    NSTRRSL R K      + +GPC  +NPI
Sbjct  66   NSTDVTTTEEEGDAKPEEEEKEFIEMLGSSTNSTRRSL-RGKGKGKWSKLKGPCTASNPI  124

Query  281  DRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVI  102
            D+CWRC  +WAK RK+L  C  GFG  TTGGKRG  YVVT+  DDD+V PK GTLRHAVI
Sbjct  125  DKCWRCRSDWAKRRKRLTRCVRGFGHRTTGGKRGRIYVVTSNLDDDMVNPKPGTLRHAVI  184

Query  101  QAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            Q  PLWI F   M+IRL  ELL+ S KTID RG
Sbjct  185  QKEPLWIIFKNDMSIRLNQELLINSHKTIDARG  217



>ref|XP_006826355.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
 gb|ERM93592.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
Length=479

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 97/158 (61%), Gaps = 17/158 (11%)
 Frame = -1

Query  476  AKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCK  297
            A+ AY P PE V+  LT H+  M                   N  RR L R  R+ GPC 
Sbjct  89   AQAAYEPDPEAVSRNLT-HLVHM--------------ELPSGNHMRRQLGR--RWHGPCV  131

Query  296  VTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTL  117
             TNPIDRCWRCD+ W  NRKKLA CA+GFG    GGK G +YVVT+  D+D++ PK GTL
Sbjct  132  ATNPIDRCWRCDQKWHTNRKKLADCAMGFGQQALGGKYGRYYVVTDPSDNDLLNPKPGTL  191

Query  116  RHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            RHAVIQ  PLWI F + M I+L  EL+V S KT+DGRG
Sbjct  192  RHAVIQNEPLWIIFQRDMVIKLTEELMVNSFKTVDGRG  229



>emb|CDY45202.1| BnaA06g34060D [Brassica napus]
Length=459

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 120/215 (56%), Gaps = 22/215 (10%)
 Frame = -1

Query  626  MEGMHSKMNWWIVVML-YALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP  450
            M   H  +  ++   +  +LA   P V  H A +   D YW  R+ +A++   ++Y+P P
Sbjct  1    MASAHLNLGSYVFAFVSLSLAVVAPSVQGHVAVY---DEYWTQRQTDALRETIKSYDPNP  57

Query  449  ELVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVT------N  288
              VT     H +  M  T               N TRR L + +R R   +        N
Sbjct  58   FNVTDHFNYHAALAMETT------------GADNGTRRELRQVRRGRKTRRRGGRHHSLN  105

Query  287  PIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHA  108
             ID+CWR D+NW KNRKKLA C LGFG  TTGGK+G FYVVT+  D D++ PK GTLRHA
Sbjct  106  AIDKCWRGDKNWHKNRKKLADCVLGFGRKTTGGKKGQFYVVTDASDHDLINPKPGTLRHA  165

Query  107  VIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            V +  PLWI F +SM I+L+ EL++T DKTIDGRG
Sbjct  166  VTRDRPLWIIFGRSMIIKLQQELIITHDKTIDGRG  200



>ref|XP_010485518.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 123/213 (58%), Gaps = 20/213 (9%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP-ELVTSKLTKHIS  414
            +V +  +A+ IP + A+ A+   TD YWV +  EA ++   AY+P P ++V     +H  
Sbjct  9    LVCVICIASLIPTIRANVAE---TDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYD  65

Query  413  KMMNETRlledveydelddEH---------NSTRRSLMRSKRYR-------GPCKVTNPI  282
               +     ED   D  +DE          NSTRRSL   +R R       GPC  +NPI
Sbjct  66   NSTDVEGTEEDTAVDSAEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPI  125

Query  281  DRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVI  102
            D+CWRC  +WAK RK+L  C  GFG  TTGGKRG  YVVT+  DDD V P+ GTLRHAVI
Sbjct  126  DKCWRCQPDWAKRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVI  185

Query  101  QAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            Q  PLWI F   M+IRL  EL++ S KTID RG
Sbjct  186  QKEPLWIIFKHDMSIRLSQELMIASHKTIDARG  218



