BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19689_g1_i1 len=526 path=[1:0-525]

Length=526
                                                                      Score     E

emb|CDP02199.1|  unnamed protein product                                261   2e-83   
emb|CAA43413.1|  pectate lyase                                          251   2e-80   Nicotiana tabacum [American tobacco]
gb|KFK33456.1|  hypothetical protein AALP_AA5G015800                    257   3e-80   
gb|KFK43687.1|  hypothetical protein AALP_AA1G160000                    256   5e-80   
ref|XP_007224275.1|  hypothetical protein PRUPE_ppa019055mg             256   7e-80   
emb|CDY68729.1|  BnaCnng60280D                                          256   7e-80   
ref|XP_010527872.1|  PREDICTED: probable pectate lyase 3 isoform X2     256   8e-80   
ref|XP_009110541.1|  PREDICTED: probable pectate lyase 3                256   9e-80   
ref|XP_010033216.1|  PREDICTED: pectate lyase-like                      254   1e-79   
ref|XP_006292606.1|  hypothetical protein CARUB_v10018855mg             255   1e-79   
emb|CDX96854.1|  BnaA08g23970D                                          255   1e-79   
ref|NP_172894.1|  putative pectate lyase 3                              254   5e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002520133.1|  Pectate lyase precursor, putative                  253   5e-79   Ricinus communis
emb|CDX81636.1|  BnaC08g39650D                                          254   9e-79   
emb|CDY53552.1|  BnaA09g57110D                                          254   1e-78   
ref|XP_009599825.1|  PREDICTED: probable pectate lyase P59 isofor...    253   1e-78   
ref|XP_009117903.1|  PREDICTED: probable pectate lyase 3                253   1e-78   
ref|XP_010425041.1|  PREDICTED: probable pectate lyase 6                253   1e-78   
ref|XP_009148818.1|  PREDICTED: probable pectate lyase 3                253   1e-78   
ref|XP_009599826.1|  PREDICTED: probable pectate lyase P59 isofor...    252   1e-78   
ref|XP_010523445.1|  PREDICTED: probable pectate lyase 3                253   1e-78   
ref|XP_008456459.1|  PREDICTED: pectate lyase-like                      252   1e-78   
emb|CDY45254.1|  BnaA06g09240D                                          253   1e-78   
ref|XP_004162547.1|  PREDICTED: probable pectate lyase P59-like         252   2e-78   
ref|XP_004234780.1|  PREDICTED: probable pectate lyase P56              251   2e-78   
gb|KHN01171.1|  Putative pectate lyase 3                                251   2e-78   
ref|XP_010514040.1|  PREDICTED: probable pectate lyase 6                252   2e-78   
ref|XP_009129128.1|  PREDICTED: probable pectate lyase 6                252   2e-78   
ref|XP_010678579.1|  PREDICTED: pectate lyase-like                      252   2e-78   
emb|CDY09356.1|  BnaA02g26540D                                          252   2e-78   
ref|XP_002892805.1|  hypothetical protein ARALYDRAFT_471616             252   2e-78   
emb|CDY39314.1|  BnaC05g10650D                                          252   2e-78   
emb|CDY41679.1|  BnaC02g34750D                                          252   2e-78   
ref|XP_007227702.1|  hypothetical protein PRUPE_ppa005744mg             251   2e-78   
ref|XP_009779191.1|  PREDICTED: probable pectate lyase P59              251   3e-78   
ref|XP_006573090.1|  PREDICTED: probable pectate lyase 3-like           251   3e-78   
ref|XP_004146792.1|  PREDICTED: probable pectate lyase P59-like         251   3e-78   
ref|XP_008221660.1|  PREDICTED: probable pectate lyase 3                251   3e-78   
ref|XP_010502279.1|  PREDICTED: probable pectate lyase 6                251   3e-78   
ref|XP_009599824.1|  PREDICTED: pectate lyase                           249   3e-78   
ref|XP_009114192.1|  PREDICTED: probable pectate lyase 6                251   4e-78   
gb|AAB69759.1|  putative pectate lyase                                  251   5e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009757256.1|  PREDICTED: pectate lyase                           249   5e-78   
ref|XP_010527871.1|  PREDICTED: probable pectate lyase 3 isoform X1     257   5e-78   
emb|CDY17432.1|  BnaC09g21050D                                          251   6e-78   
emb|CDY04133.1|  BnaA09g19110D                                          251   7e-78   
emb|CDP02198.1|  unnamed protein product                                251   8e-78   
ref|XP_010476496.1|  PREDICTED: probable pectate lyase 3                251   8e-78   
ref|XP_007138209.1|  hypothetical protein PHAVU_009G189800g             250   9e-78   
ref|NP_178375.1|  putative pectate lyase 6                              250   1e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496063.1|  PREDICTED: probable pectate lyase 3                250   1e-77   
ref|XP_006306515.1|  hypothetical protein CARUB_v10012514mg             249   2e-77   
ref|XP_011085780.1|  PREDICTED: probable pectate lyase P59              249   2e-77   
ref|XP_002875142.1|  pectate lyase family protein                       249   3e-77   
ref|XP_004155392.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    248   4e-77   
ref|XP_004135462.1|  PREDICTED: probable pectate lyase P59-like         248   5e-77   
ref|XP_007209148.1|  hypothetical protein PRUPE_ppa005859mg             248   6e-77   
ref|XP_004514773.1|  PREDICTED: probable pectate lyase 3-like           248   7e-77   
ref|XP_010066949.1|  PREDICTED: pectate lyase                           247   8e-77   
ref|XP_008230729.1|  PREDICTED: pectate lyase                           248   8e-77   
ref|XP_007215366.1|  hypothetical protein PRUPE_ppa005602mg             248   9e-77   
ref|XP_002270089.1|  PREDICTED: pectate lyase                           247   1e-76   Vitis vinifera
ref|XP_009380431.1|  PREDICTED: pectate lyase-like                      247   1e-76   
ref|XP_006361836.1|  PREDICTED: probable pectate lyase P56-like         246   1e-76   
ref|XP_004951474.1|  PREDICTED: pectate lyase-like                      247   1e-76   
ref|XP_008446316.1|  PREDICTED: probable pectate lyase P59              246   1e-76   
ref|XP_008239834.1|  PREDICTED: pectate lyase-like                      247   1e-76   
gb|AAQ62997.1|  oil palm polygalacturonase allergen PEST411             247   2e-76   Elaeis guineensis
ref|XP_003519771.2|  PREDICTED: probable pectate lyase 3-like           247   2e-76   
gb|KHN08706.1|  Putative pectate lyase 3                                247   2e-76   
ref|XP_008339934.1|  PREDICTED: probable pectate lyase 3                247   2e-76   
ref|XP_010925369.1|  PREDICTED: pectate lyase                           246   2e-76   
ref|XP_011098576.1|  PREDICTED: probable pectate lyase P56              247   2e-76   
gb|KCW52797.1|  hypothetical protein EUGRSUZ_J02132                     247   2e-76   
ref|XP_006363934.1|  PREDICTED: pectate lyase-like                      246   3e-76   
ref|XP_004489168.1|  PREDICTED: pectate lyase-like                      246   3e-76   
ref|XP_009789921.1|  PREDICTED: probable pectate lyase P59              246   3e-76   
ref|XP_010112093.1|  putative pectate lyase 7                           246   3e-76   
gb|KHN45481.1|  Putative pectate lyase 3                                244   3e-76   
ref|XP_004490004.1|  PREDICTED: probable pectate lyase 3-like iso...    244   3e-76   
ref|XP_009389712.1|  PREDICTED: pectate lyase-like                      245   4e-76   
ref|XP_007157384.1|  hypothetical protein PHAVU_002G065800g             245   6e-76   
ref|XP_003621115.1|  Pectate lyase                                      245   7e-76   
ref|XP_004490003.1|  PREDICTED: probable pectate lyase 3-like iso...    245   7e-76   
ref|XP_009587689.1|  PREDICTED: probable pectate lyase P59              245   9e-76   
emb|CAN79927.1|  hypothetical protein VITISV_042447                     245   9e-76   Vitis vinifera
ref|XP_010683248.1|  PREDICTED: pectate lyase-like                      245   9e-76   
gb|AAA86241.1|  pectate lyase homolog                                   245   9e-76   Medicago sativa [alfalfa]
ref|XP_002282500.3|  PREDICTED: pectate lyase                           244   1e-75   Vitis vinifera
ref|XP_008446067.1|  PREDICTED: pectate lyase-like                      243   1e-75   
ref|XP_004165454.1|  PREDICTED: pectate lyase-like                      244   1e-75   
ref|XP_008365507.1|  PREDICTED: pectate lyase-like                      243   1e-75   
ref|XP_007153840.1|  hypothetical protein PHAVU_003G069100g             244   1e-75   
ref|XP_008339935.1|  PREDICTED: probable pectate lyase 3                244   2e-75   
emb|CBI22159.3|  unnamed protein product                                245   2e-75   
ref|XP_009342871.1|  PREDICTED: pectate lyase-like                      244   2e-75   
ref|XP_008357758.1|  PREDICTED: pectate lyase-like                      244   2e-75   
gb|EYU24412.1|  hypothetical protein MIMGU_mgv1a011674mg                239   2e-75   
ref|XP_006357121.1|  PREDICTED: pectate lyase-like                      243   2e-75   
gb|EPS66620.1|  hypothetical protein M569_08154                         244   2e-75   
ref|XP_009360393.1|  PREDICTED: probable pectate lyase 3                244   2e-75   
ref|XP_009408830.1|  PREDICTED: pectate lyase-like                      244   2e-75   
ref|XP_010317101.1|  PREDICTED: probable pectate lyase P59              242   3e-75   
ref|XP_006579282.1|  PREDICTED: probable pectate lyase P59-like         243   3e-75   
ref|XP_003554335.1|  PREDICTED: pectate lyase-like                      243   3e-75   
ref|XP_009587688.1|  PREDICTED: pectate lyase-like                      242   4e-75   
ref|XP_008374522.1|  PREDICTED: pectate lyase-like                      243   4e-75   
ref|XP_011087217.1|  PREDICTED: pectate lyase-like                      243   4e-75   
ref|XP_004147462.1|  PREDICTED: probable pectate lyase 7-like           243   5e-75   
ref|XP_006338480.1|  PREDICTED: probable pectate lyase P59-like         243   5e-75   
gb|EEE56553.1|  hypothetical protein OsJ_05879                          242   5e-75   Oryza sativa Japonica Group [Japonica rice]
gb|KGN59593.1|  hypothetical protein Csa_3G827350                       243   5e-75   
ref|XP_009369346.1|  PREDICTED: pectate lyase-like                      243   5e-75   
ref|XP_004228388.1|  PREDICTED: pectate lyase                           243   5e-75   
ref|XP_008221658.1|  PREDICTED: pectate lyase-like                      243   6e-75   
ref|XP_009789922.1|  PREDICTED: pectate lyase-like                      241   6e-75   
ref|XP_008443432.1|  PREDICTED: probable pectate lyase 19               243   6e-75   
ref|XP_004232242.1|  PREDICTED: probable pectate lyase P59              243   6e-75   
ref|XP_006361835.1|  PREDICTED: probable pectate lyase P59-like         243   6e-75   
gb|KEH19822.1|  pectate lyase-like protein                              243   7e-75   
ref|XP_010670318.1|  PREDICTED: pectate lyase-like                      243   7e-75   
gb|KHG23093.1|  hypothetical protein F383_29772                         241   8e-75   
gb|EAY85003.1|  hypothetical protein OsI_06363                          242   8e-75   Oryza sativa Indica Group [Indian rice]
ref|XP_002270112.1|  PREDICTED: pectate lyase                           242   8e-75   Vitis vinifera
gb|ACU23277.1|  unknown                                                 242   8e-75   Glycine max [soybeans]
ref|XP_008679844.1|  PREDICTED: pectate lyase                           242   9e-75   
ref|XP_009617495.1|  PREDICTED: probable pectate lyase P59              243   9e-75   
gb|ACF87417.1|  unknown                                                 242   9e-75   Zea mays [maize]
ref|XP_003543726.1|  PREDICTED: pectate lyase                           242   9e-75   
ref|NP_001046281.1|  Os02g0214400                                       242   1e-74   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004234779.1|  PREDICTED: probable pectate lyase P59              242   1e-74   
ref|XP_009802165.1|  PREDICTED: probable pectate lyase P59              242   1e-74   
ref|XP_007032453.1|  Pectate lyase family protein                       243   1e-74   
gb|KHN08855.1|  Putative pectate lyase P59                              242   1e-74   
emb|CAN69904.1|  hypothetical protein VITISV_001006                     242   1e-74   Vitis vinifera
emb|CAN77957.1|  hypothetical protein VITISV_021245                     241   1e-74   Vitis vinifera
sp|P15722.1|PLY59_SOLLC  RecName: Full=Probable pectate lyase P59...    242   1e-74   Solanum lycopersicum
ref|XP_004508770.1|  PREDICTED: probable pectate lyase P59-like         241   2e-74   
ref|XP_006357122.1|  PREDICTED: probable pectate lyase P59-like         242   2e-74   
ref|XP_004233352.1|  PREDICTED: pectate lyase-like                      240   2e-74   
ref|XP_010256490.1|  PREDICTED: pectate lyase-like                      241   2e-74   
ref|XP_008366366.1|  PREDICTED: pectate lyase-like                      242   2e-74   
ref|XP_008786760.1|  PREDICTED: pectate lyase-like                      242   2e-74   
ref|XP_002272638.2|  PREDICTED: pectate lyase-like                      241   2e-74   Vitis vinifera
gb|KHN13490.1|  Putative pectate lyase 3                                239   2e-74   
ref|XP_003530685.1|  PREDICTED: probable pectate lyase 3-like           241   3e-74   
ref|XP_009381244.1|  PREDICTED: pectate lyase-like                      240   3e-74   
ref|XP_008389523.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    241   5e-74   
ref|XP_002311599.2|  pectate lyase family protein                       240   5e-74   Populus trichocarpa [western balsam poplar]
gb|KHG05193.1|  hypothetical protein F383_30875                         238   6e-74   
ref|XP_011025954.1|  PREDICTED: probable pectate lyase P59              239   1e-73   
ref|XP_007139601.1|  hypothetical protein PHAVU_008G043600g             239   1e-73   
ref|XP_002453531.1|  hypothetical protein SORBIDRAFT_04g007450          239   1e-73   Sorghum bicolor [broomcorn]
gb|KDP45476.1|  hypothetical protein JCGZ_09725                         240   1e-73   
ref|XP_011098575.1|  PREDICTED: probable pectate lyase P59              239   2e-73   
ref|XP_007046218.1|  Pectate lyase family protein, putative             239   2e-73   
gb|EYU34111.1|  hypothetical protein MIMGU_mgv1a006386mg                239   2e-73   
ref|XP_010242445.1|  PREDICTED: pectate lyase                           238   3e-73   
ref|XP_007137422.1|  hypothetical protein PHAVU_009G125800g             238   3e-73   
ref|XP_009615547.1|  PREDICTED: probable pectate lyase P59              238   3e-73   
ref|XP_008793504.1|  PREDICTED: pectate lyase-like                      238   4e-73   
gb|KHN13240.1|  Putative pectate lyase 3                                238   4e-73   
ref|XP_008341537.1|  PREDICTED: pectate lyase-like                      238   5e-73   
ref|XP_003613595.1|  Pectate lyase                                      238   5e-73   
gb|AES91206.2|  pectate lyase P59-like protein                          237   6e-73   
ref|XP_004489374.1|  PREDICTED: pectate lyase-like                      238   7e-73   
gb|KHG16093.1|  hypothetical protein F383_07683                         238   8e-73   
ref|XP_004236194.1|  PREDICTED: probable pectate lyase P59              237   1e-72   
gb|EYU36839.1|  hypothetical protein MIMGU_mgv1a006379mg                237   1e-72   
gb|EPS62426.1|  hypothetical protein M569_12361                         236   1e-72   
ref|XP_010105747.1|  putative pectate lyase P59                         236   2e-72   
ref|XP_003571658.1|  PREDICTED: pectate lyase-like                      236   2e-72   
ref|XP_006344502.1|  PREDICTED: probable pectate lyase P59-like         235   3e-72   
emb|CDP14850.1|  unnamed protein product                                235   4e-72   
ref|NP_197015.4|  putative pectate lyase 19                             236   4e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CDP00293.1|  unnamed protein product                                235   5e-72   
gb|ABK28696.1|  unknown                                                 236   5e-72   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ99909.1|  predicted protein                                      231   7e-72   
ref|XP_003613596.1|  Pectate lyase                                      235   9e-72   
ref|XP_011085777.1|  PREDICTED: probable pectate lyase P59              234   1e-71   
ref|XP_007151201.1|  hypothetical protein PHAVU_004G026400g             234   2e-71   
gb|KEH24975.1|  pectate lyase P59-like protein                          234   2e-71   
ref|XP_002437204.1|  hypothetical protein SORBIDRAFT_10g022830          234   2e-71   Sorghum bicolor [broomcorn]
ref|XP_011013803.1|  PREDICTED: pectate lyase-like                      233   2e-71   
ref|XP_006374492.1|  hypothetical protein POPTR_0015s07590g             233   2e-71   
ref|XP_009758350.1|  PREDICTED: pectate lyase-like                      234   2e-71   
ref|XP_004302354.1|  PREDICTED: probable pectate lyase P59-like         234   2e-71   
ref|XP_009599232.1|  PREDICTED: pectate lyase-like                      233   2e-71   
ref|XP_009761969.1|  PREDICTED: probable pectate lyase P59              233   3e-71   
ref|XP_004298448.1|  PREDICTED: probable pectate lyase 3-like           233   3e-71   
ref|XP_004152537.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    233   3e-71   
dbj|BAK06965.1|  predicted protein                                      233   4e-71   
gb|ABM68553.1|  pectate lyase                                           227   4e-71   Lilium longiflorum [Easter lily]
ref|XP_009797403.1|  PREDICTED: pectate lyase-like                      233   4e-71   
ref|XP_007037229.1|  Pectate lyase family protein                       233   4e-71   
ref|XP_003563707.1|  PREDICTED: pectate lyase-like                      233   5e-71   
ref|XP_004964534.1|  PREDICTED: pectate lyase-like                      232   6e-71   
ref|XP_009403112.1|  PREDICTED: pectate lyase-like                      232   7e-71   
ref|XP_006439649.1|  hypothetical protein CICLE_v10020193mg             232   7e-71   
gb|KHG08055.1|  putative pectate lyase P59                              232   9e-71   
ref|XP_010683249.1|  PREDICTED: pectate lyase-like                      232   9e-71   
gb|KDO76053.1|  hypothetical protein CISIN_1g013757mg                   231   1e-70   
ref|XP_010068708.1|  PREDICTED: pectate lyase-like                      231   1e-70   
ref|XP_011087066.1|  PREDICTED: pectate lyase                           231   1e-70   
ref|XP_006477525.1|  PREDICTED: pectate lyase-like                      231   1e-70   
gb|ACN35280.1|  unknown                                                 226   2e-70   Zea mays [maize]
ref|XP_004301165.1|  PREDICTED: probable pectate lyase P59-like         231   2e-70   
ref|XP_010320663.1|  PREDICTED: probable pectate lyase 3                229   2e-70   
ref|XP_006354795.1|  PREDICTED: pectate lyase-like                      231   2e-70   
ref|XP_006842121.1|  hypothetical protein AMTR_s00078p00106380          231   3e-70   
ref|XP_008812405.1|  PREDICTED: probable pectate lyase 8                231   3e-70   
ref|XP_009788285.1|  PREDICTED: pectate lyase-like                      230   3e-70   
gb|ACF84425.1|  unknown                                                 225   4e-70   Zea mays [maize]
ref|XP_006655782.1|  PREDICTED: pectate lyase-like                      227   5e-70   
ref|XP_006357289.1|  PREDICTED: probable pectate lyase 3-like           230   5e-70   
gb|KHN13652.1|  Pectate lyase                                           229   7e-70   
gb|EMS45831.1|  Pectate lyase                                           232   7e-70   
dbj|BAH20311.1|  AT3G01270                                              227   7e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003552513.1|  PREDICTED: pectate lyase-like                      229   7e-70   
gb|AAA16476.1|  pectate lyase homolog                                   229   7e-70   Zea mays [maize]
ref|XP_002323835.1|  hypothetical protein POPTR_0017s11450g             229   8e-70   Populus trichocarpa [western balsam poplar]
ref|XP_006656188.1|  PREDICTED: pectate lyase-like                      229   1e-69   
ref|XP_010528323.1|  PREDICTED: probable pectate lyase 19               229   1e-69   
ref|XP_010933172.1|  PREDICTED: probable pectate lyase 8 isoform X2     228   1e-69   
ref|XP_011009454.1|  PREDICTED: pectate lyase-like                      229   1e-69   
ref|XP_003609009.1|  Pectate lyase                                      229   1e-69   
gb|EYU46355.1|  hypothetical protein MIMGU_mgv1a007094mg                228   2e-69   
ref|XP_011005067.1|  PREDICTED: probable pectate lyase P59              229   2e-69   
ref|XP_006826355.1|  hypothetical protein AMTR_s00004p00123190          229   2e-69   
ref|XP_010463548.1|  PREDICTED: probable pectate lyase 7                229   2e-69   
emb|CDY45202.1|  BnaA06g34060D                                          229   2e-69   
ref|XP_010933171.1|  PREDICTED: probable pectate lyase 8 isoform X1     228   2e-69   
gb|EMS65801.1|  hypothetical protein TRIUR3_32637                       223   2e-69   
ref|XP_009101245.1|  PREDICTED: probable pectate lyase 6                229   2e-69   
sp|P40973.1|PLY_LILLO  RecName: Full=Pectate lyase; Flags: Precursor    228   3e-69   Lilium longiflorum [Easter lily]
gb|AAM60924.1|  putative pectate lyase                                  229   4e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AAQ62996.1|  oil palm polygalacturonase allergen PEST361             228   4e-69   Elaeis guineensis
ref|NP_186776.1|  putative pectate lyase 7                              229   4e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AGT16685.1|  pectate lyase precursor                                 224   4e-69   
ref|XP_010915114.1|  PREDICTED: LOW QUALITY PROTEIN: pectate lyas...    228   5e-69   
gb|AGT16687.1|  pectate lyase                                           227   5e-69   
ref|XP_002306040.1|  hypothetical protein POPTR_0004s12300g             227   5e-69   Populus trichocarpa [western balsam poplar]
ref|XP_009126031.1|  PREDICTED: probable pectate lyase 19               228   5e-69   
ref|XP_008789532.1|  PREDICTED: probable pectate lyase 8                224   5e-69   
ref|XP_009627245.1|  PREDICTED: pectate lyase-like                      227   6e-69   
ref|XP_010513594.1|  PREDICTED: probable pectate lyase 7                228   7e-69   
ref|XP_002437815.1|  hypothetical protein SORBIDRAFT_10g003090          227   8e-69   Sorghum bicolor [broomcorn]
dbj|BAF01663.1|  pectate lyase like protein                             222   9e-69   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001056784.1|  Os06g0144900                                       227   1e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010485518.1|  PREDICTED: probable pectate lyase 7                227   1e-68   
emb|CDY03043.1|  BnaC07g21840D                                          227   1e-68   
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8                227   1e-68   
ref|XP_011097774.1|  PREDICTED: pectate lyase-like                      226   2e-68   
gb|EAY99621.1|  hypothetical protein OsI_21600                          226   2e-68   Oryza sativa Indica Group [Indian rice]
ref|XP_010420165.1|  PREDICTED: probable pectate lyase 19 isoform X3    228   2e-68   
ref|XP_010420164.1|  PREDICTED: probable pectate lyase 19 isoform X2    227   2e-68   
ref|XP_010453638.1|  PREDICTED: probable pectate lyase 19               227   2e-68   
emb|CDY01151.1|  BnaA04g06680D                                          226   2e-68   
ref|XP_010492335.1|  PREDICTED: probable pectate lyase 19               228   2e-68   
ref|XP_010918897.1|  PREDICTED: probable pectate lyase 8 isoform X2     226   2e-68   
ref|XP_010420163.1|  PREDICTED: probable pectate lyase 19 isoform X1    228   2e-68   
ref|XP_002871648.1|  pectate lyase family protein                       227   2e-68   
sp|Q9LFP5.1|PLY19_ARATH  RecName: Full=Probable pectate lyase 19;...    226   2e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CDX85564.1|  BnaA02g02490D                                          226   2e-68   
ref|XP_010918895.1|  PREDICTED: probable pectate lyase 8 isoform X1     226   2e-68   
ref|XP_009397895.1|  PREDICTED: probable pectate lyase 8                226   2e-68   
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    226   2e-68   
ref|XP_008804450.1|  PREDICTED: probable pectate lyase 8 isoform X2     225   2e-68   
ref|XP_009609746.1|  PREDICTED: probable pectate lyase 8                225   2e-68   
ref|XP_009598230.1|  PREDICTED: pectate lyase-like                      225   2e-68   
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    226   3e-68   
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    226   3e-68   
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    226   3e-68   
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               226   3e-68   
ref|XP_009799817.1|  PREDICTED: probable pectate lyase 8                225   3e-68   
gb|EAY99626.1|  hypothetical protein OsI_21605                          225   3e-68   Oryza sativa Indica Group [Indian rice]
ref|XP_002446075.1|  hypothetical protein SORBIDRAFT_06g001410          223   3e-68   Sorghum bicolor [broomcorn]
ref|XP_011086389.1|  PREDICTED: pectate lyase-like                      225   3e-68   
ref|XP_008804449.1|  PREDICTED: probable pectate lyase 8 isoform X1     225   4e-68   
ref|XP_009121613.1|  PREDICTED: probable pectate lyase 19               226   4e-68   
ref|XP_011080166.1|  PREDICTED: probable pectate lyase 8                224   4e-68   
emb|CDY66593.1|  BnaCnng51570D                                          226   5e-68   
ref|XP_010106682.1|  hypothetical protein L484_004616                   224   5e-68   
ref|XP_009382167.1|  PREDICTED: probable pectate lyase 8                224   6e-68   
ref|XP_006286712.1|  hypothetical protein CARUB_v10002862mg             226   6e-68   
gb|KHG08946.1|  Pectate lyase                                           223   6e-68   
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               225   6e-68   
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     224   7e-68   
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     224   8e-68   
gb|KFK25747.1|  hypothetical protein AALP_AA8G154300                    226   8e-68   
emb|CDY18738.1|  BnaC08g08780D                                          225   8e-68   
emb|CDY56668.1|  BnaCnng30870D                                          223   8e-68   
ref|XP_007201029.1|  hypothetical protein PRUPE_ppa006229mg             223   9e-68   
dbj|BAF43573.1|  pectate lyase                                          223   1e-67   
ref|XP_009384552.1|  PREDICTED: probable pectate lyase 8                224   1e-67   
ref|NP_001141589.1|  uncharacterized protein LOC100273705               224   1e-67   
emb|CDX74293.1|  BnaA03g27540D                                          224   1e-67   
gb|EPS68938.1|  hypothetical protein M569_05827                         222   1e-67   
ref|XP_008235520.1|  PREDICTED: probable pectate lyase 8                224   1e-67   
ref|XP_006352706.1|  PREDICTED: probable pectate lyase 10-like          223   1e-67   
emb|CDX91953.1|  BnaC03g32550D                                          224   1e-67   
ref|XP_002870357.1|  pectate lyase family protein                       224   2e-67   
ref|NP_001147553.1|  pectate lyase 8                                    224   2e-67   
ref|XP_010102919.1|  hypothetical protein L484_018936                   223   2e-67   
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     221   2e-67   
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               224   2e-67   
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             223   2e-67   
ref|XP_008667903.1|  PREDICTED: pectate lyase 8 isoform X1              224   2e-67   
ref|XP_004242391.1|  PREDICTED: probable pectate lyase 8                223   2e-67   
ref|XP_007037816.1|  Pectin lyase-like superfamily protein isoform 2    220   2e-67   
emb|CDY53564.1|  BnaC04g55760D                                          223   2e-67   
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          223   3e-67   
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             224   3e-67   
dbj|BAK05605.1|  predicted protein                                      223   3e-67   
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     223   3e-67   
gb|KFK37588.1|  hypothetical protein AALP_AA3G002600                    224   3e-67   
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              223   3e-67   
ref|XP_004975048.1|  PREDICTED: probable pectate lyase 15-like is...    223   3e-67   
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          223   3e-67   
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     223   3e-67   
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  221   4e-67   
ref|XP_009111860.1|  PREDICTED: probable pectate lyase 20               222   4e-67   
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     222   4e-67   
ref|XP_010672089.1|  PREDICTED: probable pectate lyase 1                222   4e-67   
ref|XP_009400924.1|  PREDICTED: probable pectate lyase 8 isoform X2     223   4e-67   
ref|XP_009400922.1|  PREDICTED: probable pectate lyase 8 isoform X1     223   4e-67   
emb|CDY19932.1|  BnaA09g03190D                                          222   4e-67   
ref|XP_002436463.1|  hypothetical protein SORBIDRAFT_10g003080          223   4e-67   
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     222   4e-67   
gb|ACF40835.1|  pectate lyase                                           218   5e-67   
ref|XP_006854398.1|  hypothetical protein AMTR_s00039p00189000          223   5e-67   
ref|XP_008800564.1|  PREDICTED: probable pectate lyase 8 isoform X2     223   5e-67   
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     222   5e-67   
ref|NP_001190720.1|  probable pectate lyase 15                          222   5e-67   
ref|NP_567409.1|  probable pectate lyase 15                             223   6e-67   
ref|XP_008800563.1|  PREDICTED: probable pectate lyase 8 isoform X1     222   6e-67   
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         222   6e-67   
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     222   6e-67   
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               222   6e-67   
gb|EMT27253.1|  hypothetical protein F775_20306                         219   7e-67   
gb|KHG22755.1|  hypothetical protein F383_29653                         221   7e-67   
ref|XP_002265100.1|  PREDICTED: probable pectate lyase 8                222   8e-67   
ref|XP_004975047.1|  PREDICTED: probable pectate lyase 15-like is...    223   8e-67   
dbj|BAK06362.1|  predicted protein                                      222   9e-67   
gb|EYU28712.1|  hypothetical protein MIMGU_mgv1a006498mg                221   9e-67   
emb|CAN75298.1|  hypothetical protein VITISV_008675                     221   9e-67   
ref|XP_002887143.1|  pectate lyase family protein                       221   9e-67   
ref|XP_006653139.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    223   1e-66   
emb|CBI33346.3|  unnamed protein product                                221   1e-66   
gb|KHG12411.1|  hypothetical protein F383_06737                         219   1e-66   
ref|XP_010940647.1|  PREDICTED: probable pectate lyase 8                221   1e-66   
ref|XP_008439105.1|  PREDICTED: probable pectate lyase 22               220   1e-66   
ref|XP_010100325.1|  hypothetical protein L484_027633                   220   1e-66   
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22               220   1e-66   
ref|XP_002304700.1|  pectate lyase family protein                       221   1e-66   
ref|XP_010069078.1|  PREDICTED: probable pectate lyase 8                221   1e-66   
gb|AFW87059.1|  pectate lyase                                           221   1e-66   
ref|XP_009105097.1|  PREDICTED: probable pectate lyase 5                220   1e-66   
gb|KCW57296.1|  hypothetical protein EUGRSUZ_H00093                     221   1e-66   
ref|XP_004163042.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    220   1e-66   
ref|XP_004966014.1|  PREDICTED: pectate lyase-like                      222   1e-66   
gb|AAM61584.1|  putative pectate lyase                                  220   1e-66   
gb|KHN15224.1|  Putative pectate lyase 15                               216   1e-66   
gb|KHN07207.1|  Putative pectate lyase 15                               216   1e-66   
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           221   1e-66   
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                220   1e-66   
ref|NP_001150723.1|  pectate lyase precursor                            221   1e-66   
ref|NP_187357.1|  putative pectate lyase 8                              220   1e-66   
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8                221   1e-66   
gb|AAK66161.1|  pectate lyase                                           219   1e-66   
ref|XP_004152014.1|  PREDICTED: probable pectate lyase 8-like           221   1e-66   
ref|XP_002297822.1|  pectate lyase family protein                       221   2e-66   
gb|KDP26417.1|  hypothetical protein JCGZ_17575                         221   2e-66   
emb|CDX70590.1|  BnaC03g06740D                                          222   2e-66   
gb|ACB12931.1|  pectate lyase 1-27                                      221   2e-66   
ref|XP_008447332.1|  PREDICTED: probable pectate lyase 8                221   2e-66   
ref|XP_002285639.2|  PREDICTED: probable pectate lyase 8                221   2e-66   
ref|XP_007209185.1|  hypothetical protein PRUPE_ppa006392mg             220   2e-66   
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    219   2e-66   
ref|XP_004975046.1|  PREDICTED: probable pectate lyase 15-like is...    223   2e-66   
ref|XP_009134622.1|  PREDICTED: probable pectate lyase 7                221   2e-66   
gb|AAL06861.1|  At1g04680/T1G11_6                                       218   2e-66   
emb|CDY05305.1|  BnaC05g44980D                                          220   2e-66   
emb|CDY24654.1|  BnaA05g30530D                                          220   2e-66   
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           222   2e-66   
gb|EEE60442.1|  hypothetical protein OsJ_13660                          221   2e-66   
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                221   2e-66   
ref|XP_006360328.1|  PREDICTED: probable pectate lyase 15-like          221   2e-66   
ref|XP_009131435.1|  PREDICTED: probable pectate lyase 19               221   2e-66   
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                219   2e-66   
gb|EMT28700.1|  hypothetical protein F775_17439                         219   2e-66   
ref|XP_004247823.1|  PREDICTED: probable pectate lyase 8                221   2e-66   
ref|XP_009385867.1|  PREDICTED: probable pectate lyase 8 isoform X2     221   2e-66   
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                221   2e-66   
ref|XP_009371193.1|  PREDICTED: probable pectate lyase 8                221   2e-66   
ref|XP_002521130.1|  Pectate lyase precursor, putative                  220   2e-66   
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                219   3e-66   
gb|AAF19196.1|AF206320_1  pectate lyase 2                               221   3e-66   
gb|KFK38096.1|  hypothetical protein AALP_AA3G068900                    219   3e-66   
ref|XP_010243989.1|  PREDICTED: probable pectate lyase 8                220   3e-66   
gb|EPS58564.1|  hypothetical protein M569_16249                         217   3e-66   
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5                219   3e-66   
emb|CAN76500.1|  hypothetical protein VITISV_004734                     219   3e-66   
ref|XP_006854397.1|  hypothetical protein AMTR_s00039p00186640          220   3e-66   
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22               219   3e-66   
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                220   3e-66   
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like          220   3e-66   
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                219   3e-66   
gb|KFK39718.1|  hypothetical protein AALP_AA3G279700                    218   3e-66   
ref|XP_010109687.1|  hypothetical protein L484_015172                   220   4e-66   
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                219   4e-66   
ref|XP_002301766.2|  hypothetical protein POPTR_0002s23990g             220   4e-66   
ref|XP_004134015.1|  PREDICTED: probable pectate lyase 15-like          220   4e-66   
ref|XP_006280553.1|  hypothetical protein CARUB_v10026494mg             219   4e-66   
gb|EPS73633.1|  hypothetical protein M569_01123                         220   4e-66   
emb|CAE02420.2|  OSJNBa0095E20.8                                        221   4e-66   
ref|XP_010682362.1|  PREDICTED: probable pectate lyase 5                219   4e-66   
ref|XP_011024740.1|  PREDICTED: probable pectate lyase 20               220   4e-66   
ref|XP_009385866.1|  PREDICTED: probable pectate lyase 8 isoform X1     221   4e-66   
ref|XP_010264036.1|  PREDICTED: probable pectate lyase 8                219   4e-66   
ref|XP_004299169.1|  PREDICTED: probable pectate lyase 18-like          219   4e-66   
emb|CAC80136.1|  pectate lyase II enzyme                                220   5e-66   
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           219   5e-66   
gb|EEC76710.1|  hypothetical protein OsI_14719                          220   5e-66   
gb|EYU43815.1|  hypothetical protein MIMGU_mgv1a006554mg                219   5e-66   
gb|KDO69411.1|  hypothetical protein CISIN_1g015569mg                   214   5e-66   
ref|NP_001056786.1|  Os06g0145100                                       217   5e-66   
gb|ADB90476.1|  pectate lyase                                           219   5e-66   
ref|XP_009408120.1|  PREDICTED: probable pectate lyase 8                219   5e-66   
gb|KFK39719.1|  hypothetical protein AALP_AA3G279700                    219   5e-66   
ref|XP_010444201.1|  PREDICTED: probable pectate lyase 22 isoform X3    217   6e-66   
gb|AAZ31564.1|  pectate lyase isoform 2                                 218   6e-66   
gb|AAZ31566.1|  pectate lyase isoform 4                                 218   6e-66   
ref|NP_001052103.1|  Os04g0137100                                       221   6e-66   
gb|ABK92535.1|  unknown                                                 214   6e-66   
ref|XP_007222794.1|  hypothetical protein PRUPE_ppa006665mg             218   6e-66   
gb|KHG06252.1|  hypothetical protein F383_10745                         219   6e-66   
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like           218   6e-66   
emb|CDP13269.1|  unnamed protein product                                218   6e-66   
ref|XP_009775177.1|  PREDICTED: probable pectate lyase 8                219   6e-66   
ref|XP_010556943.1|  PREDICTED: probable pectate lyase 1                219   6e-66   
gb|AAK66160.1|  pectate lyase B                                         218   7e-66   
gb|AAB71208.1|  pectate lyase                                           218   7e-66   
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                    218   7e-66   
ref|XP_009147117.1|  PREDICTED: probable pectate lyase 8                218   7e-66   
gb|ABR26682.1|  pectate lyase                                           219   7e-66   
ref|XP_008221954.1|  PREDICTED: probable pectate lyase 5                218   7e-66   
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5                218   8e-66   
dbj|BAB10560.1|  pectate lyase                                          218   8e-66   
ref|NP_568967.1|  putative pectate lyase 22                             219   8e-66   
ref|XP_006480190.1|  PREDICTED: probable pectate lyase 8-like           219   8e-66   
ref|XP_010248740.1|  PREDICTED: probable pectate lyase 18               218   9e-66   
gb|KDO65869.1|  hypothetical protein CISIN_1g013239mg                   219   9e-66   
ref|XP_010486231.1|  PREDICTED: probable pectate lyase 8                218   9e-66   
ref|XP_008382653.1|  PREDICTED: probable pectate lyase 10               217   9e-66   
gb|KHF99208.1|  hypothetical protein F383_08934                         219   9e-66   
ref|XP_004310004.1|  PREDICTED: probable pectate lyase 5-like           218   9e-66   
emb|CDY65626.1|  BnaC03g74840D                                          219   9e-66   
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             219   9e-66   
gb|KEH41255.1|  pectate lyase family protein                            219   1e-65   
ref|XP_010484044.1|  PREDICTED: probable pectate lyase 22               218   1e-65   
ref|XP_010447044.1|  PREDICTED: probable pectate lyase 8                218   1e-65   
ref|XP_007049844.1|  Pectin lyase-like superfamily protein              219   1e-65   
gb|KHG30349.1|  hypothetical protein F383_15991                         220   1e-65   
ref|XP_010444198.1|  PREDICTED: probable pectate lyase 22               218   1e-65   
ref|XP_002321242.2|  pectate lyase family protein                       217   1e-65   
ref|XP_009359518.1|  PREDICTED: probable pectate lyase 18               218   1e-65   
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          219   1e-65   
ref|XP_002866540.1|  pectate lyase                                      218   1e-65   
ref|NP_563715.1|  putative pectate lyase 1                              218   1e-65   
ref|XP_006420566.1|  hypothetical protein CICLE_v10004783mg             219   1e-65   
ref|XP_010459939.1|  PREDICTED: probable pectate lyase 22               218   1e-65   
gb|KHG22990.1|  hypothetical protein F383_28754                         217   1e-65   
ref|XP_011029589.1|  PREDICTED: probable pectate lyase 5                217   2e-65   
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                219   2e-65   
ref|XP_009593549.1|  PREDICTED: probable pectate lyase 8                218   2e-65   
ref|XP_004290232.1|  PREDICTED: probable pectate lyase 8-like           218   2e-65   
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                217   2e-65   
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    218   2e-65   
ref|XP_009362042.1|  PREDICTED: probable pectate lyase 8                218   2e-65   
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           217   2e-65   
ref|XP_010464311.1|  PREDICTED: probable pectate lyase 8                218   2e-65   
gb|AEN70985.1|  pectate lyase                                           217   2e-65   
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like          217   2e-65   
emb|CDY41506.1|  BnaA06g22590D                                          217   2e-65   
dbj|BAD68402.1|  putative pectate lyase homolog                         218   2e-65   
ref|XP_008372438.1|  PREDICTED: probable pectate lyase 8                218   2e-65   
gb|ADB90479.1|  pectate lyase                                           217   2e-65   
ref|NP_001289258.1|  probable pectate lyase 18 precursor                217   2e-65   
gb|AFZ78654.1|  pectate lyase                                           218   2e-65   
dbj|BAC42832.1|  putative pectate lyase                                 213   2e-65   
gb|KHN34377.1|  Putative pectate lyase 22                               217   2e-65   
gb|AEN70977.1|  pectate lyase                                           217   2e-65   
gb|AEN70965.1|  pectate lyase                                           217   2e-65   
ref|NP_001056781.1|  Os06g0144200                                       218   2e-65   
gb|AEN70984.1|  pectate lyase                                           217   2e-65   
gb|KHG19997.1|  hypothetical protein F383_02891                         217   2e-65   
ref|XP_009150377.1|  PREDICTED: probable pectate lyase 22               217   2e-65   
emb|CDY16732.1|  BnaA09g06500D                                          218   2e-65   
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18               217   2e-65   



