BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19683_g1_i1 len=731 path=[1517:0-730]

Length=731
                                                                      Score     E

ref|XP_011083094.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    298   3e-96   
ref|XP_004242381.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     298   3e-96   
ref|XP_009766488.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     296   2e-95   
ref|XP_009801786.1|  PREDICTED: GDSL esterase/lipase LTL1-like          295   3e-95   
ref|XP_009587010.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     295   5e-95   
ref|XP_009589092.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     295   6e-95   
emb|CDP03830.1|  unnamed protein product                                294   1e-94   
ref|XP_006352714.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     293   2e-94   
ref|XP_008370769.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     286   1e-91   
ref|XP_006443287.1|  hypothetical protein CICLE_v10020709mg             285   5e-91   
ref|XP_008350788.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     282   9e-91   
ref|XP_002522020.1|  zinc finger protein, putative                      283   1e-90   Ricinus communis
ref|XP_008388755.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     283   3e-90   
gb|KHG28666.1|  GDSL esterase/lipase LTL1 -like protein                 282   3e-90   
ref|XP_009764127.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    281   1e-89   
gb|KHN43144.1|  GDSL esterase/lipase                                    280   2e-89   
ref|XP_006350316.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     280   2e-89   
ref|XP_009631850.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     281   2e-89   
ref|XP_003521784.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     280   4e-89   
ref|XP_008218370.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     280   4e-89   
ref|XP_010243647.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     279   5e-89   
gb|ACU23610.1|  unknown                                                 279   6e-89   Glycine max [soybeans]
ref|XP_004247304.1|  PREDICTED: GDSL esterase/lipase At4g28780          279   6e-89   
ref|XP_004237503.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     279   7e-89   
gb|EPS69813.1|  hypothetical protein M569_04951                         278   1e-88   
ref|XP_010102187.1|  GDSL esterase/lipase                               278   2e-88   
ref|XP_007206865.1|  hypothetical protein PRUPE_ppb006257mg             278   2e-88   
ref|XP_009611210.1|  PREDICTED: GDSL esterase/lipase LTL1-like          278   3e-88   
ref|XP_003554731.1|  PREDICTED: GDSL esterase/lipase LTL1-like          278   3e-88   
ref|XP_002265999.1|  PREDICTED: GDSL esterase/lipase At4g28780          278   3e-88   Vitis vinifera
ref|XP_009591832.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     277   3e-88   
gb|EYU39534.1|  hypothetical protein MIMGU_mgv1a008648mg                277   3e-88   
ref|XP_007030304.1|  Li-tolerant lipase 1 isoform 1                     277   4e-88   
ref|XP_009348739.1|  PREDICTED: GDSL esterase/lipase LTL1-like          276   6e-88   
ref|XP_010263996.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     276   7e-88   
ref|XP_006340481.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     276   8e-88   
ref|XP_009379726.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     276   1e-87   
ref|XP_009777584.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    276   1e-87   
ref|XP_009769587.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     276   2e-87   
ref|XP_003555561.1|  PREDICTED: GDSL esterase/lipase At5g33370          275   3e-87   
ref|XP_002325360.1|  hypothetical protein POPTR_0019s04130g             275   3e-87   Populus trichocarpa [western balsam poplar]
ref|XP_003554732.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     275   4e-87   
gb|KHN43145.1|  GDSL esterase/lipase                                    274   5e-87   
gb|KHN04961.1|  GDSL esterase/lipase                                    273   7e-87   
ref|XP_011002016.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     274   7e-87   
ref|XP_004494760.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     274   7e-87   
ref|XP_006375868.1|  hypothetical protein POPTR_0013s04790g             274   8e-87   
ref|XP_002319125.1|  hypothetical protein POPTR_0013s04790g             273   1e-86   Populus trichocarpa [western balsam poplar]
gb|KHN35333.1|  GDSL esterase/lipase                                    273   1e-86   
ref|XP_011076887.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     273   2e-86   
gb|ABK95911.1|  unknown                                                 273   2e-86   Populus trichocarpa [western balsam poplar]
gb|KDP23751.1|  hypothetical protein JCGZ_23584                         272   3e-86   
gb|AFK40233.1|  unknown                                                 266   3e-86   
ref|XP_007147234.1|  hypothetical protein PHAVU_006G107200g             273   4e-86   
ref|XP_003521783.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     272   4e-86   
ref|XP_011038448.1|  PREDICTED: GDSL esterase/lipase At5g33370          272   4e-86   
ref|XP_002522021.1|  zinc finger protein, putative                      272   4e-86   Ricinus communis
ref|XP_007205392.1|  hypothetical protein PRUPE_ppa007427mg             272   4e-86   
ref|XP_010648948.1|  PREDICTED: GDSL esterase/lipase At5g33370          272   5e-86   
ref|XP_011038450.1|  PREDICTED: GDSL esterase/lipase LTL1-like          271   5e-86   
ref|XP_007143993.1|  hypothetical protein PHAVU_007G120000g             271   6e-86   
ref|XP_004292262.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     271   7e-86   
emb|CBI28652.3|  unnamed protein product                                271   7e-86   
gb|ACR33100.1|  putative tea geometrid larvae-inducible protein         271   7e-86   Camellia sinensis [black tea]
ref|XP_003535381.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     271   8e-86   
ref|XP_008218371.1|  PREDICTED: GDSL esterase/lipase LTL1-like          272   8e-86   
ref|XP_008441804.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     271   1e-85   
gb|EYU46367.1|  hypothetical protein MIMGU_mgv1a008634mg                271   1e-85   
ref|XP_002319124.2|  hypothetical protein POPTR_0013s04780g             272   1e-85   Populus trichocarpa [western balsam poplar]
ref|XP_011077073.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    271   1e-85   
ref|XP_011077072.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     270   2e-85   
ref|XP_011002018.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     270   2e-85   
gb|KHN35332.1|  GDSL esterase/lipase LTL1                               270   3e-85   
ref|XP_006340478.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     270   3e-85   
ref|XP_003521782.1|  PREDICTED: GDSL esterase/lipase LTL1-like is...    270   3e-85   
gb|EPS60817.1|  hypothetical protein M569_13984                         266   4e-85   
ref|XP_006577328.1|  PREDICTED: GDSL esterase/lipase LTL1-like is...    270   4e-85   
ref|XP_010043319.1|  PREDICTED: GDSL esterase/lipase LTL1-like          269   5e-85   
ref|XP_010024922.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     268   5e-85   
gb|KCW85323.1|  hypothetical protein EUGRSUZ_B02163                     269   5e-85   
gb|KCW61461.1|  hypothetical protein EUGRSUZ_H04197                     269   5e-85   
ref|XP_004152806.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     269   7e-85   
ref|XP_011002019.1|  PREDICTED: GDSL esterase/lipase LTL1-like          268   8e-85   
ref|XP_011084387.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     268   1e-84   
emb|CDP04255.1|  unnamed protein product                                268   1e-84   
ref|XP_006350943.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     268   1e-84   
ref|XP_003520948.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    268   1e-84   
ref|XP_007147233.1|  hypothetical protein PHAVU_006G107100g             268   1e-84   
gb|EPS67986.1|  hypothetical protein M569_06783                         267   2e-84   
ref|XP_009348738.1|  PREDICTED: GDSL esterase/lipase LTL1-like          268   2e-84   
ref|XP_004237506.1|  PREDICTED: GDSL esterase/lipase At5g33370          268   2e-84   
ref|XP_006371114.1|  hypothetical protein POPTR_0019s04150g             268   2e-84   
ref|NP_001237641.2|  uncharacterized LOC100500155 precursor             267   2e-84   
ref|XP_010558733.1|  PREDICTED: GDSL esterase/lipase LTL1               267   3e-84   
ref|XP_003626495.1|  GDSL esterase/lipase                               267   3e-84   
ref|XP_008370770.1|  PREDICTED: GDSL esterase/lipase LTL1-like          267   3e-84   
ref|XP_004513280.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     267   3e-84   
ref|XP_010069682.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     267   3e-84   
gb|KHG28665.1|  hypothetical protein F383_15485                         267   4e-84   
ref|XP_008388753.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     267   4e-84   
ref|XP_004302115.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     267   4e-84   
emb|CAN66351.1|  hypothetical protein VITISV_039098                     266   4e-84   Vitis vinifera
ref|XP_009379724.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     266   5e-84   
ref|XP_004155142.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     269   5e-84   
ref|XP_004302114.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     266   5e-84   
ref|XP_004173982.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     262   6e-84   
ref|XP_010438383.1|  PREDICTED: GDSL esterase/lipase At4g28780          266   7e-84   
ref|NP_198322.1|  GDSL esterase/lipase                                  266   7e-84   Arabidopsis thaliana [mouse-ear cress]
emb|CDO99962.1|  unnamed protein product                                266   1e-83   
gb|ACU23725.1|  unknown                                                 266   1e-83   Glycine max [soybeans]
ref|XP_003589465.1|  GDSL esterase/lipase                               266   1e-83   
ref|XP_002868396.1|  GDSL-motif lipase/hydrolase family protein         265   1e-83   
ref|XP_002325361.2|  hypothetical protein POPTR_0019s04140g             265   1e-83   Populus trichocarpa [western balsam poplar]
ref|XP_010530493.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    263   1e-83   
ref|XP_008382662.1|  PREDICTED: GDSL esterase/lipase At4g28780          265   2e-83   
emb|CBI28654.3|  unnamed protein product                                265   2e-83   
ref|XP_002268826.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     265   2e-83   Vitis vinifera
ref|XP_004494759.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     265   2e-83   
emb|CAN67727.1|  hypothetical protein VITISV_038832                     265   2e-83   Vitis vinifera
ref|XP_006403052.1|  hypothetical protein EUTSA_v10003456mg             265   2e-83   
ref|XP_007144437.1|  hypothetical protein PHAVU_007G156000g             265   2e-83   
gb|EYU33157.1|  hypothetical protein MIMGU_mgv1a008646mg                265   2e-83   
ref|XP_004249922.1|  PREDICTED: GDSL esterase/lipase At5g33370          265   2e-83   
ref|XP_009348740.1|  PREDICTED: GDSL esterase/lipase LTL1-like          265   2e-83   
ref|XP_002268296.2|  PREDICTED: GDSL esterase/lipase At5g33370          265   3e-83   Vitis vinifera
ref|XP_003626492.1|  GDSL esterase/lipase                               265   3e-83   
gb|KEH21597.1|  GDSL-like lipase/acylhydrolase                          264   3e-83   
gb|EPS65950.1|  hypothetical protein M569_08823                         263   4e-83   
gb|KHN14896.1|  GDSL esterase/lipase                                    264   5e-83   
gb|KDO52501.1|  hypothetical protein CISIN_1g017684mg                   261   5e-83   
ref|XP_010440676.1|  PREDICTED: GDSL esterase/lipase At5g33370 is...    263   7e-83   
ref|XP_010530492.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    263   8e-83   
ref|XP_010043320.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     263   8e-83   
ref|XP_011038584.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     257   1e-82   
gb|KDO52499.1|  hypothetical protein CISIN_1g017684mg                   262   1e-82   
ref|XP_008370782.1|  PREDICTED: GDSL esterase/lipase LTL1-like          263   1e-82   
ref|XP_009108075.1|  PREDICTED: GDSL esterase/lipase At5g33370          263   1e-82   
emb|CDY47551.1|  BnaA08g07360D                                          263   2e-82   
ref|XP_010447915.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     263   2e-82   
gb|KDO52498.1|  hypothetical protein CISIN_1g017684mg                   262   2e-82   
ref|XP_006437267.1|  hypothetical protein CICLE_v10033835mg             262   2e-82   
emb|CDY35219.1|  BnaA01g08120D                                          261   2e-82   
ref|XP_006484791.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     262   2e-82   
ref|XP_008345728.1|  PREDICTED: GDSL esterase/lipase LTL1-like          262   3e-82   
ref|XP_008443761.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    262   3e-82   
ref|XP_003536954.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     262   3e-82   
ref|XP_003543915.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     262   3e-82   
ref|XP_009129278.1|  PREDICTED: GDSL esterase/lipase At4g28780          262   3e-82   
ref|XP_006283981.1|  hypothetical protein CARUB_v10005104mg             262   3e-82   
ref|XP_003541357.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     262   3e-82   
ref|XP_010435380.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     262   3e-82   
ref|XP_006478980.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     262   4e-82   
gb|KHN05905.1|  GDSL esterase/lipase                                    262   4e-82   
emb|CDY12384.1|  BnaC08g08210D                                          261   4e-82   
ref|XP_003524731.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     262   4e-82   
gb|EYU19868.1|  hypothetical protein MIMGU_mgv1a008447mg                262   5e-82   
ref|XP_003554997.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     261   5e-82   
ref|XP_004142546.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     261   6e-82   
ref|XP_002325359.2|  hypothetical protein POPTR_0019s04110g             263   6e-82   Populus trichocarpa [western balsam poplar]
ref|XP_003553269.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     261   6e-82   
ref|XP_006443290.1|  hypothetical protein CICLE_v10020515mg             262   7e-82   
ref|XP_003542450.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     261   8e-82   
gb|KDO46628.1|  hypothetical protein CISIN_1g041652mg                   261   8e-82   
gb|KHN48972.1|  GDSL esterase/lipase                                    261   9e-82   
gb|KFK24279.1|  hypothetical protein AALP_AAs47157U000200               261   9e-82   
ref|XP_006283972.1|  hypothetical protein CARUB_v10005096mg             261   9e-82   
emb|CDY06871.1|  BnaC01g09700D                                          260   1e-81   
gb|EYU39770.1|  hypothetical protein MIMGU_mgv1a009318mg                259   1e-81   
ref|XP_002869473.1|  GDSL-motif lipase/hydrolase family protein         260   1e-81   
ref|XP_011002017.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     259   2e-81   
ref|XP_010674245.1|  PREDICTED: GDSL esterase/lipase At5g33370          259   3e-81   
ref|XP_004495557.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     259   3e-81   
ref|XP_007030301.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    259   3e-81   
gb|KHN14884.1|  GDSL esterase/lipase                                    259   3e-81   
ref|XP_011024535.1|  PREDICTED: GDSL esterase/lipase At4g28780          259   4e-81   
gb|ABX75139.1|  lipase                                                  259   4e-81   Gossypium hirsutum [American cotton]
ref|XP_004494758.1|  PREDICTED: GDSL esterase/lipase LTL1-like          259   4e-81   
gb|KHN14886.1|  GDSL esterase/lipase                                    259   4e-81   
gb|KHN41491.1|  GDSL esterase/lipase                                    259   5e-81   
ref|XP_003553249.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     259   5e-81   
ref|XP_010433162.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     258   7e-81   
ref|NP_194607.1|  GDSL esterase/lipase                                  258   7e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007151673.1|  hypothetical protein PHAVU_004G066300g             258   8e-81   
ref|XP_008235540.1|  PREDICTED: GDSL esterase/lipase At4g28780          258   1e-80   
ref|XP_007030303.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    258   1e-80   
ref|XP_003554733.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     258   1e-80   
ref|XP_002303095.1|  GDSL-motif lipase/hydrolase family protein         258   1e-80   Populus trichocarpa [western balsam poplar]
ref|XP_007151676.1|  hypothetical protein PHAVU_004G066600g             258   1e-80   
gb|ACU23670.1|  unknown                                                 258   1e-80   Glycine max [soybeans]
gb|KFK29417.1|  hypothetical protein AALP_AA7G132000                    258   2e-80   
ref|XP_003554996.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     258   2e-80   
ref|XP_006854343.1|  hypothetical protein AMTR_s00039p00143210          257   2e-80   
ref|XP_003553275.1|  PREDICTED: GDSL esterase/lipase At5g33370          257   4e-80   
ref|XP_004489545.1|  PREDICTED: GDSL esterase/lipase LTL1-like          256   4e-80   
ref|XP_008796408.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     256   6e-80   
ref|XP_006412910.1|  hypothetical protein EUTSA_v10025523mg             256   8e-80   
gb|ACU23289.1|  unknown                                                 256   1e-79   Glycine max [soybeans]
ref|XP_007133949.1|  hypothetical protein PHAVU_010G005800g             255   1e-79   
ref|XP_006443292.1|  hypothetical protein CICLE_v10020640mg             253   1e-79   
ref|XP_003521785.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     255   2e-79   
ref|XP_010940685.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     254   4e-79   
ref|XP_010528706.1|  PREDICTED: GDSL esterase/lipase LTL1-like          254   4e-79   
gb|ACU23502.1|  unknown                                                 254   5e-79   Glycine max [soybeans]
ref|XP_003626493.1|  GDSL esterase/lipase                               254   5e-79   
emb|CDX92063.1|  BnaC03g33650D                                          254   5e-79   
ref|XP_004495029.1|  PREDICTED: GDSL esterase/lipase At4g28780-li...    254   5e-79   
ref|XP_006387004.1|  hypothetical protein POPTR_2251s00200g             246   6e-79   
ref|XP_004495028.1|  PREDICTED: GDSL esterase/lipase At4g28780-li...    253   6e-79   
gb|KHN35335.1|  GDSL esterase/lipase                                    253   6e-79   
ref|XP_007151675.1|  hypothetical protein PHAVU_004G066500g             253   7e-79   
ref|XP_008364335.1|  PREDICTED: GDSL esterase/lipase LTL1-like          253   7e-79   
gb|EYU39533.1|  hypothetical protein MIMGU_mgv1a008571mg                253   7e-79   
ref|XP_008810810.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     253   7e-79   
ref|XP_002521156.1|  zinc finger protein, putative                      253   7e-79   Ricinus communis
gb|KGN66731.1|  hypothetical protein Csa_1G665920                       253   8e-79   
ref|XP_002522022.1|  zinc finger protein, putative                      253   8e-79   Ricinus communis
emb|CDY42916.1|  BnaC05g47350D                                          253   1e-78   
ref|NP_187079.1|  Li-tolerant lipase 1                                  253   1e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408203.1|  hypothetical protein EUTSA_v10020986mg             253   1e-78   
ref|XP_006443291.1|  hypothetical protein CICLE_v10020640mg             253   1e-78   
ref|XP_010413520.1|  PREDICTED: GDSL esterase/lipase LTL1               252   2e-78   
ref|XP_009124003.1|  PREDICTED: GDSL esterase/lipase LTL1-like          252   2e-78   
emb|CDY49349.1|  BnaA05g33110D                                          252   2e-78   
ref|XP_010463906.1|  PREDICTED: GDSL esterase/lipase LTL1               252   2e-78   
ref|XP_009134760.1|  PREDICTED: GDSL esterase/lipase LTL1               252   2e-78   
ref|XP_010485798.1|  PREDICTED: GDSL esterase/lipase LTL1-like          253   2e-78   
ref|XP_002884438.1|  Li-tolerant lipase 1                               252   3e-78   
ref|XP_007147237.1|  hypothetical protein PHAVU_006G107400g             252   3e-78   
ref|XP_007201335.1|  hypothetical protein PRUPE_ppa007652mg             251   3e-78   
gb|KEH42418.1|  GDSL-like lipase/acylhydrolase                          252   3e-78   
ref|XP_008345732.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     251   5e-78   
ref|XP_008789479.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     251   6e-78   
ref|XP_006297961.1|  hypothetical protein CARUB_v10014002mg             251   8e-78   
ref|XP_010936081.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     250   1e-77   
gb|KFK37853.1|  hypothetical protein AALP_AA3G037800                    250   2e-77   
emb|CDP04257.1|  unnamed protein product                                249   2e-77   
ref|XP_003533553.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     249   4e-77   
ref|XP_011084724.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     249   4e-77   
gb|AEY85024.1|  zinc finger protein                                     248   6e-77   
gb|KHN13664.1|  GDSL esterase/lipase                                    248   1e-76   
gb|KEH28987.1|  GDSL-like lipase/acylhydrolase                          248   1e-76   
ref|XP_009371058.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    247   1e-76   
ref|XP_003552505.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     248   1e-76   
ref|XP_003626500.1|  GDSL esterase/lipase                               245   2e-76   
ref|XP_010918935.1|  PREDICTED: GDSL esterase/lipase LTL1               246   3e-76   