>gb|KHN13240.1| Putative pectate lyase 3 [Glycine soja]
Length=446

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 111/202 (55%), Gaps = 28/202 (14%)
 Frame = -1

Query  584  MLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMM  405
            +L   A  IP + A  A+    D +   +  EA + A  +Y P P  V  +L  H+   +
Sbjct  12   LLATFAIVIPCLEAGIAEF---DDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVHMAL  68

Query  404  NETRlledveydelddEHNSTRRSLMRSK-RYRGPCKVTNPIDRCWRCDRNWAKNRKKLA  228
                              NSTRR L + K R  G C+ +NPID CWRC+++WA +R +LA
Sbjct  69   -----------------ENSTRRELRQRKLRGGGKCQASNPIDACWRCNKDWANDRFRLA  111

Query  227  SCALgfgagttggkrGPFYVVTNRFDDDVVEPK-------RGTLRHAVIQAGPLWITFAK  69
             C  GFG   TGG  GP YVVT+  DDD+V PK        GT+RHAV Q GPLWI F  
Sbjct  112  KCGKGFGRRATGGLGGPIYVVTDNSDDDMVNPKPGTIRHAPGTIRHAVTQKGPLWIIFGH  171

Query  68   SMTIRLKNELLVTSDKTIDGRG  3
            SM I L+ EL+++SDKTIDGRG
Sbjct  172  SMIISLRQELMISSDKTIDGRG  193



>ref|XP_011071024.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=441

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 108/167 (65%), Gaps = 22/167 (13%)
 Frame = -1

Query  500  RKAEAMQYAKRAYNPYPELVTSKLTKHISK-MMNETRlledveydelddEHNSTRRSLMR  324
            R AE+ Q + + YNP P+ +T +  + + K +MNE                N TRR+L  
Sbjct  40   RAAESYQESLQEYNPNPQDLTDEFNELVGKTLMNE----------------NVTRRNLGE  83

Query  323  SKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDD  144
                   CK TNPIDRCWRCDR+WAK+RK+LA C  GFG  TTGGK G +Y+V +  DDD
Sbjct  84   DD-----CKATNPIDRCWRCDRDWAKHRKRLADCVRGFGHLTTGGKAGRYYLVDDPSDDD  138

Query  143  VVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            +  PK GTLRHA++Q  PLWI F  SM I+LKNEL++TSDKTIDGRG
Sbjct  139  MDHPKPGTLRHAILQTEPLWIIFKHSMVIKLKNELIMTSDKTIDGRG  185



>ref|XP_010420164.1| PREDICTED: probable pectate lyase 19 isoform X2 [Camelina sativa]
Length=472

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 120/213 (56%), Gaps = 21/213 (10%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP-ELVTSKLTKHIS  414
            ++ ++ +A  IP +  + ++    D YW  R  EA ++  +AY+  P E+V     +H  
Sbjct  9    LMFMFCIAGLIPTIRGNISE---LDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYD  65

Query  413  KMMNETRlledveyd----------elddEHNSTRRSLMRSK------RYRGPCKVTNPI  282
               + T   ED               + +   STRRSL R K      + +GPC  +NPI
Sbjct  66   NSTDATETEEDGGAKPEEEEEEGIKMVGNSTKSTRRSL-RGKGKGKWSKLKGPCTASNPI  124

Query  281  DRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVI  102
            D+CWRC  NWAK RKKL  C  GFG  TTGGKRG  YVVT+  D+D+V PK GTLRHAVI
Sbjct  125  DKCWRCRTNWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVI  184

Query  101  QAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            Q  PLWI F   M+IRL  ELL+ S KTID RG
Sbjct  185  QKEPLWIIFKNDMSIRLSQELLINSHKTIDARG  217



>ref|NP_001150425.1| LOC100284055 precursor [Zea mays]
 gb|ACG39044.1| pectate lyase precursor [Zea mays]
 gb|ACR35178.1| unknown [Zea mays]
 gb|AFW75496.1| pectate lyase [Zea mays]
Length=453