>emb|CDP02199.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V IA GAG T+QF +NIII N+ I ++K TSGG++RDSV H GLRT +EGD
Sbjct  93   KTIDGRGVNVHIAYGAGFTIQFVRNIIIHNVHIHDVKTTSGGMIRDSVDHVGLRTANEGD  152

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG+  VW+DH+SM KC DG+IDAV+ STA+TISNCHFTDH KVLLFGA++   VDK
Sbjct  153  GISIFGARDVWLDHLSMSKCSDGLIDAVQASTAITISNCHFTDHDKVLLFGASDVTEVDK  212

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+TVAFNHFGKRL QRMPRCR G FH+VNNDYT+WEMYA+GGS  +TIISQGN
Sbjct  213  NMQVTVAFNHFGKRLVQRMPRCRSGFFHLVNNDYTHWEMYAIGGSHDATIISQGN  267



>emb|CAA43413.1| pectate lyase [Nicotiana tabacum]
 emb|CAA47631.1| pectate lyase [Nicotiana tabacum]
Length=263

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V I  GAG+ +Q A NIII+NL+I NI PT GG++R+S  H GLR+ DEGD
Sbjct  17   KTIDGRGFNVHIQNGAGIKIQCASNIIISNLRIHNIVPTPGGLLRESEDHVGLRSGDEGD  76

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IF S  +WIDH+SM +  DG+IDAV  ST +TISNCHFTDH KV+LFGAN+   +DK
Sbjct  77   GISIFDSRDIWIDHISMSRATDGLIDAVAASTNITISNCHFTDHEKVMLFGANDNYVLDK  136

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             M+IT+A+NHFGKRL+QRMPRCR+G FH+VNNDYT+WE YA+GGS+G+TIISQGN
Sbjct  137  DMKITLAYNHFGKRLDQRMPRCRFGFFHLVNNDYTHWERYAIGGSSGATIISQGN  191



>gb|KFK33456.1| hypothetical protein AALP_AA5G015800 [Arabis alpina]
Length=460

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V I GGAGLT+QF KN+II N+ ++ I+  +GG++RDS +H GLRT  +GD
Sbjct  195  KTIDGRGVSVHITGGAGLTIQFVKNVIIHNIHMKFIERRAGGMIRDSENHFGLRTESDGD  254

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFG+++VWIDHVSM+ C DG+IDA+ GSTA+TISNCHFTDH +V+LFGA N D +DK
Sbjct  255  GINIFGATNVWIDHVSMRNCSDGMIDAIMGSTAITISNCHFTDHEEVMLFGAKNGDVIDK  314

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL+QRMPR R+GM H+VNNDYT+W+MYA+GG+   TIISQGN
Sbjct  315  KMQITVAFNHFGKRLDQRMPRVRYGMVHVVNNDYTHWQMYAIGGNMNPTIISQGN  369



>gb|KFK43687.1| hypothetical protein AALP_AA1G160000 [Arabis alpina]
Length=460

 Score =   256 bits (655),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA + I  GAGLTLQ+  N+II N+ +++I P +GG++RDS  H GLRT  +GD
Sbjct  195  KTIDGRGARIYIMEGAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSEHHLGLRTKSDGD  254

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+++VWIDHVSM +C DG+IDA++GSTAVTISN HFTDH +V+LFGA + D +DK
Sbjct  255  GISLFGATNVWIDHVSMTRCADGMIDAIQGSTAVTISNSHFTDHQEVMLFGARDEDVIDK  314

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRLEQRMPRCR+G+ H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  315  KMQITVAFNHFGKRLEQRMPRCRFGLIHVVNNDYTHWEMYAIGGNMNPTIISQGN  369



>ref|XP_007224275.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
 gb|EMJ25474.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
Length=443

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V I  GAG+T+QF KN+IITNL I+ IK   GGI+RDSV H G RT  +GD
Sbjct  184  KTIDGRGANVNIFDGAGITIQFVKNVIITNLHIKQIKAKEGGIIRDSVDHFGQRTKSDGD  243

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDHVSM+ C DG+IDA+ GST +TISNCHFT H++VLLFGA+N    DK
Sbjct  244  GISIFGSSNIWIDHVSMENCTDGLIDAIMGSTGITISNCHFTKHNEVLLFGASNSYTQDK  303

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFGK L QRMPRCR G FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  304  MMQITVAFNHFGKGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGN  358



>emb|CDY68729.1| BnaCnng60280D [Brassica napus]
Length=458

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I  GAGLTLQF  N+II N+ I+++ P SGG++RDS  H GLRT  +GD
Sbjct  193  KTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYIKHVVPKSGGLIRDSEQHIGLRTVSDGD  252

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+++VWIDHVSM +C DG+IDA+ GSTA+TISN HFTDH +V+LFGAN+   +DK
Sbjct  253  GISLFGATNVWIDHVSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDK  312

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL+QRMPRCR+G  H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  313  KMQITVAFNHFGKRLDQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGN  367



>ref|XP_010527872.1| PREDICTED: probable pectate lyase 3 isoform X2 [Tarenaya hassleriana]
Length=461

 Score =   256 bits (653),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V I GGAG TLQF  N+II N+ I+NI P +GG++RDS +H GLRT  +GD
Sbjct  196  KTIDGRGVRVHITGGAGFTLQFVNNVIIHNIYIKNIVPGNGGLIRDSETHFGLRTRSDGD  255

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFG+++VWIDHVSM  C DG+IDA++GST +TISNCH TDH +V+LFG  + D +DK
Sbjct  256  GINIFGATNVWIDHVSMSHCSDGMIDAIQGSTGITISNCHLTDHQEVMLFGGTDKDVIDK  315

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPRCR+G+ H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  316  KMQITVAFNHFGKRLVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNPTIISQGN  370



>ref|XP_009110541.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   256 bits (653),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I  GAGLTLQF  N+II N+ ++++ P SGG++RDS  H GLRT  +GD
Sbjct  193  KTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQHIGLRTVSDGD  252

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+++VWIDHVSM +C DG+IDA+ GSTA+TISN HFTDH +V+LFGAN+   +DK
Sbjct  253  GISLFGATNVWIDHVSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDK  312

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL+QRMPRCR+G  H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  313  KMQITVAFNHFGKRLDQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGN  367



>ref|XP_010033216.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
Length=435

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA GAG+T+QF +N+II N++I +I    GGI+RD+V H G+RT  +GD
Sbjct  176  KTIDGRGANVHIAFGAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHVGIRTMSDGD  235

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+++WIDHVSMK+C DG+IDA++GSTA+TISN H+T H+ V+LFGA++  P DK
Sbjct  236  GISIFGSTNIWIDHVSMKRCQDGLIDAIEGSTAITISNGHYTHHNDVMLFGASDLYPRDK  295

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFGK L QRMPRCRWG FH+VNNDYT+W MYA+GGS+  TIISQGN
Sbjct  296  IMQVTVAFNHFGKGLIQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSQPTIISQGN  350



>ref|XP_006292606.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
 gb|EOA25504.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
Length=455

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V I GGAGLTLQF +N+II N+ I+ IK  +GG++RDS  H GLRT  +GD
Sbjct  190  KTIDGRGANVHITGGAGLTLQFVRNVIIHNIYIKQIKKGAGGLIRDSEHHFGLRTVSDGD  249

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFG+++VWIDHVSM  C DG+IDA+ GSTA+TISN HFTDH +V+LFG  N D +DK
Sbjct  250  GINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGTNKDVIDK  309

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL+QRMPR R+G+ H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  310  KMQITVAFNHFGKRLKQRMPRVRYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGN  364



>emb|CDX96854.1| BnaA08g23970D [Brassica napus]
Length=458

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I  GAGLTLQF  N+II N+ ++++ P SGG++RDS  H GLRT  +GD
Sbjct  193  KTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQHIGLRTVSDGD  252

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+++VWIDHVSM +C DG+IDA+ GSTA+TISN HFTDH +V+LFGAN+   +DK
Sbjct  253  GISLFGATNVWIDHVSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDK  312

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL+QRMPRCR+G  H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  313  KMQITVAFNHFGKRLDQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGN  367



>ref|NP_172894.1| putative pectate lyase 3 [Arabidopsis thaliana]
 sp|Q9M9S2.1|PLY3_ARATH RecName: Full=Probable pectate lyase 3; AltName: Full=Pectate 
lyase A2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF43942.1|AC012188_19 Strong similarity to Pectate Lyase Precursor from Lilium longiflorum 
gi|730290 and contains a Pectate lyase PF|00544 domain. 
EST gb|AW004514 comes from this gene [Arabidopsis thaliana]
 gb|AAQ62871.1| At1g14420 [Arabidopsis thaliana]
 dbj|BAD43564.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43610.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43654.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43743.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43876.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43899.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29161.1| putative pectate lyase 3 [Arabidopsis thaliana]
Length=459

 Score =   254 bits (648),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I  GAGLTLQF  N+II N+ +++I P +GG++RDS +H GLRT  +GD
Sbjct  194  KTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEAHIGLRTKSDGD  253

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG++++WIDHVSM +C DG+IDA+ GSTAVTISN HFTDH +V+LFGA +   +DK
Sbjct  254  GISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDK  313

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRLEQRMPRCR+G  H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  314  KMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGN  368



>ref|XP_002520133.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF42188.1| Pectate lyase precursor, putative [Ricinus communis]
Length=440

 Score =   253 bits (646),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IAGGAGLTLQF +N+II  ++I +I   SGG+VRDSV H G RT  +GD
Sbjct  181  KTIDARGANVHIAGGAGLTLQFVQNVIIHGIRIHDIVSGSGGLVRDSVDHYGFRTKSDGD  240

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDHVSM  C DG+IDA+ GST++TISNCHFT+H++V+LFGA++    D 
Sbjct  241  GISIFGSSNIWIDHVSMSNCQDGLIDAIMGSTSITISNCHFTNHNEVMLFGASDGYSADT  300

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  301  IMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSRKPTIISQGN  355



>emb|CDX81636.1| BnaC08g39650D [Brassica napus]
Length=484

 Score =   254 bits (648),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I  GAGLT QF  N+II N+ +++I P +GG++RDS  H GLRT  +GD
Sbjct  187  KTIDGRGARVYIMEGAGLTQQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGLRTKSDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+++VWIDHVSM +C DG+IDA++GSTAVTISN HFTDH +V+LFGA +   +DK
Sbjct  247  GISLFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDK  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRLEQRMPRCR+G  H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  307  NMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGN  361



>emb|CDY53552.1| BnaA09g57110D [Brassica napus]
Length=495

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I  G GLTLQF  N+II N+ +++I P +GG++RDS  H GLRT  +GD
Sbjct  187  KTIDGRGAKVYIMEGVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGLRTKSDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+++VWIDHVSM +C DG+IDA++GSTAVTISN HFTDH +V+LFGA +   +DK
Sbjct  247  GISLFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDK  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRLEQRMPRCR+G  H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  307  NMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGN  361



>ref|XP_009599825.1| PREDICTED: probable pectate lyase P59 isoform X1 [Nicotiana tomentosiformis]
Length=445

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAG+TLQ+ KN+II  L I +I   SGG+VRD+V H G+RT  +GD
Sbjct  184  KTIDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGD  243

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG+S++WIDHVSM+KC DGIIDAV+GSTA+TISN HFTDH++V+LFGA++   +D+
Sbjct  244  GISIFGASNIWIDHVSMRKCYDGIIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQ  303

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQIT+AFNHFGKRL QRMPRCRWG  H+VNNDYT+W MYA+GGS   TII+QGN
Sbjct  304  VMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGN  358



>ref|XP_009117903.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=452

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I  G GLTLQF  N+II N+ +++I P +GG++RDS  H G+RT  +GD
Sbjct  187  KTIDGRGAKVYIMEGVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGIRTKSDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+++VWIDHVSM +C DG+IDA++GSTAVTISN HFTDH +V+LFGA +   +DK
Sbjct  247  GISLFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDK  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRLEQRMPRCR+G  H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  307  NMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGN  361



>ref|XP_010425041.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V I GGAGLTLQ+ +N+II N+ I+ IK   GG++RDS  H GLRT  +GD
Sbjct  188  KTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKKGPGGLIRDSEHHFGLRTMSDGD  247

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG+++VWIDHVSM  C DG+IDA+ GSTA+TISN HFTDH +V+LFG  N D +DK
Sbjct  248  GISIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDK  307

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL+QRMPR R+G+ H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  308  KMQITVAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGN  362



>ref|XP_009148818.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I GG+GLTLQF  N+II N+ I+ I P +GG++RDS  H GLRT  +GD
Sbjct  193  KTIDGRGARVYIMGGSGLTLQFVNNVIIHNIYIKQIVPANGGLIRDSEQHIGLRTRSDGD  252

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI +FG+++VWIDHVSM +C DG+IDA+ GSTAVT+SN HFTDH +V+LFGAN+   +DK
Sbjct  253  GINLFGATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGANDKHEIDK  312

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRLEQRMPR R+G  H+VNNDYT+WEMYA+GG+   TIIS GN
Sbjct  313  KMQITVAFNHFGKRLEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMNPTIISHGN  367



>ref|XP_009599826.1| PREDICTED: probable pectate lyase P59 isoform X2 [Nicotiana tomentosiformis]
Length=444

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAG+TLQ+ KN+II  L I +I   SGG+VRD+V H G+RT  +GD
Sbjct  183  KTIDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGD  242

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG+S++WIDHVSM+KC DGIIDAV+GSTA+TISN HFTDH++V+LFGA++   +D+
Sbjct  243  GISIFGASNIWIDHVSMRKCYDGIIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQ  302

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQIT+AFNHFGKRL QRMPRCRWG  H+VNNDYT+W MYA+GGS   TII+QGN
Sbjct  303  VMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGN  357



>ref|XP_010523445.1| PREDICTED: probable pectate lyase 3 [Tarenaya hassleriana]
Length=464

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V I GGAGLT+QF  N+II N+ I++I P +GG++RDS +H GLRT  +GD
Sbjct  199  KTIDGRGVRVHITGGAGLTVQFVNNVIIHNIYIKDIVPGNGGLIRDSETHFGLRTRSDGD  258

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFG+++VWIDHVSM  C DG+IDA++GST +TISNCH TDH +V+LFGA + D +D 
Sbjct  259  GINIFGATNVWIDHVSMAHCSDGMIDAIQGSTGITISNCHLTDHGEVMLFGATDKDEIDT  318

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPRCR+G+ H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  319  KMQITVAFNHFGKRLVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNPTIISQGN  373



>ref|XP_008456459.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=434

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAGLT+QF  N+II NL I +I   SGG++RDSV H G RT  +GD
Sbjct  172  KTIDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIISKSGGMIRDSVDHYGFRTQSDGD  231

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSSHVWIDHVSM  C+DG+IDA+ GSTA+TISNCHFT H++V+LFGA++    D+
Sbjct  232  GISIFGSSHVWIDHVSMSNCEDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDE  291