ref|XP_008810066.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     246   5e-76   
ref|XP_009405750.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     246   5e-76   
ref|XP_007162645.1|  hypothetical protein PHAVU_001G168200g             246   7e-76   
ref|XP_010038336.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     245   1e-75   
ref|XP_003520622.2|  PREDICTED: GDSL esterase/lipase At4g28780-like     243   1e-75   
ref|XP_009389128.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     246   2e-75   
gb|AES82718.2|  GDSL-like lipase/acylhydrolase                          244   3e-75   
emb|CDX74196.1|  BnaA03g28510D                                          243   3e-75   
ref|XP_010684826.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     244   3e-75   
ref|NP_001241754.1|  anther-specific proline-rich protein APG pre...    244   4e-75   
ref|XP_004494761.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     244   4e-75   
gb|ACG37655.1|  anther-specific proline-rich protein APG                243   8e-75   Zea mays [maize]
gb|AFW58803.1|  hypothetical protein ZEAMMB73_832786                    241   8e-75   
ref|NP_001141295.1|  uncharacterized protein LOC100273386 precursor     243   8e-75   Zea mays [maize]
ref|XP_004976167.1|  PREDICTED: GDSL esterase/lipase LTL1-like          243   9e-75   
ref|XP_004489173.1|  PREDICTED: GDSL esterase/lipase LTL1-like          243   1e-74   
gb|EMT19317.1|  GDSL esterase/lipase                                    243   1e-74   
ref|XP_009385316.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     242   1e-74   
ref|NP_001132075.1|  uncharacterized protein LOC100193489 precursor     242   2e-74   Zea mays [maize]
ref|XP_003590909.1|  GDSL esterase/lipase                               242   2e-74   
ref|XP_003618755.1|  GDSL esterase/lipase                               241   3e-74   
ref|XP_003573228.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     241   7e-74   
ref|XP_004304788.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     240   8e-74   
gb|AAS75127.1|  GDSL-motif lipase                                       240   1e-73   Agave americana [century plant]
ref|NP_001053264.1|  Os04g0507700                                       240   1e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004953113.1|  PREDICTED: GDSL esterase/lipase LTL1-like          239   1e-73   
ref|XP_006652494.1|  PREDICTED: GDSL esterase/lipase LTL1-like          239   2e-73   
ref|XP_006660400.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     239   2e-73   
dbj|BAK06471.1|  predicted protein                                      239   2e-73   
ref|NP_001146251.1|  hypothetical protein precursor                     239   2e-73   Zea mays [maize]
ref|XP_006400391.1|  hypothetical protein EUTSA_v10013876mg             239   3e-73   
ref|XP_002446760.1|  hypothetical protein SORBIDRAFT_06g021990          239   4e-73   Sorghum bicolor [broomcorn]
ref|XP_009386573.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     238   7e-73   
ref|XP_006443680.1|  hypothetical protein CICLE_v10020728mg             238   7e-73   
ref|XP_008677149.1|  PREDICTED: uncharacterized protein LOC100280...    237   1e-72   
ref|XP_010524958.1|  PREDICTED: GDSL esterase/lipase At5g18430          237   2e-72   
dbj|BAK07334.1|  predicted protein                                      236   5e-72   
ref|XP_003574015.1|  PREDICTED: GDSL esterase/lipase LTL1               236   5e-72   
ref|XP_007139614.1|  hypothetical protein PHAVU_008G044500g             235   8e-72   
ref|NP_001047441.1|  Os02g0617400                                       235   9e-72   
gb|EAY86703.1|  hypothetical protein OsI_08086                          235   9e-72   
ref|XP_004982954.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     234   3e-71   
ref|XP_003580102.1|  PREDICTED: GDSL esterase/lipase LTL1               234   4e-71   
ref|NP_197344.2|  GDSL esterase/lipase                                  231   2e-70   
dbj|BAJ85303.1|  predicted protein                                      231   5e-70   
gb|EMT08293.1|  GDSL esterase/lipase LTL1                               231   5e-70   
gb|EMS62626.1|  GDSL esterase/lipase LTL1                               230   6e-70   
ref|XP_002873894.1|  predicted protein                                  229   9e-70   
ref|XP_009398857.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     229   1e-69   
ref|XP_006648840.1|  PREDICTED: GDSL esterase/lipase LTL1-like          225   2e-69   
ref|XP_004955275.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     230   3e-69   
emb|CDY02631.1|  BnaC02g08040D                                          228   4e-69   
gb|ACU15088.1|  unknown                                                 220   6e-69   
ref|XP_009126251.1|  PREDICTED: GDSL esterase/lipase At5g18430          228   7e-69   
ref|XP_010420599.1|  PREDICTED: GDSL esterase/lipase At5g18430          227   9e-69   
ref|XP_002467122.1|  hypothetical protein SORBIDRAFT_01g020000          227   1e-68   
gb|ACR37591.1|  unknown                                                 227   1e-68   
gb|EMS53263.1|  GDSL esterase/lipase LTL1                               227   1e-68   
gb|AFW63005.1|  hypothetical protein ZEAMMB73_059549                    228   1e-68   
gb|ACG46653.1|  anther-specific proline-rich protein APG precursor      227   2e-68   
ref|XP_003570388.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     226   2e-68   
gb|KFK26081.1|  hypothetical protein AALP_AA8G200400                    226   3e-68   
ref|NP_001136990.1|  uncharacterized protein LOC100217152               227   3e-68   
ref|XP_010492845.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     226   5e-68   
ref|XP_006287983.1|  hypothetical protein CARUB_v10001218mg             225   7e-68   
gb|EMT16609.1|  GDSL esterase/lipase                                    225   7e-68   
ref|NP_001048510.1|  Os02g0816200                                       224   2e-67   
ref|NP_001062538.1|  Os08g0565900                                       224   2e-67   
ref|XP_010454082.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     224   3e-67   
gb|EAY88013.1|  hypothetical protein OsI_09436                          224   3e-67   
emb|CCI55370.1|  PH01B035L11.15                                         224   5e-66   
dbj|BAJ90848.1|  predicted protein                                      220   6e-66   
gb|KCW61468.1|  hypothetical protein EUGRSUZ_H04205                     219   6e-66   
ref|XP_002454777.1|  hypothetical protein SORBIDRAFT_04g037130          220   9e-66   
ref|XP_008643799.1|  PREDICTED: anther-specific proline-rich prot...    218   4e-65   
dbj|BAJ91997.1|  predicted protein                                      218   6e-65   
ref|NP_001151440.1|  anther-specific proline-rich protein APG pre...    217   9e-65   
gb|AFW64010.1|  hypothetical protein ZEAMMB73_688590                    216   4e-64   
gb|EMT04884.1|  GDSL esterase/lipase                                    214   5e-64   
ref|XP_003589453.1|  GDSL esterase/lipase                               214   2e-63   
gb|ACG31868.1|  anther-specific proline-rich protein APG precursor      213   2e-63   
ref|XP_003590908.1|  GDSL esterase/lipase                               213   2e-63   
emb|CAK18853.1|  GDSL-motif lipase/acylhydrolase precursor              202   5e-62   
ref|XP_006661836.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     210   6e-62   
gb|ACR37768.1|  unknown                                                 211   8e-62   
ref|XP_002522024.1|  carboxylic ester hydrolase, putative               204   4e-61   
gb|EMT14508.1|  GDSL esterase/lipase                                    206   2e-60   
gb|EAY78821.1|  hypothetical protein OsI_33925                          204   3e-60   
ref|XP_003590911.1|  GDSL esterase/lipase                               199   4e-60   
gb|AAN05519.1|  putative early nodulin gene (Enod) related protein      204   1e-59   
ref|NP_001064786.1|  Os10g0463200                                       204   1e-59   
gb|AFK33691.1|  unknown                                                 195   3e-59   
ref|XP_002522023.1|  zinc finger protein, putative                      190   2e-54   
gb|ABK25359.1|  unknown                                                 189   3e-54   
gb|ABK22816.1|  unknown                                                 189   4e-54   
ref|XP_002445657.1|  hypothetical protein SORBIDRAFT_07g023530          180   3e-53   
gb|AES61162.2|  GDSL-like lipase/acylhydrolase superfamily protein      177   3e-52   
ref|XP_010556418.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     175   8e-52   
gb|ABR17593.1|  unknown                                                 177   1e-49   
gb|EMS49001.1|  Alpha-amylase isozyme 3A                                177   9e-48   
gb|EMT15536.1|  GDSL esterase/lipase LTL1                               162   2e-45   
ref|XP_011083095.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    164   5e-45   
ref|XP_002975076.1|  hypothetical protein SELMODRAFT_174517             165   6e-45   
gb|AFK49140.1|  unknown                                                 154   9e-44   
ref|XP_002988967.1|  hypothetical protein SELMODRAFT_129056             161   3e-43   
gb|ACU15165.1|  unknown                                                 152   6e-43   
ref|XP_002988963.1|  hypothetical protein SELMODRAFT_128933             158   2e-42   
ref|XP_002975075.1|  hypothetical protein SELMODRAFT_232422             157   2e-42   
ref|XP_002988966.1|  hypothetical protein SELMODRAFT_128884             155   2e-41   
gb|EMT05671.1|  GDSL esterase/lipase                                    150   7e-40   
ref|XP_006443286.1|  hypothetical protein CICLE_v10020709mg             147   1e-38   
ref|XP_006576592.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    137   8e-38   
ref|NP_001078631.1|  GDSL esterase/lipase                               142   2e-36   
ref|XP_007147235.1|  hypothetical protein PHAVU_006G1073001g            140   2e-36   
ref|XP_010440677.1|  PREDICTED: GDSL esterase/lipase At5g33370 is...    141   3e-36   
ref|XP_002983359.1|  hypothetical protein SELMODRAFT_118141             141   6e-36   
ref|XP_002960678.1|  hypothetical protein SELMODRAFT_403122             141   7e-36   
ref|XP_008443762.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    139   2e-35   
ref|XP_009777585.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    138   3e-35   
ref|XP_006658083.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     139   5e-35   
gb|ACR37466.1|  unknown                                                 130   7e-35   
gb|KDO52500.1|  hypothetical protein CISIN_1g017684mg                   137   8e-35   
ref|XP_004232068.1|  PREDICTED: GDSL esterase/lipase At2g23540          136   5e-34   
ref|XP_007147236.1|  hypothetical protein PHAVU_006G1073000g            128   7e-34   
ref|XP_009384395.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     135   1e-33   
ref|NP_001148291.1|  anther-specific proline-rich protein APG pre...    135   1e-33   
ref|XP_007204479.1|  hypothetical protein PRUPE_ppa021185mg             134   1e-33   
ref|XP_004300561.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     134   2e-33   
ref|XP_008796209.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     134   2e-33   
gb|EAZ05071.1|  hypothetical protein OsI_27261                          134   3e-33   
ref|XP_001765344.1|  predicted protein                                  133   3e-33   
gb|ABR18010.1|  unknown                                                 134   4e-33   
ref|XP_002968205.1|  hypothetical protein SELMODRAFT_89823              134   4e-33   
ref|XP_010938710.1|  PREDICTED: GDSL esterase/lipase At2g23540          133   5e-33   
ref|XP_006338241.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     133   9e-33   
ref|XP_008241574.1|  PREDICTED: GDSL esterase/lipase At2g23540          132   9e-33   
ref|XP_009411706.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     132   1e-32   
ref|XP_002862414.1|  predicted protein                                  129   1e-32   
ref|XP_011039251.1|  PREDICTED: GDSL esterase/lipase At2g23540          132   1e-32   
ref|XP_002976172.1|  hypothetical protein SELMODRAFT_104120             132   1e-32   
ref|XP_002463355.1|  hypothetical protein SORBIDRAFT_02g042280          132   1e-32   
gb|KHG07651.1|  hypothetical protein F383_34423                         132   2e-32   
ref|XP_001764401.1|  predicted protein                                  131   2e-32   
gb|KFK36130.1|  hypothetical protein AALP_AA4G081500                    131   3e-32   
ref|XP_002310763.2|  GDSL-motif lipase/hydrolase family protein         131   3e-32   
ref|XP_011085659.1|  PREDICTED: GDSL esterase/lipase At2g23540          131   3e-32   
ref|XP_004958621.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     131   3e-32   
ref|XP_006414376.1|  hypothetical protein EUTSA_v10027022mg             131   3e-32   
ref|XP_010088998.1|  GDSL esterase/lipase                               131   4e-32   
ref|XP_008339077.1|  PREDICTED: GDSL esterase/lipase At2g23540          131   5e-32   
ref|XP_004509186.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     130   5e-32   
ref|XP_003632456.1|  PREDICTED: GDSL esterase/lipase At2g23540          130   6e-32   
ref|XP_007154385.1|  hypothetical protein PHAVU_003G114800g             130   7e-32   
ref|XP_001753090.1|  predicted protein                                  130   7e-32   
emb|CDP02449.1|  unnamed protein product                                130   8e-32   
ref|XP_010548387.1|  PREDICTED: GDSL esterase/lipase At2g23540          130   9e-32   
ref|XP_007155978.1|  hypothetical protein PHAVU_003G248600g             130   1e-31   
ref|XP_009366174.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     130   1e-31   
ref|XP_007047126.1|  Ankyrin repeat-containing protein isoform 3        128   1e-31   
ref|XP_009600015.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     129   1e-31   
ref|XP_002870171.1|  hypothetical protein ARALYDRAFT_355138             129   2e-31   
dbj|BAK00337.1|  predicted protein                                      129   2e-31   
emb|CDX76857.1|  BnaC08g34430D                                          129   2e-31   
ref|XP_010680502.1|  PREDICTED: GDSL esterase/lipase At2g23540          129   2e-31   
ref|XP_009625485.1|  PREDICTED: GDSL esterase/lipase At2g23540          129   2e-31   
ref|XP_009117276.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     129   2e-31   
ref|XP_009757598.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     129   3e-31   
gb|KHG08353.1|  hypothetical protein F383_35589                         129   3e-31   
ref|XP_006366739.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     128   4e-31   
gb|KCW87974.1|  hypothetical protein EUGRSUZ_A00381                     127   4e-31   
ref|XP_010255082.1|  PREDICTED: GDSL esterase/lipase At2g23540          128   5e-31   
gb|KDP31854.1|  hypothetical protein JCGZ_12315                         128   5e-31   
gb|KCW50155.1|  hypothetical protein EUGRSUZ_K03589                     127   5e-31   
ref|XP_007047125.1|  Ankyrin repeat-containing protein isoform 2        128   6e-31   
ref|XP_007047124.1|  Ankyrin repeat-containing protein isoform 1        128   7e-31   
ref|XP_002967217.1|  hypothetical protein SELMODRAFT_87116              127   8e-31   
gb|KHN24864.1|  GDSL esterase/lipase                                    126   9e-31   
ref|XP_006294399.1|  hypothetical protein CARUB_v10023416mg             127   1e-30   
ref|XP_009793344.1|  PREDICTED: GDSL esterase/lipase At2g23540          127   1e-30   
ref|XP_010449833.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     127   1e-30   
ref|XP_010417101.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     127   1e-30   
ref|XP_003562492.1|  PREDICTED: GDSL esterase/lipase At2g23540          127   1e-30   
ref|XP_010065059.1|  PREDICTED: GDSL esterase/lipase At4g16230          127   1e-30   
emb|CAN75831.1|  hypothetical protein VITISV_039635                     126   2e-30   
ref|XP_010549002.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     126   2e-30   
ref|XP_006285255.1|  hypothetical protein CARUB_v10006620mg             126   2e-30   
ref|XP_003547357.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     126   2e-30   
gb|KEH20480.1|  GDSL-like lipase/acylhydrolase                          126   2e-30   
emb|CDY09704.1|  BnaC07g33570D                                          126   2e-30   
ref|XP_009136755.1|  PREDICTED: GDSL esterase/lipase At4g16230          126   2e-30   
ref|XP_009376483.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     126   2e-30   
ref|XP_001764592.1|  predicted protein                                  126   2e-30   
ref|XP_006586888.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     126   2e-30   
gb|KHN12863.1|  GDSL esterase/lipase                                    126   2e-30   
ref|XP_010440190.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     126   3e-30   
ref|XP_008457861.1|  PREDICTED: GDSL esterase/lipase At2g23540          126   3e-30   
gb|KDO79371.1|  hypothetical protein CISIN_1g017122mg                   126   3e-30   
ref|XP_010102184.1|  GDSL esterase/lipase                               122   3e-30   
ref|XP_002960505.1|  hypothetical protein SELMODRAFT_73430              125   3e-30   
ref|XP_010427992.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     126   3e-30   
ref|XP_006425807.1|  hypothetical protein CICLE_v10025863mg             125   3e-30   
ref|XP_010434862.1|  PREDICTED: GDSL esterase/lipase At4g16230          125   4e-30   
ref|XP_002519235.1|  zinc finger protein, putative                      125   4e-30   
sp|O23470.2|GDL64_ARATH  RecName: Full=GDSL esterase/lipase At4g1...    125   4e-30   
ref|XP_003594724.1|  GDSL esterase/lipase                               125   5e-30   
ref|XP_004148069.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     125   5e-30   
ref|XP_010070488.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     125   5e-30   
ref|XP_010471167.1|  PREDICTED: GDSL esterase/lipase At1g71691          125   5e-30   
gb|KGN62048.1|  hypothetical protein Csa_2G292780                       125   5e-30   
emb|CDX89578.1|  BnaC04g35970D                                          125   6e-30   
ref|XP_010429305.1|  PREDICTED: GDSL esterase/lipase At2g23540          125   6e-30   
ref|XP_010415867.1|  PREDICTED: GDSL esterase/lipase At1g71691          125   7e-30   
ref|XP_003518088.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     124   8e-30   
ref|XP_010472349.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     125   8e-30   
ref|NP_001240089.1|  uncharacterized protein LOC100795221 precursor     124   9e-30   
ref|XP_002878691.1|  GDSL-motif lipase/hydrolase family protein         124   1e-29   
emb|CBI22872.3|  unnamed protein product                                123   1e-29   
emb|CDY70134.1|  BnaCnng66890D                                          121   1e-29   
ref|XP_004508145.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     124   2e-29   
gb|AFW63007.1|  hypothetical protein ZEAMMB73_059549                    123   2e-29   
ref|XP_002972805.1|  hypothetical protein SELMODRAFT_232013             124   2e-29   
emb|CDO98755.1|  unnamed protein product                                124   2e-29   
ref|XP_003537385.1|  PREDICTED: GDSL esterase/lipase At2g23540 is...    124   2e-29   
ref|NP_179935.1|  GDSL esterase/lipase                                  124   2e-29   
ref|XP_004166340.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     121   2e-29   
ref|XP_009132408.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     124   2e-29   
ref|XP_010671752.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     123   2e-29   
emb|CDY38949.1|  BnaA04g13700D                                          123   2e-29   
ref|XP_006301319.1|  hypothetical protein CARUB_v10021728mg             123   2e-29   
ref|XP_009140469.1|  PREDICTED: GDSL esterase/lipase At2g23540          123   3e-29   
ref|XP_010028324.1|  PREDICTED: GDSL esterase/lipase At2g23540          123   3e-29   
gb|KHG10962.1|  hypothetical protein F383_14205                         123   3e-29   
ref|XP_010649507.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     123   3e-29   
ref|XP_010319008.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     123   3e-29   
gb|AFK33479.1|  unknown                                                 122   4e-29   
ref|XP_007147369.1|  hypothetical protein PHAVU_006G118500g             122   4e-29   
ref|XP_010265554.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     122   5e-29   
ref|XP_003569720.1|  PREDICTED: GDSL esterase/lipase At5g45670          122   5e-29   
emb|CDY43014.1|  BnaA03g11610D                                          122   6e-29   
ref|XP_010272684.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     122   7e-29   
ref|XP_011100822.1|  PREDICTED: GDSL esterase/lipase At4g16230          122   7e-29   
ref|XP_008223373.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     122   7e-29   
ref|XP_006404839.1|  hypothetical protein EUTSA_v10000195mg             122   7e-29   
gb|KHN36184.1|  GDSL esterase/lipase                                    122   8e-29   
emb|CDX68306.1|  BnaA07g23460D                                          122   9e-29   
emb|CDX90976.1|  BnaC02g06210D                                          122   9e-29   
ref|XP_002522360.1|  zinc finger protein, putative                      122   9e-29   
ref|XP_007035821.1|  GDSL esterase/lipase isoform 2                     122   9e-29   
ref|XP_010267929.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     122   1e-28   
ref|XP_006573614.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     122   1e-28   
emb|CDX96333.1|  BnaA07g29440D                                          121   1e-28   
gb|KFK32711.1|  hypothetical protein AALP_AA6G278700                    121   1e-28   
emb|CDY36687.1|  BnaCnng07890D                                          121   1e-28   
ref|XP_009361010.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     121   1e-28   
gb|EYU39392.1|  hypothetical protein MIMGU_mgv1a018005mg                121   1e-28   