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 104/188 (55%), Gaps = 22/188 (12%)
 Frame = -1

Query  560  IPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlled  381
            I    AH  +      YW  R   A  Y + AY   P  V  +    + +          
Sbjct  34   IDEAYAHLVNLTANQEYWAERAEAAHAYNRAAYQTDPVAVVQRFNDGVHRA---------  84

Query  380  veydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgag  201
                       +  RS   + R RGPC  TNPID+CWRC R+WA++RK+LA CA+GFG  
Sbjct  85   -----------TATRSRSLAHRARGPCTATNPIDQCWRCRRDWARDRKRLARCAMGFGHR  133

Query  200  ttggkrGPFYVVTNRFDD--DVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTS  27
            TTGG  G FYVV +  DD  D+V P++GTLRHAV +A  LWITFA+ M I L  EL+V+S
Sbjct  134  TTGGLAGKFYVVIDPSDDAADLVTPRKGTLRHAVTRARALWITFARDMVIELCQELIVSS  193

Query  26   DKTIDGRG  3
            DKTIDGRG
Sbjct  194  DKTIDGRG  201



>ref|XP_004301165.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=445

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 116/197 (59%), Gaps = 20/197 (10%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHIS  414
            +V++   ++ AIPV+ A+       D  W  R+ EA Q AK AY   P      L K + 
Sbjct  11   LVILCLLMSIAIPVLKANIG---MFDDVWEQRQKEAEQAAKAAYQHDPLKHVVHLNKQVH  67

Query  413  KMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKK  234
            K M                 HN TRR+L       GPC+  NPID+CWRCD NW +NR+K
Sbjct  68   KAM---------------KGHNDTRRNLRH--HVDGPCEAINPIDKCWRCDPNWHENRQK  110

Query  233  LASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIR  54
            LA CALGFG GTTGGK G  YVVT+  D+D+V PK GTLR+AV +  PLWI F + M I 
Sbjct  111  LADCALGFGHGTTGGKGGKIYVVTDDTDEDMVNPKEGTLRYAVTRPEPLWIIFEEDMKIE  170

Query  53   LKNELLVTSDKTIDGRG  3
            LK EL++ SDKTIDGRG
Sbjct  171  LKQELMMASDKTIDGRG  187



>ref|XP_008679844.1| PREDICTED: pectate lyase [Zea mays]
 gb|AFW66064.1| pectate lyase-like protein [Zea mays]
Length=444

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 103/172 (60%), Gaps = 15/172 (9%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D +   RK  A   A+ AY P P  VT+     + + ++ +R                  
Sbjct  37   DDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAVSSSRREM---------------  81

Query  338  RSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTN  159
            R   R  + RGPC+ TNPID+CWRC R+WA +R++LA CA GFG  TTGG  G  YVVT+
Sbjct  82   RERPRKHKKRGPCRATNPIDKCWRCRRDWATDRQRLARCARGFGHATTGGLGGKIYVVTD  141

Query  158  RFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              D DVV P+ GTLR  VIQ GPLWI FA+SM I+L  ELL++SDKTIDGRG
Sbjct  142  PTDLDVVNPRPGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRG  193



>ref|XP_010317101.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=389

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -1

Query  350  NSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFY  171
            N T R  + +K+Y GPC VTNPID+CWRCD NWA NRKKL  C++GFG  TTGG+ G FY
Sbjct  20   NETIRRALGTKKYDGPCTVTNPIDKCWRCDPNWADNRKKLVECSMGFGYKTTGGRDGEFY  79

Query  170  VVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            VVT+   DD   PK GTLRHAVIQ  PLWI F K+M I+L  EL++  DKTIDGRG
Sbjct  80   VVTDP-SDDYTTPKPGTLRHAVIQKEPLWIIFEKNMKIKLHQELIMQGDKTIDGRG  134



>ref|XP_003613596.1| Pectate lyase [Medicago truncatula]
 gb|AES96554.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 102/170 (60%), Gaps = 17/170 (10%)
 Frame = -1