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+T+AFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  292  IMQVTLAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGN  346



>emb|CDY45254.1| BnaA06g09240D [Brassica napus]
Length=458

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I GG+GLTLQF  N+II N+ I+ I P +GG++RDS  H GLRT  +GD
Sbjct  193  KTIDGRGARVYIMGGSGLTLQFVNNVIIHNIYIKQIVPANGGLIRDSEQHIGLRTRSDGD  252

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI +FG+++VWIDHVSM +C DG+IDA+ GSTAVT+SN HFTDH +V+LFGAN+   +DK
Sbjct  253  GINLFGATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGANDKHEIDK  312

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRLEQRMPR R+G  H+VNNDYT+WEMYA+GG+   TIIS GN
Sbjct  313  KMQITVAFNHFGKRLEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMNPTIISHGN  367



>ref|XP_004162547.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
Length=435

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAGLT+QF  N+II NL I +I   SGG++RDSV H G RT  +GD
Sbjct  173  KTIDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRTQSDGD  232

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSSHVWIDHVSM  C DG+IDA+ GSTA+TISNCHFT H++V+LFGA++    D+
Sbjct  233  GISIFGSSHVWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDE  292

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+T+AFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  293  IMQVTLAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGN  347



>ref|XP_004234780.1| PREDICTED: probable pectate lyase P56 [Solanum lycopersicum]
 sp|P15721.2|PLY56_SOLLC RecName: Full=Probable pectate lyase P56; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33524.1| P56 protein [Solanum lycopersicum]
Length=398

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V IA GAG+ +Q A N+II+NL+I NI PT+GG++R+S  H GLR  DEGD
Sbjct  136  KTIDGRGKYVHIANGAGIKIQSASNVIISNLRIHNIVPTAGGLLRESDDHLGLRGADEGD  195

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IF S  +WIDH+SM +  DG+IDAV GST +TISNCHFTDH KV+LFGAN+    D+
Sbjct  196  AISIFNSHDIWIDHISMSRATDGLIDAVAGSTNITISNCHFTDHEKVMLFGANDHAEEDR  255

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             M+IT+A+NHFGKRL+QRMPRCR+G FH+VNNDYT+WE YA+GGS+G+TIISQGN
Sbjct  256  GMKITLAYNHFGKRLDQRMPRCRFGFFHLVNNDYTHWERYAIGGSSGATIISQGN  310



>gb|KHN01171.1| Putative pectate lyase 3 [Glycine soja]
Length=433

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V IA GAG+T+QF KN+II  +KI NI+  +GG++RDS +H G RT+ +GD
Sbjct  173  KTIDGRGVDVYIANGAGITIQFIKNVIIHGIKIFNIQVGNGGLIRDSETHYGFRTYSDGD  232

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS+VWIDHVSM+ C DG+IDA++GSTA+TISN HFTDH++V+LFGA++    DK
Sbjct  233  GISIFGSSNVWIDHVSMRNCKDGLIDAIQGSTAITISNGHFTDHNEVMLFGASDSYDGDK  292

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDYT+WEMYA+GGS   TIIS+GN
Sbjct  293  IMQITLAFNHFGKRLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGN  347



>ref|XP_010514040.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V I GGAGLTLQ+ +N+II N+ I+ IK   GG++RDS  H GLRT  +GD
Sbjct  188  KTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKKGPGGLIRDSEHHFGLRTMSDGD  247

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG++++WIDHVSM  C DG+IDA+ GSTA+TISN HFTDH +V+LFG  N D +DK
Sbjct  248  GISIFGATNIWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDK  307

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL+QRMPR R+G+ H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  308  KMQITVAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGN  362



>ref|XP_009129128.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=457

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V I GGAG TLQF KN+II N+ ++ IK   GG++RDS  H GLRT  +GD
Sbjct  192  KTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLRTISDGD  251

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFG++++WIDHVSM+ C DG+IDA+ GSTA+TISN HFTDH +V+LFGA N D  DK
Sbjct  252  GINIFGATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKNGDEFDK  311

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPR R+GM H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  312  KMQITVAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNMNPTIISQGN  366



>ref|XP_010678579.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG HV IAGGAG+ LQF  N+II N+ I +IK   GG +RDSVSH G RT  +GD
Sbjct  183  KTIDGRGGHVHIAGGAGIMLQFVDNVIIHNVHIHDIKTGGGGFIRDSVSHFGFRTASDGD  242

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+++WIDHVSM  C DG+IDA++ STA+T+SNCHFTDH+ V+LFGA +    D+
Sbjct  243  GISIFGSTNIWIDHVSMSNCMDGLIDAIEASTAITVSNCHFTDHNDVMLFGARDSSSQDE  302

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+T+AFNHFGKRL QRMPRCR+G FH++NNDYT+WEMYA+GGS   TII QGN
Sbjct  303  IMQVTIAFNHFGKRLIQRMPRCRFGFFHVLNNDYTHWEMYAIGGSQHPTIICQGN  357



>emb|CDY09356.1| BnaA02g26540D [Brassica napus]
Length=457

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V I GGAG TLQF KN+II N+ ++ IK   GG++RDS  H GLRT  +GD
Sbjct  192  KTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLRTISDGD  251

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFG++++WIDHVSM+ C DG+IDA+ GSTA+TISN HFTDH +V+LFGA N D  DK
Sbjct  252  GINIFGATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKNGDEFDK  311

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPR R+GM H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  312  KMQITVAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNMNPTIISQGN  366



>ref|XP_002892805.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69064.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I  GAGLTLQ+  N+II N+ +++I P +GG++RDS  H GLRT  +GD
Sbjct  194  KTIDGRGARVYIMEGAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSEDHIGLRTKSDGD  253

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG++++WIDHVSM +C DG+IDA+ GSTAVTISN HFTDH +V+LFGA +   +DK
Sbjct  254  GISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDK  313

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRLEQRMPRCR+G  H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  314  KMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGN  368



>emb|CDY39314.1| BnaC05g10650D [Brassica napus]
Length=459

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I GG+GLTLQF  N+I+ N+ I+ I P +GG++RDS  H GLRT  +GD
Sbjct  194  KTIDGRGARVYIMGGSGLTLQFVNNVIVHNIYIKQIVPANGGLIRDSEQHIGLRTRSDGD  253

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI +FG+++VWIDHVSM +C DG+IDA+ GSTAVT+SN HFTDH +V+LFGAN+   +DK
Sbjct  254  GINLFGATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGANDKHEIDK  313

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRLEQRMPR R+G  H+VNNDYT+WEMYA+GG+   TIIS GN
Sbjct  314  KMQITVAFNHFGKRLEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMNPTIISHGN  368



>emb|CDY41679.1| BnaC02g34750D [Brassica napus]
Length=457

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V I GGAG TLQF KN+II N+ ++ IK   GG++RDS  H GLRT  +GD
Sbjct  192  KTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLRTISDGD  251

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFG++++WIDHVSM+ C DG+IDA+ GSTA+TISN HFTDH +V+LFGA N D  DK
Sbjct  252  GINIFGATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKNGDEFDK  311

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPR R+GM H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  312  KMQITVAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNMNPTIISQGN  366



>ref|XP_007227702.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
 gb|EMJ28901.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
Length=446

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V I  GAG+TLQF KN+IITNL I+ I P  GG++RDSV H G RT  +GD
Sbjct  187  KTIDGRGANVNIHNGAGITLQFVKNVIITNLHIKKIVPKQGGMIRDSVDHIGRRTKSDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS+VWIDHVSM+ C DG+IDA+ GSTA+TISN HFT H+ V+LFGA+N    DK
Sbjct  247  GISIFGSSNVWIDHVSMENCADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDK  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCR G FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  307  IMQITVAFNHFGQGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGN  361



>ref|XP_009779191.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAG+TLQ+ KN+II  L I +I   SGG+VRD+V H G+RT  +GD
Sbjct  186  KTIDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGD  245

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG+S++WIDHVSMKKC DGIIDAV+GST +TISN HFTDH++V+LFGA++   +D+
Sbjct  246  GISIFGASNIWIDHVSMKKCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQ  305

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQIT+AFNHFGKRL QRMPRCRWG  H+VNNDYT+W MYA+GGS   TII+QGN
Sbjct  306  VMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGN  360



>ref|XP_006573090.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=448

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V IA GAG+T+QF KN+II  +KI NI+  +GG++RDS +H G RT+ +GD
Sbjct  188  KTIDGRGVDVYIANGAGITIQFIKNVIIHGIKIFNIQVGNGGLIRDSETHYGFRTYSDGD  247

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS+VWIDHVSM+ C DG+IDA++GSTA+TISN HFTDH++V+LFGA++    DK
Sbjct  248  GISIFGSSNVWIDHVSMRNCKDGLIDAIQGSTAITISNGHFTDHNEVMLFGASDSYDGDK  307

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDYT+WEMYA+GGS   TIIS+GN
Sbjct  308  IMQITLAFNHFGKRLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGN  362



>ref|XP_004146792.1| PREDICTED: probable pectate lyase P59-like, partial [Cucumis 
sativus]
Length=442

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAGLT+QF  N+II NL I +I   SGG++RDSV H G RT  +GD
Sbjct  180  KTIDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRTQSDGD  239

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSSHVWIDHVSM  C DG+IDA+ GSTA+TISNCHFT H++V+LFGA++    D+
Sbjct  240  GISIFGSSHVWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDE  299

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+T+AFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  300  IMQVTLAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGN  354



>ref|XP_008221660.1| PREDICTED: probable pectate lyase 3 [Prunus mume]
Length=443

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V I  GAG+TLQF KN+IITNL I+ I P  GG++RDSV H G RT  +GD
Sbjct  184  KTIDGRGANVNIHDGAGITLQFVKNVIITNLHIKRIVPKGGGMIRDSVDHLGQRTRSDGD  243

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS+VWIDHVSM+ C DG+IDA+ GSTA+TISN HFT H+ V+LFGA+N    DK
Sbjct  244  GISIFGSSNVWIDHVSMENCADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDK  303

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCR G FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  304  IMQITVAFNHFGQGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGN  358



>ref|XP_010502279.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V I GGAGLTLQ+ +N+II N+ I+ IK   GG++RDS  H GLRT  +GD
Sbjct  188  KTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKRGPGGLIRDSEHHFGLRTMSDGD  247

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFG+++VWIDHVSM  C DG+IDA+ GSTA+TISN HFTDH +V+LFG  N D +DK
Sbjct  248  GINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDK  307

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL+QRMPR R+G+ H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  308  KMQITVAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGN  362



>ref|XP_009599824.1| PREDICTED: pectate lyase [Nicotiana tomentosiformis]
Length=397

 Score =   249 bits (637),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V I  GAG+ +Q A NIII+NL+I NI PT GG++R+S  H GLR+ DEGD
Sbjct  135  KTIDGRGFNVHIQNGAGIKIQCASNIIISNLRIHNIVPTPGGLLRESEDHVGLRSGDEGD  194

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IF S  +WIDH+SM +  DG+IDAV  ST +TISNCHFTDH KV+LFGAN+   +DK
Sbjct  195  GISIFDSRDIWIDHISMSRATDGLIDAVAASTNITISNCHFTDHEKVMLFGANDNYVLDK  254

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             M+IT+A+NHFGKRL+QRMPRCR+G FH+VNNDYT+WE YA+GGS+G+TIISQGN
Sbjct  255  DMKITLAYNHFGKRLDQRMPRCRFGFFHLVNNDYTHWERYAIGGSSGATIISQGN  309



>ref|XP_009114192.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   251 bits (642),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA++ I GGAGLTLQF KN+II N+ I+ I P +GG++RDS  H G RT  +GD
Sbjct  194  KTIDGRGANIHITGGAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEHHFGHRTTSDGD  253

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFGS++VWIDHVSM  C DG+ID + GSTA+TISNCH TDH++V+LFGA   D VDK
Sbjct  254  GINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREEDVVDK  313

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPR R+G+ H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  314  KMQITVAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGN  368



>gb|AAB69759.1| putative pectate lyase [Arabidopsis thaliana]
Length=459

 Score =   251 bits (641),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I  GAGLTLQF  N+II N+ +++I P +GG++RDS +H GLRT  +GD
Sbjct  194  KTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEAHIGLRTKSDGD  253

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++ G++++WIDHVSM +C DG+IDA+ GSTAVTISN HFTDH +V+LFGA +   +DK
Sbjct  254  GISLIGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDK  313

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRLEQRMPRCR+G  H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  314  KMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGN  368



>ref|XP_009757256.1| PREDICTED: pectate lyase [Nicotiana sylvestris]
 sp|P40972.1|PLY_TOBAC RecName: Full=Pectate lyase; Flags: Precursor [Nicotiana tabacum]
 emb|CAA47630.1| pectate lyase [Nicotiana tabacum]
 emb|CAA43414.1| pectate lyase [Nicotiana tabacum]
Length=397

 Score =   249 bits (636),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V I  GAG+ +Q A NIII+NL+I NI PT GG++R+S  H GLR  DEGD
Sbjct  135  KTIDGRGFNVHIQNGAGIKIQSASNIIISNLRIHNIVPTPGGLLRESEDHVGLRGSDEGD  194

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IF S  +WIDH+SM +  DG+IDAV  ST +TISNCHFTDH KV+LFGAN+   +DK
Sbjct  195  GISIFSSHDIWIDHISMSRATDGLIDAVAASTNITISNCHFTDHEKVMLFGANDHYVLDK  254

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             M+IT+A+NHFGKRL+QRMPRCR+G FH+VNNDYT+WE YA+GGS+G+TIISQGN
Sbjct  255  DMKITLAYNHFGKRLDQRMPRCRFGFFHLVNNDYTHWERYAIGGSSGATIISQGN  309



>ref|XP_010527871.1| PREDICTED: probable pectate lyase 3 isoform X1 [Tarenaya hassleriana]
Length=709

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V I GGAG TLQF  N+II N+ I+NI P +GG++RDS +H GLRT  +GD
Sbjct  444  KTIDGRGVRVHITGGAGFTLQFVNNVIIHNIYIKNIVPGNGGLIRDSETHFGLRTRSDGD  503

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFG+++VWIDHVSM  C DG+IDA++GST +TISNCH TDH +V+LFG  + D +DK
Sbjct  504  GINIFGATNVWIDHVSMSHCSDGMIDAIQGSTGITISNCHLTDHQEVMLFGGTDKDVIDK  563

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPRCR+G+ H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  564  KMQITVAFNHFGKRLVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNPTIISQGN  618



>emb|CDY17432.1| BnaC09g21050D [Brassica napus]
Length=459

 Score =   251 bits (641),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V I GGAGLTLQF KN+II N+ I+ I P +GG++RDS  H G RT  +GD
Sbjct  194  KTIDGRGANVHITGGAGLTLQFVKNVIIHNIHIKTIIPGNGGMIRDSEHHFGHRTTSDGD  253

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFGS++VWIDHVSM  C DG+ID + GSTA+TISNCH TDH++V+LFGA   D +DK
Sbjct  254  GINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREEDVIDK  313

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPR R+G+ H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  314  KMQITVAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGN  368



>emb|CDY04133.1| BnaA09g19110D [Brassica napus]
 gb|AIS67292.1| pectate lyase-like protein 9 [Brassica rapa subsp. chinensis]
Length=459

 Score =   251 bits (640),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA++ I GGAGLTLQF KN+II N+ I+ I P +GG++RDS  H G RT  +GD
Sbjct  194  KTIDGRGANIHITGGAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEHHFGHRTTSDGD  253

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFGS++VWIDHVSM  C DG+ID + GSTA+TISNCH TDH++V+LFGA   D +DK
Sbjct  254  GINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREEDVIDK  313

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPR R+G+ H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  314  KMQITVAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGN  368



>emb|CDP02198.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   251 bits (641),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V IA GAG+T+QF KN+II  L I +I   SGG+VRDSV H G+RT  +GD
Sbjct  211  KTIDGRGVSVHIAYGAGITIQFVKNVIIHGLHIHDIHQGSGGLVRDSVDHFGIRTMSDGD  270

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS+VWIDHVSM KC DG+IDAV+ STA+TISN HFTDH++V+LFGA++    D 
Sbjct  271  GISIFGSSNVWIDHVSMWKCYDGLIDAVEASTAITISNSHFTDHNEVMLFGASDSQSKDA  330

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQITVAFNHFGKRL QRMPRCRWG  H+VNNDYT+WEMYA+GGS    IISQGN
Sbjct  331  VMQITVAFNHFGKRLIQRMPRCRWGFIHVVNNDYTHWEMYAIGGSQHPIIISQGN  385



>ref|XP_010476496.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   251 bits (640),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I  GAGLTLQF  N+II N+ ++ I   +GG++RDS  H GLRT  +GD
Sbjct  190  KTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKQIVTGNGGLIRDSEQHIGLRTKSDGD  249

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG++++WIDHVSM +C+DG+IDA+ GSTAVTISN HFTDH +V+LFGA +   +DK
Sbjct  250  GISLFGATNIWIDHVSMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDK  309

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRLEQRMPRCR+G  H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  310  KMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMDPTIISQGN  364



>ref|XP_007138209.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
 gb|ESW10203.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
Length=434

 Score =   250 bits (638),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V I  GA +T+QF KNIII  L I +I+P SGG++RDS+SH G+R   +GD
Sbjct  177  KTIDARGANVHILDGAQMTIQFVKNIIIHGLHIHDIQPISGGLIRDSMSHYGVRAMSDGD  236

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FGS+H+WIDHVSM  C DG+ID V  STAVTISNCHF  H+ VLLFGA +    DK
Sbjct  237  GISVFGSTHIWIDHVSMTNCSDGLIDVVSASTAVTISNCHFVKHNDVLLFGATDSFSRDK  296

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQ+T+AFNHFGK L QRMPRCRWG FHIVNNDYT+W MYA+GGS   TIISQGN
Sbjct  297  VMQVTLAFNHFGKGLVQRMPRCRWGFFHIVNNDYTHWLMYAVGGSQQPTIISQGN  351



>ref|NP_178375.1| putative pectate lyase 6 [Arabidopsis thaliana]
 sp|O64510.1|PLY6_ARATH RecName: Full=Probable pectate lyase 6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC05350.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAO64162.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAV34776.1| At2g02720 [Arabidopsis thaliana]
 gb|AEC05615.1| putative pectate lyase 6 [Arabidopsis thaliana]
Length=455

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA + I GGAGLTLQF +N+II N+ I+ IK  +GG++ DS  H GLRT  +GD
Sbjct  190  KTIDGRGAKIYITGGAGLTLQFVRNVIIHNIHIKQIKRGAGGLIIDSEQHFGLRTVSDGD  249

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFG+++VWIDHVSM  C DG+IDA+ GSTA+TISN HFTDH +V+LFG  N D +DK
Sbjct  250  GINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGTNKDVIDK  309

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL+QRMPR R+G+ H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  310  KMQITVAFNHFGKRLKQRMPRVRFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGN  364



>ref|XP_010496063.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I  GAGLTLQF  N+II N+ +++I   +GG++RDS  H GLRT  +GD
Sbjct  190  KTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVTGNGGLIRDSEQHIGLRTKSDGD  249

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG++++WIDHVSM +C+DG+IDA+ GSTAVTISN HFTDH +V+LFGA +   +DK
Sbjct  250  GISLFGATNIWIDHVSMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDK  309

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRLEQRMPRCR+G  H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  310  KMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMDPTIISQGN  364



>ref|XP_006306515.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
 gb|EOA39413.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
Length=455

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I  GAGLT+Q+  N+II ++ +++I P +GG++RDS  H GLRT  +GD
Sbjct  190  KTIDGRGAKVYIMEGAGLTMQYVNNVIIHSIYVKHIVPGNGGLIRDSEHHVGLRTKSDGD  249

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG++++WIDHVSM +C DG+IDA+ GSTAVTISN HFTDH +V+LFGA +   +DK
Sbjct  250  GISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDK  309

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRLEQRMPRCR+G  H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  310  KMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGN  364



>ref|XP_011085780.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=447

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V+IA GAG+T+QF KN+II NLKI +I    GG++RDS SH GLRT  +GD
Sbjct  188  KTIDGRGAIVQIAYGAGITIQFVKNVIIHNLKIHHIVEKDGGLIRDSASHTGLRTQSDGD  247

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS  +WIDHVSM +C DG+ID ++GST +TISN HFTDH   +LFG N+  P D+
Sbjct  248  GISIFGSQDIWIDHVSMTRCADGLIDIIQGSTGITISNSHFTDHDHAMLFGGNDKYPGDE  307

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKR+ QRMPRCR+G FH+VNNDYT+W+MYA+GGS+  TIISQGN
Sbjct  308  KMQITVAFNHFGKRMVQRMPRCRYGFFHVVNNDYTHWKMYAIGGSSHPTIISQGN  362



>ref|XP_002875142.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51401.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score =   249 bits (636),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA + I GGAGLTLQF +N+II N+ I+ IK   GG++RDS  H G RT  +GD
Sbjct  190  KTIDGRGARIYITGGAGLTLQFVRNVIIHNVHIKLIKKGVGGVIRDSEHHYGHRTMSDGD  249

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFG+++VWIDHVSM  C DG+IDA+ GSTA+TISN HFTDH +V+LFG  N D +DK
Sbjct  250  GINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGTNKDVIDK  309

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL+QRMPR R+G+ H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  310  KMQITVAFNHFGKRLKQRMPRVRYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGN  364



>ref|XP_004155392.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=432

 Score =   248 bits (633),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V+IA GAG+TLQ+ +N+II  L+I +I   SGG++RD+V H GLRT  +GD
Sbjct  172  KTIDARGANVQIAYGAGITLQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGD  231

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS+VWIDHVSM  C DG+IDA+ GSTA+TISNCHFT H++V+LFGA++    D+
Sbjct  232  GISIFGSSNVWIDHVSMSNCHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQ  291

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  292  IMQITVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGN  346



>ref|XP_004135462.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
 gb|KGN51889.1| hypothetical protein Csa_5G604340 [Cucumis sativus]
Length=432

 Score =   248 bits (632),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V+IA GAG+TLQ+ +N+II  L+I +I   SGG++RD+V H GLRT  +GD
Sbjct  172  KTIDARGANVQIAYGAGITLQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGD  231

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS+VWIDHVSM  C DG+IDA+ GSTA+TISNCHFT H++V+LFGA++    D+
Sbjct  232  GISIFGSSNVWIDHVSMSNCHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQ  291

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  292  IMQITVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGN  346



>ref|XP_007209148.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
 gb|EMJ10347.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
Length=440

 Score =   248 bits (632),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V I  GA ++LQF KN+IITNL I N KP +GG++RDS++H G RT  +GD
Sbjct  182  KTIDARGANVHILDGAQISLQFVKNVIITNLHIHNNKPGNGGMIRDSINHFGQRTRSDGD  241

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+++VWIDHVS+  C DG+IDA++GSTA+TISNCH T+H+ V+LFG+++ +  D+
Sbjct  242  GISMFGATNVWIDHVSLSNCADGLIDAIQGSTAITISNCHLTNHNDVMLFGSSDSNSQDQ  301

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQIT+AFNHFGK L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  302  VMQITLAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGN  356



>ref|XP_004514773.1| PREDICTED: probable pectate lyase 3-like [Cicer arietinum]
Length=454

 Score =   248 bits (633),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V IA GAG+T+QF KNIII  +KI NIK   GG++RDS SH G RT  +GD
Sbjct  187  KTIDGRGVEVYIANGAGITVQFVKNIIIHGIKIYNIKVKEGGMIRDSESHYGFRTKSDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG+S+VWIDHVSM+ C DG+IDA+ GSTA+TISN HFTDH++V+LFGA++    DK
Sbjct  247  GISIFGASNVWIDHVSMRNCTDGLIDAIMGSTAITISNGHFTDHNEVMLFGASDDYSDDK  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+AFNHFGKRL QRMPR R+G  H+VNNDYT+WEMYA+GGS   TIIS+GN
Sbjct  307  IMQITLAFNHFGKRLVQRMPRARFGFVHVVNNDYTHWEMYAMGGSQNPTIISEGN  361



>ref|XP_010066949.1| PREDICTED: pectate lyase [Eucalyptus grandis]
 gb|KCW65002.1| hypothetical protein EUGRSUZ_G02541 [Eucalyptus grandis]
Length=436

 Score =   247 bits (631),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAG+TLQF +N+II  L I +I   SGG++RD+  H GLRT  +GD
Sbjct  176  KTIDARGANVHIAYGAGITLQFIRNVIIHGLHIHDIVRGSGGLIRDAHDHVGLRTASDGD  235

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSSH+WIDHVSM  C DG+IDA++GSTA+TISNCHFT H++V+LFGA++    D+
Sbjct  236  GISIFGSSHLWIDHVSMSACSDGLIDAIQGSTAITISNCHFTHHNEVMLFGASDGYSQDQ  295

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  296  IMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGN  350



>ref|XP_008230729.1| PREDICTED: pectate lyase [Prunus mume]
Length=452

 Score =   248 bits (632),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAGLTLQF +N+II  L I +I P SGG +RDSV H G RT  +GD
Sbjct  192  KTIDARGANVHIAHGAGLTLQFVQNVIIHGLHIHDIVPGSGGTIRDSVDHFGTRTQSDGD  251

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSSHVW+DH+SM  C DG+ID ++GSTAVTISNCHFT H+ VLLFGA++    D 
Sbjct  252  GISIFGSSHVWLDHLSMWNCADGLIDVIQGSTAVTISNCHFTRHNDVLLFGASDSFAGDA  311

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFGK L QRMPRCRWG  H+VNNDYT+W MYA+GGS+  TIISQGN
Sbjct  312  IMQITVAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGN  366



>ref|XP_007215366.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
 gb|EMJ16565.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
Length=452

 Score =   248 bits (632),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+VRIA GAG+TLQF +N+II  L I +I P SGG +RDSV H G RT  +GD
Sbjct  192  KTIDARGANVRIAHGAGITLQFVQNVIIHGLHIHDIVPGSGGTIRDSVDHFGTRTQSDGD  251

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSSH+W+DH+SM  C DG+ID ++GSTA+TISNCHFT H+ VLLFGA++    D 
Sbjct  252  GISIFGSSHIWLDHLSMWNCGDGLIDVIQGSTAITISNCHFTRHNDVLLFGASDSFAGDA  311

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFGK L QRMPRCRWG  H+VNNDYT+W MYA+GGS+  TIISQGN
Sbjct  312  IMQITVAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGN  366



>ref|XP_002270089.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32015.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V IA GAG+T+QF KN+II  L I +I   SGG++RDSV+H G R+  +GD
Sbjct  179  KTIDGRGVNVHIAYGAGITIQFVKNVIIHGLHIHDIVSGSGGLIRDSVNHFGYRSRSDGD  238

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GSSHVWIDH SM  C DG+IDA++GSTA+TISN HFT H++V+LFGA++ +  D+
Sbjct  239  GISIYGSSHVWIDHNSMSNCKDGLIDAIQGSTAITISNNHFTKHNEVMLFGASDSNSADE  298

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGSA  TIISQGN
Sbjct  299  IMQITVAFNHFGRGLIQRMPRCRWGFFHVVNNDYTHWNMYAIGGSAHPTIISQGN  353



>ref|XP_009380431.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA GAGLT+QF K++I+ NL I +IKP +GG +RDS  H G+RT  +GD
Sbjct  177  KTIDGRGANVHIAYGAGLTIQFVKHVIVHNLHIHDIKPGAGGNIRDSEGHWGIRTRSDGD  236

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G++IFG+SHVW+DH+SM  C DG+IDAVK STA+TISNCH T H+ V+L GA++    D 
Sbjct  237  GVSIFGASHVWVDHLSMSNCADGLIDAVKASTAITISNCHLTRHNDVILLGASDKSQEDA  296

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQ+TVA+NHFGK L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  297  VMQVTVAYNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAVGGSQHPTIISQGN  351



>ref|XP_006361836.1| PREDICTED: probable pectate lyase P56-like [Solanum tuberosum]
Length=398

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V IA GAG+ +Q A N+II+NL+I +I PT+GG++R+S  H GLR  DEGD
Sbjct  136  KTIDGRGKYVHIANGAGIKIQSASNVIISNLRIHHIVPTAGGLLRESDDHLGLRGGDEGD  195