>ref|XP_011083094.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Sesamum 
indicum]
Length=363

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+KILMRLY++GARRVLVTGTGPLGCVPA LA RS NG+CA+EPQ+AAAIFNPLL++
Sbjct  194  ISEYKKILMRLYDLGARRVLVTGTGPLGCVPAVLATRSRNGECAVEPQRAAAIFNPLLVQ  253

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LNQ++GS++FVAVNAM+MQNDFI NPQA+GF+TSK+ACCGQGPYNG+GLCT  SNL
Sbjct  254  MIGALNQEIGSNVFVAVNAMEMQNDFITNPQAFGFITSKVACCGQGPYNGLGLCTVLSNL  313

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHP+ERANR +V+ ILTG++KYM PMNLSTIM LDSK
Sbjct  314  CPNRDVYAFWDPFHPTERANRFIVRTILTGSDKYMYPMNLSTIMALDSK  362



>ref|XP_004242381.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum lycopersicum]
Length=361

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKILMRLY++GARRVLVTG+GPLGCVP+ LA RS+NG+CA EPQ+A+AIFNPLL++
Sbjct  193  ISEYRKILMRLYDLGARRVLVTGSGPLGCVPSSLASRSVNGECAEEPQKASAIFNPLLVQ  252

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LNQ+LGSDIFVA NAM+MQNDFI +PQA+GFVTSKIACCGQGPYNGIG+CT++SNL
Sbjct  253  MIQGLNQELGSDIFVAANAMEMQNDFIKDPQAFGFVTSKIACCGQGPYNGIGICTSSSNL  312

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDPFHPSERAN+++VQ + TG++KYM+PMNLSTIM +DS
Sbjct  313  CPNRDLYAFWDPFHPSERANKIIVQTLFTGSDKYMTPMNLSTIMAIDS  360



>ref|XP_009766488.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Nicotiana sylvestris]
Length=366

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +++YRKIL RL+++G RRVLVTGTGPLGCVPAELA RS NG+CA EPQQAAA FNPLL++
Sbjct  198  VTKYRKILKRLHDLGGRRVLVTGTGPLGCVPAELATRSSNGECAKEPQQAAAAFNPLLVQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LNQ+LGSDIFVAVNAM+MQNDFINNP+A+GFVTSKIACCGQGPYNGIGLCTAASNL
Sbjct  258  MIKRLNQELGSDIFVAVNAMEMQNDFINNPKAFGFVTSKIACCGQGPYNGIGLCTAASNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NR+EYAFWDPFHPSE+AN+++V+ I +G++KY++PMNLSTIM +DS
Sbjct  318  CPNREEYAFWDPFHPSEKANKIIVKTIYSGSDKYITPMNLSTIMAIDS  365



>ref|XP_009801786.1| PREDICTED: GDSL esterase/lipase LTL1-like [Nicotiana sylvestris]
Length=361

 Score =   295 bits (755),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKILMRLY++GARRVLVTG+GPLGCVP+ LA RS NG+CA EPQ+A+AIFNPLL+E
Sbjct  193  ISEYRKILMRLYDLGARRVLVTGSGPLGCVPSSLASRSTNGECAEEPQRASAIFNPLLVE  252

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LNQ+LGSD+FVA NA+ MQNDFI +PQA+GF+TSK+ACCGQGPYNG+G+CTAASNL
Sbjct  253  MILSLNQELGSDVFVAANAVDMQNDFIRDPQAFGFITSKVACCGQGPYNGVGICTAASNL  312

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDPFHP+ERAN+++VQ I TG++KYM+PMNLSTIM +DS
Sbjct  313  CPNRDLYAFWDPFHPTERANKIIVQTIFTGSDKYMTPMNLSTIMAIDS  360



>ref|XP_009587010.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Nicotiana tomentosiformis]
Length=367

 Score =   295 bits (755),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ++EYRKIL RL ++GARRVLVTGTGPLGCVPAELA RS NG CA EPQQAAA FNPLL++
Sbjct  199  VTEYRKILKRLDDLGARRVLVTGTGPLGCVPAELAMRSSNGDCAKEPQQAAAAFNPLLVQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LNQ+LGSDIFVAVNAM+MQNDFINNP+A+GFVTSKIACCGQGP+NGIGLCTAASNL
Sbjct  259  MIKRLNQELGSDIFVAVNAMEMQNDFINNPKAFGFVTSKIACCGQGPFNGIGLCTAASNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NR+EYAFWDPFHPSE+AN+++V+ I +G++KY++PMNLSTIM +DS
Sbjct  319  CPNREEYAFWDPFHPSEKANKIIVKTIYSGSDKYITPMNLSTIMAIDS  366



>ref|XP_009589092.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Nicotiana tomentosiformis]
Length=363

 Score =   295 bits (754),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKILMRLY++GARRVLVTG+GPLGCVP+ LA RS NG+CA EPQ+A+AIFNPLL++
Sbjct  195  ISEYRKILMRLYDLGARRVLVTGSGPLGCVPSSLASRSTNGECAEEPQRASAIFNPLLVQ  254

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LNQ+LGSDIFVA NA+ MQNDFI +PQA+GF+TSK+ACCGQGPYNG+G+CTAASNL
Sbjct  255  MIQSLNQELGSDIFVAANAVDMQNDFIRDPQAFGFITSKVACCGQGPYNGVGICTAASNL  314

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDPFHP+ERAN+++VQ I TG++KYM+PMNLSTIM +DS
Sbjct  315  CPNRDLYAFWDPFHPTERANKIIVQTIFTGSDKYMTPMNLSTIMAIDS  362



>emb|CDP03830.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL+RLYE+GARRVLVTGTGP+GCVP ELA RS NG+CA EPQQAAAIFNPLLI+
Sbjct  199  ISEYRKILLRLYELGARRVLVTGTGPIGCVPGELATRSRNGECAEEPQQAAAIFNPLLIQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LNQ LGS++FVAVNAMQMQ DFI +P+A+GFVTSK+ACCGQG +NG+GLCTAASNL
Sbjct  259  MIQGLNQDLGSNVFVAVNAMQMQYDFITSPRAFGFVTSKVACCGQGAFNGVGLCTAASNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C +R+ YAFWDPFHP+ERAN+++VQ I+TG++KYM+PMNLSTIM LDSK
Sbjct  319  CPDRNVYAFWDPFHPTERANKIIVQTIITGSDKYMTPMNLSTIMALDSK  367



>ref|XP_006352714.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum tuberosum]
Length=364

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKILMRLY++GARRVLVTG+GPLGCVP+ LA RS+NG+CA EPQ+A+AIFNPLL++
Sbjct  196  ISEYRKILMRLYDLGARRVLVTGSGPLGCVPSSLASRSVNGECAEEPQRASAIFNPLLVQ  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LNQ+LGS IFVA NAM+MQ +FI NPQA+GFVTSKIACCGQGPYNGIG+CTA+SNL
Sbjct  256  MIQGLNQELGSHIFVAANAMEMQTNFITNPQAFGFVTSKIACCGQGPYNGIGICTASSNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDPFHPSERAN+++VQ + TG++KYM+PMNLSTIM +DS
Sbjct  316  CPNRDLYAFWDPFHPSERANKIIVQTLFTGSDKYMTPMNLSTIMAIDS  363



>ref|XP_008370769.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
 ref|XP_008345729.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
Length=362

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLYE+GAR+VLVTGTGPLGCVPAELAQ S NG+CA+E Q+AA++FNP L++
Sbjct  193  ISEYRKVLERLYELGARKVLVTGTGPLGCVPAELAQHSTNGECAVELQRAASLFNPQLVD  252

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN Q GSD FVA NA +M  DF+++PQAYGFVTSKIACCGQGPYNGIGLCT ASNL
Sbjct  253  MINSLNSQFGSDAFVAANAYEMHMDFVSDPQAYGFVTSKIACCGQGPYNGIGLCTFASNL  312

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSE+ANR++VQ ILTG+NKYM+PMNLSTI+ LD+K
Sbjct  313  CPNRDLYAFWDPFHPSEKANRIIVQQILTGSNKYMNPMNLSTILALDTK  361



>ref|XP_006443287.1| hypothetical protein CICLE_v10020709mg [Citrus clementina]
 ref|XP_006478978.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Citrus sinensis]
 gb|ESR56527.1| hypothetical protein CICLE_v10020709mg [Citrus clementina]
 gb|KDO52496.1| hypothetical protein CISIN_1g017552mg [Citrus sinensis]
Length=369

 Score =   285 bits (728),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL R+YE+GARRVLVTGTGPLGCVPAELAQR +NG+C++E Q+AA +FNP L++
Sbjct  200  ISEYRKILARIYELGARRVLVTGTGPLGCVPAELAQRGVNGECSVELQRAADLFNPQLVQ  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ +LN Q+GSD+FVA NA  M  DFI++PQAYGFVTSKIACCGQGPYNGIGLCT ASNL
Sbjct  260  MLNELNSQIGSDVFVAANAFAMHMDFIHDPQAYGFVTSKIACCGQGPYNGIGLCTIASNL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSE+ANR++VQ I +G++KYM+PMNLSTIM LDS+
Sbjct  320  CPNRDLYAFWDPFHPSEKANRIIVQRIASGSSKYMNPMNLSTIMALDSR  368



>ref|XP_008350788.1| PREDICTED: GDSL esterase/lipase At5g33370-like, partial [Malus 
domestica]
Length=319

 Score =   282 bits (722),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLYE+GAR+VLVTGTGPLGC PAELAQRS  G+CA+E Q+AA++FNP L++
Sbjct  150  ISEYRKVLARLYELGARKVLVTGTGPLGCAPAELAQRSRRGECAVELQRAASLFNPQLVD  209

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN Q+GSD+FVA NA QM  DFI+NPQAYGFVTSKIACCGQGPYNGIGLCT ASNL
Sbjct  210  MINSLNGQIGSDVFVAANAFQMHMDFISNPQAYGFVTSKIACCGQGPYNGIGLCTIASNL  269

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSE+A+R++ Q ILTG+NKYM+PMNLSTI+ LDSK
Sbjct  270  CPNRDLYAFWDAFHPSEKASRIIAQQILTGSNKYMNPMNLSTILALDSK  318



>ref|XP_002522020.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40424.1| zinc finger protein, putative [Ricinus communis]
Length=364

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L+R+YE+GARRVLVTGTGPLGCVPAELA RS NG+C++E Q+AA +FNP L++
Sbjct  195  ISEYRKVLLRVYELGARRVLVTGTGPLGCVPAELAMRSRNGECSVELQRAAGLFNPQLVQ  254

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI ++N Q+GSD+FVA NA QM  DFI++PQAYGFVTSKIACCGQGPYNGIGLCT ASNL
Sbjct  255  MINEVNNQIGSDVFVAANAYQMNMDFISDPQAYGFVTSKIACCGQGPYNGIGLCTIASNL  314

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSERANR++V+ IL G++KYM+PMNLSTIM LDS+
Sbjct  315  CPNRDIYAFWDPFHPSERANRIIVRQILIGSSKYMNPMNLSTIMELDSR  363



>ref|XP_008388755.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
Length=362

 Score =   283 bits (723),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLYE+GAR+VLVTGTGPLGC PAELAQRS  G+CA+E Q+AA++FNP L++
Sbjct  193  ISEYRKVLARLYELGARKVLVTGTGPLGCAPAELAQRSRRGECAVELQRAASLFNPQLVD  252

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN Q+GSD+FVA NA QM  DFI+NPQAYGFVTSKIACCGQGPYNGIGLCT ASNL
Sbjct  253  MINSLNGQIGSDVFVAANAFQMHMDFISNPQAYGFVTSKIACCGQGPYNGIGLCTIASNL  312

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSE+A+R++ Q ILTG+NKYM+PMNLSTI+ LDSK
Sbjct  313  CPNRDLYAFWDAFHPSEKASRIIAQQILTGSNKYMNPMNLSTILALDSK  361



>gb|KHG28666.1| GDSL esterase/lipase LTL1 -like protein [Gossypium arboreum]
Length=365