Query  512  YWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTRRS  333
            YW  + + A +   +AY P P  V+  L+  +S+M+                   + RR+
Sbjct  43   YWQKKASIAAKANDKAYTPDPYAVSGNLSSTVSEMI---------------IGGINGRRN  87

Query  332  LMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRF  153
            L+        C  TNPIDRCWRCD NWA NRKKLA C  GFG  TTGGK GP YVVT+  
Sbjct  88   LVGLGN--SSCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKDGPIYVVTDPS  145

Query  152  DDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            D D+V P+ GTLRHAV + GPLWI FA+SM IRL  EL++  +KTIDGRG
Sbjct  146  DSDLVNPRPGTLRHAVTRNGPLWIIFARSMKIRLNQELIMAGNKTIDGRG  195



>ref|XP_010463548.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 123/213 (58%), Gaps = 20/213 (9%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP-ELVTSKLTKHIS  414
            +V +  +A+ IP + A+ A+   TD YWV +  EA ++   AY+P P ++V     +H  
Sbjct  9    LVCVICIASLIPTIRANVAE---TDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYD  65

Query  413  KMMNETRlledveydelddEH---------NSTRRSLMRSKRYR-------GPCKVTNPI  282
               +     ED   D  +DE          NSTRRSL   +R R       GPC  +NPI
Sbjct  66   NSTDVEGTEEDKAVDSAEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPI  125

Query  281  DRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVI  102
            D+CWRC  +WA+ RK+L  C  GFG  TTGGKRG  YVVT+  DDD V P+ GTLRHAVI
Sbjct  126  DKCWRCQPDWARRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVI  185

Query  101  QAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            Q  PLWI F   M+IRL  EL++ S KTID RG
Sbjct  186  QKEPLWIIFKHDMSIRLSQELMIASHKTIDARG  218



>gb|ACN96380.1| hypothetical protein, partial [Tripsacum sp. JRI-2009]
Length=262

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 85/115 (74%), Gaps = 3/115 (3%)
 Frame = -1

Query  347  STRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYV  168
            +TRR+L    RY GPC  TNPIDRCWRC  +WA++RK+LA CA GFG  T GG  G  YV
Sbjct  30   TTRRAL---ARYEGPCMATNPIDRCWRCRADWAQDRKRLAQCARGFGHKTVGGAAGKLYV  86

Query  167  VTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            VT+  DD+++ P++GTLRHAVIQ  PLWI FA+ M I L+ EL+V  +KTIDGRG
Sbjct  87   VTDPSDDEMIIPRKGTLRHAVIQDRPLWIVFARDMVIELRQELIVNHNKTIDGRG  141



>ref|XP_004951474.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=440

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 101/173 (58%), Gaps = 20/173 (12%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D +W  R+  A   A+ AY P P  VT+     + +                     S R
Sbjct  35   DEHWQKRRELAEASAREAYKPDPFNVTNSFNAAVHR-------------------STSPR  75

Query  338  RSL-MRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVT  162
            R +  + K+  GPC+ TNPID+CWRC +NWA +R++LA CA GFG   TGG  G  YVVT
Sbjct  76   REMREKKKKSNGPCRATNPIDKCWRCRKNWATDRQRLARCARGFGRAATGGLGGKIYVVT  135

Query  161  NRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            +  D DVV P+ GTLR   IQ GPLWI FA+SM I+L  ELLV+SDKTIDGRG
Sbjct  136  DPTDADVVNPRPGTLRWGAIQPGPLWIIFARSMIIQLSQELLVSSDKTIDGRG  188



>sp|P40973.1|PLY_LILLO RecName: Full=Pectate lyase; Flags: Precursor [Lilium longiflorum]
 emb|CAA78976.1| pectate lyase [Lilium longiflorum]
 gb|AAA33398.1| pectate lyase [Lilium longiflorum]
Length=434

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 113/199 (57%), Gaps = 23/199 (12%)
 Frame = -1

Query  599  WWIVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKH  420
            +++  +L+  +AA+      +A+    D YW  +   A   AK+AY P+PE VT+   K 
Sbjct  6    FFLYSLLFFASAALS-----SANIAEFDEYWQKKSKVAQAKAKKAYTPHPEEVTNHFNKA  60