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IF S  +WIDH+SM +  DG+IDAV GST +TISNCHFTDH KV+LFGAN+    D+
Sbjct  196  AISIFNSHDIWIDHISMSRAADGLIDAVAGSTNITISNCHFTDHEKVMLFGANDHSVEDR  255

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             M+IT+ +NHFGKRL+QRMPRCR+G FH+VNNDYT+WE YA+GGS+G+TIISQGN
Sbjct  256  GMKITLVYNHFGKRLDQRMPRCRFGFFHLVNNDYTHWERYAIGGSSGATIISQGN  310



>ref|XP_004951474.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=440

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V IA G G+T+QFA+N+II  L + ++K T GG++RDS +H G RT  +GD
Sbjct  182  KTIDGRGAQVHIANGGGITVQFARNVIIHGLHVHDVKHTDGGLMRDSPTHMGPRTKADGD  241

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG++ VWIDH+SM  C+DG+ID V+ ST VTISNCHFT+H+ V+LFGA++  P D+
Sbjct  242  GISLFGATDVWIDHISMSNCEDGLIDVVQSSTGVTISNCHFTNHNDVMLFGASDSYPQDQ  301

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  302  VMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSNAPTIISQGN  356



>ref|XP_008446316.1| PREDICTED: probable pectate lyase P59 [Cucumis melo]
Length=432

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V+IA GAG+TLQ+ +N+II  L+I +I   +GG++RD+V H GLRT  +GD
Sbjct  172  KTIDARGANVQIAYGAGITLQYVRNVIIHGLRIHHIVVGNGGMIRDAVDHVGLRTMSDGD  231

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS+VWIDHVSM  C DG+IDA+ GSTA+TISNCHFT H++V+LFGA++    D+
Sbjct  232  GISIFGSSNVWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSNDQ  291

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  292  IMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGN  346



>ref|XP_008239834.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=438

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V I  GA ++LQF KN+IITNL I N KP +GG++RDS++H G RT  +GD
Sbjct  180  KTIDARGANVHILDGAQISLQFVKNVIITNLHIHNNKPGNGGLIRDSINHFGQRTRSDGD  239

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+++G+++VWIDHVS+  C DG+IDA++GSTA+TISNCH T+H+ V+LFG+++ +  D+
Sbjct  240  GISMYGATNVWIDHVSLSNCADGLIDAIQGSTAITISNCHLTNHNDVMLFGSSDSNSQDQ  299

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQIT+AFNHFGK L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  300  VMQITLAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGN  354



>gb|AAQ62997.1| oil palm polygalacturonase allergen PEST411 [Elaeis guineensis]
Length=447

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GA +T+QF  N+II  L I +IKP++GG++RDS+ H GLRT  +GD
Sbjct  185  KTIDARGANVHIAYGAQITIQFVNNVIIHGLHIHDIKPSNGGMIRDSLHHFGLRTKSDGD  244

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GSS VWIDH SM+ C DG+IDA++GSTA+TISNCHFT H+ VLLFGA++ +  D 
Sbjct  245  GISIYGSSDVWIDHCSMRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNENDS  304

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ TVAFNHFGK L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  305  IMQATVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSKHPTIISQGN  359



>ref|XP_003519771.2| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=447

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V +AGGAG+T+QF KN+II  +KI +I+  +GG++ DS +H GLRT  +GD
Sbjct  187  KTIDGRGVDVYLAGGAGITIQFIKNVIIHGVKIFDIQVGNGGLIIDSENHYGLRTMSDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDHVSM+KC DG+IDA++GSTA+TISN HFTDH++V+LFGA++    D 
Sbjct  247  GISIFGSSNIWIDHVSMRKCKDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSYDGDT  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDYT+WEMYA+GGS   TIIS+GN
Sbjct  307  IMQITLAFNHFGKRLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGN  361



>gb|KHN08706.1| Putative pectate lyase 3 [Glycine soja]
Length=444

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V +AGGAG+T+QF KN+II  +KI +I+  +GG++ DS +H GLRT  +GD
Sbjct  184  KTIDGRGVDVYLAGGAGITIQFIKNVIIHGVKIFDIQVGNGGLIIDSENHYGLRTMSDGD  243

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDHVSM+KC DG+IDA++GSTA+TISN HFTDH++V+LFGA++    D 
Sbjct  244  GISIFGSSNIWIDHVSMRKCKDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSYDGDT  303

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDYT+WEMYA+GGS   TIIS+GN
Sbjct  304  IMQITLAFNHFGKRLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGN  358



>ref|XP_008339934.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V I  GAG+TLQF KN+IITNL I+ I P  GG++RDSV H GLRT  +GD
Sbjct  193  KTIDARGANVVIEEGAGITLQFVKNVIITNLHIKMIVPKPGGMIRDSVDHIGLRTQSDGD  252

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+S+VWIDHVSM +C DG+IDAV GST++TISN HFTDH + +LFGANN    DK
Sbjct  253  GISLFGASNVWIDHVSMSRCADGLIDAVMGSTSITISNSHFTDHDEAMLFGANNAHTQDK  312

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+AFNHFG+ L QRMPR R G FH+VNNDYT+W MYA+GG+   TIISQGN
Sbjct  313  IMQITLAFNHFGQGLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGN  367



>ref|XP_010925369.1| PREDICTED: pectate lyase [Elaeis guineensis]
Length=444

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GA +T+QF  N+II  L I +IKP++GG++RDS+ H GLRT  +GD
Sbjct  185  KTIDARGANVHIAYGAQITIQFVNNVIIHGLHIHDIKPSNGGMIRDSLHHFGLRTKSDGD  244

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GSS VWIDH SM+ C DG+IDA++GSTA+TISNCHFT H+ VLLFGA++ +  D 
Sbjct  245  GISIYGSSDVWIDHCSMRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNENDS  304

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ TVAFNHFGK L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  305  IMQATVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSKHPTIISQGN  359



>ref|XP_011098576.1| PREDICTED: probable pectate lyase P56 [Sesamum indicum]
Length=465

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA ++I GGAGLT+QF  NIIITNLKI NI P+ GG +RDSV+H G RT  +GD
Sbjct  204  KTIDGRGALIQITGGAGLTIQFVHNIIITNLKITNIVPSPGGTIRDSVNHFGFRTGSDGD  263

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I IFGS ++WIDH+SM    DG+IDAV GSTA+TISNCHF  H KVLLFG  + D +D 
Sbjct  264  AINIFGSHNIWIDHLSMSGGADGLIDAVMGSTAITISNCHFVRHDKVLLFGGRDMDEIDS  323

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQIT+AFNHFGK L QRMPRCR G FH+VNNDYT+W MYA+GGS  +TIISQGN
Sbjct  324  KMQITLAFNHFGKHLVQRMPRCRRGFFHLVNNDYTHWLMYAIGGSHHATIISQGN  378



>gb|KCW52797.1| hypothetical protein EUGRSUZ_J02132 [Eucalyptus grandis]
Length=451

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 150/188 (80%), Gaps = 13/188 (7%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA GAG+T+QF +N+II N++I +I    GGI+RD+V H G+RT  +GD
Sbjct  179  KTIDGRGANVHIAFGAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHVGIRTMSDGD  238

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHH-------------KV  206
            GI+IFGS+++WIDHVSMK+C DG+IDA++GSTA+TISN H+T H+             +V
Sbjct  239  GISIFGSTNIWIDHVSMKRCQDGLIDAIEGSTAITISNGHYTHHNDTLMFNLHPGTYVQV  298

Query  205  LLFGANNWDPVDKVMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAG  26
            +LFGA++  P DK+MQ+TVAFNHFGK L QRMPRCRWG FH+VNNDYT+W MYA+GGS+ 
Sbjct  299  MLFGASDLYPRDKIMQVTVAFNHFGKGLIQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSQ  358

Query  25   STIISQGN  2
             TIISQGN
Sbjct  359  PTIISQGN  366



>ref|XP_006363934.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=439

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V IA GAGLT+QF  N+II N++I+NI  T+GG++RDSV+H GLRT  +GD
Sbjct  178  KTIDGRGVAVHIANGAGLTIQFVHNVIIHNIRIQNIISTNGGMIRDSVNHIGLRTVSDGD  237

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+H+WIDH ++ +C DG++DA+  STA+TISNC F  H+ V+L GA +  P D 
Sbjct  238  GISIFGSNHIWIDHCTLSECTDGLVDAIMASTAITISNCKFNHHNDVMLLGATDAFPQDS  297

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFN FG+ L QRMPRCRWG FH+VNNDYT+W+MYA+GGSA  TIISQGN
Sbjct  298  IMQVTVAFNRFGEGLIQRMPRCRWGFFHVVNNDYTHWQMYAIGGSAHPTIISQGN  352



>ref|XP_004489168.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=444

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V I  GAG+T+QF  N+II  L IRNIK  SGG++RDS +H GLRT  +GD
Sbjct  184  KTIDGRGANVHIRDGAGITMQFVNNVIIHGLHIRNIKARSGGMIRDSYNHVGLRTRSDGD  243

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             +++FGSS++WIDH+S+ + +DG+ID ++GSTA+TISNCH T H+ V+LFGA++    DK
Sbjct  244  ALSVFGSSNIWIDHISLSESEDGLIDVIQGSTAITISNCHMTKHNDVMLFGASDSYSDDK  303

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG FH++NNDYT+W MYA+GGS+G TI+SQGN
Sbjct  304  IMQITVAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWLMYAIGGSSGPTILSQGN  358



>ref|XP_009789921.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IAGGAG+ +Q+ KN+II  L I +I   +GG+VRD+V H GLRT  +GD
Sbjct  186  KTIDARGANVHIAGGAGIMIQYTKNVIIHGLHIHDIVQGNGGMVRDAVDHIGLRTMSDGD  245

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG+S++WIDHVSM  C DGIIDAV+GST +TISN HFTDH++V+LFGA++   +D+
Sbjct  246  GISIFGASNIWIDHVSMWNCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQ  305

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQIT+AFNHFGKRL QRMPRCRWG  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  306  QMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGN  360



>ref|XP_010112093.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXC32626.1| putative pectate lyase 7 [Morus notabilis]
Length=437

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA++ IA GAG+T+QFA+N+II  L I +I  + GG++RDSV H G RT  +GD
Sbjct  177  KTIDARGANIHIANGAGITIQFARNVIIHGLHIHDIVASGGGMIRDSVDHFGFRTPADGD  236

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+++W+DH+SM  C DG+IDA++GSTA+TISNCHFT H+ V+LFGA++    DK
Sbjct  237  GISIFGSTNIWLDHISMSNCQDGLIDAIQGSTAITISNCHFTHHNDVMLFGASDSFEGDK  296

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS+  TIISQGN
Sbjct  297  IMQVTVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSHPTIISQGN  351



>gb|KHN45481.1| Putative pectate lyase 3 [Glycine soja]
Length=379

 Score =   244 bits (623),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V    GAGLT+QF  N+II  ++I+NI P  GG++RDS +H GLRT  +GD
Sbjct  180  KTIDGRGANVVFRDGAGLTIQFVNNVIIHGVRIKNIVPKEGGMIRDSYNHVGLRTKSDGD  239

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IFG+S+VWIDHVS+  C DG+ID ++GSTA+TISNCH T H+ V+LFGA++    DK
Sbjct  240  AISIFGASNVWIDHVSLSNCADGLIDVIQGSTAITISNCHMTKHNDVMLFGASDSYSGDK  299

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG  H++NNDYT+W MYA+GGS+G TI+SQGN
Sbjct  300  IMQITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWMMYAIGGSSGPTILSQGN  354



>ref|XP_004490004.1| PREDICTED: probable pectate lyase 3-like isoform X2 [Cicer arietinum]
Length=376

 Score =   244 bits (622),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA + IA GAG+T+Q+ +N+II  +K+ +I   SGG+VRDS +H GLRT  +GD
Sbjct  116  KTIDGRGADIVIANGAGITIQYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGD  175

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDHVSM+ C DG+IDA+ GSTA+TISN HFTDH++V+LFGA++    D+
Sbjct  176  GISIFGSSNIWIDHVSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQ  235

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPRCR+G  H+VNNDYT+WEMYA+GGS   TIIS+GN
Sbjct  236  KMQITVAFNHFGKRLIQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGN  290



>ref|XP_009389712.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=438

 Score =   245 bits (626),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V+I GGAG+T+Q+  N+I+ NL I++IK  +GG++RDS  H GLRT  +GD
Sbjct  178  KTIDGRGANVQIMGGAGVTIQYVHNVIVHNLHIQDIKAGNGGMIRDSEHHYGLRTRSDGD  237

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GSS++WIDHVSM  C DG+IDA++GSTA+TISN HFT H++ +LFGA++    D 
Sbjct  238  GISIYGSSNIWIDHVSMSNCMDGLIDAIEGSTAITISNSHFTRHNEAMLFGASDAYSPDA  297

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFGK L QRMPRCRWG  H+VNNDYT+WEMYA+GGS   TIISQGN
Sbjct  298  IMQITVAFNHFGKGLVQRMPRCRWGFVHVVNNDYTHWEMYAVGGSQHPTIISQGN  352



>ref|XP_007157384.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
 gb|ESW29378.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
Length=448

 Score =   245 bits (626),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA + I  GAG T+QF KN+II  +KI +I    GG++RDS SH GLRT  +GD
Sbjct  188  KTIDGRGADIYIVNGAGFTIQFVKNVIIHGIKIFDINAGQGGLIRDSESHYGLRTQSDGD  247

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDHVSM+   DG+IDA++GSTA+TISN HFTDH++V+LFGA++    DK
Sbjct  248  GISIFGSSYIWIDHVSMRNARDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSHEEDK  307

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+ FNHFGKRL QRMPRCR+G  H+VNNDYT+WEMYA+GGS   TIIS+GN
Sbjct  308  IMQITLVFNHFGKRLVQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGN  362



>ref|XP_003621115.1| Pectate lyase [Medicago truncatula]
 gb|AES77333.1| pectate lyase P59-like protein [Medicago truncatula]
Length=451

 Score =   245 bits (626),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V+I  GAG+T+QF  N+II  L+I+NIK  +GG++RDS  H G+RT  +GD
Sbjct  191  KTIDGRGANVQIREGAGITMQFVNNVIIHGLRIKNIKAKNGGLIRDSFDHLGVRTRSDGD  250

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I++FGSS++WIDH+S+  C+DG++D ++GSTAVTISNCH T H+ V+LFGA++    DK
Sbjct  251  AISVFGSSNIWIDHISLSNCEDGLVDVIQGSTAVTISNCHMTKHNDVMLFGASDTYQDDK  310

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFG+ L QRMPRCRWG FH++NNDYT+W MYA+GGS+  TI+SQGN
Sbjct  311  IMQVTVAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWIMYAIGGSSAPTILSQGN  365



>ref|XP_004490003.1| PREDICTED: probable pectate lyase 3-like isoform X1 [Cicer arietinum]
Length=450

 Score =   245 bits (626),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA + IA GAG+T+Q+ +N+II  +K+ +I   SGG+VRDS +H GLRT  +GD
Sbjct  190  KTIDGRGADIVIANGAGITIQYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGD  249

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDHVSM+ C DG+IDA+ GSTA+TISN HFTDH++V+LFGA++    D+
Sbjct  250  GISIFGSSNIWIDHVSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQ  309

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPRCR+G  H+VNNDYT+WEMYA+GGS   TIIS+GN
Sbjct  310  KMQITVAFNHFGKRLIQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGN  364



>ref|XP_009587689.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=447

 Score =   245 bits (625),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V I+GGAG+ +Q+ KN+II  L I +I   +GG+VRD+V H GLRT  +GD
Sbjct  186  KTIDARGANVHISGGAGIMIQYTKNVIIHGLHIHDIVQGNGGMVRDAVDHIGLRTMSDGD  245

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG+S++WIDHVSM  C DGIIDAV+GST +TISN HFTDH++V+LFGA++   +D+
Sbjct  246  GISIFGASNIWIDHVSMWNCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQ  305

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQIT+AFNHFGKRL QRMPRCRWG  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  306  QMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGN  360



>emb|CAN79927.1| hypothetical protein VITISV_042447 [Vitis vinifera]
Length=439

 Score =   245 bits (625),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA G G+T+QF KNIII NL I +I P  GG++RDSV H GLRT  +GD
Sbjct  179  KTIDGRGANVHIAYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGD  238

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G++IFGSS+VW+DH+SM  C DG++D +  STA+TISNCHFT+H++V+LFG +N    DK
Sbjct  239  GVSIFGSSNVWVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDK  298

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNH+G+ L QRMPRCR+G  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  299  IMQVTVAFNHYGRGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGN  353



>ref|XP_010683248.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   245 bits (625),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG+HV I GGAG+T+QF +NIII  +K RNI P  GG++RDS++H GLRT  +GD
Sbjct  186  KTIDGRGSHVIIEGGAGITIQFVENIIIHGIKFRNIVPRPGGLIRDSLTHFGLRTPSDGD  245

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IFGS H+WIDH S  +C DG+ID +KGSTA+TISNCH TDH KV LFGA++    D+
Sbjct  246  AISIFGSHHIWIDHCSFSRCYDGLIDVIKGSTAITISNCHMTDHDKVFLFGASDQHSEDR  305

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQIT+A+ HFGK L QRMPRCR G FHIVNNDYT+W MYA+GG    TIIS+GN
Sbjct  306  KMQITIAYTHFGKGLVQRMPRCRLGFFHIVNNDYTHWLMYAIGGGMNPTIISEGN  360



>gb|AAA86241.1| pectate lyase homolog [Medicago sativa]
Length=450

 Score =   245 bits (625),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V+I  GAG+T+QF  N+II  L+I+NIK  +GG++RDS  H G+RT  +GD
Sbjct  190  KTIDGRGANVQIRDGAGITMQFVNNVIIHGLRIKNIKARNGGLIRDSFDHIGVRTRSDGD  249

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I++FGSS++WIDH+S+  C+DG++D ++GSTAVTISNCH T H+ V+LFGA++    DK
Sbjct  250  AISVFGSSNIWIDHISLSDCEDGLVDVIQGSTAVTISNCHMTKHNDVMLFGASDTYQDDK  309

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG FH++NNDYT+W MYA+GGS+  TI+SQGN
Sbjct  310  IMQITVAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWIMYAIGGSSAPTILSQGN  364



>ref|XP_002282500.3| PREDICTED: pectate lyase [Vitis vinifera]
Length=443

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA G G+T+QF KNIII NL I +I P  GG++RDSV H GLRT  +GD
Sbjct  183  KTIDGRGANVHIAYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGD  242

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G++IFGSS+VW+DH+SM  C DG++D +  STA+TISNCHFT+H++V+LFG +N    DK
Sbjct  243  GVSIFGSSNVWVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDK  302

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNH+G+ L QRMPRCR+G  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  303  IMQVTVAFNHYGRGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGN  357



>ref|XP_008446067.1| PREDICTED: pectate lyase-like, partial [Cucumis melo]
Length=381

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KT+DGRGA+V IA G  +TLQF +NIII NL I +IK  +GG +RDSVSH G RT  +GD
Sbjct  123  KTLDGRGANVHIANGGQITLQFVRNIIIHNLHIHDIKAGNGGFIRDSVSHYGYRTQSDGD  182

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FGSS VWIDHVSM  C DG+IDAV  STA+TISNCHFT H+ V+L GA++    DK
Sbjct  183  GISMFGSSRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASDSYSNDK  242

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+T+AFNHFGK L QRMPRCRWG  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  243  IMQVTLAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSHNPTIISQGN  297



>ref|XP_004165454.1| PREDICTED: pectate lyase-like [Cucumis sativus]
 gb|KGN64253.1| hypothetical protein Csa_1G045510 [Cucumis sativus]
Length=439

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KT+DGRGA+V IA G  +TLQF KNIII NL I +IK  +GG++RDSVSH G RT  +GD
Sbjct  181  KTLDGRGANVHIANGGQITLQFVKNIIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRSDGD  240

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+S VWIDHVSM  C DG+IDAV  STA+TISNCHFT H+ V+L GA+N    D+
Sbjct  241  GISMFGASRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASNGYSNDQ  300

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+T+AFNHFGK L QRMPRCRWG  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  301  IMQVTLAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSHNPTIISQGN  355



>ref|XP_008365507.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=396

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAG+TLQF +N+II  L+I +  P SGG++RDS+SH G+RT  +GD
Sbjct  136  KTIDARGANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGD  195

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GSS++W+DH+SM  C DG+IDA++GSTA+TISNCHFT H+ V+LFGA++    D 
Sbjct  196  GISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFAGDA  255

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFGK L QRMPRCRWG  H+VNNDYT+W MYA+GGS+  TIISQGN
Sbjct  256  IMQITVAFNHFGKGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGN  310



>ref|XP_007153840.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
 gb|ESW25834.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
Length=447

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V IA GAG+T+QF +N+II  +K+ +I+   GG++RDS +H GLRT  +GD
Sbjct  187  KTIDGRGVEVYIASGAGITVQFIRNVIIHGIKVYDIQVHGGGMIRDSETHYGLRTQSDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDHVSM+ C DG+IDA+ GSTA+TISN HFTDH++ +LFGA++    DK
Sbjct  247  GISIFGSSNIWIDHVSMRNCYDGLIDAIMGSTAITISNSHFTDHNEAMLFGASDSYDKDK  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDYT+WEMYA+GGS   TIIS+GN
Sbjct  307  IMQITLAFNHFGKRLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGN  361



>ref|XP_008339935.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V I  GAG+TLQF KN+IITNL I+ I    GG++RDSV H GLRT  +GD
Sbjct  193  KTIDARGANVVIEEGAGITLQFVKNVIITNLHIKMIVTKPGGLIRDSVDHIGLRTQSDGD  252

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+S+VWIDHVSM +C DG+IDA+ GSTA+TISN HFTDH + +LFGANN    DK
Sbjct  253  GISLFGASNVWIDHVSMSRCADGLIDAIMGSTAITISNSHFTDHDEAMLFGANNAHTQDK  312

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+AFNHFG+ L QRMPR R G FH+VNNDYT+W MYA+GG+   TIISQGN
Sbjct  313  IMQITLAFNHFGQGLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGN  367



>emb|CBI22159.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA G G+T+QF KNIII NL I +I P  GG++RDSV H GLRT  +GD
Sbjct  208  KTIDGRGANVHIAYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGD  267

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G++IFGSS+VW+DH+SM  C DG++D +  STA+TISNCHFT+H++V+LFG +N    DK
Sbjct  268  GVSIFGSSNVWVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDK  327

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNH+G+ L QRMPRCR+G  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  328  IMQVTVAFNHYGRGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGN  382



>ref|XP_009342871.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=454

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAG+TLQF +N+II  L+I +  P SGG++RDS+SH G+RT  +GD
Sbjct  194  KTIDARGANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGD  253

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GSS++W+DH+SM  C DG+IDA++GSTA+TISNCHFT H+ V+LFGA++    D 
Sbjct  254  GISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTRHNDVMLFGASDAFAGDA  313

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFGK L QRMPRCRWG  H+VNNDYT+W MYA+GGS+  TIISQGN
Sbjct  314  IMQITVAFNHFGKGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGN  368



>ref|XP_008357758.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=459

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAG+TLQF +N+II  L+I +  P SGG++RDS+SH G+RT  +GD
Sbjct  199  KTIDARGANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGD  258

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GSS++W+DH+SM  C DG+IDA++GSTA+TISNCHFT H+ V+LFGA++    D 
Sbjct  259  GISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFAGDA  318

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFGK L QRMPRCRWG  H+VNNDYT+W MYA+GGS+  TIISQGN
Sbjct  319  IMQITVAFNHFGKGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGN  373



>gb|EYU24412.1| hypothetical protein MIMGU_mgv1a011674mg [Erythranthe guttata]
Length=274

 Score =   239 bits (609),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA + IA GAGLT+Q+  N++I N++I +IK  +GG++RDSV+H G R+  +GD
Sbjct  15   KTIDGRGAQIHIANGAGLTIQYVSNVVIHNIRIHDIKAGNGGLIRDSVNHYGYRSRSDGD  74

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I++FG+++VWIDHVS+ KC DG+IDA++GSTA+TISN HFT H+ V+LFGA++    D+
Sbjct  75   AISMFGATNVWIDHVSLSKCVDGLIDAIEGSTAITISNSHFTHHNDVMLFGASDSYSGDQ  134

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQITVAFNHFGK L QRMPR RWG  HIVNNDYT WEMYA+GGS   TI+SQGN
Sbjct  135  VMQITVAFNHFGKGLIQRMPRVRWGFVHIVNNDYTRWEMYAIGGSQHPTILSQGN  189



>ref|XP_006357121.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=397

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG ++ I  GAGL +Q   NIIITNL + NI  T GG++RDSV H G+R+ DEGD
Sbjct  137  KTIDGRGFNIHIEKGAGLKMQSVNNIIITNLHVHNIGITPGGMIRDSVDHVGIRSEDEGD  196

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++F ++ VWIDHVSM +  DG+IDAV+GST +TISNCHFTDH K +LFGAN+    DK
Sbjct  197  GISLFAATDVWIDHVSMSRATDGLIDAVQGSTGITISNCHFTDHDKAMLFGANDNHVEDK  256

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQIT+A+NHFGKRL+QRMPR R+G FHIVNNDYT+W  YA+GG++G+TIISQGN
Sbjct  257  KMQITLAYNHFGKRLDQRMPRVRFGFFHIVNNDYTHWMRYAIGGNSGATIISQGN  311



>gb|EPS66620.1| hypothetical protein M569_08154, partial [Genlisea aurea]
Length=451

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V +A GAG+TLQF  N+II  L I +I   SGG++RDSV H G RT  +GD
Sbjct  187  KTIDGRGARVHVAYGAGITLQFVSNVIIHGLHIHDIVQGSGGMIRDSVDHYGFRTRSDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS  +WIDHVSM++C DG+IDA+ GST +TISN HFTDH++V+LFGA++    D 
Sbjct  247  GISIFGSQDLWIDHVSMRRCYDGLIDAIMGSTGITISNSHFTDHNEVMLFGASDGYSPDA  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+TVAFNHFGKRL QRMPRCRWG  H+VNNDYT+W MYA+GGS+  TIISQGN
Sbjct  307  KMQMTVAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSSAPTIISQGN  361



>ref|XP_009360393.1| PREDICTED: probable pectate lyase 3 [Pyrus x bretschneideri]
Length=452

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V I  G G+TLQF KN+IITNL I+ I    GG++RDSV H GLRT  +GD
Sbjct  193  KTIDGRGANVVIEEGGGITLQFVKNVIITNLHIKMIVSKPGGMIRDSVDHMGLRTKSDGD  252

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+S+VWIDHVSM +C DG+IDAV  STA+TISN HFTDH  V+LFGANN    DK
Sbjct  253  GISLFGASNVWIDHVSMSRCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDK  312

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+AFNHFG+ L QRMPR R G FH+VNNDYT+W MYA+GG+   TIISQGN
Sbjct  313  IMQITLAFNHFGQGLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGN  367



>ref|XP_009408830.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   244 bits (622),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V+IA GAGLT+QF  N+I+ N++I +IK  +GG++RDS  H GLRT  +GD
Sbjct  179  KTIDGRGANVQIAYGAGLTIQFVHNVIVHNIRIHDIKAGNGGMIRDSEEHYGLRTRSDGD  238

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG+S++WIDHVSM  C DG+IDA++GSTA+TISN HFT H+ V+LFGA++    D 
Sbjct  239  GISIFGASNIWIDHVSMSNCMDGLIDAIEGSTAITISNSHFTQHNDVMLFGASDAFSGDA  298

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFGK L QRMPRCRWG  H+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  299  IMQITVAFNHFGKGLVQRMPRCRWGFVHVVNNDYTHWMMYAVGGSQHPTILSQGN  353



>ref|XP_010317101.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=389

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I GGA + +Q+ KN+II  L I +I   SGG+VRD+V H GLRT  +GD
Sbjct  128  KTIDGRGATVHITGGASIMIQYTKNVIIHGLHIHDIVEGSGGMVRDAVDHIGLRTKSDGD  187

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GSS++WIDH+SM+ C DG+IDAV+GST +TISN H+TDH++V+LFGA++   +D+
Sbjct  188  GISIYGSSNIWIDHMSMENCYDGLIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSIDQ  247

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQIT+AFNHFGKRL QRMPRCRWG  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  248  KMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGN  302