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL+RLYE+GARRVLVTGTGPLGCVPAELAQ S  G+CA+E Q+A+A+FNP L E
Sbjct  196  ISEYRKILLRLYELGARRVLVTGTGPLGCVPAELAQHSRAGECAIELQRASALFNPQLAE  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M++ LN +LG+DIFVAVN  +M  D+INNPQ +GFVTSK+ACCGQGPYNGIGLCT ASNL
Sbjct  256  MLSGLNNELGADIFVAVNTNEMHMDWINNPQQFGFVTSKVACCGQGPYNGIGLCTIASNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSERANRL+VQ I+TG+ KYM PMNLSTIM LDS+
Sbjct  316  CLNRDIYAFWDPFHPSERANRLIVQQIITGSTKYMHPMNLSTIMELDSR  364



>ref|XP_009764127.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009764128.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X2 [Nicotiana 
sylvestris]
Length=378

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKILMR+Y++GARRVLVTGTGPLGCVPAELAQRS NG+CA+E QQAAA+FNP L +
Sbjct  209  ISEYRKILMRVYDLGARRVLVTGTGPLGCVPAELAQRSRNGECAVELQQAAALFNPQLTQ  268

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ DLN +LGS+IF+A N  QM  DFI NPQAYGF+TSK+ACCGQGPYNG+GLCT  SNL
Sbjct  269  MLQDLNSELGSNIFIAANTQQMHIDFITNPQAYGFITSKVACCGQGPYNGLGLCTPLSNL  328

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD +AFWDPFHPSERAN+++VQ I+TG+++YM+PMNLSTI+ +DS
Sbjct  329  CPNRDVFAFWDPFHPSERANKIIVQQIMTGSSEYMNPMNLSTILAMDS  376



>gb|KHN43144.1| GDSL esterase/lipase [Glycine soja]
Length=363

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLYE+GARRVLVTGTGPLGCVPAELAQRS NG C+ E Q+AAA+FNP L++
Sbjct  194  ISEYKKVLRRLYEIGARRVLVTGTGPLGCVPAELAQRSTNGDCSAELQRAAALFNPQLVQ  253

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +I  LN ++GS++FV VN  QM  DFI+NPQ YGFVTSK+ACCGQGPYNG+GLCT ASNL
Sbjct  254  IIQQLNSEIGSNVFVGVNTQQMHIDFISNPQRYGFVTSKVACCGQGPYNGLGLCTPASNL  313

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSERANRL+VQ IL+GT++YM PMNLSTIM LDSK
Sbjct  314  CPNRDIYAFWDPFHPSERANRLIVQQILSGTSEYMYPMNLSTIMALDSK  362



>ref|XP_006350316.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Solanum tuberosum]
Length=363

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I+EY KIL RL+++GARRVLVTGTGPLGCVPAELA  S NG+CA E QQA+ IFNPLL++
Sbjct  195  ITEYSKILTRLHDLGARRVLVTGTGPLGCVPAELALWSSNGECANELQQASKIFNPLLVQ  254

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M   LNQQL SDIFVAVNAM++QNDFI+ P+ +GFVTSKIACCGQGPYNG+GLCT ASNL
Sbjct  255  MTTRLNQQLSSDIFVAVNAMELQNDFIDKPKEFGFVTSKIACCGQGPYNGLGLCTTASNL  314

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRDEYAFWD FHP+E+AN+++V+ I TG+NKYMSPMNLSTIM +DS
Sbjct  315  CTNRDEYAFWDAFHPTEKANKIIVKTIFTGSNKYMSPMNLSTIMEIDS  362



>ref|XP_009631850.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nicotiana tomentosiformis]
Length=380

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKILMRLY +GARRVLVTGTGPLGCVPAELAQRS NG+CA+E Q+AAA+FNP L +
Sbjct  211  ISEYRKILMRLYNLGARRVLVTGTGPLGCVPAELAQRSRNGECAIELQRAAALFNPQLTQ  270

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ +LN QLGS+IF+A N  QM  DFI NPQAYGF+TSK+ACCGQGPYNG+GLCT  SNL
Sbjct  271  MLQNLNSQLGSNIFIAANTQQMHTDFITNPQAYGFITSKVACCGQGPYNGLGLCTPLSNL  330

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD +AFWDPFHPSERAN+++VQ I+TG+++YM+PMNLSTI+ +DS
Sbjct  331  CPNRDLFAFWDPFHPSERANKIIVQQIMTGSSEYMNPMNLSTILAMDS  378



>ref|XP_003521784.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
 gb|KHN35334.1| GDSL esterase/lipase [Glycine soja]
Length=365

 Score =   280 bits (715),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLYE+GARRVLVTGTGPLGCVPAELAQRS NG C+ E QQAAA+FNP L++
Sbjct  195  ISEYKKVLRRLYEIGARRVLVTGTGPLGCVPAELAQRSTNGDCSAELQQAAALFNPQLVQ  254

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +I  LN ++GS++FV VN  QM  DFI+NPQ YGFVTSK+ACCGQGPYNG+GLCT ASNL
Sbjct  255  IIRQLNSEIGSNVFVGVNTQQMHIDFISNPQRYGFVTSKVACCGQGPYNGLGLCTPASNL  314

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWDPFHP+ERANR++VQ IL+GT++YM PMNLSTIM LDS +
Sbjct  315  CPNRDSYAFWDPFHPTERANRIIVQQILSGTSEYMYPMNLSTIMALDSSK  364



>ref|XP_008218370.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Prunus mume]
Length=363

 Score =   280 bits (715),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLYE+GARRVLVTGTGPLGCVPAELAQ S  G+C++E ++AA++FNP L++
Sbjct  194  ISEYRKVLARLYELGARRVLVTGTGPLGCVPAELAQHSRAGECSVELERAASLFNPQLVQ  253

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN Q+GSD+FVA NA +M  DFI +PQAYGFVTSKIACCGQGPYNGIGLCT  SNL
Sbjct  254  MINGLNSQIGSDVFVAANAYEMHMDFIADPQAYGFVTSKIACCGQGPYNGIGLCTVVSNL  313

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSE+ANR++ Q ILTG+NKYM+PMNLSTI+ LDS+
Sbjct  314  CPNRDLYAFWDPFHPSEKANRIIAQQILTGSNKYMNPMNLSTILALDSR  362



>ref|XP_010243647.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nelumbo nucifera]
Length=368

 Score =   279 bits (714),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+KILMR+YE+GARRVLVTGTGPLGCVPAELA  S+NG+CA+E Q+AAA+FNP L +
Sbjct  197  ISEYKKILMRVYELGARRVLVTGTGPLGCVPAELALHSVNGECAIELQRAAALFNPQLAQ  256

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
             I +LN ++GSD+FVA N  +M  DF++NPQAYGFVTSKIACCGQGPYNGIGLCT+ASNL
Sbjct  257  TINELNSEIGSDVFVAANTNRMTMDFVSNPQAYGFVTSKIACCGQGPYNGIGLCTSASNL  316

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDPFHPSERANR++VQ IL G+N YM PMNLSTIM +D+
Sbjct  317  CPNRDVYAFWDPFHPSERANRIIVQQILAGSNDYMHPMNLSTIMAVDA  364



>gb|ACU23610.1| unknown [Glycine max]
Length=363

 Score =   279 bits (714),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLYE+GARRVLVTGTGPLGCVPAELAQRS NG C+ E Q+AAA+FNP L++
Sbjct  194  ISEYKKVLRRLYEIGARRVLVTGTGPLGCVPAELAQRSTNGDCSAELQRAAALFNPQLVQ  253

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +I  LN ++GS++FV VN  QM  DFI+NPQ YGFVTSK+ACCGQGPYNG+GLCT ASNL
Sbjct  254  IIQQLNSEIGSNVFVGVNTQQMHIDFISNPQRYGFVTSKVACCGQGPYNGLGLCTPASNL  313

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSERANRL+VQ IL+GT++YM PMN STIM LDSK
Sbjct  314  CPNRDIYAFWDPFHPSERANRLIVQQILSGTSEYMYPMNFSTIMALDSK  362



>ref|XP_004247304.1| PREDICTED: GDSL esterase/lipase At4g28780 [Solanum lycopersicum]
Length=367

 Score =   279 bits (714),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I+EY KIL RL+++GARRVLVTGTGPLGCVPAELA  S NG+CA E QQA  IFNPLLI+
Sbjct  199  INEYSKILTRLHDLGARRVLVTGTGPLGCVPAELALWSSNGECANELQQATKIFNPLLIQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LNQQL SDIFVAVNAM++QNDFIN P+ +GFVTSKIACCGQGPYNG+GLCT ASNL
Sbjct  259  MVTRLNQQLSSDIFVAVNAMELQNDFINKPKEFGFVTSKIACCGQGPYNGLGLCTTASNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRDEYAFWD FHP+E+AN+++V+ I TG+++YMSPMNLSTIM +DS
Sbjct  319  CTNRDEYAFWDAFHPTEKANKIIVKTIFTGSDEYMSPMNLSTIMEIDS  366



>ref|XP_004237503.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum lycopersicum]
Length=367

 Score =   279 bits (713),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL +LY++G RRVLVTGTGP+GCVPAELAQRS +G+C++E Q+AAA+FNP L +
Sbjct  198  ISEYRKILQKLYDLGGRRVLVTGTGPIGCVPAELAQRSRSGECSVELQRAAALFNPQLTQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ADLN Q+G+++F+A N   M  DF++NPQAYGFVTSKIACCGQGPYNGIGLCT  SNL
Sbjct  258  MLADLNSQIGANVFIAANTYTMNMDFVSNPQAYGFVTSKIACCGQGPYNGIGLCTPLSNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSERANR++VQ ILTG+++YMSPMNLSTIM LDS+
Sbjct  318  CPNRDIYAFWDPFHPSERANRIIVQQILTGSSQYMSPMNLSTIMALDSR  366



>gb|EPS69813.1| hypothetical protein M569_04951, partial [Genlisea aurea]
Length=337

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L  LY++GARRVLVTGTGPLGCVP++LA +SINGQCA EPQ+AAA+FNPLL++
Sbjct  170  ISEYRKVLSTLYDLGARRVLVTGTGPLGCVPSQLATQSINGQCAQEPQRAAALFNPLLLQ  229

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+++LN +LGSD+F+A NA Q   DF+ +PQA+GFVTSK+ACCGQGPYNG+GLC + SN+
Sbjct  230  MVSELNGELGSDVFIASNANQQHGDFVKDPQAFGFVTSKVACCGQGPYNGVGLCRSTSNI  289

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            CANRDEYAFWDPFHP+ERANR++VQ +LTG+ +YM PMNLSTI+ +D+
Sbjct  290  CANRDEYAFWDPFHPTERANRIIVQGLLTGSQEYMFPMNLSTIIAMDA  337



>ref|XP_010102187.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB93130.1| GDSL esterase/lipase [Morus notabilis]
Length=367

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLYE+GARRVLVTGTGPLGCVPAELA RS NGQCA+E Q+AA +FNP L++
Sbjct  198  ISEYQKVLARLYELGARRVLVTGTGPLGCVPAELAMRSPNGQCAVELQRAAGLFNPQLVQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN  +GSD+FVA NA +M  DFI+NPQAYGFVTSK+ACCGQGPYNG+GLCT ASNL
Sbjct  258  MINRLNSDIGSDVFVAANAFEMHMDFISNPQAYGFVTSKVACCGQGPYNGLGLCTIASNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSERANR++V+ IL G +KYM PMNLSTIM LDS+
Sbjct  318  CPNRDIYAFWDAFHPSERANRIIVRNILEGDSKYMHPMNLSTIMALDSR  366



>ref|XP_007206865.1| hypothetical protein PRUPE_ppb006257mg [Prunus persica]
 gb|EMJ08064.1| hypothetical protein PRUPE_ppb006257mg [Prunus persica]
Length=363

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLYE+GARRVLVTGTGPLGCVPAELAQ S  G+C++E ++AA++FNP L++
Sbjct  194  ISEYRKVLARLYELGARRVLVTGTGPLGCVPAELAQHSRAGECSVELERAASLFNPQLVQ  253

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN QLGSD+FVA NA +M  DFI+NP+AYGFVTSKIACCGQGPYNGIGLCT  SNL
Sbjct  254  MINGLNSQLGSDVFVAANAYEMHMDFISNPRAYGFVTSKIACCGQGPYNGIGLCTMVSNL  313

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSE+ANR++ Q ILTG+NKYM+PMNLSTI+ LDS+
Sbjct  314  CPNRDLYAFWDAFHPSEKANRIIAQQILTGSNKYMNPMNLSTILALDSR  362



>ref|XP_009611210.1| PREDICTED: GDSL esterase/lipase LTL1-like [Nicotiana tomentosiformis]
Length=369

 Score =   278 bits (710),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL +LYE+GARRVLVTGTGP+GCVPAELAQRS  G+CA+E Q+AA++FNP L +
Sbjct  200  ISEYRKILQKLYELGARRVLVTGTGPMGCVPAELAQRSPTGECAVELQRAASLFNPQLTQ  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +++DLN QL +D+FVA N   M  DF++NPQAYGFVTSKIACCGQGPYNGIGLCT  SNL
Sbjct  260  LLSDLNSQLAADVFVAANTYAMHMDFVSNPQAYGFVTSKIACCGQGPYNGIGLCTPLSNL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSE+ANR++VQ ILTG++ YM+PMNLS+IM LDS+
Sbjct  320  CPNRDLYAFWDPFHPSEKANRIIVQQILTGSSTYMNPMNLSSIMALDSR  368



>ref|XP_003554731.1| PREDICTED: GDSL esterase/lipase LTL1-like [Glycine max]
 gb|KHN43146.1| GDSL esterase/lipase LTL1 [Glycine soja]
Length=376

 Score =   278 bits (710),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL+RLYE+GARRVLVTGTGPLGCVPAELAQRS NG+CA E QQA+A+FNP L++
Sbjct  205  ISEYRKILVRLYELGARRVLVTGTGPLGCVPAELAQRSRNGECAAELQQASALFNPQLVQ  264

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++  LN ++GSD+F++ NA Q   DFI+NPQAYGF+TSK+ACCGQGPYNGIGLCT ASNL
Sbjct  265  LVNQLNSEIGSDVFISANAFQSNMDFISNPQAYGFITSKVACCGQGPYNGIGLCTPASNL  324

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDPFHPSERANRL+V   + G +KYM PMNLST+++LDS
Sbjct  325  CPNRDVYAFWDPFHPSERANRLIVDTFMIGDSKYMHPMNLSTMLLLDS  372



>ref|XP_002265999.1| PREDICTED: GDSL esterase/lipase At4g28780 [Vitis vinifera]
 emb|CBI37236.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   278 bits (710),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKILM+LYE+GARRVLVTGTGPLGCVPAELA    NGQCA EPQ+AAAIFNP LIE
Sbjct  198  ISEYRKILMKLYELGARRVLVTGTGPLGCVPAELAMSRSNGQCAEEPQRAAAIFNPQLIE  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M   LN +LGS+IF+  NA +M  DFI +PQ YGFVTSK+ACCGQGPYNG+G CT ASNL
Sbjct  258  MAQGLNSELGSNIFITANAFEMHMDFITDPQLYGFVTSKVACCGQGPYNGLGFCTLASNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ YAFWDP+HP+ERANRL+VQ I++G++KYM+PMNLSTIM +DS+
Sbjct  318  CPNRNIYAFWDPYHPTERANRLIVQQIMSGSSKYMNPMNLSTIMEMDSR  366



>ref|XP_009591832.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nicotiana tomentosiformis]
Length=370

 Score =   277 bits (709),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L +LY +GARRV+VTGTGPLGCVPAELAQRS +G CA E Q+AA++FNP L+E
Sbjct  201  ISEYKKVLAKLYSLGARRVIVTGTGPLGCVPAELAQRSQDGNCAAELQEAASLFNPQLVE  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN ++GS +F+A N  QM  DF+ NPQA+GFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  261  MLNGLNSEIGSHVFIAANTNQMHLDFVTNPQAFGFVTSKVACCGQGPYNGIGLCTPLSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRDEYAFWDPFHPSE+ANR++VQ ILTGT  YM PMNLSTIMV+DSK
Sbjct  321  CPNRDEYAFWDPFHPSEKANRIIVQQILTGTTAYMHPMNLSTIMVMDSK  369



>gb|EYU39534.1| hypothetical protein MIMGU_mgv1a008648mg [Erythranthe guttata]
Length=367

 Score =   277 bits (709),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L +LY++GARRVLVTGTGPLGCVPAELAQRS  G+CA+E  +AAA+FNP L E
Sbjct  198  ISEYRKVLTKLYDLGARRVLVTGTGPLGCVPAELAQRSRGGECAVELMRAAALFNPQLTE  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI+ +N ++G+D+FVA N   M  DF++NPQAYGF+TSKIACCGQGPYNGIGLCT  SNL
Sbjct  258  MISSVNSEIGADVFVAANTYTMHMDFVSNPQAYGFITSKIACCGQGPYNGIGLCTPLSNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSERANR++VQ ILTG NKYM PMNLSTI+ +DS+
Sbjct  318  CPNRDLYAFWDPFHPSERANRIIVQQILTGDNKYMKPMNLSTILAVDSR  366



>ref|XP_007030304.1| Li-tolerant lipase 1 isoform 1 [Theobroma cacao]
 ref|XP_007030305.1| Li-tolerant lipase 1 isoform 1 [Theobroma cacao]
 gb|EOY10806.1| Li-tolerant lipase 1 isoform 1 [Theobroma cacao]
 gb|EOY10807.1| Li-tolerant lipase 1 isoform 1 [Theobroma cacao]
Length=367