Query  419  ISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNR  240
            +                      NSTRR+L  +K   G C  TNPIDRCWRC +NW+ NR
Sbjct  61   VHSSFEG----------------NSTRRNLRTNKL--GQCLATNPIDRCWRCKKNWSANR  102

Query  239  KKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMT  60
            K L  C  GFG  TTGG  G  YVVT+  DD + +PK GTLR  VIQ  PLWI F KSM 
Sbjct  103  KDLVKCVKGFGRKTTGGAAGEIYVVTDPSDDSLTDPKFGTLRWGVIQDRPLWIIFGKSMV  162

Query  59   IRLKNELLVTSDKTIDGRG  3
            IRLK EL++ +DKTIDGRG
Sbjct  163  IRLKQELIINNDKTIDGRG  181



>emb|CDY03043.1| BnaC07g21840D [Brassica napus]
Length=459

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 118/215 (55%), Gaps = 22/215 (10%)
 Frame = -1

Query  626  MEGMHSKMNWWIVVMLYALAAAI-PVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP  450
            M   H  +  ++        A + P V  H A +   D YW  R+ +A++   ++Y+P P
Sbjct  1    MASAHLNIGSYVFAFASLFVAIVAPSVQGHVAVY---DEYWTQRQTDALRQTIKSYDPNP  57

Query  449  ELVTSKLTKHISKMMNETRlledveydelddEHNSTRRSLMRSKRYRGPCKVT------N  288
              VT     H +  M  T               N TRR L + +R R   +        N
Sbjct  58   FNVTDHFNYHAALAMETT------------GADNGTRRELRQVRRGRRTKRRGGRHHSLN  105

Query  287  PIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHA  108
             ID+CWR D+NW KNRKKLA C LGFG  TTGGK+G FYVVT+  D D+V PK GTLRHA
Sbjct  106  AIDKCWRGDKNWHKNRKKLADCVLGFGRRTTGGKKGQFYVVTDASDHDLVNPKPGTLRHA  165

Query  107  VIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            V +  PLWI F +SM I+L+ EL++T DKTIDGRG
Sbjct  166  VTRDRPLWIIFGRSMIIKLQQELIITHDKTIDGRG  200



>ref|XP_009131435.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX78607.1| BnaA03g05190D [Brassica napus]
Length=475

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 117/216 (54%), Gaps = 24/216 (11%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP-ELVTSKLTKHIS  414
            ++++  +   IP +    AD +  D YW  R  EA ++  +AY+  P E++     +H  
Sbjct  9    LMLVLCIVGLIPTI---RADMSELDEYWSGRADEAREFTLQAYHSDPYEIIDHFHERHYD  65

Query  413  KMMN-------------ETRlledveydelddEHNSTRRSLMRSK------RYRGPCKVT  291
               +             E            D+  NSTRRSL R K      + +GPC  +
Sbjct  66   NSTDVTPTEEDNNTKPEEVENEVIEMVGSGDNSTNSTRRSL-RGKGKGKWSKLKGPCTAS  124

Query  290  NPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRH  111
            NPID+CWRC +NW+K RKKL  C  GFG  T GGK G  YVVT+  D+D+V P+ GTLRH
Sbjct  125  NPIDKCWRCRKNWSKRRKKLVKCVRGFGHMTVGGKHGRIYVVTSNLDEDMVNPEPGTLRH  184

Query  110  AVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            AVIQ  PLWI F   M+IRL  ELL+ S KTID RG
Sbjct  185  AVIQKEPLWIIFKNDMSIRLNQELLINSFKTIDARG  220



>emb|CDY28691.1| BnaCnng05770D [Brassica napus]
Length=469

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 123/212 (58%), Gaps = 18/212 (8%)
 Frame = -1

Query  593  IVVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP-ELVTSKLTKHI  417
            ++V +  +A+ IP + A+ A+   TD YWVT+  EA +    AY+P P ++V     +H 
Sbjct  6    LLVCVICIASLIPTLRANVAE---TDEYWVTKANEARRRTLMAYHPDPYQIVDHFHERHY  62