>ref|XP_006579282.1| PREDICTED: probable pectate lyase P59-like [Glycine max]
Length=420

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V I+ GA +TLQ+ KNIII  L I +IK  SGG++RDS+ H G+R   +GD
Sbjct  112  KTIDARGANVHISEGAQITLQYVKNIIIHGLHIHDIKKCSGGLIRDSMDHYGVRAMSDGD  171

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I++FGS++VWIDHVS   CDDG+ID V  STAVTISNCH T H+ VLLFGA++    DK
Sbjct  172  AISVFGSTYVWIDHVSFTNCDDGLIDVVSASTAVTISNCHLTKHNDVLLFGASDSYSGDK  231

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+T+AFNHFGK L QRMPRCRWG FHIVNNDYT+W MYA+GGS   TIISQGN
Sbjct  232  IMQVTLAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSQQPTIISQGN  286



>ref|XP_003554335.1| PREDICTED: pectate lyase-like [Glycine max]
Length=443

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V    GAGLT+QF  N+II  ++I+NI P  GG++RDS +H GLRT  +GD
Sbjct  184  KTIDGRGANVVFRDGAGLTIQFVNNVIIHGVRIKNIVPKEGGMIRDSYNHVGLRTKSDGD  243

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IFG+S+VWIDHVS+  C DG+ID ++GSTA+TISNCH T H+ V+LFGA++    DK
Sbjct  244  AISIFGASNVWIDHVSLSNCADGLIDVIQGSTAITISNCHMTKHNDVMLFGASDSYSGDK  303

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG  H++NNDYT+W MYA+GGS+G TI+SQGN
Sbjct  304  IMQITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWMMYAIGGSSGPTILSQGN  358



>ref|XP_009587688.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=396

 Score =   242 bits (617),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG +V I  GAG+ +Q   NIIITNL I NI P+SGG++RDS+ H G+R  DEGD
Sbjct  136  KTIDARGHNVHIENGAGIKMQGVNNIIITNLHIHNIGPSSGGMIRDSIDHIGIRGADEGD  195

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IF S  +WIDHVSM +  DG+IDAV+GST +TISNCHFTDH KV+LFGAN+    DK
Sbjct  196  AISIFASHDIWIDHVSMSRAADGLIDAVQGSTGITISNCHFTDHDKVMLFGANDNYLDDK  255

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQIT+A+NHFGKRL+QRMPRCR G FH+VNNDYT+W  YA+GGS+ +TIISQGN
Sbjct  256  KMQITLAYNHFGKRLDQRMPRCRLGFFHLVNNDYTHWMRYAIGGSSEATIISQGN  310



>ref|XP_008374522.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=441

 Score =   243 bits (620),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V I  G  +TLQF KN+II NL I + K  +GG++RDSV+H G RT  +GD
Sbjct  183  KTIDARGANVHIQDGGQITLQFVKNVIIHNLHIHDNKAGNGGMIRDSVNHYGQRTRSDGD  242

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+++G+S+VWIDHVS   C+DG+IDA++GSTA+TISNCHFT+H+ V+LFG+++ +  D+
Sbjct  243  GISMYGASNVWIDHVSASNCEDGLIDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDE  302

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQIT+AFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  303  VMQITIAFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGN  357



>ref|XP_011087217.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=436

 Score =   243 bits (620),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V IA GAG+TLQ+  N+II N+++ +IK  +GG++RDS +H G RT  +GD
Sbjct  176  KTIDGRGAQVHIANGAGITLQYIHNVIIHNIRVHDIKTGNGGMIRDSATHYGFRTRSDGD  235

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FGS+++WIDHVS+ +CDDG+IDA++ STA+TISNCHF  H+ VLLFGA++    D 
Sbjct  236  GISLFGSTNIWIDHVSLSRCDDGLIDAIEASTAITISNCHFAHHNDVLLFGASDSRSEDH  295

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFGK L QRMPR RWG  HIVNNDYT W+MYA+GGS   TI+SQGN
Sbjct  296  IMQITVAFNHFGKGLIQRMPRVRWGFVHIVNNDYTRWQMYAIGGSQQPTILSQGN  350



>ref|XP_004147462.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
 ref|XP_004163529.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
Length=431

 Score =   243 bits (619),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAGL++QFA+N+II  L+I ++  T GG++RD+ +H GLRT  +GD
Sbjct  171  KTIDARGANVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGD  230

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+++W+DH+SM  C DG+IDA++GSTA+TISN HFT H+ V+LFGA++    D 
Sbjct  231  GISIFGSTNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDS  290

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFGK L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  291  IMQVTVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGN  345



>ref|XP_006338480.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=446

 Score =   243 bits (620),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V IA GAG  LQ+ KN+II  L+I +I   SGG++RD++ H G RT  +GD
Sbjct  185  KTIDGRGVNVHIANGAGFMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHIGQRTQSDGD  244

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++W+DHVSM  C DG++DAV+GSTAVTISN HFTDH++V+LFGA++   +D+
Sbjct  245  GISIFGSSNIWVDHVSMWSCYDGLVDAVEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQ  304

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVA+NHFGKRL QRMPRCRWG  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  305  RMQITVAYNHFGKRLIQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGN  359



>gb|EEE56553.1| hypothetical protein OsJ_05879 [Oryza sativa Japonica Group]
Length=410

 Score =   242 bits (617),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 144/176 (82%), Gaps = 1/176 (1%)
 Frame = -1

Query  526  KTIDGRGAHVRIA-GGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEG  350
            KTIDGRGA V IA GGAG+T+QFA+N+IIT+L + ++K + GG VRDS +H G RT  +G
Sbjct  151  KTIDGRGAQVHIARGGAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRADG  210

Query  349  DGITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVD  170
            DGI++F ++ VW+DHVSM  C+DG+ID V+GST VTISN HFT+H+ V+LFGA++  P D
Sbjct  211  DGISLFAATDVWVDHVSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQD  270

Query  169  KVMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            KVMQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GG    TI+SQGN
Sbjct  271  KVMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGMSPTILSQGN  326



>gb|KGN59593.1| hypothetical protein Csa_3G827350 [Cucumis sativus]
Length=441

 Score =   243 bits (619),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAGL++QFA+N+II  L+I ++  T GG++RD+ +H GLRT  +GD
Sbjct  181  KTIDARGANVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGD  240

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+++W+DH+SM  C DG+IDA++GSTA+TISN HFT H+ V+LFGA++    D 
Sbjct  241  GISIFGSTNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDS  300

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFGK L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  301  IMQVTVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGN  355



>ref|XP_009369346.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=441

 Score =   243 bits (619),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V I  G  +TLQF KN+II NL I + K  +GG++RDSV+H G RT  +GD
Sbjct  183  KTIDARGANVHIQDGGQITLQFVKNVIIHNLHIHDNKAGNGGMIRDSVNHYGQRTRSDGD  242

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+++G+S+VWIDHVS   C+DG+IDA++GSTA+TISNCHFT+H+ V+LFG+++ +  D+
Sbjct  243  GISMYGASNVWIDHVSASNCEDGLIDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDE  302

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQIT+AFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  303  VMQITLAFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGN  357



>ref|XP_004228388.1| PREDICTED: pectate lyase [Solanum lycopersicum]
Length=439

 Score =   243 bits (619),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V IA GAGL +QF  N+II N++I+NI  T+GG++RDS++H GLRT  +GD
Sbjct  178  KTIDGRGVAVHIAYGAGLMIQFVHNVIIHNIRIQNIISTNGGMIRDSINHIGLRTVSDGD  237

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+H+WIDH ++ +C DG+IDA+  STA+TISNC F  H+ V+L GA +  P D 
Sbjct  238  GISIFGSNHIWIDHCTLSECTDGLIDAIMASTAITISNCKFNYHNDVMLLGATDAFPQDA  297

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFN FG+ L QRMPRCRWG FH+VNNDYT+W+MYA+GGSA  TIISQGN
Sbjct  298  IMQVTVAFNRFGEGLIQRMPRCRWGFFHVVNNDYTHWQMYAIGGSAHPTIISQGN  352



>ref|XP_008221658.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=443

 Score =   243 bits (619),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V I  GA +T+QF KN+IITN+ I+ IK   GG++RDSV H G RT  +GD
Sbjct  184  KTIDGRGANVNIFDGACITIQFVKNVIITNIHIKQIKAKEGGMIRDSVDHFGQRTKSDGD  243

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GSS++WIDHVSM+ C DG+ID + GST +TISN HFT H++V+LFGA+N    DK
Sbjct  244  GISIYGSSNIWIDHVSMENCTDGLIDVIMGSTGITISNSHFTKHNEVMLFGASNSYTQDK  303

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFGK L QRMPRCR G FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  304  MMQITVAFNHFGKGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGN  358



>ref|XP_009789922.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=396

 Score =   241 bits (616),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG +V I  GAG+ +Q   NIIITNL I NI P+SGG++RDS+ H G+R  DEGD
Sbjct  136  KTIDARGHNVHIEKGAGIKMQGVNNIIITNLHIHNIGPSSGGMIRDSIDHIGIRGADEGD  195

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IF S  +WIDHVSM +  DG+IDAV+GST +TISNCHFTDH KV+LFGAN+    DK
Sbjct  196  AISIFASHDIWIDHVSMSRAADGLIDAVQGSTGITISNCHFTDHDKVMLFGANDNYLDDK  255

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQIT+A+NHFGKRL+QRMPRCR G FH+VNNDYT+W  YA+GGS+ +TIISQGN
Sbjct  256  KMQITLAYNHFGKRLDQRMPRCRLGFFHLVNNDYTHWMRYAIGGSSEATIISQGN  310



>ref|XP_008443432.1| PREDICTED: probable pectate lyase 19 [Cucumis melo]
Length=441

 Score =   243 bits (619),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG++V IA GAGL++QFA+N+II  L+I ++  T GG++RD+ +H GLRT  +GD
Sbjct  181  KTIDARGSNVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGD  240

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++W+DH+SM  C DG+IDA++GSTA+TISN HFT H+ V+LFGA++    D 
Sbjct  241  GISIFGSSNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDS  300

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFGK L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  301  IMQVTVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGN  355



>ref|XP_004232242.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=446

 Score =   243 bits (619),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V IA GAG  LQ+ KN+II  L+I +I   SGG++RD++ H G RT  +GD
Sbjct  185  KTIDGRGVNVHIANGAGFMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHVGQRTQSDGD  244

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++W+DHVSM  C DG++DA++GSTAVTISN HFTDH++V+LFGA++   +D+
Sbjct  245  GISIFGSSNIWVDHVSMWSCYDGLVDAIEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQ  304

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVA+NHFGKRL QRMPRCRWG  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  305  RMQITVAYNHFGKRLIQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGN  359



>ref|XP_006361835.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=447

 Score =   243 bits (619),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG +V I  GAG+TLQ+ KN+II  L I +I   +GG+VRD+V H G+RT  +GD
Sbjct  186  KTIDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGD  245

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG+S++WIDHVSM++C DG+IDAV+GST +TISN HFTDH++V+LFGA++   +D+
Sbjct  246  GISIFGASNIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQ  305

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQIT+AFNHFGKRL QRMPRCRWG  H+VNNDYT+W MYA+GGS   TII+QGN
Sbjct  306  VMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGN  360



>gb|KEH19822.1| pectate lyase-like protein [Medicago truncatula]
Length=455

 Score =   243 bits (620),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V I+ GAG+T+QF KN+II  +KI +I+   GG++RDS +H G RT  +GD
Sbjct  188  KTIDGRGVDVYISNGAGITIQFVKNVIIHGIKIYDIQVRDGGMIRDSEAHYGFRTKSDGD  247

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG+S+VWIDHVSM+ C DG+IDA+ GSTA+TISN HFTDH++V+LFGA+N    DK
Sbjct  248  GISIFGASNVWIDHVSMRNCTDGLIDAIMGSTAITISNSHFTDHNEVMLFGASNDYSEDK  307

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+AFNHFGKRL QRMPR R+G  H VNNDYT+WEMYA+GGS   TIIS+GN
Sbjct  308  IMQITLAFNHFGKRLVQRMPRARFGFVHCVNNDYTHWEMYAIGGSQNPTIISEGN  362



>ref|XP_010670318.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   243 bits (619),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V+IA GAG+T+QFA N+II N+KI +I P++GG++RD+ +H G+R  D+GD
Sbjct  191  KTIDGRGAQVQIADGAGITIQFANNVIIHNIKIHDIVPSTGGMIRDTNNHVGIRGADDGD  250

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI +F SS++W+DH+SM  C DG+ID VK STA+T+SN HFT H  VLLFGA++ DP D+
Sbjct  251  GINVFASSNIWLDHLSMWNCKDGLIDIVKASTAITLSNNHFTRHDHVLLFGADDKDPADE  310

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQI++AFNHFGK L QRMPRCR+G FH++NNDYT+W MYA+GG++  TIISQGN
Sbjct  311  IMQISLAFNHFGKGLVQRMPRCRFGFFHVLNNDYTHWIMYAIGGTSHPTIISQGN  365



>gb|KHG23093.1| hypothetical protein F383_29772 [Gossypium arboreum]
Length=385

 Score =   241 bits (614),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA G G+TLQF  N+II N+ I  +  +SGG++RDS  H G RT  +GD
Sbjct  124  KTIDGRGANVHIAYGCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGFRTVGDGD  183

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS +W+DH+SM +C DG+IDA++GSTA+TISNCHFT H  V+L GA++    D+
Sbjct  184  GISIFGSSKIWLDHISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSRDQ  243

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+T+AFNHFGK L QRMPRCRWG FH+VNNDYT+W++YA+GGS   TIISQGN
Sbjct  244  FMQVTLAFNHFGKELIQRMPRCRWGYFHVVNNDYTHWKLYAIGGSTHPTIISQGN  298



>gb|EAY85003.1| hypothetical protein OsI_06363 [Oryza sativa Indica Group]
Length=439

 Score =   242 bits (618),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 144/176 (82%), Gaps = 1/176 (1%)
 Frame = -1

Query  526  KTIDGRGAHVRIA-GGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEG  350
            KTIDGRGA V IA GGAG+T+QFA+N+IIT+L + ++K + GG VRDS +H G RT  +G
Sbjct  180  KTIDGRGAQVHIARGGAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRADG  239

Query  349  DGITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVD  170
            DGI++F ++ VW+DHVSM  C+DG+ID V+GST VTISN HFT+H+ V+LFGA++  P D
Sbjct  240  DGISLFAATDVWVDHVSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQD  299

Query  169  KVMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            KVMQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GG    TI+SQGN
Sbjct  300  KVMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGMSPTILSQGN  355



>ref|XP_002270112.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32014.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   242 bits (618),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V IA GAG+T+QFA+N+II  L I +I    GG++RDSV H GLRT  +GD
Sbjct  179  KTIDGRGVNVHIAYGAGITIQFARNVIIHGLHIHDIVSRPGGLIRDSVHHFGLRTRSDGD  238

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSSHVWIDH SM KC+DG++DA++GSTA+TISN HFT H++ +L GA++    D 
Sbjct  239  GISIFGSSHVWIDHNSMSKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDI  298

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGSA  TI+SQGN
Sbjct  299  IMQVTVAFNHFGRGLIQRMPRCRWGFFHVVNNDYTHWNMYAVGGSAHPTIVSQGN  353



>gb|ACU23277.1| unknown [Glycine max]
Length=443

 Score =   242 bits (618),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V+  GGAGLT+QF  N+II  ++I++I P  GG++RDS  H GLRT  +GD
Sbjct  184  KTIDGRGANVQFRGGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGD  243

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IFGS+++WIDHVS+  C DG+ID ++GSTA+TISNCH T H+ V LFGA++    DK
Sbjct  244  AISIFGSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDK  303

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG  H++NNDYT+W MYA+GGS+G TI+SQGN
Sbjct  304  IMQITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGN  358



>ref|XP_008679844.1| PREDICTED: pectate lyase [Zea mays]
 gb|AFW66064.1| pectate lyase-like protein [Zea mays]
Length=444

 Score =   242 bits (618),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V IA GAG+T+Q A+N+II NL + ++K T GG++RDS +H G RT  +GD
Sbjct  187  KTIDGRGAQVHIANGAGITVQLAQNVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++F +++VWIDH+SM  C+DG+ID V+ ST +TISNCHFT+H+ V+LFGA++  P D+
Sbjct  247  GISLFSATNVWIDHISMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSWPQDQ  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GG    TIISQGN
Sbjct  307  IMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGDAPTIISQGN  361



>ref|XP_009617495.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=451

 Score =   243 bits (619),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V IA GAG+TLQ+ KN+II  L I +I   +GG+V  +V H G+RT  +GD
Sbjct  190  KTIDGRGVNVHIAYGAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRTQSDGD  249

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDHVSM +C DG+IDAV+GSTA+TISN HFTDH++V+LFGA++   +D+
Sbjct  250  GISIFGSSNIWIDHVSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQ  309

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPRCRWG  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  310  RMQITVAFNHFGKRLVQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGN  364



>gb|ACF87417.1| unknown [Zea mays]
Length=444

 Score =   242 bits (618),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V IA GAG+T+Q A+N+II NL + ++K T GG++RDS +H G RT  +GD
Sbjct  187  KTIDGRGAQVHIANGAGITVQLAQNVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++F +++VWIDH+SM  C+DG+ID V+ ST +TISNCHFT+H+ V+LFGA++  P D+
Sbjct  247  GISLFSATNVWIDHISMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSWPQDQ  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GG    TIISQGN
Sbjct  307  IMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGDAPTIISQGN  361



>ref|XP_003543726.1| PREDICTED: pectate lyase [Glycine max]
Length=443

 Score =   242 bits (618),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V+  GGAGLT+QF  N+II  ++I++I P  GG++RDS  H GLRT  +GD
Sbjct  184  KTIDGRGANVQFRGGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGD  243

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IFGS+++WIDHVS+  C DG+ID ++GSTA+TISNCH T H+ V LFGA++    DK
Sbjct  244  AISIFGSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDK  303

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG  H++NNDYT+W MYA+GGS+G TI+SQGN
Sbjct  304  IMQITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGN  358



>ref|NP_001046281.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAD25039.1| putative pectate lyase precursor [Oryza sativa Japonica Group]
 dbj|BAF08195.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAG94880.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 144/176 (82%), Gaps = 1/176 (1%)
 Frame = -1

Query  526  KTIDGRGAHVRIA-GGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEG  350
            KTIDGRGA V IA GGAG+T+QFA+N+IIT+L + ++K + GG VRDS +H G RT  +G
Sbjct  187  KTIDGRGAQVHIARGGAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRADG  246

Query  349  DGITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVD  170
            DGI++F ++ VW+DHVSM  C+DG+ID V+GST VTISN HFT+H+ V+LFGA++  P D
Sbjct  247  DGISLFAATDVWVDHVSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQD  306

Query  169  KVMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            KVMQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GG    TI+SQGN
Sbjct  307  KVMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGMSPTILSQGN  362



>ref|XP_004234779.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=449

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG +V I  GAG+TLQ+ KN+II  L I +I   +GG+VRD+V H G+RT  +GD
Sbjct  188  KTIDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGD  247

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG+S++WIDHVSM++C DG+IDAV+GST +TISN HFTDH++V+LFGA++   +D+
Sbjct  248  GISIFGASNIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQ  307

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQIT+AFNHFGKRL QRMPRCRWG  H+VNNDYT+W MYA+GGS   TII+QGN
Sbjct  308  VMQITLAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGN  362



>ref|XP_009802165.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=451

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V IA GAG+TLQ+ KN+II  L I +I   +GG+V  +V H G+RT  +GD
Sbjct  190  KTIDGRGVNVHIAYGAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRTQSDGD  249

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDHVSM +C DG+IDAV+GSTA+TISN HFTDH++V+LFGA++   +D+
Sbjct  250  GISIFGSSNIWIDHVSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQ  309

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPRCRWG  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  310  RMQITVAFNHFGKRLVQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGN  364



>ref|XP_007032453.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY03379.1| Pectate lyase family protein [Theobroma cacao]
Length=454

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA GAG+TLQF  N+II NL I +I+ +SGG++RDSV H G RT  +GD
Sbjct  193  KTIDGRGANVHIAYGAGITLQFVDNVIIHNLHIHHIRKSSGGLIRDSVDHYGFRTVGDGD  252

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+++W+DH+SM +C+DG+IDA++GSTA+TISNCHFT H+ V+L GA++    DK
Sbjct  253  GISIFGSTNIWLDHLSMSECEDGLIDAIQGSTAITISNCHFTHHNDVILLGASDSYSRDK  312

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFGK L QRMPRCRWG FH+VNNDYT+W+MYA+GGS   TIISQGN
Sbjct  313  LMQVTVAFNHFGKELIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSQHPTIISQGN  367



>gb|KHN08855.1| Putative pectate lyase P59 [Glycine soja]
Length=435

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V I+ GA +TLQ+ KNIII  L I +IK  SGG++RDS+ H G+R   +GD
Sbjct  178  KTIDARGANVHISEGAQITLQYVKNIIIHGLHIHDIKKCSGGLIRDSMDHYGVRAMSDGD  237

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I++FGS++VWIDHVS   CDDG+ID V  STAVTISNCH T H+ VLLFGA++    DK
Sbjct  238  AISVFGSTYVWIDHVSFTNCDDGLIDVVSASTAVTISNCHLTKHNDVLLFGASDSYSGDK  297

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+T+AFNHFGK L QRMPRCRWG FHIVNNDYT+W MYA+GGS   TIISQGN
Sbjct  298  IMQVTLAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSQQPTIISQGN  352



>emb|CAN69904.1| hypothetical protein VITISV_001006 [Vitis vinifera]
Length=443

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V IA GAG+T+QFA+N+II  L I +I    GG++RDSV H GLRT  +GD
Sbjct  179  KTIDGRGVNVHIAYGAGITIQFARNVIIHGLHIHDIVSHPGGLIRDSVHHFGLRTRSDGD  238

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSSHVWIDH SM KC+DG++DA++GSTA+TISN HFT H++ +L GA++    D 
Sbjct  239  GISIFGSSHVWIDHNSMSKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDI  298

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGSA  TI+SQGN
Sbjct  299  IMQVTVAFNHFGRGLIQRMPRCRWGFFHVVNNDYTHWNMYAVGGSAHPTIVSQGN  353



>emb|CAN77957.1| hypothetical protein VITISV_021245 [Vitis vinifera]
Length=407

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAGLTLQF  NIII  L I +IK  +GG++RDS SH G RT  +GD
Sbjct  149  KTIDARGANVHIANGAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSASHYGFRTRSDGD  208

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG++++WIDH+SM  C DG+IDA+  STA+TISNCHFT H++V+LFGA++    D 
Sbjct  209  GISIFGATNIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGASDGYSGDA  268

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+ FNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  269  IMQITITFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTILSQGN  323



>sp|P15722.1|PLY59_SOLLC RecName: Full=Probable pectate lyase P59; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33523.1| P59 protein [Solanum lycopersicum]
Length=449

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG +V I  GAG+TLQ+ KN+II  L I +I   +GG+VRD+V H G+RT  +GD
Sbjct  188  KTIDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGD  247

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG+S++WIDHVSM++C DG+IDAV+GST +TISN HFTDH++V+LFGA++   +D+
Sbjct  248  GISIFGASYIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQ  307

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQIT+AFNHFGKRL QRMPRCRWG  H+VNNDYT+W MYA+GGS   TII QGN
Sbjct  308  VMQITLAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIIHQGN  362



>ref|XP_004508770.1| PREDICTED: probable pectate lyase P59-like [Cicer arietinum]
Length=434

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V I+ GA +TLQ+ KNIII  L I +IK   GG++RDSV+H G R+  +GD
Sbjct  177  KTIDARGANVHISNGAQMTLQYVKNIIIHGLHIHDIKKGGGGLIRDSVNHYGYRSSSDGD  236

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I++FGSSHVWIDH+S+  CDDG+ID V+GSTA+TISNCH T H+ V+LFGA++    DK
Sbjct  237  AISLFGSSHVWIDHISLWNCDDGLIDVVEGSTAITISNCHMTRHNDVMLFGASDGYSGDK  296

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            V+Q+TVAFNHFGK L QRMPRCRWG FHIVNNDYT W MYA+GGS   TI+SQGN
Sbjct  297  VLQVTVAFNHFGKGLIQRMPRCRWGFFHIVNNDYTQWVMYAIGGSQQPTILSQGN  351



>ref|XP_006357122.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=448

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I GGA + +Q+ KN+II  L I +I   +GG+VRD+V H G RT  +GD
Sbjct  187  KTIDGRGATVHITGGASIMIQYTKNVIIHGLHIHDIVEGNGGMVRDAVDHIGFRTKSDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDH+SM+ C DGIIDAV+GST +TISN H+TDH++V+LFGA++   +D+
Sbjct  247  GISIFGSSNIWIDHMSMENCYDGIIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSIDQ  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQIT+AFNHFGKRL QRMPRCRWG  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  307  KMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGN  361



>ref|XP_004233352.1| PREDICTED: pectate lyase-like [Solanum lycopersicum]
Length=397

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG ++ I  GAGL +Q   N+II+NL + NI  T GG++RDS  H G+R+ DEGD
Sbjct  137  KTIDGRGFNIHIEKGAGLKMQGVSNVIISNLHVHNIVITPGGMIRDSAEHVGIRSEDEGD  196

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++F ++ +WIDHVSM +  DG+IDAVKGST +TISNCHFTDH KV+LFGAN+    DK
Sbjct  197  GISLFSATDIWIDHVSMSRATDGLIDAVKGSTGITISNCHFTDHDKVMLFGANDNHVEDK  256

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQIT+A+NHFGKRL+QRMPR R+G FHIVNNDYT+W  YA+GG+ G+TIISQGN
Sbjct  257  KMQITLAYNHFGKRLDQRMPRVRFGFFHIVNNDYTHWMRYAIGGNNGATIISQGN  311



>ref|XP_010256490.1| PREDICTED: pectate lyase-like [Nelumbo nucifera]
Length=441

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V +A GAG+T+QF KN+II  L + +I P SGG++RDSV H GLRT  +GD
Sbjct  181  KTIDARGANVHVAYGAGITIQFVKNVIIHGLHVHDIVPGSGGLIRDSVDHYGLRTQSDGD  240

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+++VWIDH+SM  C DG+IDA+  +TAVT+SNCHFT H++V+LFGA+     D 
Sbjct  241  GISLFGATNVWIDHISMSNCKDGLIDAIMSTTAVTVSNCHFTHHNEVMLFGASGSYSGDA  300

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQITVAFNHFG+ L QRMPRCRWG  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  301  VMQITVAFNHFGRGLVQRMPRCRWGFAHVVNNDYTHWIMYAIGGSEHPTIISQGN  355



>ref|XP_008366366.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=479

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V I  GA +TLQF  N+II NL I + KP +GG++RDSV+H G RT  +GD
Sbjct  221  KTIDARGANVHIEDGAQITLQFVXNVIIHNLHIHDTKPGNGGMIRDSVNHYGQRTRSDGD  280

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+++G+S+VWIDHVS   C DG++DA++GSTA+TISNCHFT+H+ V+LFG+++ +  D+
Sbjct  281  GISMYGASNVWIDHVSGSNCADGLVDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDE  340

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQIT+AFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  341  VMQITLAFNHFGQGLIQRMPRCRWGFFHVVNNDYTHWIMYAIGGSQHPTIISQGN  395



>ref|XP_008786760.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=467

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GA +++QF +N+II  L I +IKP +GG++RDS+ H G RT  +GD
Sbjct  208  KTIDARGANVHIAFGAQISIQFVQNVIIHGLHIHDIKPGNGGMIRDSLRHYGFRTKSDGD  267

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GSS +WIDH SM+ C DG+IDA++ STA+TISNCHF  H+ VLLFGA++ +  D 
Sbjct  268  GISIYGSSDIWIDHCSMRNCADGLIDAIEASTAITISNCHFARHNDVLLFGASDSNERDS  327

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFGK L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  328  IMQVTVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSQHPTIISQGN  382



>ref|XP_002272638.2| PREDICTED: pectate lyase-like [Vitis vinifera]
Length=434

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAGLTLQF  NIII  L I +IK  +GG++RDS SH G RT  +GD
Sbjct  176  KTIDARGANVHIANGAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSASHYGFRTRSDGD  235

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG++++WIDH+SM  C DG+IDA+  STA+TISNCHFT H++V+LFGA++    D 
Sbjct  236  GISIFGATNIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGASDGYSGDA  295

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+ FNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  296  IMQITITFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTILSQGN  350



>gb|KHN13490.1| Putative pectate lyase 3, partial [Glycine soja]
Length=364

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V IA GAG+T+QF KNIII  +K+ +I    GG++RDS +H G RT  +GD
Sbjct  103  KTIDGRGVDVYIAKGAGITVQFVKNIIIHGIKVFDIVIREGGMIRDSETHYGFRTKSDGD  162

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDHVSM+ C DG+IDA+ GSTA+TISN HFTDH++V+LFGA++    DK
Sbjct  163  GISIFGSSNIWIDHVSMRNCSDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDSYSDDK  222

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+AFNHFGKRL QRMPR R+G  H VNNDYT+WEMYA+GGS   TIIS+GN
Sbjct  223  IMQITLAFNHFGKRLVQRMPRVRYGFVHSVNNDYTHWEMYAIGGSKNPTIISEGN  277



>ref|XP_003530685.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=451

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V IA GAG+T+QF KNIII  +K+ +I    GG++RDS +H G RT  +GD
Sbjct  190  KTIDGRGVDVYIAKGAGITVQFVKNIIIHGIKVFDIVIREGGMIRDSETHYGFRTKSDGD  249

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS+VWIDHVSM+ C DG+IDA+ GSTA+TISN HFTDH++V+LFGA++    DK
Sbjct  250  GISIFGSSNVWIDHVSMRNCSDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDSYSDDK  309

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+AFNHFGKRL QRMPR R+G  H VNNDYT+WEMYA+GGS   TIIS+GN
Sbjct  310  IMQITLAFNHFGKRLVQRMPRVRYGFVHSVNNDYTHWEMYAIGGSKNPTIISEGN  364



>ref|XP_009381244.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=423

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V+I  GAG+T+Q+  NIII NL+I +IK  +GG++RDS  H GLRT  +GD
Sbjct  164  KTIDGRGVDVQIMNGAGITIQYVDNIIIHNLRIHDIKAGNGGMIRDSEHHYGLRTRSDGD  223

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG+S+VWIDHVSM  C DG+IDA++GSTA+TISN HFT H+ V+LFGA++    D 
Sbjct  224  GISIFGASNVWIDHVSMSNCMDGLIDAIQGSTAITISNSHFTQHNDVMLFGASDAFSGDA  283

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQITVAFNHFGK L QRMPRCRWG  H+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  284  VMQITVAFNHFGKGLVQRMPRCRWGFVHVVNNDYTHWMMYAIGGSQHPTILSQGN  338



>ref|XP_008389523.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 3 [Malus 
domestica]
Length=452

 Score =   241 bits (614),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V I  G G+TLQF KN+I+TNL I+ I   +GG++RDSV H GLRT  +GD
Sbjct  193  KTIDGRGANVVIEEGGGITLQFVKNVILTNLHIKMIVSKTGGMIRDSVDHMGLRTKSDGD  252

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+S+VWIDH+SM +C DG+IDAV  STA+TISN HFTDH  V+LFGANN    DK
Sbjct  253  GISLFGASNVWIDHMSMSRCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDK  312

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+AFNHFG+ L QRMPR R G FH+VNNDY +W MYA+GG+   TIISQGN
Sbjct  313  IMQITLAFNHFGRGLVQRMPRVRHGFFHLVNNDYNHWIMYAIGGNMNPTIISQGN  367



>ref|XP_002311599.2| pectate lyase family protein [Populus trichocarpa]
 gb|EEE88966.2| pectate lyase family protein [Populus trichocarpa]
Length=441

 Score =   240 bits (613),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA V IA GAG+TLQF +N+II  L+I +I   SGG+VRDSV H G RT  +GD
Sbjct  180  KTIDSRGAKVHIAYGAGITLQFVQNVIIHGLRIHDIVIGSGGLVRDSVDHYGFRTKSDGD  239

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDHVSM  C DG+ID + GS A+TISN HFT H++V+LFGA++    D 
Sbjct  240  GISIFGSSNIWIDHVSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFGASDSYSGDS  299

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  300  IMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSHNPTIVSQGN  354



>gb|KHG05193.1| hypothetical protein F383_30875 [Gossypium arboreum]
Length=385

 Score =   238 bits (608),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V IA G G+TLQF  N+II N+ I  +  +SGG++RDS  H G RT  +GD
Sbjct  124  KTIDGRGVNVHIAYGCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGYRTVGDGD  183

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS +W+DH+SM +C DG+IDA++GSTA+TISNCHFT H  V+L GA++    D+
Sbjct  184  GISIFGSSKIWLDHISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSKDQ  243

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+T+AFNHFGK L QRMPRCRWG FH+VNNDYT+W++YA+GGS   TIISQGN
Sbjct  244  YMQVTLAFNHFGKELIQRMPRCRWGYFHVVNNDYTHWKLYAIGGSTHPTIISQGN  298



>ref|XP_011025954.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=441

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG  V IA GAG+TLQFA+N+II  L+I +I   SGG++RDSV H G RT  +GD
Sbjct  180  KTIDSRGFKVHIAYGAGITLQFAQNVIIHGLRIHDIVSGSGGLIRDSVDHYGFRTKSDGD  239

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDHVSM  C DG+ID + GS A+TISN HFT H++V+LFGA++    D 
Sbjct  240  GISIFGSSNIWIDHVSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFGASDSYSGDS  299

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITV+FNHFGK L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  300  IMQITVSFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSHNPTIVSQGN  354



>ref|XP_007139601.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
 gb|ESW11595.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
Length=444

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V I  G+GLT+QF  N+II  L+++NIK T GG +RDS +H G+RT  +GD
Sbjct  184  KTIDGRGANVMIKDGSGLTMQFVNNVIIHGLRLQNIKSTPGGTIRDSWNHVGIRTKADGD  243

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IFGSS++WIDH+S+  C+DG++D ++GST +TISNCH T H+ V+LFGA++    DK
Sbjct  244  AISIFGSSNIWIDHLSLSDCEDGLVDIIQGSTGITISNCHMTKHNDVMLFGASDTFTGDK  303

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFG+ L QRMPRCRWG FH++NNDYT+W MYA+GGS+  TI+SQGN
Sbjct  304  IMQVTVAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWLMYAIGGSSAPTILSQGN  358



>ref|XP_002453531.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
 gb|EES06507.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
Length=445

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V IA GAG+T+Q A+N+II NL + ++  + GG++RDS +H G RT  +GD
Sbjct  187  KTIDGRGAQVHIANGAGITVQLARNVIIHNLHVHDVLHSMGGLMRDSPTHVGSRTKADGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++F +++VWIDH+SM  C+DG+ID V+ ST +TISNCHFT+H+ V+LFGA++  P D+
Sbjct  247  GISLFQATNVWIDHISMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSYPQDQ  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GG    TIISQGN
Sbjct  307  MMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGKAPTIISQGN  361



>gb|KDP45476.1| hypothetical protein JCGZ_09725 [Jatropha curcas]
Length=462

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V I+ GAG+T+QF  NIII  L+I +I  T GG++RDSV H GLRT  +GD
Sbjct  202  KTIDGRGFNVHISHGAGITIQFVSNIIIHGLRIHHICSTCGGMIRDSVDHVGLRTASDGD  261

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS++VWIDHVSM  C DG+IDA++GSTA+TISNCHF++H+  +L GA++    D+
Sbjct  262  GISIFGSTNVWIDHVSMSNCQDGLIDAIQGSTAITISNCHFSNHNDAILLGASDSFSGDQ  321

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W +YA+GGS   TI+SQGN
Sbjct  322  FMQITVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWLLYAIGGSMHPTIVSQGN  376



>ref|XP_011098575.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=449

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V IA GAG+TLQF KN+II  +KI NI P  GG++RD+V H GLRT  +GD
Sbjct  187  KTIDGRGARVLIANGAGITLQFVKNVIIHGIKIYNISPGQGGMIRDAVDHYGLRTRSDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS  +WIDHVSM  C DG+ID + GST VT+SN HFTDH++ +LFGA++    D 
Sbjct  247  GISIFGSQDIWIDHVSMLNCADGLIDVIMGSTGVTVSNSHFTDHNEAMLFGASDSHTQDV  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+TVAFNHFGKR+ QRMPR R+G  H+VNNDYT+W MYA+GGS    IISQGN
Sbjct  307  KMQVTVAFNHFGKRMVQRMPRARYGYIHVVNNDYTHWNMYAVGGSKNPIIISQGN  361



>ref|XP_007046218.1| Pectate lyase family protein, putative [Theobroma cacao]
 gb|EOY02050.1| Pectate lyase family protein, putative [Theobroma cacao]
Length=441

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V +A GAG+T+QFA+NIII  L I +I   SGG++RDSV H G RT  +GD
Sbjct  181  KTIDARGANVHVAYGAGITIQFARNIIIHGLHIHDIVQGSGGMIRDSVDHYGFRTKSDGD  240

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G+++FG++++W+DH+SM  C DG+IDA++GSTA+TISNCHFT+H++V+LFGA++    D+
Sbjct  241  GVSLFGATNIWLDHLSMYNCYDGLIDAIQGSTAITISNCHFTNHNEVMLFGASDSYSEDQ  300

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAF HFGK L QRMPRCRWG  H+VNNDYT+W MYA+GGS+  TIISQGN
Sbjct  301  KMQITVAFTHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGN  355



>gb|EYU34111.1| hypothetical protein MIMGU_mgv1a006386mg [Erythranthe guttata]
Length=446

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V I GGAG+T+QF KNIII  + I +I P +GG++RDSV H GLRT  +GD
Sbjct  184  KTIDGRGVRVHITGGAGITIQFVKNIIIHGILIHDIVPGNGGLIRDSVDHYGLRTRSDGD  243

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+G+  +WIDHVSM KC DG+IDA+ GST +TISN HFTDH++ +LFGA++    D 
Sbjct  244  GISIYGAQDIWIDHVSMTKCSDGLIDAIMGSTGITISNGHFTDHNEAMLFGASDSHTQDV  303

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKR+ QRMPRCR+G  H+VNNDYT+W MYA+GGS    IISQGN
Sbjct  304  KMQITVAFNHFGKRMVQRMPRCRFGYIHVVNNDYTHWNMYAIGGSKNPIIISQGN  358



>ref|XP_010242445.1| PREDICTED: pectate lyase [Nelumbo nucifera]
Length=443

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KT+DGRGA V IA GAG+T+QF KN+II NL   +I    GG++RDSV+H G RT  +GD
Sbjct  187  KTLDGRGARVHIAYGAGITIQFIKNVIIHNLHFHDIVAREGGMIRDSVNHLGFRTASDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IFGS++VWIDH SM  C DG++DA+ GSTA+TISN H T H++V+LFGA++  P D 
Sbjct  247  AISIFGSTNVWIDHNSMSNCKDGLVDAIMGSTAITISNNHLTHHNEVMLFGASDSYPDDS  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS+  TIISQGN
Sbjct  307  KMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSNPTIISQGN  361



>ref|XP_007137422.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
 gb|ESW09416.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
Length=439

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V+I  GAGLT+QF  N+II  ++++NI    GG++RDS +H GLRT  +GD
Sbjct  180  KTIDGRGANVQIRDGAGLTMQFVNNVIIHGIRVKNIVSKEGGMIRDSYNHVGLRTRSDGD  239

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I++FG+S++WIDHVS+   DDG+ID ++GSTA+TISNCH T H+ V+LFGA +    DK
Sbjct  240  AISVFGASNIWIDHVSLSNSDDGLIDVIQGSTAITISNCHMTRHNDVMLFGATDTYSGDK  299

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCR G FH++NNDYT+W MYA+GGSA  TI+SQGN
Sbjct  300  IMQITVAFNHFGQGLIQRMPRCRMGFFHVLNNDYTHWMMYAIGGSAAPTILSQGN  354



>ref|XP_009615547.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=434

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG  V IA G GL LQF  N+II+NL+I + K  +GG++RDSV+H G RT  +GD
Sbjct  175  KTIDARGKQVHIAHGGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVNHYGYRTKSDGD  234

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS++VWIDHVSM  C DG+IDAV+ STA+TISNCHFT H++V+LFGA++    D 
Sbjct  235  GISIFGSTNVWIDHVSMSNCQDGLIDAVEASTAITISNCHFTKHNEVMLFGASDSSSRDS  294

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+AFNHFG+ L QRMPR RWG  H VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  295  IMQITLAFNHFGQGLRQRMPRVRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQGN  349



>ref|XP_008793504.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=446

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+VRIA GA +TLQF  N+II  + I +IKP++GGI+RDS+ H G+RT  +GD
Sbjct  187  KTIDGRGANVRIAYGAQITLQFVHNVIIHGIHIHDIKPSNGGIIRDSLQHFGIRTKSDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GSS +WIDH S++ C DG+IDA++GSTA+TISNCHFT H+ VLLFGA++ +  D 
Sbjct  247  GISIYGSSDIWIDHCSLRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNEHDS  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFGK L QRMPRCRWG  H+VNNDYT W MYA+GGS   TIISQGN
Sbjct  307  IMQITVAFNHFGKGLVQRMPRCRWGFVHVVNNDYTQWIMYAIGGSQHPTIISQGN  361



>gb|KHN13240.1| Putative pectate lyase 3 [Glycine soja]
Length=446

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V    GAGLT+QF  N+II  ++I++I P  GG++RDS  H GLRT  +GD
Sbjct  187  KTIDGRGANVVFRDGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IFGS+++WIDHVS+  C DG+ID ++GSTA+TISNCH T H+ V LFGA++    DK
Sbjct  247  AISIFGSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDK  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG  H++NNDYT+W MYA+GGS+G TI+SQGN
Sbjct  307  IMQITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGN  361



>ref|XP_008341537.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=454

 Score =   238 bits (607),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAG+TLQF +N+II  L I +  P +GG++RDSV H G+RT  +GD
Sbjct  194  KTIDARGANVHIAHGAGITLQFVQNVIIHGLHIHDTVPGNGGMIRDSVDHIGIRTHSDGD  253

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GSS++W+DH+SM  C DG+IDA++GSTA+TISN HFT H+ V+LFGA++    D 
Sbjct  254  GISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNSHFTRHNDVMLFGASDGFSGDA  313

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFGK L QRMPRCRWG  H+VNNDYT+W MYA+GGS+  TIISQGN
Sbjct  314  IMQITVAFNHFGKGLIQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGN  368



>ref|XP_003613595.1| Pectate lyase [Medicago truncatula]
 gb|AES96553.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   238 bits (607),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V IA GAG+T+QF +N+II  +KI +I   SGG++RD   H G RT  +GD
Sbjct  189  KTIDGRGADVTIASGAGITIQFIENVIIHGIKIFDIVVGSGGLIRDGQDHFGQRTMSDGD  248

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDHVSM+ C DG++DA+ GSTA+TISN HFTDH++V+LFGA++    D+
Sbjct  249  GISIFGSSNIWIDHVSMRNCRDGLVDAIMGSTAITISNSHFTDHNEVMLFGASDGYGGDE  308

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPRCR+G  H++NNDYT+WEMYA+GGS   TIIS+GN
Sbjct  309  KMQITVAFNHFGKRLIQRMPRCRFGFIHVLNNDYTHWEMYAIGGSMHPTIISEGN  363



>gb|AES91206.2| pectate lyase P59-like protein [Medicago truncatula]
Length=434

 Score =   237 bits (605),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V I+ GA +TLQ+ KNIII  L I + K TSGG +RDS+ H G R+  +GD
Sbjct  177  KTIDARGANVHISEGAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDGD  236

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I++FG+SHVWIDH+SM  C DG++DAV GSTA+TISNCH T H+ V+LFGAN+    D+
Sbjct  237  AISMFGASHVWIDHISMWNCADGLVDAVAGSTAITISNCHMTRHNDVMLFGANDGFSGDQ  296

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            + QITVAFNHFGK L QRMPRCRWG FHIVNNDYT+W MYA+GGS   TI+SQGN
Sbjct  297  ISQITVAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSTHPTILSQGN  351



>ref|XP_004489374.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=447

 Score =   238 bits (606),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V+I  G G+T+QF  N+II  L I NIK   G ++RDS +H G RT  +GD
Sbjct  187  KTIDGRGANVQIRDGGGITMQFVNNVIIHGLHISNIKSKPGAMIRDSYNHVGQRTRSDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             ++IFGSS++WIDHVS+ +C+DG+ID ++GSTA+TISNCH T H+ V+LFGA++    DK
Sbjct  247  ALSIFGSSNIWIDHVSLSQCEDGLIDVIQGSTAITISNCHMTKHNDVMLFGASDTYNGDK  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCR+G  H+VNNDYT+W+MYA+GGS+G TI+SQGN
Sbjct  307  LMQITVAFNHFGQGLIQRMPRCRFGFVHVVNNDYTHWQMYAIGGSSGPTILSQGN  361



>gb|KHG16093.1| hypothetical protein F383_07683 [Gossypium arboreum]
Length=454

 Score =   238 bits (606),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA GAG+TLQF  ++II ++ I +I P+  G++RDSV H GLRT  +GD
Sbjct  193  KTIDGRGANVHIAHGAGITLQFVDDVIIHSIHIHHIGPSKAGLIRDSVDHIGLRTTGDGD  252

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFGS+++W+DH+SM +C DG+IDA++GSTA+TISNCHFT H+ V+L GA++    DK
Sbjct  253  GINIFGSTNIWLDHLSMSECQDGLIDAIQGSTAITISNCHFTHHNDVILLGASDTYERDK  312

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFGK L QRMPRCRWG FH+VNNDYT+W+MYA+GGS   TIISQGN
Sbjct  313  LMQVTVAFNHFGKELIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSMHPTIISQGN  367



>ref|XP_004236194.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=435

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG  V IA G GL LQF  N+II+NL I + K  +GG++RDSVSH G R+  +GD
Sbjct  176  KTIDARGRQVHIAHGGGLMLQFIHNVIISNLHIHDTKAGAGGLIRDSVSHYGYRSKSDGD  235

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS++VWIDH+SM  C DG+IDAV+GSTA+TISNCHFT H+ V+LFGA++    D 
Sbjct  236  GISIFGSTNVWIDHISMSNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDS  295

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQIT+AFNHFG  L QRMPR RWG  H+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  296  VMQITLAFNHFGHGLTQRMPRVRWGFVHVVNNDYTHWLMYAIGGSMHPTILSQGN  350



>gb|EYU36839.1| hypothetical protein MIMGU_mgv1a006379mg [Erythranthe guttata]
Length=446

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V I GGAG+T+QF KNIII  L I +I P  GG++RDSV H G RT  +GD
Sbjct  184  KTIDGRGVRVHITGGAGITIQFVKNIIIHGLLIHDIVPGDGGMIRDSVDHYGFRTRSDGD  243

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+G+  +WIDHVSM  C DG+IDA+ GST +TISN HFTDH++ +LFGA++    D 
Sbjct  244  GISIYGAQDIWIDHVSMTNCSDGLIDAIMGSTGITISNGHFTDHNEAMLFGASDSHTQDV  303

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPRCR+G  H+VNNDYT+W MYA+GGS    IISQGN
Sbjct  304  KMQITVAFNHFGKRLVQRMPRCRFGYIHVVNNDYTHWNMYAIGGSKNPIIISQGN  358



>gb|EPS62426.1| hypothetical protein M569_12361, partial [Genlisea aurea]
Length=410

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  + IAGGAG+TLQ+  N+I+ NL+I +IKP SGG +RDS +H G RT  +GD
Sbjct  153  KTIDGRGRRITIAGGAGITLQYVSNVILHNLRIHDIKPGSGGTIRDSPTHFGFRTPSDGD  212

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I++FG++++WIDHVS  +C DG+IDA++ STA+TISNCHF  H+ V+L GA++    D+
Sbjct  213  AISMFGATNIWIDHVSAARCSDGLIDAIQASTAITISNCHFAQHNDVMLLGASDKSSEDQ  272

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            ++Q+T+AFNHFG  L QRMPR RWG  HIVNNDYT WEMYA+GGS   TI+SQGN
Sbjct  273  ILQVTLAFNHFGTGLIQRMPRIRWGFVHIVNNDYTKWEMYAIGGSQHPTILSQGN  327



>ref|XP_010105747.1| putative pectate lyase P59 [Morus notabilis]
 gb|EXC05967.1| putative pectate lyase P59 [Morus notabilis]
Length=421

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+VRIA GAG+T+QF KN+II N+ I +I   SGG +RDS++H G RT  +GD
Sbjct  161  KTIDGRGANVRIAYGAGITIQFVKNVIIHNIHIHDINAGSGGNIRDSINHIGFRTKSDGD  220

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSSH+WIDHVSM  C DG+IDA+ GSTA+TISNCHFT H++V+LFGA++    D+
Sbjct  221  GISIFGSSHIWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYSDDQ  280

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+TVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  281  RMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGN  335



>ref|XP_003571658.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=432

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = -1

Query  523  TIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGDG  344
            TIDGRGA V IA GAGLT+Q   N+II NL + +IK T GG+VRDS  H G RT  +GDG
Sbjct  174  TIDGRGAQVHIAKGAGLTVQNRSNVIIHNLHVHDIKHTDGGMVRDSPDHIGYRTRADGDG  233

Query  343  ITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDKV  164
            I++F +++VWIDH+S   C+DG++D V+ STA+TISNCH T H+ V+LFGA++  P DK+
Sbjct  234  ISLFTATNVWIDHISTSMCEDGLVDIVQSSTAITISNCHLTSHNDVMLFGASDSYPDDKI  293

Query  163  MQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            MQ+TVAF HFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS+  TIISQGN
Sbjct  294  MQVTVAFTHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSNPTIISQGN  347



>ref|XP_006344502.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=435

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG  V IA G GL LQF  N++I+NL I + K  SGG++RDSVSH G R+  +GD
Sbjct  176  KTIDARGRQVHIAHGGGLMLQFVHNVLISNLHIHDTKAGSGGLIRDSVSHYGYRSKSDGD  235

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS++VWIDH+SM  C DG+IDAV+GSTA+TISNCHFT H+ V+LFGA++    D 
Sbjct  236  GISIFGSTNVWIDHISMSNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDS  295

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQIT+AFNHFG  L QRMPR RWG  H VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  296  VMQITLAFNHFGHGLTQRMPRIRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQGN  350



>emb|CDP14850.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   235 bits (600),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V IA GAG TLQF  NIII NL I +IK  +GG++RDSV+H G+R+  +GD
Sbjct  176  KTIDGRGVQVHIAYGAGFTLQFVHNIIIHNLHIHDIKSGNGGMIRDSVNHYGIRSRSDGD  235

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GS+++WIDH+SM  C+DG+IDAV+ STA+TISN HFT H++ +LFGA++    D 
Sbjct  236  GISIYGSTNIWIDHISMSNCNDGLIDAVQASTAITISNGHFTHHNEAMLFGASDSYSDDS  295

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+AFNHFG+ +EQRMPR RWG  H+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  296  IMQITLAFNHFGQGIEQRMPRARWGFVHVVNNDYTHWLMYAIGGSQHPTILSQGN  350



>ref|NP_197015.4| putative pectate lyase 19 [Arabidopsis thaliana]
 gb|AED92118.1| putative pectate lyase 19 [Arabidopsis thaliana]
Length=472

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V +A GAG+T+QF KN++I  L I +I  +SGG++RDSV H G+RT  +GD
Sbjct  211  KTIDARGANVHVAHGAGITMQFVKNVVIHGLHIHHISESSGGMIRDSVDHFGMRTRADGD  270

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G++I+GSS++W+DH+SM KC DG+IDA+ GST +TISN HFT H+ V+L GA N +  DK
Sbjct  271  GLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADK  330

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+TVA+NHFGK L QRMPR RWG  H+VNNDYT+WE+YA+GGS G TI+S GN
Sbjct  331  HMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGN  385



>emb|CDP00293.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   235 bits (600),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V IA GAGL++QF +N+II N+KI +I P +GG+VRDS SH GLRT  +GD
Sbjct  185  KTIDGRGVEVHIAYGAGLSIQFVQNVIIHNIKIHHIVPKNGGLVRDSTSHIGLRTRSDGD  244

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+HVWIDHVS+ KC DG+IDA+  STA+TISNC F +H+ V+L GA++    D 
Sbjct  245  GISIFGSNHVWIDHVSLSKCSDGLIDAIMASTAITISNCKFNNHNDVILLGASDEHSEDA  304

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFN FGK L QRMPRCRWG FHIVNNDY+ W+MYA+GGSA  TIISQGN
Sbjct  305  IMQVTVAFNRFGKGLVQRMPRCRWGFFHIVNNDYSQWQMYAIGGSAHPTIISQGN  359



>gb|ABK28696.1| unknown [Arabidopsis thaliana]
Length=473

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V +A GAG+T+QF KN++I  L I +I  +SGG++RDSV H G+RT  +GD
Sbjct  211  KTIDARGANVHVAHGAGITMQFVKNVVIHGLHIHHISESSGGMIRDSVDHFGMRTRADGD  270

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G++I+GSS++W+DH+SM KC DG+IDA+ GST +TISN HFT H+ V+L GA N +  DK
Sbjct  271  GLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADK  330

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+TVA+NHFGK L QRMPR RWG  H+VNNDYT+WE+YA+GGS G TI+S GN
Sbjct  331  HMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGN  385



>dbj|BAJ99909.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   231 bits (588),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KT+DGRGA V IA G GLT+Q   N+II NL + +IK T GG V  + +H  +RT  +GD
Sbjct  43   KTLDGRGAQVHIANGGGLTIQHQNNVIIHNLHVHDIKHTDGGNVSLAANHATIRTRADGD  102

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G++IF +++VW+DH+SM  C+DG+ID V  STA+TISNCH T+H+ V+LFGA++  P DK
Sbjct  103  GVSIFNATNVWVDHLSMALCEDGMIDVVAASTAITISNCHLTNHNDVMLFGADDNKPEDK  162

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQ+TVAFNHFG+ L QRMPRCR+G FH+VNNDYT+W MYA+GGS+  TIISQGN
Sbjct  163  VMQVTVAFNHFGRGLVQRMPRCRYGFFHVVNNDYTHWLMYAIGGSSEPTIISQGN  217



>ref|XP_003613596.1| Pectate lyase [Medicago truncatula]
 gb|AES96554.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   235 bits (599),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V IA GAG+T+QF +N+II  +KI +I   SGG+VRDS  H GLRT  +GD
Sbjct  189  KTIDGRGADVTIANGAGITIQFIENVIIHGIKIYDIMVGSGGLVRDSEDHYGLRTISDGD  248

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSSH+WIDHVSM+ C DG+IDA+ GSTA+TISN HFTDH++V+LFGA++    D+
Sbjct  249  GISIFGSSHIWIDHVSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDTYDGDQ  308

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITV FN FGK+L QRMPRCR+G  H++NN Y  WEMYA+GG+   TIIS+GN
Sbjct  309  KMQITVVFNRFGKKLIQRMPRCRFGFIHVLNNFYNRWEMYAIGGTMHPTIISEGN  363



>ref|XP_011085777.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=446

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V+IA GAG+T+Q+ +NIII N+KI NI    GGI+RDS +H GLRT  +GD
Sbjct  187  KTIDGRGVKVQIAHGAGITVQYVRNIIIHNIKIHNIVEKKGGIIRDSTTHSGLRTQSDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG+  +WIDHVSM +CDDG+IDA++GSTA+TISN HFTDH   +LFGAN+  P D+
Sbjct  247  GISIFGAQDIWIDHVSMTRCDDGLIDAIQGSTAITISNGHFTDHDHAMLFGANDKYPGDE  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKR+ QRMPRCR+G FH+VNNDYT+W+MYA+GGS+  TIISQGN
Sbjct  307  KMQITVAFNHFGKRMVQRMPRCRYGFFHVVNNDYTHWKMYAIGGSSHPTIISQGN  361



>ref|XP_007151201.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
 gb|ESW23195.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
Length=441

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V+I  G GLT+QF  N+II  +++++I P  GG++RDS +H G RT  +GD
Sbjct  182  KTIDGRGANVQIRDGGGLTMQFVNNVIIHGIRVKDIVPKEGGLIRDSYNHIGQRTRSDGD  241