 Score =   277 bits (708),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL+RL+ +GARRVLVTGTGPLGCVPAELAQ S  G+CA+E Q+AAA+FNP L++
Sbjct  198  ISEYRKILVRLHGLGARRVLVTGTGPLGCVPAELAQHSRAGECAVELQRAAALFNPQLVQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN++LGSDIF+A NA  M  D+I+NPQAYGFVTSK+ACCGQGPYNGIGLCT ASNL
Sbjct  258  MLNGLNRELGSDIFIAANAYDMHMDWISNPQAYGFVTSKVACCGQGPYNGIGLCTMASNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSERANRL+V+ I TG+ KYM+PMNLSTIM LDS+
Sbjct  318  CPNRDIYAFWDPFHPSERANRLIVRQIATGSTKYMNPMNLSTIMELDSR  366



>ref|XP_009348739.1| PREDICTED: GDSL esterase/lipase LTL1-like [Pyrus x bretschneideri]
Length=362

 Score =   276 bits (707),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLYE+GAR+VLVTGTGPLGCVPAELA  S NG+CA+E Q+AA++FNP L++
Sbjct  193  ISEYRKVLERLYELGARKVLVTGTGPLGCVPAELALHSRNGECAVELQRAASLFNPQLVD  252

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN Q GSD FVA NA +M  DF+++PQAYGFVTSKIACCGQGPYNGIGLCT ASNL
Sbjct  253  MINSLNSQFGSDAFVAANAYEMNMDFVSDPQAYGFVTSKIACCGQGPYNGIGLCTIASNL  312

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSE+ANR++VQ I TG+NKYM+PMNLSTI+ LD+K
Sbjct  313  CPNRDLYAFWDAFHPSEKANRIIVQNIFTGSNKYMNPMNLSTILALDTK  361



>ref|XP_010263996.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nelumbo nucifera]
Length=368

 Score =   276 bits (707),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLYE+GARRVLVTGTGP+GCVPAELA RS+NG+C +E Q+AA +FNP L E
Sbjct  197  ISEYKKVLARLYELGARRVLVTGTGPMGCVPAELAMRSVNGECVVELQRAADLFNPQLTE  256

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +I  LN ++GSD F+A N  +M  DFI+NPQA+GFVTSKIACCGQGPYNGIGLCTAASNL
Sbjct  257  IIKQLNSEIGSDNFIAANTNRMHMDFISNPQAFGFVTSKIACCGQGPYNGIGLCTAASNL  316

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSERANR++VQ IL G+  YM PMNLST+M LD+K
Sbjct  317  CPNRDVYAFWDPFHPSERANRIIVQQILAGSTDYMHPMNLSTVMALDAK  365



>ref|XP_006340481.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum tuberosum]
Length=367

 Score =   276 bits (707),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL +LY++G RRVLVTGTGP+GCVPAELAQRS +G+C++E Q+AAA+FNP L +
Sbjct  198  ISEYRKILQKLYDLGGRRVLVTGTGPIGCVPAELAQRSTSGECSIELQRAAALFNPQLTQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ADLN Q+G+++F+A N   M  +F++NPQAYGFVTSKIACCGQGPYNGIGLCT  SNL
Sbjct  258  MLADLNSQIGANVFIAANTFTMNMNFVSNPQAYGFVTSKIACCGQGPYNGIGLCTPLSNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSERANR++VQ ILTG+++YM+PMNLST+M LDS+
Sbjct  318  CPNRDIYAFWDPFHPSERANRIIVQQILTGSSEYMNPMNLSTVMALDSR  366



>ref|XP_009379726.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Pyrus x bretschneideri]
Length=362

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLYE+GARRVLVTGTGPLGCVPAELAQRS  G+CA+E Q+AA++FNP L +
Sbjct  193  ISEYRKVLARLYELGARRVLVTGTGPLGCVPAELAQRSRRGECAVELQRAASLFNPQLAD  252

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN Q+GSD+F+  +A +M  +FI+NPQAYGFVTSKIACCGQGPYNG+GLCT  SNL
Sbjct  253  MVNSLNNQIGSDVFIYADAFRMHMNFISNPQAYGFVTSKIACCGQGPYNGVGLCTIVSNL  312

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSE+ANR++VQ ILTG+N+YM+PMNLSTI+ LDSK
Sbjct  313  CPNRDLYAFWDSFHPSEKANRIIVQIILTGSNEYMNPMNLSTILALDSK  361



>ref|XP_009777584.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Nicotiana 
sylvestris]
Length=370

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I EYRKIL +LYE+GARRVLVTGTGP+GCVPAELAQRS  G+CA+E Q+AA++FNP L +
Sbjct  201  IYEYRKILQKLYELGARRVLVTGTGPMGCVPAELAQRSRTGECAVELQRAASLFNPQLTQ  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +++DLN QL +D+FVA N   M  DF++NPQAYGFVTSKIACCGQGPYNGIGLCT  SNL
Sbjct  261  LLSDLNAQLAADVFVAANTYTMHMDFVSNPQAYGFVTSKIACCGQGPYNGIGLCTPLSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSE+ANR++VQ ILTG+++YM+PMNLS+IM LDS+
Sbjct  321  CPNRDLYAFWDPFHPSEKANRIIVQQILTGSSEYMNPMNLSSIMALDSR  369



>ref|XP_009769587.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nicotiana sylvestris]
Length=369

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+ +L +LY +GARRV+VTGTGPLGCVPAELAQRS +G CA E Q+AA++FNP L+E
Sbjct  200  ISEYKHVLAKLYSLGARRVIVTGTGPLGCVPAELAQRSQDGNCAAELQEAASLFNPQLVE  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN ++GS +F+A N  QM  DF+ NPQA+GFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  260  MLNGLNSEIGSHVFIAANTNQMHLDFVTNPQAFGFVTSKVACCGQGPYNGIGLCTPLSNL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRDEYAFWDPFHPSE+ANR++VQ ILTGT  YM PMNLSTIMV+DSK
Sbjct  320  CPNRDEYAFWDPFHPSEKANRIIVQQILTGTTAYMHPMNLSTIMVMDSK  368



>ref|XP_003555561.1| PREDICTED: GDSL esterase/lipase At5g33370 [Glycine max]
Length=371

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLY++GARRVLVTGTGPLGCVPAELA R  NG+C+ E Q+A+A++NP L+E
Sbjct  201  ISEYKKVLRRLYDLGARRVLVTGTGPLGCVPAELALRGRNGECSEELQRASALYNPQLVE  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN+++GSD+FVA N   M +DF+ NPQAYGF+TSK+ACCGQGP+NG+GLCT  SNL
Sbjct  261  MIKQLNKEVGSDVFVAANTQLMHDDFVTNPQAYGFITSKVACCGQGPFNGLGLCTVVSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NR E+AFWDPFHPSE+ANRL+VQ I++GT+KYM PMNLSTI+ LDSK+
Sbjct  321  CPNRHEFAFWDPFHPSEKANRLIVQQIMSGTSKYMHPMNLSTILALDSKK  370



>ref|XP_002325360.1| hypothetical protein POPTR_0019s04130g [Populus trichocarpa]
 gb|EEE99741.1| hypothetical protein POPTR_0019s04130g [Populus trichocarpa]
Length=367

 Score =   275 bits (702),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKILMRLY++GARRVLVTGTGP+GCVPAELAQRS NGQC+ E Q+AA+++NP L +
Sbjct  198  ISEYRKILMRLYDLGARRVLVTGTGPMGCVPAELAQRSPNGQCSAELQRAASLYNPQLTQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN Q G+DIF+A N  QM  DF+ NPQAYGFVTSKIACCGQGPYNG+GLCT ASNL
Sbjct  258  MLGQLNDQYGADIFIAANTRQMTADFVYNPQAYGFVTSKIACCGQGPYNGLGLCTPASNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSERAN +VVQ IL G   YM PMNLSTI+ LDS+
Sbjct  318  CPNRDLYAFWDPFHPSERANGIVVQQILNGDATYMHPMNLSTILALDSR  366



>ref|XP_003554732.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=365

 Score =   275 bits (702),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLY++G RRVLVTGTGP+GCVPAELA RS  G C +E Q+AA++FNP L+E
Sbjct  196  ISEYRKVLRRLYDLGTRRVLVTGTGPMGCVPAELATRSRTGDCDVELQRAASLFNPQLVE  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LNQ+LG+D+F+A NA +M  DF++NP+AYGFVTSKIACCGQGPYNG+GLCTAASNL
Sbjct  256  MLNGLNQELGADVFIAANAQRMHMDFVSNPRAYGFVTSKIACCGQGPYNGVGLCTAASNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSE+A+R++VQ IL GT +YM PMNLSTIM +DS+
Sbjct  316  CPNRDLYAFWDPFHPSEKASRIIVQQILRGTTEYMHPMNLSTIMAIDSR  364



>gb|KHN43145.1| GDSL esterase/lipase [Glycine soja]
Length=365

 Score =   274 bits (701),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLY++G RRVLVTGTGP+GCVPAELA RS  G C +E Q+AA++FNP L+E
Sbjct  196  ISEYRKVLRRLYDLGTRRVLVTGTGPMGCVPAELATRSRTGDCDVELQRAASLFNPQLVE  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LNQ+LG+D+F+A NA +M  DF++NP+AYGFVTSKIACCGQGPYNG+GLCTAASNL
Sbjct  256  MLNGLNQELGADVFIAANAQRMHMDFVSNPRAYGFVTSKIACCGQGPYNGVGLCTAASNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSE+A+R++VQ IL GT +YM PMNLSTIM +DS+
Sbjct  316  CPNRDLYAFWDPFHPSEKASRIIVQQILRGTTEYMHPMNLSTIMAIDSR  364



>gb|KHN04961.1| GDSL esterase/lipase [Glycine soja]
Length=355

 Score =   273 bits (699),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLY++GARRV+VTGTGPLGCVPAELA R  NG+C+ E Q+A+A++NP L+E
Sbjct  185  ISEYKKVLRRLYDLGARRVVVTGTGPLGCVPAELALRGRNGECSEELQRASALYNPQLVE  244

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN+++GSD+FVA N   M +DF+ NPQAYGF+TSK+ACCGQGP+NG+GLCT  SNL
Sbjct  245  MIKQLNKEVGSDVFVAANTQLMHDDFVTNPQAYGFITSKVACCGQGPFNGLGLCTVVSNL  304

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NR E+AFWDPFHPSE+ANRL+VQ I++GT+KYM PMNLSTI+ LDSK+
Sbjct  305  CPNRHEFAFWDPFHPSEKANRLIVQQIMSGTSKYMHPMNLSTILALDSKK  354



>ref|XP_011002016.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Populus euphratica]
Length=368

 Score =   274 bits (700),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKILMRLY++G RRVLVTGTGP+GCVPAELAQRS NGQCA+E Q+AA+++NP L +
Sbjct  199  ISEYRKILMRLYDLGVRRVLVTGTGPMGCVPAELAQRSTNGQCAVELQRAASLYNPQLTQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN Q G+DIF+A N  QM  +F++NPQAYGFVTSKIACCGQGPYNG+GLCT ASNL
Sbjct  259  MLGQLNNQYGADIFIAANTGQMTANFVDNPQAYGFVTSKIACCGQGPYNGLGLCTLASNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHP+ERAN ++ Q ILTG   YM PMNLSTI+ LDS+
Sbjct  319  CPNRDLYAFWDPFHPTERANSIIAQQILTGDATYMHPMNLSTILALDSR  367



>ref|XP_004494760.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cicer arietinum]
Length=371

 Score =   274 bits (700),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+KIL RLY++GARRVLVTGTGPLGCVPAELAQRS+NG+C+ E  +AA++FNP L++
Sbjct  202  ISEYKKILRRLYDLGARRVLVTGTGPLGCVPAELAQRSVNGECSPELMRAASLFNPQLVQ  261

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN ++GS+IFV  N  QM  +F+NNPQAYGFVTSK+ACCGQGPYNG+GLCT ASNL
Sbjct  262  MIQQLNGEIGSNIFVGANTRQMSINFVNNPQAYGFVTSKVACCGQGPYNGLGLCTVASNL  321

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD+YAFWDPFHPSERAN ++VQ I++G  +YM PMNLSTI+ LDSK
Sbjct  322  CPNRDQYAFWDPFHPSERANSIIVQQIMSGNTEYMYPMNLSTILALDSK  370



>ref|XP_006375868.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
 ref|XP_006375869.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
 gb|ERP53665.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
 gb|ERP53666.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
Length=372

 Score =   274 bits (700),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+KILMRLY +GARRVLVTGTGPLGCVPAELA RS NG C+ E Q+AAA++NP L  
Sbjct  203  ISEYKKILMRLYNLGARRVLVTGTGPLGCVPAELATRSTNGGCSAELQRAAALYNPQLES  262

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI D+N+++GSD+F+A N  QM  DF++NPQAYGF TSKIACCGQGPYNG+GLCT  SNL
Sbjct  263  MIIDVNRKIGSDVFIAANTHQMHADFVSNPQAYGFTTSKIACCGQGPYNGLGLCTLLSNL  322

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ YAFWDPFHPSE+AN+++VQ I+TG+ +YM PMNLSTIM LDS+
Sbjct  323  CPNRELYAFWDPFHPSEKANKIIVQQIMTGSTRYMKPMNLSTIMALDSR  371



>ref|XP_002319125.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
 gb|EEE95048.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
Length=368

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+KILMRLY +GARRVLVTGTGPLGCVPAELA RS NG C+ E Q+AAA++NP L  
Sbjct  199  ISEYKKILMRLYNLGARRVLVTGTGPLGCVPAELATRSTNGGCSAELQRAAALYNPQLES  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI D+N+++GSD+F+A N  QM  DF++NPQAYGF TSKIACCGQGPYNG+GLCT  SNL
Sbjct  259  MIIDVNRKIGSDVFIAANTHQMHADFVSNPQAYGFTTSKIACCGQGPYNGLGLCTLLSNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ YAFWDPFHPSE+AN+++VQ I+TG+ +YM PMNLSTIM LDS+
Sbjct  319  CPNRELYAFWDPFHPSEKANKIIVQQIMTGSTRYMKPMNLSTIMALDSR  367



>gb|KHN35333.1| GDSL esterase/lipase, partial [Glycine soja]
Length=368

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLY++GARRVLVTGTGP+GCVPAELA RS  G C +E Q+AA++FNP L++
Sbjct  199  ISEYRKVLRRLYDLGARRVLVTGTGPMGCVPAELATRSRTGDCDVELQRAASLFNPQLVQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LNQ+LG+D+F+A NA +M  DF++NP+AYGFVTSKIACCGQGPYNG+GLCT ASNL
Sbjct  259  MLNGLNQELGADVFIAANAQRMHMDFVSNPRAYGFVTSKIACCGQGPYNGVGLCTPASNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSE+A+R++VQ IL GT +YM PMNLSTIM +DSK
Sbjct  319  CPNRDLYAFWDPFHPSEKASRIIVQQILRGTTEYMHPMNLSTIMAIDSK  367



>ref|XP_011076887.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Sesamum indicum]
Length=369

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL RLYE+GARRVLVTGTGPLGCVPAELA RS NG+CA E QQAAA+FNP L E
Sbjct  200  ISEYRKILSRLYELGARRVLVTGTGPLGCVPAELAMRSRNGECAPELQQAAALFNPQLTE  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN QLGSD+F+A N   M +DFI +PQA+GF+TSK+ACCGQG YNG+GLCT  SNL
Sbjct  260  MLLSLNSQLGSDVFIAANTQLMNSDFIRDPQAFGFITSKVACCGQGLYNGLGLCTQLSNL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSERANR +V+ I+TG++ YM+PMNLSTI+ LDS+
Sbjct  320  CPNRDVYAFWDPFHPSERANRFIVRQIMTGSSAYMTPMNLSTIIALDSR  368



>gb|ABK95911.1| unknown [Populus trichocarpa]
Length=368

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+LMRLY +GARRVLVTGTGPLGCVPAELA RS NG C+ E Q+AAA++NP L  
Sbjct  199  ISEYKKLLMRLYNLGARRVLVTGTGPLGCVPAELATRSTNGGCSAELQRAAALYNPQLES  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI D+N+++GSD+F+A N  QM  DF++NPQAYGF TSKIACCGQGPYNG+GLCT  SNL
Sbjct  259  MIIDVNRKIGSDVFIAANTHQMHADFVSNPQAYGFTTSKIACCGQGPYNGLGLCTLLSNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ YAFWDPFHPSE+AN+++VQ I+TG+ +YM PMNLSTIM LDS+
Sbjct  319  CPNRELYAFWDPFHPSEKANKIIVQQIMTGSTRYMKPMNLSTIMALDSR  367



>gb|KDP23751.1| hypothetical protein JCGZ_23584 [Jatropha curcas]
Length=367

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLY++GARRVLVTGTGPLGCVPAELAQR  NGQC+ E Q+AA++FNP L +
Sbjct  198  ISEYKKLLQRLYDLGARRVLVTGTGPLGCVPAELAQRGRNGQCSAELQRAASLFNPQLTQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN Q GSD+F+A N  +M  DFI NP AYGFVTSK+ACCGQGPYNGIGLCT ASNL
Sbjct  258  MLRQLNSQYGSDVFIAANTGRMTGDFITNPGAYGFVTSKVACCGQGPYNGIGLCTPASNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSE+ANR + Q IL+G+  YMSPMNLSTIM LDS+
Sbjct  318  CPNRDVYAFWDPFHPSEKANRYIAQQILSGSTDYMSPMNLSTIMALDSR  366



>gb|AFK40233.1| unknown [Lotus japonicus]
Length=198

 Score =   266 bits (681),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL RLYE+GARRV+VTGTGPLGCVPAELAQRS NG+C+ E QQA+ +FNP L++
Sbjct  27   ISEYRKILARLYELGARRVMVTGTGPLGCVPAELAQRSRNGECSPELQQASDLFNPQLLQ  86