Query  416  SKMMN-----ETRlledveydelddEHNSTRRSLMRS---------KRYRGPCKVTNPID  279
                +     E    E+ + + +    NSTRRSL             + +GPC  +NPID
Sbjct  63   DNSTDVEEMEENASEEEDDIEMISSATNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPID  122

Query  278  RCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVIQ  99
            +CWRC  +WA+ RKKL  C  GFG  TTGGKRG  YVVT+  DDD V P+ GTLRHAVIQ
Sbjct  123  KCWRCQPDWARRRKKLVKCVRGFGYKTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQ  182

Query  98   AGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
              PLWI F   M+IRL  EL++ S KTID RG
Sbjct  183  NEPLWIIFKHDMSIRLCQELMINSHKTIDARG  214



>sp|Q9LFP5.1|PLY19_ARATH RecName: Full=Probable pectate lyase 19; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC01830.1| pectate lyase-like protein [Arabidopsis thaliana]
Length=472

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 120/213 (56%), Gaps = 21/213 (10%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP-ELVTSKLTKHIS  414
            ++  + +A  IP +  + ++    D YW  R  EA ++  +AY+  P E+V     +H  
Sbjct  9    LMFTFCIAVLIPTIRGNISE---LDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYD  65

Query  413  KMMNETRlledveyd----------elddEHNSTRRSLMRSK------RYRGPCKVTNPI  282
               + T   ED +             L    NSTRRSL R K      + +GPC  +NPI
Sbjct  66   NSTDVTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSL-RGKGKGKWSKLKGPCTASNPI  124

Query  281  DRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVI  102
            D+CWRC  +WAK RKKL  C  GFG  TTGGKRG  YVVT+  D+D+V PK GTLRHAVI
Sbjct  125  DKCWRCRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVI  184

Query  101  QAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            Q  PLWI F   M+IRL  ELL+ S KTID RG
Sbjct  185  QKEPLWIIFKNDMSIRLNQELLINSHKTIDARG  217



>ref|XP_006579282.1| PREDICTED: probable pectate lyase P59-like [Glycine max]
Length=420

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 88/116 (76%), Gaps = 2/116 (2%)
 Frame = -1

Query  350  NSTRRSLMRSKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFY  171
            N++RR L  S +Y GPCK TNPID+CWRCD NW KNRK+LA CALGFG GTTGGK G  Y
Sbjct  5    NNSRRGL--SNQYDGPCKATNPIDKCWRCDPNWEKNRKRLADCALGFGHGTTGGKDGKIY  62

Query  170  VVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            VV +  D+D+V PK GTLRHA IQ  PLWI F ++M I+L  EL++T +KTID RG
Sbjct  63   VVNDSSDNDLVNPKPGTLRHAAIQREPLWIIFDRNMNIKLHAELMLTDNKTIDARG  118



>ref|XP_002882189.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58448.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=475

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 126/214 (59%), Gaps = 20/214 (9%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP-ELVTSKLTKHI-  417
            +V ++ +A+ IP + A+ AD   TD YWV +  EA ++   AY+P P E+V     +H  
Sbjct  9    LVCVFCIASLIPTIRANVAD--ETDDYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYD  66

Query  416  -SKMMNETRlledveydelddEH------NSTRRSL---------MRSKRYRGPCKVTNP  285
             S  +  T   + V  +E D         NSTRRSL          +  + +GPC  +NP
Sbjct  67   NSTDVEGTEEEKAVASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLKGPCTASNP  126

Query  284  IDRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAV  105
            ID+CWRC  +WA+ RKKL  C  GFG  TTGGKRG  YVVT+  DDD+V P+ GTLRHAV
Sbjct  127  IDKCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAV  186

Query  104  IQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            IQ  PLWI F   M+IRL  EL++ S KTID RG
Sbjct  187  IQKEPLWIIFKHDMSIRLNQELMIASHKTIDARG  220