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I++FG+S++WIDHVS+    DG+ID ++GSTA+TISNCH T H+ V+LFGA +    DK
Sbjct  242  AISVFGASNIWIDHVSLSNSADGLIDVIQGSTAITISNCHMTRHNDVMLFGAADSYTGDK  301

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCR G FH++NNDYT+W MYA+GGSAG TI+SQGN
Sbjct  302  IMQITVAFNHFGQGLIQRMPRCRMGFFHVLNNDYTHWMMYAIGGSAGPTILSQGN  356



>gb|KEH24975.1| pectate lyase P59-like protein [Medicago truncatula]
Length=453

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V+I  GAG+T+QF  N+II  L I+NIK   GG++RDS  H G RT  +GD
Sbjct  193  KTIDGRGANVQIRDGAGITMQFVNNVIIHGLHIQNIKAKPGGLIRDSFDHTGQRTRSDGD  252

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+I+GSS++WIDH+S+ +C+DG++D ++GST +TISNCH T H+ V+LFGA++    DK
Sbjct  253  AISIYGSSNIWIDHLSLSECEDGLVDIIQGSTGITISNCHMTKHNDVMLFGASDSYTGDK  312

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCR+G  H++NNDYT+W MYA+GGS+  TI+SQGN
Sbjct  313  LMQITVAFNHFGQGLIQRMPRCRYGFVHVLNNDYTHWIMYAIGGSSSPTILSQGN  367



>ref|XP_002437204.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
 gb|EER88571.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
Length=454

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 139/177 (79%), Gaps = 2/177 (1%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTS--GGIVRDSVSHKGLRTFDE  353
            KTIDGRGA VRIA GA LT+QFA N+II N+ I +I  ++  GG +RDS  H G RT  +
Sbjct  192  KTIDGRGAQVRIANGAQLTVQFANNVIIHNVHINDIMSSNKNGGNIRDSPDHFGWRTVSD  251

Query  352  GDGITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPV  173
            GDGIT+FGS++VW+DH+S+  C DG+ID +  ST VTISNCH T+H+ V+LF +++  P 
Sbjct  252  GDGITLFGSTNVWLDHLSLSNCQDGLIDVIVKSTGVTISNCHMTNHNDVMLFSSSDKHPE  311

Query  172  DKVMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            D++MQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  312  DQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAPTIISQGN  368



>ref|XP_011013803.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=419

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V I  GA +TLQF KN+II  + I + K  +GG++RDSV H G R+  +GD
Sbjct  161  KTIDGRGVNVHIYNGAQITLQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDGD  220

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+ +WIDH+S+  C+DG+IDAV GS A+TISNCHFT H+ V+LFGA++    D 
Sbjct  221  GISIFGSTDIWIDHISLSNCEDGLIDAVMGSNAITISNCHFTKHNDVMLFGASDGYSGDS  280

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQITVAFNHFG+ L QRMPR RWG  H+VNNDYT+WEMYA+GGS   TIISQGN
Sbjct  281  VMQITVAFNHFGRGLVQRMPRVRWGFAHVVNNDYTHWEMYAIGGSQHPTIISQGN  335



>ref|XP_006374492.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
 gb|ERP52289.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
Length=435

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V I  GA +TLQF KN+II  + I + K  +GG++RDSV H G R+  +GD
Sbjct  177  KTIDGRGVNVHIYNGAQITLQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDGD  236

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+ +WIDH+S+  C+DG+IDA+ GS A+TISNCHFT H+ V+LFGA++    D 
Sbjct  237  GISIFGSTDIWIDHISLSNCEDGLIDAIMGSNAITISNCHFTKHNDVMLFGASDSYSGDS  296

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQITVAFNHFG+ L QRMPR RWG  H+VNNDYT+WEMYA+GGS   TIISQGN
Sbjct  297  VMQITVAFNHFGRGLVQRMPRVRWGFVHVVNNDYTHWEMYAIGGSQHPTIISQGN  351



>ref|XP_009758350.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=445

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V +A GAGLT+QF  N+I+ N+++ +I  TSGG++RDS+ H GLRT  +GD
Sbjct  185  KTIDGRGVSVHVAYGAGLTIQFVHNVIVHNIRVHHILSTSGGMIRDSIDHIGLRTVSDGD  244

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IFG++ +WIDH ++ K  DG+IDA+  STA+TISNC F  H+ V+L GAN+  P DK
Sbjct  245  AISIFGANRIWIDHCTLTKGADGLIDAIMASTAITISNCKFNHHNDVMLLGANDAFPQDK  304

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFN FGK   QRMPRCRWG FH+VNNDY  WEMYA+GG+A  TIISQGN
Sbjct  305  IMQVTVAFNRFGKGCIQRMPRCRWGFFHVVNNDYAKWEMYAIGGTANPTIISQGN  359



>ref|XP_004302354.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA GAG+T+QF +N+II  + I +I    GG++RDS+ H GLR   +GD
Sbjct  185  KTIDGRGANVHIAHGAGITIQFVENVIIHGIHIHDIVSVGGGLIRDSLDHIGLRGQSDGD  244

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GIT+FGSSH+W+DH+SM  C DG+ D V+GSTA+TISNCHFT H+ V+LFGAN+    D+
Sbjct  245  GITVFGSSHIWLDHLSMWNCYDGLTDVVQGSTAITISNCHFTRHNDVMLFGANDLYERDQ  304

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFGK L QRMPRCR+G FH+VNNDYT+W+MYA+GGS+  TIISQGN
Sbjct  305  IMQITVAFNHFGKGLIQRMPRCRFGFFHVVNNDYTHWQMYAIGGSSHPTIISQGN  359



>ref|XP_009599232.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=445

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V +A GAGLT+QF  N+I+ N+++ +I  TSGG++RDS+ H GLRT  +GD
Sbjct  185  KTIDGRGVSVHVAYGAGLTIQFVHNVIVHNIRVHHILSTSGGMIRDSIDHIGLRTVSDGD  244

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IFG++ +WIDH ++ K  DG+IDA+  STA+TISNC F  H+ V+L GAN+  P DK
Sbjct  245  AISIFGANRIWIDHCTLTKGADGLIDAIMASTAITISNCKFNHHNDVMLLGANDAFPQDK  304

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFN FGK   QRMPRCRWG FH+VNNDY  WEMYA+GG+A  TIISQGN
Sbjct  305  IMQVTVAFNRFGKGCIQRMPRCRWGFFHVVNNDYAKWEMYAIGGTANPTIISQGN  359



>ref|XP_009761969.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=434

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG  V IA G GL LQF  N+II+NL+I + K  +GG++RDSV H G RT  +GD
Sbjct  175  KTIDARGKQVHIAHGGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVDHYGYRTKSDGD  234

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS++VWIDHVSM  C DG+IDAV+ STA+TISN HFT H++V+LFGA++    D 
Sbjct  235  GISIFGSTNVWIDHVSMSNCQDGLIDAVEASTAITISNSHFTKHNEVMLFGASDSSSRDS  294

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQIT+AFNHFG+ L QRMPR RWG  H VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  295  IMQITLAFNHFGQGLMQRMPRVRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQGN  349



>ref|XP_004298448.1| PREDICTED: probable pectate lyase 3-like [Fragaria vesca subsp. 
vesca]
Length=443

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA++ IA G G+TLQ+  N+IITN+K+++I+   GG++RD+  H GLRT  +GD
Sbjct  184  KTIDGRGANIVIAYGGGITLQYVNNVIITNIKVKDIQSLPGGMLRDAEDHVGLRTRSDGD  243

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++F +S++WIDHVSM +  DG+ID + GSTAVTISN HFTDH++ +LFGA N    DK
Sbjct  244  GISLFSASNIWIDHVSMARTADGLIDCIMGSTAVTISNGHFTDHNEAMLFGAKNTHTQDK  303

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQIT+AFNHFG+ L QRMPRCR+G FH+VNNDYT W MYA+GG+   TIISQGN
Sbjct  304  NMQITLAFNHFGQGLVQRMPRCRFGFFHVVNNDYTQWIMYAIGGNMNPTIISQGN  358



>ref|XP_004152537.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=434

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 138/177 (78%), Gaps = 2/177 (1%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KT+DGRGA+V IA G  +TLQF KNIII NL I +IK  +GG++RDSVSH G RT  +GD
Sbjct  181  KTLDGRGANVHIANGGQITLQFVKNIIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRSDGD  240

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+S VWIDHVSM  C DG+IDAV  STA+TISNCHFT H+ V+L GA+N    D+
Sbjct  241  GISMFGASRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASNGYSNDQ  300

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGS--AGSTIISQGN  2
            +MQ+T+AFNHFGK L QRMPRCRWG  H+VNNDYT+W MYA+GGS   G+  I+  N
Sbjct  301  IMQVTLAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSHXQGNRFIAPPN  357



>dbj|BAK06965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   233 bits (594),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA VRIA GA +T+Q++ N+II N+ + ++    GG +RDS  H G RT  +GD
Sbjct  185  KTIDGRGAQVRIADGAQVTVQYSHNVIIHNIHVNDLIVGKGGRIRDSPQHAGFRTQSDGD  244

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G+++FGS++VW+DH+S+  C DG+ID +  +T VTISNCH T+H+ V+LFG+++ +P D+
Sbjct  245  GVSVFGSTNVWLDHLSLATCQDGLIDVIAEATGVTISNCHLTNHNDVMLFGSSDSNPKDQ  304

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  305  IMQVTVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGN  359



>gb|ABM68553.1| pectate lyase [Lilium longiflorum]
Length=251

 Score =   227 bits (578),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V+IAGGA LT+QF  N+II  + I +IKP  GG++RDS  H G+RT  +GD
Sbjct  34   KTIDGRGANVQIAGGAQLTVQFVHNVIIHGIHIHDIKPGEGGLIRDSEKHSGIRTRSDGD  93

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I GSS++WIDHVS+ +C DG+ID + GSTA+TISNCH T+H  V+L GA++    D+
Sbjct  94   GISIIGSSNIWIDHVSLARCSDGLIDVILGSTAITISNCHLTEHDDVMLLGASDTYTQDE  153

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFG+ L QRMPRCR+G  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  154  IMQVTVAFNHFGRGLVQRMPRCRYGFVHVVNNDYTHWIMYAVGGSQHPTIISQGN  208



>ref|XP_009797403.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=439

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  + IA GAGLT+QF  N+II N++I +I  TSGG++RDSV H G+RT  +GD
Sbjct  178  KTIDGRGVSIYIAYGAGLTIQFVHNVIIHNIRIHHIISTSGGMIRDSVKHIGIRTLSDGD  237

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+H+WIDH ++ +C DG+IDA+  STA+TISNC F  H+ V+L GA +  P D 
Sbjct  238  GISIFGSNHIWIDHCTLSQCTDGLIDAIMASTAITISNCKFNHHNDVMLLGATDAFPQDS  297

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFN FGK L QRMPRCRWG FH+VNNDY++W+MYA+GGSA  TIISQGN
Sbjct  298  IMQVTVAFNRFGKGLIQRMPRCRWGFFHVVNNDYSHWQMYAIGGSANPTIISQGN  352



>ref|XP_007037229.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY21730.1| Pectate lyase family protein [Theobroma cacao]
Length=434

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V    GA +TLQ+ +N+II  + IR     +GG++RDSV H G RT  +GD
Sbjct  176  KTIDGRGANVHFFRGAQITLQYIQNVIIHGIHIRLSVEANGGMIRDSVDHFGFRTKSDGD  235

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS ++WIDHVSM +C DG+ID ++ STA+TISNCHFTDH+ V+LFGA++    DK
Sbjct  236  GISIFGSHNIWIDHVSMSRCSDGLIDVIQASTAITISNCHFTDHNDVMLFGASDSFSDDK  295

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFG+ L QRMPRCRWG  H+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  296  IMQVTVAFNHFGQGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSNQPTILSQGN  350



>ref|XP_003563707.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=448

 Score =   233 bits (593),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA VRIA GA +T+Q+A N+II N+ I ++    GG++RDS +H G RT  +GD
Sbjct  189  KTIDGRGAQVRIADGAQVTVQYAHNVIIHNIHINDLIVGKGGMIRDSPAHFGFRTQSDGD  248

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G+ +FGS+ VW+DH+S+  C DG+ID +  ST VTISNCH T+H+ V+LFG+++ +P D 
Sbjct  249  GVNVFGSTSVWLDHLSLATCQDGLIDVIAESTGVTISNCHLTNHNDVMLFGSSDSNPKDV  308

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  309  IMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKDPTILSQGN  363



>ref|XP_004964534.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=438

 Score =   232 bits (592),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 137/175 (78%), Gaps = 1/175 (1%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I G A +TLQ   ++II N+ I +  P SGGI+RDS  H GLRT  +GD
Sbjct  180  KTIDGRGAQVHITG-AQITLQSVSHVIIHNVHIHHSAPHSGGIIRDSKRHYGLRTRSDGD  238

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++  SS+VWIDHVSM +C DG+ID V GST +T+SN HFT H  V+LFGA+N +P D+
Sbjct  239  GISVLSSSNVWIDHVSMYRCSDGLIDVVNGSTGITVSNSHFTKHDHVMLFGASNDNPQDR  298

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFGK L QRMPRCR+G FH+VNNDYT+W+MYA+GG+   TIISQGN
Sbjct  299  MMQVTVAFNHFGKGLVQRMPRCRYGFFHVVNNDYTHWQMYAIGGNKNPTIISQGN  353



>ref|XP_009403112.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=437

 Score =   232 bits (592),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG++V I GGAG+ LQF  N+II  L I +IK  +GG++RDS  H GLRT  +GD
Sbjct  178  KTIDARGSNVHIMGGAGIMLQFVHNVIIHGLHIHDIKAGNGGMIRDSEHHFGLRTRSDGD  237

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GSS++WIDHVSM  C DG+ID ++GSTA+TISN HFT H+ V+LFGA++    D 
Sbjct  238  GISIYGSSNIWIDHVSMSNCMDGLIDVIQGSTAITISNSHFTKHNDVMLFGASDSYQGDA  297

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFGK L QRMPRCRWG  H+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  298  MMQITVAFNHFGKGLVQRMPRCRWGFVHVVNNDYTHWLMYAVGGSQHPTILSQGN  352



>ref|XP_006439649.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
 gb|ESR52889.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
Length=437

 Score =   232 bits (591),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG++V+I  GA +T+QF KNIII  L IR  K   GG++RDSVSH G R+  +GD
Sbjct  179  KTIDARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHHGFRSSSDGD  238

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+SH+WIDHVSM  C DG+IDAV GSTA+T+SN HFT    V+L GA++  P D 
Sbjct  239  GISMFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDSHPQDS  298

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFGK+L QRMPR R+G  H+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  299  IMQVTVAFNHFGKQLVQRMPRVRFGFAHVVNNDYTHWLMYAIGGSQHPTILSQGN  353



>gb|KHG08055.1| putative pectate lyase P59 [Gossypium arboreum]
 gb|KHG08558.1| putative pectate lyase P59 [Gossypium arboreum]
Length=440

 Score =   232 bits (591),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V +A GAG+T+Q+ +N+II  L I +I P +GG++RDSV+H G RT  +GD
Sbjct  180  KTIDARGANVHVAYGAGITIQYVRNVIIHGLHIHHIVPGNGGMIRDSVNHYGFRTKSDGD  239

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+++VW+DH+SM KC DG+IDA++GSTA+TISNCHFT H +V+LFGAN+   +D+
Sbjct  240  GISLFGATNVWLDHLSMYKCRDGLIDAIQGSTAITISNCHFTHHDQVMLFGANDNHKMDE  299

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQIT+ FNHFGK L QRMPRCRWG  H+VNNDYT+W MYA+GGS+  T+ISQGN
Sbjct  300  KMQITLVFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTVISQGN  354



>ref|XP_010683249.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   232 bits (591),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAG+T+QF KN+II  L I  I P  GG++RDS +H GLRT  +GD
Sbjct  185  KTIDARGANVHIAHGAGITIQFIKNVIIHGLHIHQIYPGDGGLIRDSANHFGLRTRSDGD  244

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IFG+S++WIDHVSM +  DG+ID ++GSTA+TISNCH TDH++V LFGA N    D+
Sbjct  245  AISIFGASNIWIDHVSMARGTDGLIDIIQGSTAITISNCHMTDHNEVFLFGATNDYTDDQ  304

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+TVAFNHFGK L QRMPR R+G  H+VNNDYT+W+MYA+GGS   TIISQGN
Sbjct  305  KMQVTVAFNHFGKGLVQRMPRARFGFIHVVNNDYTHWQMYAIGGSQHPTIISQGN  359



>gb|KDO76053.1| hypothetical protein CISIN_1g013757mg [Citrus sinensis]
Length=437

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG++V+I  GA +T+QF KNIII  L IR  K   GG++RDSVSH G R+  +GD
Sbjct  179  KTIDARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHHGFRSSSDGD  238

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+SH+WIDHVSM  C DG+IDAV GSTA+T+SN HFT    V+L GA++  P D 
Sbjct  239  GISMFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDGHPQDS  298

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFGK+L QRMPR R+G  H+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  299  IMQVTVAFNHFGKQLVQRMPRVRFGFAHVVNNDYTHWLMYAIGGSQHPTILSQGN  353



>ref|XP_010068708.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
 gb|KCW64557.1| hypothetical protein EUGRSUZ_G02162 [Eucalyptus grandis]
Length=435

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V I  GA +TLQF +N+II  L I +  P +GG++RDS+ H G RT  +GD
Sbjct  177  KTIDGRGANVHICDGAQITLQFVRNVIIHGLHIHDTHPGNGGLIRDSLEHYGFRTGSDGD  236

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+++VWIDHVSM  C DG+ID ++ STA+TISNCHFT H++V+LFG ++    D 
Sbjct  237  GISLFGATNVWIDHVSMSHCYDGLIDVIQASTAITISNCHFTRHNEVMLFGGSDTYSDDA  296

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFG+ L QRMPRCRWG  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  297  HMQITVAFNHFGQGLVQRMPRCRWGFVHVVNNDYTHWLMYAIGGSQHPTIISQGN  351



>ref|XP_011087066.1| PREDICTED: pectate lyase [Sesamum indicum]
Length=431

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KT+DGRGA V IA GAG+TLQF  N+II N++I +I P  GG++RD+V H GLRT  +GD
Sbjct  169  KTLDGRGAKVHIAYGAGITLQFVHNVIIHNIRIHDIHPAPGGMIRDAVDHIGLRTRSDGD  228

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++F S+++WIDHVS+ K  DG+ID ++GSTA+TISNC F  H+ V+L GA++    D 
Sbjct  229  GISVFNSNNIWIDHVSLSKGTDGLIDVIEGSTAITISNCKFNHHNDVMLLGAHDSTAKDS  288

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFN FGK L QRMPR RWG  H++NNDY++WEMYA+GGSA  TIISQGN
Sbjct  289  IMQITVAFNRFGKGLIQRMPRIRWGFVHVINNDYSHWEMYAIGGSAHPTIISQGN  343



>ref|XP_006477525.1| PREDICTED: pectate lyase-like [Citrus sinensis]
Length=437

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG++V+I  GA +T+QF KNIII  L IR  K   GG++RDSVSH G R+  +GD
Sbjct  179  KTIDARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHYGFRSSSDGD  238

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FG+SH+WIDHVSM  C DG+IDAV GSTA+T+SN HFT    V+L GA++  P D 
Sbjct  239  GISMFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDGHPQDS  298

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFGK+L QRMPR R+G  H+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  299  IMQVTVAFNHFGKQLVQRMPRVRFGFAHVVNNDYTHWLMYAIGGSQHPTILSQGN  353



>gb|ACN35280.1| unknown [Zea mays]
 gb|AFW57902.1| hypothetical protein ZEAMMB73_963462 [Zea mays]
 gb|AFW57903.1| hypothetical protein ZEAMMB73_963462 [Zea mays]
Length=274

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA GA +T+Q+  N+II  L I + KPT   +VR S SH G RT  +GD
Sbjct  15   KTIDGRGANVHIANGACITIQYITNVIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  74

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G++IFGSSHVW+DH S+  C DG+IDA+ GSTA+T+SN +FT H++V+L G ++    DK
Sbjct  75   GVSIFGSSHVWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHSDSYVKDK  134

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+T+AFNHFG+ L QRMPRCR G FH+VNNDYT+WEMYA+GGSA  TI SQGN
Sbjct  135  AMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGN  189



>ref|XP_004301165.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=445

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 145/181 (80%), Gaps = 6/181 (3%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V I GG  +TLQ+ +NIII+N+ +R+  P +GG++RDS++H GLRT  +GD
Sbjct  181  KTIDGRGVNVHIQGGGQITLQYVRNIIISNIHVRDTIPKNGGMIRDSINHYGLRTESDGD  240

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHH------KVLLFGANN  185
            GI++FG+++VWIDHVS   C DG+ID ++ STA+TISN HFTDH+       V+LFG+++
Sbjct  241  GISLFGATNVWIDHVSASNCADGLIDVIQASTAITISNSHFTDHNDVIINLSVMLFGSSD  300

Query  184  WDPVDKVMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQG  5
             +  D++MQIT+AFNHFG+ L QRMPRCR+G FH+VNNDYT+W MYA+GGS+  TI+SQG
Sbjct  301  SNSKDEIMQITLAFNHFGQGLVQRMPRCRFGFFHVVNNDYTHWIMYAIGGSSHPTILSQG  360

Query  4    N  2
            N
Sbjct  361  N  361



>ref|XP_010320663.1| PREDICTED: probable pectate lyase 3 [Solanum lycopersicum]
Length=386

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V +A G GLTLQF  N+I+ N+++ +I   +GG++RDSV H GLRT  +GD
Sbjct  196  KTIDGRGVSVHVAYGGGLTLQFVHNVIVHNIRVHHILSKNGGMIRDSVKHIGLRTVSDGD  255

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I++FG++ +WIDH ++ K  DG++DA+  STA+TISNC F  H+ V+L GAN+  P DK
Sbjct  256  AISLFGANRIWIDHCTLTKGADGLLDAIMASTAITISNCKFNHHNDVMLLGANDAFPQDK  315

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFN FGK   QRMPRCRWG FH+VNNDY  WEMYA+GG+A  TIISQGN
Sbjct  316  IMQVTVAFNRFGKGCIQRMPRCRWGFFHVVNNDYAKWEMYAIGGTANPTIISQGN  370



>ref|XP_006354795.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=435

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG  V I GGA L LQ+  N+II  L I +IK  +GG++RDS++H G RT  +GD
Sbjct  176  KTIDARGQQVHITGGASLMLQYINNVIIHGLHIHDIKSGNGGLIRDSINHYGFRTRSDGD  235

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+++WIDHVSM  CDDG+IDAV+ STA+TISNCHFT H+ V+LFGA++    D 
Sbjct  236  GISIFGSTNIWIDHVSMSNCDDGLIDAVQASTAITISNCHFTHHNDVMLFGASDSYKQDA  295

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            ++QIT+AFNHFG+ L QRMPR RWG  H VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  296  ILQITLAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWIMYAIGGSQHPTILSQGN  350



>ref|XP_006842121.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
 gb|ERN03796.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
Length=438

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V IA GAG+T+Q+ KN+II  L I +IK  +GG++RDS  H GLRT  +GD
Sbjct  179  KTIDGRGTNVHIAYGAGITIQYQKNVIIHGLHIHDIKAGNGGMIRDSPEHYGLRTKSDGD  238

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IF SS VWIDH SM  C DG+IDA+ GSTA+TISN HFT+H++V L GA++    DK
Sbjct  239  AISIFASSFVWIDHNSMSNCMDGLIDAIMGSTAITISNNHFTNHNEVSLMGASDSFSDDK  298

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+T AFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  299  IMQVTFAFNHFGRGLIQRMPRCRWGFFHVVNNDYTHWGMYAVGGSQHPTIISQGN  353



>ref|XP_008812405.1| PREDICTED: probable pectate lyase 8 [Phoenix dactylifera]
Length=451

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA GA +T+QF  NIII  L I + KPT   +VR S SH G RT  +GD
Sbjct  192  KTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  251

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             ++IFGSSH+W+DH S+ KC DG++DAV GSTA+TISN +FT H++V+L G ++    DK
Sbjct  252  AVSIFGSSHIWVDHCSLSKCADGLVDAVMGSTAITISNNYFTHHNEVMLLGHSDSYERDK  311

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+T+AFNHFG+ L QRMPRCR G FH+VNNDYT+WEMYA+GGSAG TI SQGN
Sbjct  312  AMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAGPTINSQGN  366



>ref|XP_009788285.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=434

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RG  V IA GA   LQF  N+II  L I +IK  +GG++RDS++H G R+  +GD
Sbjct  175  KTIDARGQQVHIAFGASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYGFRSRSDGD  234

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+++WIDHVSM  CDDG+IDAV+ STA+TISNCHFT+H+ V+LFGA++    D 
Sbjct  235  GISIFGSTNIWIDHVSMSNCDDGLIDAVQASTAITISNCHFTNHNDVMLFGASDSYSEDS  294

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            ++QIT+AFNHFG+ L QRMPR RWG  H VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  295  ILQITLAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWLMYAIGGSQHPTILSQGN  349



>gb|ACF84425.1| unknown [Zea mays]
 tpg|DAA38669.1| TPA: hypothetical protein ZEAMMB73_698118 [Zea mays]
Length=274

 Score =   225 bits (574),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA GA +T+Q+  N+II  L I + +PT   +VR S SH G RT  +GD
Sbjct  15   KTIDGRGANVHIANGACVTIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGWRTMADGD  74

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G++IFGSSHVW+DH S+  C DG+IDA+ GSTA+T+SN +FT H++V+L G ++    DK
Sbjct  75   GVSIFGSSHVWVDHCSLSNCADGLIDAIMGSTAITLSNNYFTHHNEVMLLGHSDSYVKDK  134

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+T+AFNHFG+ L QRMPRCR G FH+VNNDYT+WEMYA+GGSA  TI SQGN
Sbjct  135  AMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGN  189



>ref|XP_006655782.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=351

 Score =   227 bits (579),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 135/175 (77%), Gaps = 1/175 (1%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I G A +TLQ  +++I+ N+ I +  P  GG++RDS  H G RT  +GD
Sbjct  93   KTIDGRGAQVHITG-AQITLQGVQHVIVHNVHIHHSAPHGGGMIRDSKRHYGRRTRSDGD  151

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++  SS+VWIDHVSM  C DG++D V GSTA+TISN HFT H  V+LFGA+N DP D+
Sbjct  152  GISVMSSSNVWIDHVSMSNCSDGLVDVVSGSTAITISNGHFTKHDHVMLFGASNSDPQDR  211

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQITVAFNHFGK L QRMPRCR+G FH+VNNDYT+W MYA+GG+   TIISQGN
Sbjct  212  VMQITVAFNHFGKGLVQRMPRCRFGFFHVVNNDYTHWMMYAIGGNMNPTIISQGN  266



>ref|XP_006357289.1| PREDICTED: probable pectate lyase 3-like [Solanum tuberosum]
Length=459

 Score =   230 bits (587),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  V +A GAGLTLQF  N+I+ N+++ +I    GG++RDSV H GLRT  +GD
Sbjct  199  KTIDGRGISVHVAYGAGLTLQFVHNVIVHNIRVHHILSKDGGMIRDSVKHIGLRTVSDGD  258

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I++FG++ +WIDH ++ K  DG++DA+  STA+TISNC F  H+ V+L GAN+  P DK
Sbjct  259  AISLFGANRIWIDHCTLTKGADGLVDAIMASTAITISNCKFNHHNDVMLLGANDAFPQDK  318

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFN FGK   QRMPRCRWG FH+VNNDY  WEMYA+GG+A  TIISQGN
Sbjct  319  IMQVTVAFNRFGKGCIQRMPRCRWGFFHVVNNDYAKWEMYAIGGTANPTIISQGN  373



>gb|KHN13652.1| Pectate lyase [Glycine soja]
Length=440

 Score =   229 bits (585),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V I GGAGL +QF  NIII  ++I  IK   G ++RD  +H G+RT  +GD
Sbjct  180  KTIDGRGANVVIKGGAGLAMQFVNNIIIHGIRINKIKSMEGTMLRDLWNHVGIRTRCDGD  239