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +I  LN ++GSD+FV+ NA  M  DFI++P+A+GF TSK+ACCGQGPYNG+GLCT  SNL
Sbjct  87   LINQLNSEIGSDVFVSANAFTMNMDFISDPEAFGFATSKVACCGQGPYNGLGLCTPVSNL  146

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDPFHPSERANRL+V+  + G+++YM PMNLSTIM LDS
Sbjct  147  CPNRDLYAFWDPFHPSERANRLIVERFMIGSSEYMHPMNLSTIMHLDS  194



>ref|XP_007147234.1| hypothetical protein PHAVU_006G107200g [Phaseolus vulgaris]
 gb|ESW19228.1| hypothetical protein PHAVU_006G107200g [Phaseolus vulgaris]
Length=389

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLY++G RRVLVTGTGP+GCVPAELA RS  G C +E Q+AAA+FNP L++
Sbjct  220  ISEYRKVLRRLYDLGTRRVLVTGTGPMGCVPAELAMRSRTGDCDVELQRAAALFNPQLVQ  279

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LNQ+LGS++F+A NA +M  DF++NP+AYGFVTSKIACCGQGPYNGIGLCT ASNL
Sbjct  280  MLNGLNQELGSEVFIAANAYRMHMDFVSNPRAYGFVTSKIACCGQGPYNGIGLCTPASNL  339

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSERA+R++VQ IL GT +YM PMNL+TIM LDS+
Sbjct  340  CPNRDLYAFWDPFHPSERASRIIVQQILRGTTEYMHPMNLTTIMELDSR  388



>ref|XP_003521783.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=365

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLY++GARRVLVTGTGP+GCVPAELA RS  G C +E Q+AA++FNP L++
Sbjct  196  ISEYRKVLRRLYDLGARRVLVTGTGPMGCVPAELATRSRTGDCDVELQRAASLFNPQLVQ  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LNQ+LG+D+F+A NA +M  DF++NP+AYGFVTSKIACCGQGPYNG+GLCT  SNL
Sbjct  256  MLNGLNQELGADVFIAANAQRMHMDFVSNPRAYGFVTSKIACCGQGPYNGVGLCTPTSNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSE+A+R++VQ IL GT +YM PMNLSTIM +DSK
Sbjct  316  CPNRDLYAFWDPFHPSEKASRIIVQQILRGTTEYMHPMNLSTIMAIDSK  364



>ref|XP_011038448.1| PREDICTED: GDSL esterase/lipase At5g33370 [Populus euphratica]
 ref|XP_011038449.1| PREDICTED: GDSL esterase/lipase At5g33370 [Populus euphratica]
Length=368

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+LMRLY +GARRVLVTGTGPLGCVPAELA RS NG C+ E Q+AAA++NP L  
Sbjct  199  ISEYKKLLMRLYNLGARRVLVTGTGPLGCVPAELAMRSANGGCSAELQRAAALYNPQLES  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI D+N+++GSD+F+A N  QM  DF +NPQAYGF TSKIACCGQGPYNG+GLCT  SNL
Sbjct  259  MIIDVNRKIGSDVFIAANTHQMHVDFFSNPQAYGFTTSKIACCGQGPYNGLGLCTLFSNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSE+AN+++VQ I+TG+ +YM PMNLSTIM LDS+
Sbjct  319  CPNRDLYAFWDPFHPSEKANKIIVQQIMTGSTRYMKPMNLSTIMALDSR  367



>ref|XP_002522021.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40425.1| zinc finger protein, putative [Ricinus communis]
Length=368

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+LMRLY++GARRVLVTGTGPLGCVPAELA RS NG+CA E Q+AAA+FNP L +
Sbjct  199  ISEYKKLLMRLYDLGARRVLVTGTGPLGCVPAELAMRSSNGECAAELQRAAALFNPQLTQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN Q GSDIF+A N  QM  DFI+NP A+GFVTSK+ACCGQGPYNG+GLCT  SNL
Sbjct  259  MLRQLNSQYGSDIFIAANTGQMSADFISNPGAFGFVTSKVACCGQGPYNGLGLCTGLSNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSERAN  + + ILTGT  YM+PMNLSTIM LDS+
Sbjct  319  CPNRDVYAFWDPFHPSERANSYIARQILTGTTDYMNPMNLSTIMALDSR  367



>ref|XP_007205392.1| hypothetical protein PRUPE_ppa007427mg [Prunus persica]
 gb|EMJ06591.1| hypothetical protein PRUPE_ppa007427mg [Prunus persica]
Length=368

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISE +K+L+R+Y++G RRVLVTGTGPLGCVPAELAQRS NG+C+ E Q+AA+++NP L++
Sbjct  199  ISELKKLLLRMYDLGTRRVLVTGTGPLGCVPAELAQRSRNGECSAELQRAASLYNPQLVQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN QLGSD+F+A N  Q +NDFI+NPQA+GF TSKIACCGQGPYNG+GLCT ASNL
Sbjct  259  MLKSLNSQLGSDVFIAANTQQTRNDFISNPQAFGFSTSKIACCGQGPYNGLGLCTVASNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR  YAFWD FHPSE+AN+L+VQ ILTG+ KYM PMNLSTI+ LDS+
Sbjct  319  CPNRGRYAFWDAFHPSEKANKLIVQNILTGSTKYMDPMNLSTILALDSR  367



>ref|XP_010648948.1| PREDICTED: GDSL esterase/lipase At5g33370 [Vitis vinifera]
 emb|CAN67726.1| hypothetical protein VITISV_038831 [Vitis vinifera]
Length=369

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLYE+GARRVLVTGTGP+GCVPAELA RS NG+CA+E Q+AA +FNP L++
Sbjct  200  ISEYRKVLRRLYELGARRVLVTGTGPMGCVPAELAMRSRNGECAVELQRAADLFNPQLVQ  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN ++G D+F+A NA +M  DFI+NP AYGFVTSKIACCGQGPYNG+GLCT ASNL
Sbjct  260  MINGLNNEIGGDVFIAANAFRMHMDFISNPGAYGFVTSKIACCGQGPYNGLGLCTIASNL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            CANRD YAFWD FHPSERANR +V+ IL+G+  YM PMNLS IM LDS+
Sbjct  320  CANRDIYAFWDAFHPSERANRYIVRQILSGSTDYMHPMNLSNIMALDSR  368



>ref|XP_011038450.1| PREDICTED: GDSL esterase/lipase LTL1-like [Populus euphratica]
Length=368

 Score =   271 bits (694),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL+R+YE+GARR+LVTGTGPLGC PAE A RS NG+CA+E Q+AAA+FNP L++
Sbjct  199  ISEYRKILVRVYELGARRILVTGTGPLGCAPAERATRSRNGECAVELQRAAAMFNPQLVQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI +LN+++GSD+F+A NA  M  DF+ NPQAYGFVTS++ACCGQG +NGIGLCT ASNL
Sbjct  259  MITELNKEIGSDVFIATNAYDMNTDFVTNPQAYGFVTSQVACCGQGRFNGIGLCTIASNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ +AFWDPFHP+ERANR++V  I+TG  KYM+PMNLSTIM LDS+
Sbjct  319  CPNREIFAFWDPFHPTERANRIIVSTIVTGDTKYMNPMNLSTIMALDSR  367



>ref|XP_007143993.1| hypothetical protein PHAVU_007G120000g [Phaseolus vulgaris]
 gb|ESW15987.1| hypothetical protein PHAVU_007G120000g [Phaseolus vulgaris]
Length=366

 Score =   271 bits (694),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYR IL RLY++G RRVLVTGTGP+GCVPAELA RS NG+C LE Q+AA++FNP L+E
Sbjct  197  ISEYRLILKRLYDLGGRRVLVTGTGPMGCVPAELALRSGNGECDLELQRAASLFNPQLVE  256

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LNQ++G+ +F+AVNA +M  DF+NNP+A+GFVTSKIACCGQGPYNG+GLCTA SNL
Sbjct  257  MVRGLNQEIGAHVFIAVNAYEMHMDFVNNPRAFGFVTSKIACCGQGPYNGVGLCTAISNL  316

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSE+ANR++VQ ++TG+ +YM PMNLSTIM +DS+
Sbjct  317  CPNRDLYAFWDPFHPSEKANRIIVQQMMTGSVQYMHPMNLSTIMAIDSR  365



>ref|XP_004292262.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Fragaria vesca 
subsp. vesca]
Length=357

 Score =   271 bits (693),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL+RLYE+G RRVLVTGTGPLGCVPA +AQRS NG+CA E Q+AAAIFNPLL++
Sbjct  189  ISEYRKILLRLYELGGRRVLVTGTGPLGCVPAAMAQRSRNGECAPELQRAAAIFNPLLVQ  248

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN QLG++ FVA NA     DF++NP+ YGFVTS++ CCGQGPYNG+GLCT  SNL
Sbjct  249  MVQGLNAQLGTEAFVAANA-HASMDFLSNPRKYGFVTSRVVCCGQGPYNGVGLCTPLSNL  307

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C+NRD YAFWDPFHPSERANRL+VQ ++TG++KYM+PMNLSTIM +DS+
Sbjct  308  CSNRDVYAFWDPFHPSERANRLIVQTMMTGSSKYMNPMNLSTIMAMDSR  356



>emb|CBI28652.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   271 bits (694),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLYE+GARRVLVTGTGP+GCVPAELA RS NG+CA+E Q+AA +FNP L++
Sbjct  198  ISEYRKVLRRLYELGARRVLVTGTGPMGCVPAELAMRSRNGECAVELQRAADLFNPQLVQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN ++G D+F+A NA +M  DFI+NP AYGFVTSKIACCGQGPYNG+GLCT ASNL
Sbjct  258  MINGLNNEIGGDVFIAANAFRMHMDFISNPGAYGFVTSKIACCGQGPYNGLGLCTIASNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            CANRD YAFWD FHPSERANR +V+ IL+G+  YM PMNLS IM LDS+
Sbjct  318  CANRDIYAFWDAFHPSERANRYIVRQILSGSTDYMHPMNLSNIMALDSR  366



>gb|ACR33100.1| putative tea geometrid larvae-inducible protein [Camellia sinensis]
Length=367

 Score =   271 bits (693),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L+RLYE+GARRVLVTGTGPLGCVPAELAQRS  G+C +E Q+AA +FNP LI+
Sbjct  198  ISEYRKVLVRLYELGARRVLVTGTGPLGCVPAELAQRSRTGECVVELQRAAGLFNPQLIQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN Q+GS +F+A NA +M  DFI++PQAYGFVTSKIACCGQGPYNG+GLCT  SNL
Sbjct  258  MVNGLNSQIGSTVFIAANAQRMHMDFISDPQAYGFVTSKIACCGQGPYNGLGLCTPLSNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDPFHP ERANR VVQ ILTG+  YMSPMNLS I+ LDS
Sbjct  318  CPNRDIYAFWDPFHPFERANRFVVQQILTGSPNYMSPMNLSPILALDS  365



>ref|XP_003535381.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=371

 Score =   271 bits (694),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLY++GARRV+VTGTGPLGCVPAELA R  NG+C+ E QQAA+++NP L+E
Sbjct  201  ISEYKKVLRRLYDLGARRVVVTGTGPLGCVPAELALRGRNGECSEELQQAASLYNPQLVE  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN+++GSD+FVA N   M NDF+ NPQ YGF+TSK+ACCGQGP+NGIGLCT ASNL
Sbjct  261  MIKQLNKEVGSDVFVAANTQLMHNDFVTNPQTYGFITSKVACCGQGPFNGIGLCTVASNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C  RDE+AFWD FHPSE+A++L+VQ I++GT+KYM PMNLSTI+ LDSK+
Sbjct  321  CPYRDEFAFWDAFHPSEKASKLIVQQIMSGTSKYMHPMNLSTILALDSKK  370



>ref|XP_008218371.1| PREDICTED: GDSL esterase/lipase LTL1-like [Prunus mume]
Length=405

 Score =   272 bits (696),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +SE +K+L+R+Y++G RRVLVTGTGPLGCVPAELAQRS NG+C+ E Q+AA+++NP L++
Sbjct  236  MSELKKLLLRMYDLGTRRVLVTGTGPLGCVPAELAQRSRNGECSAELQRAASLYNPQLVQ  295

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++  LN QLGSD+F+A N  Q +NDFI+NPQA+GF TSKIACCGQGPYNG+GLCT ASNL
Sbjct  296  LLKSLNSQLGSDVFIAANTQQTRNDFISNPQAFGFSTSKIACCGQGPYNGLGLCTVASNL  355

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSE+AN+L+VQ ILTG+ KYM+PMNLSTI+ LDS+
Sbjct  356  CPNRDRYAFWDAFHPSEKANKLIVQNILTGSTKYMNPMNLSTILALDSR  404



>ref|XP_008441804.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cucumis melo]
Length=368

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL  LYE GARRVLVTGTGPLGCVPAELA R  NG+C++E Q+AAA+FNP L++
Sbjct  199  ISEYRKILASLYEFGARRVLVTGTGPLGCVPAELAMRGRNGECSVELQRAAALFNPQLVQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +I  LN ++GS +F+AVN   M  DF++NPQAYGF+TSK+ACCGQGP+NGIGLCT ASNL
Sbjct  259  IINSLNDEIGSHVFIAVNTQMMHMDFVSNPQAYGFITSKVACCGQGPFNGIGLCTPASNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ YAFWDPFHPSERANR++VQ ILTGT +YM PMNLSTI+ +DS+
Sbjct  319  CPNRNVYAFWDPFHPSERANRIIVQQILTGTQEYMHPMNLSTILAMDSR  367



>gb|EYU46367.1| hypothetical protein MIMGU_mgv1a008634mg [Erythranthe guttata]
Length=367

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +SEY+ IL+ LY  GARRVLVTGTGP+GCVPAE+A R +NGQCA+EPQ+AAAI+NPLL E
Sbjct  198  VSEYKSILLELYNSGARRVLVTGTGPIGCVPAEVALRGVNGQCAVEPQRAAAIYNPLLTE  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+A LNQ++GS++F+A  A + Q DFINNP+A+GF TSK ACCGQGPYNGIGLC A SNL
Sbjct  258  MLAGLNQEIGSNVFIAAKAFEKQYDFINNPKAFGFTTSKRACCGQGPYNGIGLCIATSNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRDEYAFWD FHP+E+ANR +V+AI+ G+  YM+PMNLSTIM LDS+
Sbjct  318  CKNRDEYAFWDAFHPTEKANRYIVRAIMEGSEAYMAPMNLSTIMELDSR  366



>ref|XP_002319124.2| hypothetical protein POPTR_0013s04780g [Populus trichocarpa]
 gb|EEE95047.2| hypothetical protein POPTR_0013s04780g [Populus trichocarpa]
Length=419

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL+R+YE+GARR+LVTGTGPLGCVPAE A RS NG+CA+E Q+AA +FNP L++
Sbjct  250  ISEYRKILVRVYELGARRILVTGTGPLGCVPAERATRSRNGECAVELQRAATLFNPQLVQ  309

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI +LN ++GSD+F+A NA +M  DF+ NPQAYGFVTS++ACCGQG +NGIGLCT ASNL
Sbjct  310  MITELNMEIGSDVFIAANAYEMNMDFVTNPQAYGFVTSQVACCGQGRFNGIGLCTIASNL  369

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD +AFWDPFHP+ERANR++V  I+TG  KYM+PMNLSTIM LDS+
Sbjct  370  CPNRDIFAFWDPFHPTERANRIIVSTIVTGDTKYMNPMNLSTIMALDSR  418



>ref|XP_011077073.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At5g33370-like 
[Sesamum indicum]
Length=368

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL RLYE+GARRVLVTGTGP+GCVPAELAQRS  G+CA E  +AA +FNP L E
Sbjct  199  ISEYRKILARLYELGARRVLVTGTGPMGCVPAELAQRSRAGECAAELTRAAGLFNPQLTE  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN +LG+D+FVA N   M  DFI+NPQA+GF+TSKIACCGQGPYNG+GLCT  SNL
Sbjct  259  MLRSLNSELGADVFVAANTYAMHMDFISNPQAHGFITSKIACCGQGPYNGVGLCTPVSNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWD FHPSERANR++VQ ILTG NKYM+P+NL+TIM +DS
Sbjct  319  CPNRDVYAFWDSFHPSERANRIIVQQILTGDNKYMNPINLTTIMAMDS  366



>ref|XP_011077072.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Sesamum indicum]
Length=367

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +SEY+K+LMRL+++G RRV+VTGTGPLGCVPAELA  S NG+CA E Q+AAA+FNP L++
Sbjct  198  VSEYKKVLMRLHDLGPRRVIVTGTGPLGCVPAELALHSTNGECAEELQKAAALFNPQLVQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ +LNQQLGS++F+A N  QM  DFI+NPQA+GF TSKIACCGQGPYNG+GLCT  SNL
Sbjct  258  MLNELNQQLGSNVFIAANTNQMHMDFISNPQAFGFTTSKIACCGQGPYNGLGLCTPFSNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD Y FWDPFHPSERAN+L+VQ IL G+  YM PMNLSTIM LDS+
Sbjct  318  CPNRDLYVFWDPFHPSERANKLIVQQILAGSTAYMHPMNLSTIMALDSR  366



>ref|XP_011002018.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Populus euphratica]
Length=368

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYR++LM+LY +GARRVLVTGTGPLGCVPAELA RS NG C+ E Q+AAA++NP L  
Sbjct  199  ISEYRELLMKLYNLGARRVLVTGTGPLGCVPAELATRSTNGGCSEELQRAAALYNPQLES  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI D+N+++GS++F+A N  QM  DF++NPQAYGF TSK ACCGQGPYNGIGLCT  SNL
Sbjct  259  MIKDVNRKIGSNVFIAANTHQMHTDFVSNPQAYGFTTSKTACCGQGPYNGIGLCTTLSNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWDPFHPSE+A+R++VQ I+TG+ +YM PMNLSTIM LDS+ 
Sbjct  319  CPNRDLYAFWDPFHPSEKASRIIVQQIMTGSTQYMKPMNLSTIMALDSRS  368