>ref|NP_197015.4| putative pectate lyase 19 [Arabidopsis thaliana]
 gb|AED92118.1| putative pectate lyase 19 [Arabidopsis thaliana]
Length=472

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 120/213 (56%), Gaps = 21/213 (10%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP-ELVTSKLTKHIS  414
            ++  + +A  IP +  + ++    D YW  R  EA ++  +AY+  P E+V     +H  
Sbjct  9    LMFTFCIAVLIPTIRGNISE---LDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYD  65

Query  413  KMMNETRlledveyd----------elddEHNSTRRSLMRSK------RYRGPCKVTNPI  282
               + T   ED +             L    NSTRRSL R K      + +GPC  +NPI
Sbjct  66   NSTDVTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSL-RGKGKGKWSKLKGPCTASNPI  124

Query  281  DRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVI  102
            D+CWRC  +WAK RKKL  C  GFG  TTGGKRG  YVVT+  D+D+V PK GTLRHAVI
Sbjct  125  DKCWRCRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVI  184

Query  101  QAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            Q  PLWI F   M+IRL  ELL+ S KTID RG
Sbjct  185  QKEPLWIIFKNDMSIRLNQELLINSHKTIDARG  217



>gb|ABK28696.1| unknown [Arabidopsis thaliana]
Length=473

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 120/213 (56%), Gaps = 21/213 (10%)
 Frame = -1

Query  590  VVMLYALAAAIPVVMAHTADHNNTDIYWVTRKAEAMQYAKRAYNPYP-ELVTSKLTKHIS  414
            ++  + +A  IP +  + ++    D YW  R  EA ++  +AY+  P E+V     +H  
Sbjct  9    LMFTFCIAVLIPTIRGNISE---LDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYD  65

Query  413  KMMNETRlledveyd----------elddEHNSTRRSLMRSK------RYRGPCKVTNPI  282
               + T   ED +             L    NSTRRSL R K      + +GPC  +NPI
Sbjct  66   NSTDVTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSL-RGKGKGKWSKLKGPCTASNPI  124

Query  281  DRCWRCDRNWAKNRKKLASCALgfgagttggkrGPFYVVTNRFDDDVVEPKRGTLRHAVI  102
            D+CWRC  +WAK RKKL  C  GFG  TTGGKRG  YVVT+  D+D+V PK GTLRHAVI
Sbjct  125  DKCWRCRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVI  184

Query  101  QAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
            Q  PLWI F   M+IRL  ELL+ S KTID RG
Sbjct  185  QKEPLWIIFKNDMSIRLNQELLINSHKTIDARG  217



>ref|NP_001046281.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAD25039.1| putative pectate lyase precursor [Oryza sativa Japonica Group]
 dbj|BAF08195.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAG94880.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 105/178 (59%), Gaps = 27/178 (15%)
 Frame = -1

Query  518  DIYWVTRKAEAMQYAKRAYNPYPELVTSKLTKHISKMMNETRlledveydelddEHNSTR  339
            D +W  R+A A   A+  Y P P  VT++    + +                     ST 
Sbjct  37   DEHWEKRRAAAEAAAEEVYKPDPFNVTNEFNHAVIR---------------------STE  75

Query  338  RSLMR------SKRYRGPCKVTNPIDRCWRCDRNWAKNRKKLASCALgfgagttggkrGP  177
            R ++R      + +Y+GPC  TNPIDRCWRC ++WA +RK+LA CA+GFG G TGG RG 
Sbjct  76   RGVLRRELSGKNSKYKGPCLATNPIDRCWRCRKDWATDRKRLARCAMGFGRGATGGVRGK  135

Query  176  FYVVTNRFDDDVVEPKRGTLRHAVIQAGPLWITFAKSMTIRLKNELLVTSDKTIDGRG  3
             YVVT+  D D   P+ GTLR   +QA PLWITFAKSM IRL  ELLV SDKTIDGRG
Sbjct  136  IYVVTDPGDGDAANPRYGTLRWGAMQAAPLWITFAKSMVIRLTQELLVASDKTIDGRG  193



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 922580742716