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             ++IFGSS++W+DH+S+ +C+DG+ID V+GST +TISNCH T H+ V+LFGA++    DK
Sbjct  240  AVSIFGSSNIWLDHLSLSECEDGLIDIVQGSTGITISNCHMTKHNDVMLFGASDTYAGDK  299

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFG+ L QRMPRCRWG  H++NNDYT+W MYA+GGS+  TI+SQGN
Sbjct  300  IMQVTVAFNHFGQGLIQRMPRCRWGFVHVINNDYTHWLMYAIGGSSEPTILSQGN  354



>gb|EMS45831.1| Pectate lyase [Triticum urartu]
Length=540

 Score =   232 bits (592),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  +RIA GA +T+Q+A N+II N+ + ++    GG +RDS  H G RT  +GD
Sbjct  187  KTIDGRGVQLRIADGAQVTVQYAHNVIIHNIHVNDLIVGKGGRIRDSPQHAGFRTQSDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G+++FGS+ VW+DH+S+  C DG+ID +  ST VTISNCH T+H+ V+LFG+++ +P D+
Sbjct  247  GVSVFGSTDVWLDHLSLATCQDGLIDVIDQSTGVTISNCHLTNHNDVMLFGSSDSNPKDE  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  307  IMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGN  361



>dbj|BAH20311.1| AT3G01270 [Arabidopsis thaliana]
Length=365

 Score =   227 bits (579),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAG+T+Q+  NIII  L + +I  +SGG++RDS++H G R   +GD
Sbjct  104  KTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIVKSSGGLIRDSINHFGHRGEADGD  163

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG++++W+DH+SM KC DG+IDA+ GSTA+TISN HFT H+ V+L GA N +  DK
Sbjct  164  GISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDK  223

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+TVA+NHFGK L QRMPR RWG  H+VNNDYT+WE+YA+GGS G TI+S GN
Sbjct  224  KMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGN  278



>ref|XP_003552513.1| PREDICTED: pectate lyase-like [Glycine max]
Length=440

 Score =   229 bits (585),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V I GGAGL +QF  NIII  ++I  IK   G ++RD  +H G+RT  +GD
Sbjct  180  KTIDGRGANVVIKGGAGLAMQFVNNIIIHGIRINKIKSMEGTMLRDLWNHVGIRTRCDGD  239

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             ++IFGSS++W+DH+S+ +C+DG+ID V+GST +TISNCH T H+ V+LFGA++    DK
Sbjct  240  AVSIFGSSNIWLDHLSLSECEDGLIDIVQGSTGITISNCHMTKHNDVMLFGASDTYAGDK  299

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFG+ L QRMPRCRWG  H++NNDYT+W MYA+GGS+  TI+SQGN
Sbjct  300  IMQVTVAFNHFGQGLIQRMPRCRWGFVHVINNDYTHWLMYAIGGSSEPTILSQGN  354



>gb|AAA16476.1| pectate lyase homolog [Zea mays]
 gb|AFW85884.1| hypothetical protein ZEAMMB73_308319 [Zea mays]
Length=438

 Score =   229 bits (585),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 135/175 (77%), Gaps = 1/175 (1%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I   A +TLQ  +N+I+ NL I + K  SGG++RDS  H GLRT  +GD
Sbjct  180  KTIDGRGAQVHIMF-AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGD  238

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G+++  SS+VWIDHVSM  C DG+ID V GSTA+T+SN HFTDH  V+LFGA+N  P D 
Sbjct  239  GVSVLSSSNVWIDHVSMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDA  298

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQ+TVAFNHFG+ L QRMPRCR+G FH+VNNDYT+W MYA+GG+   TIISQGN
Sbjct  299  VMQVTVAFNHFGRGLVQRMPRCRYGFFHVVNNDYTHWIMYAIGGNMNPTIISQGN  353



>ref|XP_002323835.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
 gb|EEF03968.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
Length=452

 Score =   229 bits (585),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG H+ IA GAG+T+QF +N+II  ++I +I  TSGG +RDSV H G+RT  +GD
Sbjct  193  KTIDGRGHHIHIAYGAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVEHYGIRTNSDGD  252

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDHVSM +C DG+IDA+ GSTA+TISN HFT H+  +L GA++    D+
Sbjct  253  GISIFGSSNIWIDHVSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAILLGASDSFSGDE  312

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  313  LMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRMYAIGGSKHPTIISQGN  367



>ref|XP_006656188.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=446

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KT+DGRGA VRI  GA +T+Q + N+II N+ + +I    GG++RDS  H G RT  +GD
Sbjct  187  KTVDGRGAQVRITNGAQVTVQNSNNVIIHNIHVHDIVLGKGGMIRDSPEHFGFRTQSDGD  246

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GITIFGS++VW+DH+S+  C DG+ID +  ST VTISNCH T+H+ V+LFG+++    D+
Sbjct  247  GITIFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFGSSDSFSEDQ  306

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQITVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  307  IMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGN  361



>ref|XP_010528323.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=458

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAG+T+QFA+N+II  L I +I  ++GG++RDSV H G+RT  +GD
Sbjct  197  KTIDARGANVHIAFGAGITIQFAQNVIIHGLHIHHIVTSNGGMIRDSVDHIGIRTQADGD  256

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++FGSS+VW+DH+SM +C DG+ID ++GSTA+TISNCHFT H+ V+L GA++    D 
Sbjct  257  GISVFGSSNVWLDHLSMSRCQDGLIDVIQGSTAITISNCHFTHHNDVILLGASDQFSGDS  316

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+T+A+NHFGK L QRMPRCRWG  H+VNNDYT+WEMYA+GGS   TI+SQGN
Sbjct  317  IMQVTIAYNHFGKGLVQRMPRCRWGFVHVVNNDYTHWEMYAIGGSQHPTILSQGN  371



>ref|XP_010933172.1| PREDICTED: probable pectate lyase 8 isoform X2 [Elaeis guineensis]
Length=426

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA GA +T+QF  NIII  L I + KPT   +VR S SH G RT  +GD
Sbjct  167  KTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  226

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G++IFGSSH+W+DH S+  C DG+IDA+ GSTA+TISN +FT H+KV+L G ++    DK
Sbjct  227  GVSIFGSSHIWVDHCSLSNCADGLIDAIMGSTAITISNNYFTHHNKVMLLGHSDSYKRDK  286

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+T+AFNHFG+ L QRMPRCR G FH+VNNDYT+WEMYA+GGSA  TI SQGN
Sbjct  287  AMQVTIAFNHFGEDLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGN  341



>ref|XP_011009454.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=474

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG HV I+ GAG+T+QF  N+II  ++I +I  TSGG +RDSV H G+RT  +GD
Sbjct  215  KTIDGRGHHVHISYGAGITIQFIHNVIIHGIRIHHIIATSGGNIRDSVDHYGIRTNSDGD  274

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+ VWIDHVSM +C DG+IDA+ GSTA+TISNCHFT H+  +L GA++    D 
Sbjct  275  GISIFGSTDVWIDHVSMSRCTDGLIDAIMGSTAITISNCHFTHHNDAILLGASDSYSGDH  334

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W +YA+GGS   TIISQGN
Sbjct  335  LMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRLYAIGGSKHPTIISQGN  389



>ref|XP_003609009.1| Pectate lyase [Medicago truncatula]
Length=445

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 138/186 (74%), Gaps = 11/186 (6%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V I+ GA +TLQ+ KNIII  L I + K TSGG +RDS+ H G R+  +GD
Sbjct  177  KTIDARGANVHISEGAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDGD  236

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHK-----------VLL  200
             I++FG+SHVWIDH+SM  C DG++DAV GSTA+TISNCH T H+            V+L
Sbjct  237  AISMFGASHVWIDHISMWNCADGLVDAVAGSTAITISNCHMTRHNDVINNISSTYSFVML  296

Query  199  FGANNWDPVDKVMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGST  20
            FGAN+    D++ QITVAFNHFGK L QRMPRCRWG FHIVNNDYT+W MYA+GGS   T
Sbjct  297  FGANDGFSGDQISQITVAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSTHPT  356

Query  19   IISQGN  2
            I+SQGN
Sbjct  357  ILSQGN  362



>gb|EYU46355.1| hypothetical protein MIMGU_mgv1a007094mg [Erythranthe guttata]
Length=419

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA GA +T+Q+  N+I+  L I + KPT   +VR S SH G RT  +GD
Sbjct  159  KTIDGRGANVHIANGACITIQYVTNVIVHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  218

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG+SHVWIDH S+  C DG+IDA+ GSTA+TISN +FT H++V+L G ++ +  DK
Sbjct  219  GISIFGASHVWIDHNSLSGCSDGLIDAIMGSTAITISNNYFTQHNEVMLLGHSDSNTRDK  278

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQ+TVA+NHFG+ L QRMPRCR G FH+VNNDYT WEMYA+GGSA  TI SQGN
Sbjct  279  VMQVTVAYNHFGEGLTQRMPRCRHGYFHVVNNDYTSWEMYAIGGSANPTINSQGN  333



>ref|XP_011005067.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=452

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG H+ IA GAG+T+QF +N+II  ++I +I  TSGG +RDSV H G+RT  +GD
Sbjct  193  KTIDGRGHHIHIAYGAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVGHYGIRTNSDGD  252

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGSS++WIDHVSM +C DG+IDA+ GSTA+TISN HFT H+  +L GA++    D+
Sbjct  253  GISIFGSSNIWIDHVSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAILLGASDSFSGDE  312

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W MYA+GGS   TI+SQGN
Sbjct  313  LMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRMYAIGGSKHPTIVSQGN  367



>ref|XP_006826355.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
 gb|ERM93592.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
Length=479

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KT+DGRGA+V IA GA +T+Q+ KN+II  L I + K  +GG++RDS  H G+RT  +GD
Sbjct  223  KTVDGRGANVHIAYGACITIQYVKNVIIHGLHIHDCKAGNGGMIRDSEDHFGIRTRSDGD  282

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GS++VW+DH ++ KC DG++DA+ GSTA+TISN HF+ H +VLL G ++  P+DK
Sbjct  283  GISIYGSTNVWVDHNTLSKCQDGLVDAIMGSTAITISNNHFSKHDEVLLLGGSDLYPMDK  342

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQ+TVAFNHFGK L QRMPRCR+G FH+VNNDYT+W  YA+GGS   TI+SQGN
Sbjct  343  VMQVTVAFNHFGKGLSQRMPRCRFGYFHVVNNDYTHWGKYAIGGSMNPTILSQGN  397



>ref|XP_010463548.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAG+T+Q+ KNIII  L + +I  +SGG++RDS+ H G R   +GD
Sbjct  212  KTIDARGANVHIAYGAGITMQYVKNIIIHGLHVHHIVTSSGGLIRDSIDHFGQRGQADGD  271

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG++ +W+DH+SM KC DG+IDA+ GSTA+TISN HFT H+ V+L GA + +  DK
Sbjct  272  GISIFGATDIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQDHNQDDK  331

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+TVA+NHFGK L QRMPR RWG  H+VNNDYT+WE+YA+GGS G TI+S GN
Sbjct  332  KMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGN  386



>emb|CDY45202.1| BnaA06g34060D [Brassica napus]
Length=459

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V I GGAGLTLQF KN+II N+ I++IK  +GG++RD   H G R+  +GD
Sbjct  194  KTIDGRGANVHIMGGAGLTLQFVKNVIIHNIHIKHIKCGAGGMIRDCEHHVGQRSKSDGD  253

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFG++++WIDHVSM  C DG+IDA+ GSTA+TISN H TDH++VLLFG  + D +DK
Sbjct  254  GINIFGATNIWIDHVSMTHCSDGMIDAIMGSTAITISNSHLTDHNEVLLFGGKDGDVIDK  313

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPR R+G+ H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  314  KMQITVAFNHFGKRLVQRMPRVRYGLVHVVNNDYTHWEMYAIGGNKNPTIISQGN  368



>ref|XP_010933171.1| PREDICTED: probable pectate lyase 8 isoform X1 [Elaeis guineensis]
Length=452

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA GA +T+QF  NIII  L I + KPT   +VR S SH G RT  +GD
Sbjct  193  KTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  252

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G++IFGSSH+W+DH S+  C DG+IDA+ GSTA+TISN +FT H+KV+L G ++    DK
Sbjct  253  GVSIFGSSHIWVDHCSLSNCADGLIDAIMGSTAITISNNYFTHHNKVMLLGHSDSYKRDK  312

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+T+AFNHFG+ L QRMPRCR G FH+VNNDYT+WEMYA+GGSA  TI SQGN
Sbjct  313  AMQVTIAFNHFGEDLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGN  367



>gb|EMS65801.1| hypothetical protein TRIUR3_32637 [Triticum urartu]
Length=273

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 134/175 (77%), Gaps = 1/175 (1%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I G A +TLQ  +++II N+ I +  P SGG++RDS  H G RT  +GD
Sbjct  15   KTIDGRGAQVHITG-AQMTLQGVRHVIIHNVHIHHSVPHSGGMIRDSKHHYGRRTRSDGD  73

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            G++I  SS VWIDHVSM  C DG+ID V GSTA+T+SN HFT H  V+LFGA+N +  D+
Sbjct  74   GVSILSSSSVWIDHVSMSSCADGLIDVVSGSTAITVSNSHFTKHDHVMLFGASNTEEQDR  133

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFGK L QRMPRCR+G F +VNNDYT+W+MYA+GG+   TIISQGN
Sbjct  134  MMQVTVAFNHFGKGLVQRMPRCRFGFFQVVNNDYTHWQMYAIGGNRDPTIISQGN  188



>ref|XP_009101245.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V I GGAGLTLQF KN+II N+ I++IK  +GG++RD   H G R+  +GD
Sbjct  194  KTIDGRGANVHIMGGAGLTLQFVKNVIIHNIHIKHIKCGAGGMIRDCEHHVGQRSKSDGD  253

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI IFG++++WIDHVSM  C DG+IDA+ GSTA+TISN H TDH++VLLFG  + D +DK
Sbjct  254  GINIFGATNIWIDHVSMTHCSDGMIDAIMGSTAITISNSHLTDHNEVLLFGGKDGDVIDK  313

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQITVAFNHFGKRL QRMPR R+G+ H+VNNDYT+WEMYA+GG+   TIISQGN
Sbjct  314  KMQITVAFNHFGKRLVQRMPRVRYGLVHVVNNDYTHWEMYAIGGNKNPTIISQGN  368



>sp|P40973.1|PLY_LILLO RecName: Full=Pectate lyase; Flags: Precursor [Lilium longiflorum]
 emb|CAA78976.1| pectate lyase [Lilium longiflorum]
 gb|AAA33398.1| pectate lyase [Lilium longiflorum]
Length=434

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V+IAGGA LT+QF  N+II  + I +IKP  GG++RDS  H G+RT  +GD
Sbjct  175  KTIDGRGANVQIAGGAQLTVQFVHNVIIHGIHIHDIKPGEGGLIRDSEKHSGIRTRSDGD  234

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I GSS++WIDHVS+ +C DG+ID + GSTA+TISNCH T+H  V+L GA++    D+
Sbjct  235  GISIIGSSNIWIDHVSLARCSDGLIDVILGSTAITISNCHLTEHDDVMLLGASDTYTQDE  294

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFG+ L QRMPRCR+G  H+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  295  IMQVTVAFNHFGRGLVQRMPRCRYGFVHVVNNDYTHWIMYAVGGSQHPTIISQGN  349



>gb|AAM60924.1| putative pectate lyase [Arabidopsis thaliana]
Length=475

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAG+T+Q+  NIII  L + +I  +SGG++RDS++H G R   +GD
Sbjct  214  KTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIVKSSGGLIRDSINHFGHRGEADGD  273

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG++++W+DH+SM KC DG+IDA+ GSTA+TISN HFT H+ V+L GA N +  DK
Sbjct  274  GISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDK  333

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+TVA+NHFGK L QRMPR RWG  H+VNNDYT+WE+YA+GGS G TI+S GN
Sbjct  334  KMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGN  388



>gb|AAQ62996.1| oil palm polygalacturonase allergen PEST361 [Elaeis guineensis]
Length=447

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA GA +T+QF  ++II  + I +I+P++GGI+RDS+ H G+RT  +GD
Sbjct  185  KTIDGRGANVHIAFGAQITIQFVHDVIIHGIHIHDIRPSNGGIIRDSLQHFGIRTKSDGD  244

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GSS +WIDH S++ C DG+IDA++ STA+TISNCHFT H+ VLLFGA++ +  D 
Sbjct  245  GISIYGSSDIWIDHCSLRNCADGLIDAIEASTAITISNCHFTHHNDVLLFGASDSNEHDS  304

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ TVAFNHFGK L QRMPRCRWG FH+VNNDYT W MYA+GGS   TIISQGN
Sbjct  305  MMQATVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTQWIMYAIGGSQHPTIISQGN  359



>ref|NP_186776.1| putative pectate lyase 7 [Arabidopsis thaliana]
 sp|Q9SRH4.1|PLY7_ARATH RecName: Full=Probable pectate lyase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF03499.1|AC010676_9 putative pectate lyase [Arabidopsis thaliana]
 gb|AAF26147.1|AC008261_4 putative pectate lyase [Arabidopsis thaliana]
 gb|ABI93918.1| At3g01270 [Arabidopsis thaliana]
 gb|AEE73631.1| putative pectate lyase 7 [Arabidopsis thaliana]
Length=475

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAG+T+Q+  NIII  L + +I  +SGG++RDS++H G R   +GD
Sbjct  214  KTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIVKSSGGLIRDSINHFGHRGEADGD  273

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG++++W+DH+SM KC DG+IDA+ GSTA+TISN HFT H+ V+L GA N +  DK
Sbjct  274  GISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDK  333

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+TVA+NHFGK L QRMPR RWG  H+VNNDYT+WE+YA+GGS G TI+S GN
Sbjct  334  KMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGN  388



>gb|AGT16685.1| pectate lyase precursor [Saccharum hybrid cultivar R570]
Length=326

 Score =   224 bits (571),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 133/175 (76%), Gaps = 1/175 (1%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I G A +TLQ   N+I+ NL I +  P  GG++RDS  H G+R   +GD
Sbjct  68   KTIDGRGAQVHITG-AQITLQNVHNVILHNLHIHDAVPRGGGVIRDSKHHSGVRGESDGD  126

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++ GSS +WIDHVSM+ C DG++D V GSTAVTISN HFT H  V+LFGA++    DK
Sbjct  127  GISVMGSSDIWIDHVSMRSCADGLVDVVDGSTAVTISNGHFTKHDHVMLFGASDSAVKDK  186

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFGK L QRMPRCR+G FH+VNNDYT+W MYA+GGS   TIISQGN
Sbjct  187  LMQVTVAFNHFGKGLVQRMPRCRYGFFHVVNNDYTHWLMYAIGGSQNPTIISQGN  241



>ref|XP_010915114.1| PREDICTED: LOW QUALITY PROTEIN: pectate lyase-like [Elaeis guineensis]
Length=444

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA GA +T+QF  ++II  + I +I+P++GGI+RDS+ H G+RT  +GD
Sbjct  185  KTIDGRGANVHIAFGAQITIQFVHDVIIHGIHIHDIRPSNGGIIRDSLQHFGIRTKSDGD  244

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GSS +WIDH S++ C DG+IDA++ STA+TISNCHFT H+ VLLFGA++ +  D 
Sbjct  245  GISIYGSSDIWIDHCSLRNCADGLIDAIEASTAITISNCHFTHHNDVLLFGASDSNEHDS  304

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ TVAFNHFGK L QRMPRCRWG FH+VNNDYT W MYA+GGS   TIISQGN
Sbjct  305  MMQATVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTQWIMYAIGGSQHPTIISQGN  359



>gb|AGT16687.1| pectate lyase [Saccharum hybrid cultivar R570]
Length=441

 Score =   227 bits (579),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 135/175 (77%), Gaps = 1/175 (1%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V I   A +TLQ   ++I+ NL I + K  SGG++RDS  H GLRT  +GD
Sbjct  183  KTIDGRGAQVHIVH-AQITLQNVHDVILHNLHIHDAKAHSGGMIRDSKRHTGLRTRSDGD  241

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++  SS+VWIDHVSM  C DG+ID V GSTA+T+SN HFT H  V+LFGA+N +P D+
Sbjct  242  GISVLSSSNVWIDHVSMSSCADGLIDVVNGSTAITVSNSHFTRHDHVMLFGASNDNPQDE  301

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQITVAFNHFG+ L QRMPRCR+G FH+VNNDYT+W MYA+GG+   TIISQGN
Sbjct  302  VMQITVAFNHFGRGLVQRMPRCRYGFFHVVNNDYTHWLMYAIGGNKNPTIISQGN  356



>ref|XP_002306040.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
 gb|EEE86551.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
Length=432

 Score =   227 bits (579),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG HV I+ G G+T+QF  N+II  ++I +I  TSGG +RDSV H G+RT  +GD
Sbjct  173  KTIDGRGHHVHISYGGGITIQFIHNVIIHGIRIHHIIATSGGNIRDSVDHYGIRTNSDGD  232

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+ VWIDHVSM +C DG+IDA+ GSTA+TISNCHFT H+  +L GA++    D 
Sbjct  233  GISIFGSTDVWIDHVSMSRCTDGLIDAIMGSTAITISNCHFTHHNDAILLGASDSYSGDH  292

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFNHFG+ L QRMPRCRWG FH+VNNDYT+W +YA+GGS   TIISQGN
Sbjct  293  LMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRLYAIGGSKHPTIISQGN  347



>ref|XP_009126031.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
Length=481

 Score =   228 bits (582),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA V IA GAG+T+QF +++II  L+I +I  ++GG++RDS  H G+RT  +GD
Sbjct  220  KTIDARGADVHIAHGAGITIQFVRHVIIHGLRIHHICQSNGGMIRDSTDHFGMRTKADGD  279

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+I+GSS +W+DH+SM KC DG+IDA+ GSTA+TISN HFT H+ V+L GA N +  DK
Sbjct  280  GISIYGSSMIWLDHISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNDNQGDK  339

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+TVA+NHFGK L QRMPR RWG  H+VNNDYT+WE+YA+GGS   TI+S GN
Sbjct  340  KMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQAPTILSHGN  394



>ref|XP_008789532.1| PREDICTED: probable pectate lyase 8 [Phoenix dactylifera]
Length=322

 Score =   224 bits (570),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA+V IA GA +T+QF  NIII  L I + KPT   +VR S SH G RT  +GD
Sbjct  125  KTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  184

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             ++IFGSSHVW+D  S+  C DG++DAV GSTA+TISN HFT H++V+L G ++    DK
Sbjct  185  AVSIFGSSHVWVDRCSLSNCADGLVDAVMGSTAITISNNHFTHHNEVMLLGHSDSYERDK  244

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+T+AFNHFG+ L QRMPRCR G FH+VNNDYT+WEMYA+GGSA  TI SQGN
Sbjct  245  GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGN  299



>ref|XP_009627245.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=440

 Score =   227 bits (579),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG  + IA GAG T+QF  N+II N++I +I  TSGG++RDS  H G+RT  +GD
Sbjct  178  KTIDGRGVSLHIAYGAGFTIQFVHNVIIHNIRIHHIISTSGGMIRDSGKHIGIRTVSDGD  237

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFGS+H+WIDH ++ +C DG+IDA+  STA+TISNC F  H+ V+L GA +  P D 
Sbjct  238  GISIFGSNHIWIDHCTLSQCTDGLIDAIMASTAITISNCKFNHHNDVMLLGATDAFPQDS  297

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+TVAFN FGK L QRMPRCRWG FH+VNNDY++W+MYA+GGSA  TIISQGN
Sbjct  298  IMQVTVAFNRFGKGLIQRMPRCRWGFFHVVNNDYSHWQMYAIGGSANPTIISQGN  352



>ref|XP_010513594.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   228 bits (581),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAG+T+Q+  NIII  L + +I  +SGG++RDS+ H G R   +GD
Sbjct  212  KTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIVSSSGGLIRDSIDHFGQRGQADGD  271

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG++++W+DH+SM KC DG+IDA+ GSTA+TISN HFT H+ V+L GA + +  DK
Sbjct  272  GISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQDHNQDDK  331

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+TVA+NHFGK L QRMPR RWG  H+VNNDYT+WE+YA+GGS G TI+S GN
Sbjct  332  KMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGN  386



>ref|XP_002437815.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
 gb|EER89182.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
Length=444

 Score =   227 bits (578),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 136/175 (78%), Gaps = 1/175 (1%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V + G A +TLQ   ++I+ NL I +    SGG++RDS  H G+RT  +GD
Sbjct  186  KTIDGRGAQVHVVG-AQVTLQSVHDVILHNLHIHDAVAHSGGMIRDSKRHTGMRTRSDGD  244

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++  SS+VWIDHVSM +C DG+ID V GSTA+T+SN HFT H  V+LFGA+N +P D+
Sbjct  245  GISVLSSSNVWIDHVSMSRCADGLIDVVNGSTAITVSNSHFTHHDHVMLFGASNDNPQDE  304

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQITVAFNHFG+ L QRMPRCR+G FH+VNNDYT+W MYA+GG+   TIISQGN
Sbjct  305  VMQITVAFNHFGRGLVQRMPRCRYGFFHVVNNDYTHWIMYAIGGNKNPTIISQGN  359



>dbj|BAF01663.1| pectate lyase like protein [Arabidopsis thaliana]
Length=274

 Score =   222 bits (565),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRG +V IA GA LT+Q+  NII+  + + + KPT   +VR S SH G R+  +GD
Sbjct  15   KTIDGRGVNVHIANGACLTIQYVTNIIVHGIHVHDCKPTGNAMVRSSPSHYGFRSMADGD  74

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
             I+IFGSSH+WIDH S+  C DG++DAV  STA+T+SN  FT H++V+L G ++    DK
Sbjct  75   AISIFGSSHIWIDHNSLSNCADGLVDAVMSSTAITVSNNFFTHHNEVMLLGHSDSYTRDK  134

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            VMQ+T+A+NHFG+ L QRMPRCR G FH+VNNDYT+WEMYA+GGSAG TI SQGN
Sbjct  135  VMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAGPTINSQGN  189



>ref|NP_001056784.1| Os06g0144900 [Oryza sativa Japonica Group]
 dbj|BAD68407.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAD68762.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAF18698.1| Os06g0144900 [Oryza sativa Japonica Group]
 gb|EAZ35811.1| hypothetical protein OsJ_20103 [Oryza sativa Japonica Group]
 dbj|BAG91996.1| unnamed protein product [Oryza sativa Japonica Group]
Length=448

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 134/175 (77%), Gaps = 1/175 (1%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTIDGRGA V + G A +T+Q   N+II NL I N  P SGG++RDS+ H G+R   +GD
Sbjct  190  KTIDGRGAQVHVTG-AQITVQAVSNVIIHNLHIHNSVPRSGGLIRDSMHHFGIRGESDGD  248

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI++ GSS++WIDHVSM  C DG+ID   GSTA+TISN HFT H  V+LFGA +  P DK
Sbjct  249  GISVMGSSNIWIDHVSMSNCSDGLIDITDGSTAITISNSHFTKHDHVMLFGARDDSPKDK  308

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
            +MQ+T+AFNHFGK L QRMPRCR+G FH+VNNDYT+W MYA+GG+   TIISQGN
Sbjct  309  IMQVTLAFNHFGKGLVQRMPRCRFGFFHMVNNDYTHWLMYAIGGNMNPTIISQGN  363



>ref|XP_010485518.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  526  KTIDGRGAHVRIAGGAGLTLQFAKNIIITNLKIRNIKPTSGGIVRDSVSHKGLRTFDEGD  347
            KTID RGA+V IA GAG+T+Q+  NIII  L + +I  +SGG++RDS+ H G R   +GD
Sbjct  212  KTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIVTSSGGLIRDSIDHFGQRGQADGD  271

Query  346  GITIFGSSHVWIDHVSMKKCDDGIIDAVKGSTAVTISNCHFTDHHKVLLFGANNWDPVDK  167
            GI+IFG++++W+DH+SM KC DG+IDA+ GSTA+TISN HFT H+ V+L GA + +  DK
Sbjct  272  GISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQDHNQDDK  331

Query  166  VMQITVAFNHFGKRLEQRMPRCRWGMFHIVNNDYTYWEMYALGGSAGSTIISQGN  2
             MQ+TVA+NHFGK L QRMPR RWG  H+VNNDYT+WE+YA+GGS G TI+S GN
Sbjct  332  KMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGN  386



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 529541835880