>gb|KHN35332.1| GDSL esterase/lipase LTL1 [Glycine soja]
Length=376

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL+RLYE+GARRVLVTGTGPLGCVPAELAQRS NG+CA E Q+A+A+FNP L++
Sbjct  205  ISEYRKILVRLYELGARRVLVTGTGPLGCVPAELAQRSRNGECAAELQEASALFNPQLVQ  264

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++  LN ++GS +F++ NA +   DFI+NPQAYGF+TSK+ACCGQGPYNGIGLCT ASNL
Sbjct  265  LVNQLNSEIGSVVFISANAFESNMDFISNPQAYGFITSKVACCGQGPYNGIGLCTPASNL  324

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD +AFWDPFHPSERANRL+V   + G +KYM PMNLST+++LD+
Sbjct  325  CPNRDVFAFWDPFHPSERANRLIVDTFMIGDSKYMHPMNLSTVLLLDA  372



>ref|XP_006340478.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum tuberosum]
Length=360

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+ +L +LY +GARRV+VTGTGPLGCVPAELAQRS +G CA + QQAA +FNP L+E
Sbjct  191  ISEYKNVLQKLYSLGARRVIVTGTGPLGCVPAELAQRSRDGSCADDLQQAAVLFNPQLVE  250

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN ++G+ +FVA N  QM  DFI +PQA+GFVTSK+ACCGQGPYNG+GLCT  SNL
Sbjct  251  MLNGLNSEIGNHVFVAANTNQMHLDFITDPQAFGFVTSKVACCGQGPYNGMGLCTPLSNL  310

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C+NRDEYAFWDPFHP+E+ANR++V+ ILTGT  YM PMNLSTIMV+DSK
Sbjct  311  CSNRDEYAFWDPFHPTEKANRIIVEQILTGTTDYMHPMNLSTIMVMDSK  359



>ref|XP_003521782.1| PREDICTED: GDSL esterase/lipase LTL1-like isoform X1 [Glycine 
max]
Length=376

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL+RLYE+GARRVLVTGTGPLGCVPAELAQRS NG+CA E Q+A+A+FNP L++
Sbjct  205  ISEYRKILVRLYELGARRVLVTGTGPLGCVPAELAQRSRNGECAAELQEASALFNPQLVQ  264

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++  LN ++GS +F++ NA +   DFI+NPQAYGF+TSK+ACCGQGPYNGIGLCT ASNL
Sbjct  265  LVNQLNSEIGSVVFISANAFESNMDFISNPQAYGFITSKVACCGQGPYNGIGLCTPASNL  324

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD +AFWDPFHPSERANRL+V   + G +KYM PMNLST+++LD+
Sbjct  325  CPNRDVFAFWDPFHPSERANRLIVDTFMIGDSKYMHPMNLSTVLLLDA  372



>gb|EPS60817.1| hypothetical protein M569_13984, partial [Genlisea aurea]
Length=285

 Score =   266 bits (681),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+KIL RLY++GARRVLVTGTGPLGCVPAELA RS NG+C+ E Q+AAA+FNP L  
Sbjct  116  ISEYQKILRRLYDLGARRVLVTGTGPLGCVPAELATRSRNGECSQELQRAAALFNPQLSR  175

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++ +LN Q+GS +FV  N  Q  NDFI+NPQA+GF TSK+ACCGQGPYNGIGLC A SNL
Sbjct  176  ILQNLNSQIGSTVFVGANTQQTNNDFIHNPQAFGFETSKVACCGQGPYNGIGLCNALSNL  235

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C++R+ YAFWDPFHPSE+ANR++V+ ILTG+N+YM+PMNLSTI+ LDS+
Sbjct  236  CSDREAYAFWDPFHPSEKANRIIVRQILTGSNEYMNPMNLSTILALDSQ  284



>ref|XP_006577328.1| PREDICTED: GDSL esterase/lipase LTL1-like isoform X2 [Glycine 
max]
Length=382

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL+RLYE+GARRVLVTGTGPLGCVPAELAQRS NG+CA E Q+A+A+FNP L++
Sbjct  211  ISEYRKILVRLYELGARRVLVTGTGPLGCVPAELAQRSRNGECAAELQEASALFNPQLVQ  270

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++  LN ++GS +F++ NA +   DFI+NPQAYGF+TSK+ACCGQGPYNGIGLCT ASNL
Sbjct  271  LVNQLNSEIGSVVFISANAFESNMDFISNPQAYGFITSKVACCGQGPYNGIGLCTPASNL  330

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD +AFWDPFHPSERANRL+V   + G +KYM PMNLST+++LD+
Sbjct  331  CPNRDVFAFWDPFHPSERANRLIVDTFMIGDSKYMHPMNLSTVLLLDA  378



>ref|XP_010043319.1| PREDICTED: GDSL esterase/lipase LTL1-like [Eucalyptus grandis]
 gb|KCW85324.1| hypothetical protein EUGRSUZ_B02163 [Eucalyptus grandis]
Length=365

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYR IL RLYE+GARRVLVTGTGPLGCVP+ELAQRS NG+C  E Q+AAA+FNP L++
Sbjct  196  ISEYRNILARLYELGARRVLVTGTGPLGCVPSELAQRSRNGECVAELQRAAALFNPQLVQ  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M++ LN ++GS++F+A NA QM ++FI+NP+A+GFVTSK+ACCGQG YNG+GLCT ASNL
Sbjct  256  MVSSLNNEIGSNVFIAANAQQMSSNFISNPRAFGFVTSKVACCGQGRYNGLGLCTVASNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSERANR +V+ ILTG  +YM PMNLSTIM LD++
Sbjct  316  CPNRDVYAFWDAFHPSERANRFIVREILTGDTRYMYPMNLSTIMALDTR  364



>ref|XP_010024922.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Eucalyptus grandis]
Length=352

 Score =   268 bits (686),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLYE+GARRVLVTGTGPLGCVPAELA R  NGQCA E QQAA++FNP L +
Sbjct  182  ISEYRKLLERLYELGARRVLVTGTGPLGCVPAELALRGRNGQCAPELQQAASLFNPQLTQ  241

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LNQ+ GS +F+A N   M  DFI++PQAYGFVTSK+ACCGQGPYNGIGLCT AS+L
Sbjct  242  MLQGLNQEYGSPVFIAANTDLMHGDFISDPQAYGFVTSKVACCGQGPYNGIGLCTTASDL  301

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD+YAFWDPFHPS++AN+L+VQ+I+ G+ +YM PMNLSTI+ LDS 
Sbjct  302  CTNRDQYAFWDPFHPSQKANKLIVQSIMKGSAEYMYPMNLSTILALDSH  350



>gb|KCW85323.1| hypothetical protein EUGRSUZ_B02163 [Eucalyptus grandis]
Length=367

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYR IL RLYE+GARRVLVTGTGPLGCVP+ELAQRS NG+C  E Q+AAA+FNP L++
Sbjct  198  ISEYRNILARLYELGARRVLVTGTGPLGCVPSELAQRSRNGECVAELQRAAALFNPQLVQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M++ LN ++GS++F+A NA QM ++FI+NP+A+GFVTSK+ACCGQG YNG+GLCT ASNL
Sbjct  258  MVSSLNNEIGSNVFIAANAQQMSSNFISNPRAFGFVTSKVACCGQGRYNGLGLCTVASNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSERANR +V+ ILTG  +YM PMNLSTIM LD++
Sbjct  318  CPNRDVYAFWDAFHPSERANRFIVREILTGDTRYMYPMNLSTIMALDTR  366



>gb|KCW61461.1| hypothetical protein EUGRSUZ_H04197 [Eucalyptus grandis]
Length=373

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLYE+GARRVLVTGTGPLGCVPAELA R  NGQCA E QQAA++FNP L +
Sbjct  203  ISEYRKLLERLYELGARRVLVTGTGPLGCVPAELALRGRNGQCAPELQQAASLFNPQLTQ  262

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LNQ+ GS +F+A N   M  DFI++PQAYGFVTSK+ACCGQGPYNGIGLCT AS+L
Sbjct  263  MLQGLNQEYGSPVFIAANTDLMHGDFISDPQAYGFVTSKVACCGQGPYNGIGLCTTASDL  322

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD+YAFWDPFHPS++AN+L+VQ+I+ G+ +YM PMNLSTI+ LDS 
Sbjct  323  CTNRDQYAFWDPFHPSQKANKLIVQSIMKGSAEYMYPMNLSTILALDSH  371



>ref|XP_004152806.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cucumis sativus]
 gb|KGN61316.1| Zinc finger protein [Cucumis sativus]
Length=368

 Score =   269 bits (687),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L  LYE GARRVLVTGTGPLGCVPAELA R  NG+C+ E Q+AAA+FNP L +
Sbjct  199  ISEYRKVLASLYEFGARRVLVTGTGPLGCVPAELAMRGRNGECSAELQRAAALFNPQLAQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +I  LN+++GS +F+AVN   M  DF++NPQAYGF+TSK+ACCGQGP+NGIGLCT ASNL
Sbjct  259  IINSLNEEIGSHVFIAVNTQMMHMDFVSNPQAYGFITSKVACCGQGPFNGIGLCTPASNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ YAFWDPFHPSERANR++VQ ILTGT +YM PMNLSTI+ +DS+
Sbjct  319  CRNRNVYAFWDPFHPSERANRIIVQQILTGTQEYMHPMNLSTILAMDSR  367



>ref|XP_011002019.1| PREDICTED: GDSL esterase/lipase LTL1-like [Populus euphratica]
Length=367

 Score =   268 bits (686),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL+R+YE+GARRVLVTGTGPLGCVPAE A RS NG+CA E Q+AAA+FNP L++
Sbjct  198  ISEYRKILVRVYELGARRVLVTGTGPLGCVPAERAMRSRNGECAAELQRAAALFNPQLVQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ +LN+++GSD+F+A NA     DF+ NPQAYGFVTS++ACCGQG +NGIGLCT ASNL
Sbjct  258  MLMELNREIGSDVFIAANAFDANMDFVTNPQAYGFVTSQVACCGQGRFNGIGLCTIASNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NR+ +AFWDPFHP+ERANR++V +I+TG+ KYM+PMNLSTIM LDS
Sbjct  318  CPNREIFAFWDPFHPTERANRIIVSSIVTGSTKYMNPMNLSTIMALDS  365



>ref|XP_011084387.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Sesamum indicum]
Length=354

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYR IL+RLY++GARRVLVTGTGPLGCVPAELA R  NGQC+ E QQAAA+FNP L +
Sbjct  185  ISEYRNILLRLYQLGARRVLVTGTGPLGCVPAELAMRGRNGQCSTELQQAAALFNPQLTQ  244

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+QLG ++F+A N      DFI+NPQA+GFVTSK+ACCGQGP+NG+GLCT  SNL
Sbjct  245  MLLALNEQLGDNVFIAANTQLTHYDFISNPQAFGFVTSKVACCGQGPFNGLGLCTQLSNL  304

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSERANRL+VQ I+TG+ +YM+PMNLSTI+ LDS+
Sbjct  305  CPNRDVYAFWDPFHPSERANRLIVQQIMTGSIEYMNPMNLSTILALDSR  353



>emb|CDP04255.1| unnamed protein product [Coffea canephora]
Length=369

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKILMRLYE+G+R+V+VTGTGP+GCVPAELAQRS NG+C+ E Q AA++FNP L +
Sbjct  199  ISEYRKILMRLYELGSRKVIVTGTGPIGCVPAELAQRSRNGECSAELQHAASLFNPQLAQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +I+D+N QLGS++F+A N M M  DF++NPQA+GFVTSKIACCGQGPYNGIGLCT  SNL
Sbjct  259  LISDINSQLGSNVFMAANTMAMHMDFVSNPQAFGFVTSKIACCGQGPYNGIGLCTPLSNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWDPFHPSERANR++VQ I +G+ +YM PMNLS  + +D+  
Sbjct  319  CPNRDIYAFWDPFHPSERANRIIVQQIFSGSPQYMHPMNLSAALAMDTSR  368



>ref|XP_006350943.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum tuberosum]
Length=364

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I EYRKILM +Y +G RRV+VTGTGPLGCVPAELAQRS NG+C+ E QQAAA+FNP L++
Sbjct  195  IREYRKILMTVYNLGGRRVIVTGTGPLGCVPAELAQRSRNGECSPELQQAAALFNPQLMQ  254

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN++LGS++F+A N  QM  +FI NPQAYGF+TSK+ACCGQGPYNG+GLCT  SNL
Sbjct  255  MLQGLNRELGSNVFIAANTQQMHTNFITNPQAYGFITSKVACCGQGPYNGLGLCTPLSNL  314

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSE+AN+++VQ I++GT +YM+PMNLSTI+ +DS+
Sbjct  315  CPNRDVYAFWDPFHPSEKANKIIVQQIMSGTTEYMNPMNLSTILAMDSE  363



>ref|XP_003520948.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Glycine 
max]
 gb|KHN27241.1| GDSL esterase/lipase [Glycine soja]
Length=372

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL  LYE+GARRVLVTGTGPLGCVPAELA  S NG+CA E Q+A  +FNP L++
Sbjct  203  ISEYRKILANLYELGARRVLVTGTGPLGCVPAELAMHSQNGECATELQRAVNLFNPQLVQ  262

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++ +LN Q+GSD+F++ NA  M  DF++NPQAYGFVTSK+ACCGQG YNGIGLCT ASNL
Sbjct  263  LLHELNTQIGSDVFISANAFTMHLDFVSNPQAYGFVTSKVACCGQGAYNGIGLCTPASNL  322

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDPFHPSERANRL+V   +TG+ +YM PMNLSTI+ LDS
Sbjct  323  CPNRDLYAFWDPFHPSERANRLIVDKFMTGSTEYMHPMNLSTIIALDS  370



>ref|XP_007147233.1| hypothetical protein PHAVU_006G107100g [Phaseolus vulgaris]
 gb|ESW19227.1| hypothetical protein PHAVU_006G107100g [Phaseolus vulgaris]
Length=369

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL+RLYE+GARRVLVTGTGPLGCVPAELAQ S NG+CA E QQA+A+FNP L++
Sbjct  200  ISEYRKILLRLYELGARRVLVTGTGPLGCVPAELAQHSRNGECAAELQQASALFNPQLVQ  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++  LN ++GS IFV+ NA +   DFI+NPQAYGF+TSK+ACCGQG +NGIGLCT  SNL
Sbjct  260  LVNQLNSEIGSVIFVSANAFESNMDFISNPQAYGFITSKVACCGQGRFNGIGLCTPISNL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD +AFWDPFHPSERANR++V   + G NKYM+PMNLSTIM LDS+
Sbjct  320  CPNRDVFAFWDPFHPSERANRIIVDTFMIGDNKYMNPMNLSTIMHLDSR  368



>gb|EPS67986.1| hypothetical protein M569_06783, partial [Genlisea aurea]
Length=353

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +SEY  IL  LY++GARRVLVTG GPLGCVPAELA RS +G+CA E QQA++++N LL+E
Sbjct  186  VSEYHNILRTLYDLGARRVLVTGAGPLGCVPAELAMRSPDGRCAEEVQQASSLYNKLLVE  245

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN+++GSD+FVAVNA  MQNDFI+NP+A+GFVTSK+ACCGQGPYNG+GLCT ASNL
Sbjct  246  MILGLNKEVGSDVFVAVNAQGMQNDFIDNPRAFGFVTSKVACCGQGPYNGVGLCTGASNL  305

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C +RD+YAFWD FHPSE+ANR++V+ I TG ++YM PMNL+TIM LDS
Sbjct  306  CTDRDKYAFWDAFHPSEKANRIIVKTIFTGGDEYMIPMNLTTIMHLDS  353



>ref|XP_009348738.1| PREDICTED: GDSL esterase/lipase LTL1-like [Pyrus x bretschneideri]
Length=361

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISE RKIL+++Y++GARRVLVTGTGPLGC PAELA RS NG+CA E Q+AAA++NP LI+
Sbjct  192  ISELRKILLKMYDLGARRVLVTGTGPLGCAPAELAMRSRNGECAAELQRAAALYNPQLIQ  251

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  +N QLGSD+FVA N  + +NDFI NPQA+GF TSKIACCGQGPYNG+GLCT ASNL
Sbjct  252  MLRSVNSQLGSDVFVAANVQETRNDFIKNPQAFGFTTSKIACCGQGPYNGLGLCTRASNL  311

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSE+ NRL+V+ I+TG  KYM PMNLSTI+ LDS+
Sbjct  312  CPNRDLYAFWDAFHPSEKGNRLIVENIMTGDEKYMYPMNLSTILALDSR  360



>ref|XP_004237506.1| PREDICTED: GDSL esterase/lipase At5g33370 [Solanum lycopersicum]
Length=363

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+ +L +LY +GARRV+VTGTGPLGCVPAELAQRS +G CA + QQAA +FNP L+E
Sbjct  194  ISEYKNVLQKLYNLGARRVIVTGTGPLGCVPAELAQRSRDGSCADDLQQAAVLFNPQLVE  253

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN ++G+ +FVA N  QM  DFI +PQA+GFVTSK+ACCGQGPYNG+GLCT  SNL
Sbjct  254  MLNGLNSEIGTHVFVAANTNQMHLDFITDPQAFGFVTSKVACCGQGPYNGMGLCTPLSNL  313

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRDEYAFWDPFHP+E+ANR++V+ I+TGT  YM PMNLSTIMV+DSK
Sbjct  314  CPNRDEYAFWDPFHPTEKANRIIVEQIMTGTTDYMHPMNLSTIMVMDSK  362



>ref|XP_006371114.1| hypothetical protein POPTR_0019s04150g [Populus trichocarpa]
 gb|ERP48911.1| hypothetical protein POPTR_0019s04150g [Populus trichocarpa]
Length=395

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYR++LM+LY +GARRVLVTGTGPLGCVPAELA RS NG C+ E Q+AAA++NP L  
Sbjct  226  ISEYRELLMKLYNLGARRVLVTGTGPLGCVPAELATRSTNGGCSEELQRAAALYNPQLES  285

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI D+N+++GS++F++ N  QM  DF++NPQAYGF TSKIACCGQG YNG+GLCT  SNL
Sbjct  286  MINDVNRKIGSNVFISANTHQMHTDFVSNPQAYGFTTSKIACCGQGSYNGLGLCTILSNL  345

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWDPFHPSE+ANR++VQ I+TG+ +YM PMNLSTIM LDS+ 
Sbjct  346  CPNRDVYAFWDPFHPSEKANRIIVQQIMTGSTQYMKPMNLSTIMALDSRS  395



>ref|NP_001237641.2| uncharacterized LOC100500155 precursor [Glycine max]
Length=364

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYR IL RLY++G RRVLVTGTGP+GCVPAELA RS NG+C +E Q+AA++FNP L+E
Sbjct  195  ISEYRLILRRLYDLGGRRVLVTGTGPMGCVPAELALRSRNGECDVELQRAASLFNPQLVE  254

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LNQ++G+ +F+AVNA +M  DF+ NPQ +GFVTSKIACCGQGP+NG+GLCT  SNL
Sbjct  255  MVKGLNQEIGAHVFIAVNAYEMHMDFVTNPQDFGFVTSKIACCGQGPFNGVGLCTPLSNL  314

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSE+ANR++VQ ++TG+++YM PMNLSTIM LDS+
Sbjct  315  CPNRDLYAFWDPFHPSEKANRIIVQQMMTGSDQYMHPMNLSTIMALDSR  363



>ref|XP_010558733.1| PREDICTED: GDSL esterase/lipase LTL1 [Tarenaya hassleriana]
Length=366

 Score =   267 bits (683),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +SEYRKIL R+YE+GARRVLVTGTGP+GCVPAELA  S NG+C +E  +AAA+FNP L++
Sbjct  195  VSEYRKILTRVYELGARRVLVTGTGPMGCVPAELALHSRNGECGVELMRAAALFNPQLVD  254

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN ++GSD+F+A NA +M  DF+ NPQ +GFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  255  MINQLNSEIGSDVFIAANANEMHLDFVTNPQQFGFVTSKVACCGQGPYNGIGLCTPLSNL  314

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWDPFHPSE+ANR++VQ +LTG++KYM PMNLST ++LDS  
Sbjct  315  CPNRDLYAFWDPFHPSEKANRIIVQQMLTGSSKYMHPMNLSTALLLDSSS  364



>ref|XP_003626495.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES82713.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=371

 Score =   267 bits (683),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+KIL RLY++GARRV+VTGTGP+GCVPAELAQR  NG C++E Q+AAA+FNP LI+
Sbjct  201  ISEYKKILRRLYDLGARRVIVTGTGPIGCVPAELAQRGTNGGCSVELQRAAALFNPQLIQ  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +I  LN ++GS++F+  N  QM  DF+NNPQAYGFVTS+IACCGQGPYNG+GLCT  SNL
Sbjct  261  IIQQLNNEIGSNVFMGANTRQMALDFVNNPQAYGFVTSQIACCGQGPYNGLGLCTPLSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRDEYAFWD FHPSE+AN L+VQ IL+GT  YM PMNLST++ LDSK
Sbjct  321  CPNRDEYAFWDAFHPSEKANSLIVQQILSGTTDYMYPMNLSTVLALDSK  369



>ref|XP_008370770.1| PREDICTED: GDSL esterase/lipase LTL1-like [Malus domestica]
Length=361

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISE RKIL+++Y++GARRVLVTGTGP+GCVPAELA RS NG+CA E Q+A+A++NP LI+
Sbjct  192  ISELRKILLKMYDLGARRVLVTGTGPMGCVPAELAMRSRNGECAAELQRASALYNPQLIQ  251

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  +N QLGSD+FVA N  + +NDFI NPQA+GF TSK+ACCGQGPYNG+GLCT ASNL
Sbjct  252  MLRSVNSQLGSDVFVAANVQETRNDFIRNPQAFGFTTSKVACCGQGPYNGLGLCTRASNL  311

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSE+ NRL+V+ ILTG  KYM PMNLSTI+ LDS+
Sbjct  312  CPNRDLYAFWDAFHPSEKGNRLIVENILTGDEKYMYPMNLSTILALDSR  360



>ref|XP_004513280.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cicer arietinum]
Length=368

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL  +YE+GARRVLVTGTGPLGCVPAELA  S NG+CA E Q+A  +FNP L++
Sbjct  199  ISEYRKILENMYELGARRVLVTGTGPLGCVPAELAMHSRNGECATELQRAVNLFNPQLVQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +I  LN Q GSD+F++ NA  M  DF+N+PQAYGFVTSK+ACCGQG YNGIGLCT ASNL
Sbjct  259  LINQLNSQFGSDVFISANAFTMHLDFVNDPQAYGFVTSKVACCGQGAYNGIGLCTPASNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSE+ANRL+V   +TG+ +YM PMNLSTI+ LDS+
Sbjct  319  CPNRDLYAFWDPFHPSEKANRLIVDKFMTGSTEYMHPMNLSTIIALDSR  367



>ref|XP_010069682.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Eucalyptus grandis]
 gb|KCW58101.1| hypothetical protein EUGRSUZ_H00825 [Eucalyptus grandis]
 gb|KCW58102.1| hypothetical protein EUGRSUZ_H00825 [Eucalyptus grandis]
Length=374

 Score =   267 bits (683),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELA-QRSINGQCALEPQQAAAIFNPLLI  178
            ISEYR IL RLY++GARRVLVTGTGPLGCVPAELA Q S+NG+C  EPQQAAAIFNP L+
Sbjct  204  ISEYRNILRRLYDLGARRVLVTGTGPLGCVPAELASQGSLNGECVAEPQQAAAIFNPALV  263

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
             M+  LNQ+LGSD+F+A NA QM  DFI++PQ YGF+TSK+ACCGQG YNG+G+C   SN
Sbjct  264  RMVQGLNQELGSDVFIAANAFQMNMDFISDPQRYGFITSKVACCGQGAYNGVGICNPLSN  323

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC +R+ YAFWDPFHP+ERA RL+ Q IL+G   YMSPMNLSTIM LDSK
Sbjct  324  LCPDRNVYAFWDPFHPTERATRLIAQMILSGPADYMSPMNLSTIMALDSK  373



>gb|KHG28665.1| hypothetical protein F383_15485 [Gossypium arboreum]
Length=369

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+LMRLYE+GAR+VLVTGTGPLGCVPAELA RS NGQCA E Q+AA +FNP L++
Sbjct  198  ISEYRKLLMRLYELGARKVLVTGTGPLGCVPAELAMRSPNGQCAAELQRAAGLFNPQLVQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN  LG+++F+A N  Q  NDFI+NP A+GF TSKIACCGQGPYNG+GLCT ASNL
Sbjct  258  MINGLNSDLGANVFIAANTQQQTNDFISNPGAFGFTTSKIACCGQGPYNGLGLCTIASNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDPFHPSE+ANR++V  IL G+  YMSPMNLS+++ LD+
Sbjct  318  CPNRDLYAFWDPFHPSEKANRIIVNMILRGSTNYMSPMNLSSLLALDT  365



>ref|XP_008388753.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
 ref|XP_008350647.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
Length=363

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISE RK+L+++Y++G RRVLVTGTGPLGCVPAELA RS NG+C+ E Q+AA+++NP L++
Sbjct  194  ISELRKLLLKMYDLGVRRVLVTGTGPLGCVPAELAMRSRNGECSAELQRAASLYNPQLVQ  253

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++  LN QLGSD+F+A N  Q +NDF++NPQAYGF TSKIACCGQGPYNG+GLCT ASNL
Sbjct  254  LLRSLNSQLGSDVFIAANTQQTRNDFVSNPQAYGFSTSKIACCGQGPYNGLGLCTVASNL  313

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR++YAFWD FHP+E+AN+L+VQ ILTG  KYM PMNLSTI+ LDS+
Sbjct  314  CPNRNQYAFWDAFHPTEKANKLIVQNILTGDEKYMYPMNLSTILALDSR  362



>ref|XP_004302115.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISE+RK+L+RLY++G RRVLVTGTGPLGCVPAELA RS NGQCA E Q+AA++FNP L +
Sbjct  196  ISEFRKLLLRLYDLGGRRVLVTGTGPLGCVPAELAMRSTNGQCAPELQRAASLFNPQLTQ  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI ++N +LG+DIF+A N      DF++NPQAYGF TSKIACCGQGPYNG+GLCTA SN+
Sbjct  256  MIREVNSELGADIFIAANTQLSHYDFVSNPQAYGFTTSKIACCGQGPYNGLGLCTALSNV  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C +RD YAFWD FHPSERANR VVQAIL G  +YMSPMNLSTI+ LDS+
Sbjct  316  CPDRDLYAFWDAFHPSERANRYVVQAILNGGTEYMSPMNLSTILALDSR  364



>emb|CAN66351.1| hypothetical protein VITISV_039098 [Vitis vinifera]
Length=354

 Score =   266 bits (680),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+KILMRLY++GARRVLVTGTGP+GCVPAE A RS NG+CA E QQA+A+FNP L++
Sbjct  185  ISEYQKILMRLYKLGARRVLVTGTGPMGCVPAERAMRSRNGECAAELQQASALFNPQLVQ  244

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN++  +D+F+A N  +M  DFI +PQAYGF TSKIACCGQGPYNG+GLCT  SNL
Sbjct  245  MLQGLNKKFHADVFIAANTHEMHMDFITDPQAYGFTTSKIACCGQGPYNGLGLCTVLSNL  304

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR +YAFWD FHPSE+ANRL+VQ I+TG+  YM+PMNLSTIM LDS+
Sbjct  305  CPNRGQYAFWDAFHPSEKANRLIVQQIMTGSTMYMNPMNLSTIMALDSR  353



>ref|XP_009379724.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Pyrus x bretschneideri]
Length=363

 Score =   266 bits (681),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISE RK+L+++Y++GARRVLVTGTGPLGCVPAELA RS NG+C+ E Q+AA+++NP LI+
Sbjct  194  ISELRKLLLKMYDLGARRVLVTGTGPLGCVPAELAMRSRNGECSAELQRAASLYNPQLIQ  253

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  +N QLGSD+F+A N  Q  NDF++NPQA+GF TSKIACCGQGPYNG+GLCT ASNL
Sbjct  254  MLKSVNSQLGSDVFIAANTQQTHNDFVSNPQAFGFSTSKIACCGQGPYNGLGLCTVASNL  313

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR++YAFWD FHPSE+AN+L+VQ IL G  KYM PMNLSTI+ LDS+
Sbjct  314  CPNRNQYAFWDAFHPSEKANKLIVQNILKGDEKYMYPMNLSTILALDSR  362



>ref|XP_004155142.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cucumis sativus]
Length=440

 Score =   269 bits (687),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L  LYE GARRVLVTGTGPLGCVPAELA R  NG+C+ E Q+AAA+FNP L +
Sbjct  271  ISEYRKVLASLYEFGARRVLVTGTGPLGCVPAELAMRGRNGECSAELQRAAALFNPQLAQ  330

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +I  LN+++GS +F+AVN   M  DF++NPQAYGF+TSK+ACCGQGP+NGIGLCT ASNL
Sbjct  331  IINSLNEEIGSHVFIAVNTQMMHMDFVSNPQAYGFITSKVACCGQGPFNGIGLCTPASNL  390

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ YAFWDPFHPSERANR++VQ ILTGT +YM PMNLSTI+ +DS+
Sbjct  391  CRNRNVYAFWDPFHPSERANRIIVQQILTGTQEYMHPMNLSTILAMDSR  439



>ref|XP_004302114.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   266 bits (681),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL RLYE+GAR+VLVTGTG LGCVPAELA RS NG+C++E Q+AA++FNP L++
Sbjct  195  ISEYRKILNRLYELGARQVLVTGTGSLGCVPAELAMRSRNGECSVELQRAASLFNPQLVQ  254

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN ++G+++F+A N+ +M  DFI++P AYGFVTSKIACCGQGPYNGIGLCT  SNL
Sbjct  255  MIGSLNSEIGANVFIASNSNEMHMDFISDPGAYGFVTSKIACCGQGPYNGIGLCTPLSNL  314

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWDPFHPSE+ANRL+VQ ILTG++KYM PMNLST++ LD+  
Sbjct  315  CPNRDLYAFWDPFHPSEKANRLIVQQILTGSDKYMHPMNLSTMLSLDNSR  364



>ref|XP_004173982.1| PREDICTED: GDSL esterase/lipase At5g33370-like, partial [Cucumis 
sativus]
Length=240

 Score =   262 bits (670),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            I EYRK+L+RLYE+GARRVLVTGTGPLGCVPAELA R S  GQC+ E Q+AAA++NP L+
Sbjct  70   IVEYRKLLLRLYELGARRVLVTGTGPLGCVPAELAMRGSSGGQCSEELQRAAALYNPKLL  129

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +MI  LN QLGS++FVAVN  QM  DFI+NP+AYGF TSK+ACCGQGPYNG+GLCT ASN
Sbjct  130  QMIKGLNTQLGSNVFVAVNTQQMHIDFISNPRAYGFETSKVACCGQGPYNGLGLCTVASN  189

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC+NRD YAFWD FHPSE+AN ++V+ + +GT +YM PMNL+TI+ LDSK
Sbjct  190  LCSNRDAYAFWDAFHPSEKANGIIVKQMFSGTTQYMYPMNLTTILQLDSK  239



>ref|XP_010438383.1| PREDICTED: GDSL esterase/lipase At4g28780 [Camelina sativa]
Length=363

 Score =   266 bits (680),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            ISEY+KIL+RLYE+GARRV+VTGTGPLGCVPAELA   S+NG+CA E QQAAAIFNPLL+
Sbjct  193  ISEYKKILVRLYELGARRVMVTGTGPLGCVPAELASSGSVNGECAPEAQQAAAIFNPLLV  252

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+  LN+++GSD+F+  NA +M  DFINNPQ +GFVTSK+ACCGQG YNG G+CT  S+
Sbjct  253  QMLQGLNREIGSDVFIGANAFEMNADFINNPQRFGFVTSKVACCGQGAYNGRGICTPLSS  312

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC +R+ YAFWDPFHP+E+A RL+VQ I+TG+ +YMSPMNLSTIM LDS+
Sbjct  313  LCPDRNAYAFWDPFHPTEKATRLIVQQIMTGSVEYMSPMNLSTIMALDSR  362



>ref|NP_198322.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q8LB81.1|GDL79_ARATH RecName: Full=GDSL esterase/lipase At5g33370; AltName: Full=Extracellular 
lipase At5g33370; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM64916.1| putative GDSL-motif lipase/acylhydrolase [Arabidopsis thaliana]
 gb|AAO42146.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50514.1| unknown protein [Arabidopsis thaliana]
 gb|AED93898.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=366

 Score =   266 bits (680),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L ++Y++GARRVLVTGTGP+GCVPAELAQRS NG+CA E Q+AA++FNP LI+
Sbjct  197  ISEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRNGECATELQRAASLFNPQLIQ  256

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI DLN ++GS  F+A N  QM  DFI++PQAYGFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  257  MITDLNNEVGSSAFIAANTQQMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTPLSNL  316

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD +AFWDPFHPSE+A+R++ Q IL G+ +YM PMNLSTI+ +DS
Sbjct  317  CPNRDLFAFWDPFHPSEKASRIIAQQILNGSPEYMHPMNLSTILTVDS  364



>emb|CDO99962.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLY++GARRV+VTGTGPLGCVPAELA RS NG+C+ E Q+AA +FNP LI+
Sbjct  201  ISEYQKVLSRLYDLGARRVIVTGTGPLGCVPAELAMRSRNGECSAELQRAAGLFNPQLIQ  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN ++G D+F+  N  QM NDFI NP A+GFV+SK+ACCGQGPYNG+GLCT  SNL
Sbjct  261  MLRGLNSKIGKDVFIGANTQQMHNDFITNPGAFGFVSSKVACCGQGPYNGLGLCTGLSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD+YAFWDPFHPSE+AN+++VQ ILTG+  YM+PMNLSTI+ +DS
Sbjct  321  CPNRDQYAFWDPFHPSEKANKIIVQQILTGSTDYMTPMNLSTILAVDS  368



>gb|ACU23725.1| unknown [Glycine max]
Length=372

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL  LYE+GARRVLVTGTGPLGCVPAELA  S NG+CA E Q+A ++FNP L++
Sbjct  203  ISEYRKILANLYELGARRVLVTGTGPLGCVPAELAMHSQNGECATELQRAVSLFNPQLVQ  262

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++ +LN Q+GSD+F++ NA  M  DF++NPQAYGFVTSK+AC GQG YNGIGLCT ASNL
Sbjct  263  LLHELNTQIGSDVFISANAFTMHLDFVSNPQAYGFVTSKVACGGQGAYNGIGLCTPASNL  322

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDPFHPSERANRL+V   +TG+ +YM PMNLSTI+ LDS
Sbjct  323  CPNRDLYAFWDPFHPSERANRLIVDKFMTGSTEYMHPMNLSTIIALDS  370



>ref|XP_003589465.1| GDSL esterase/lipase [Medicago truncatula]
 ref|XP_003590913.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES59716.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=368

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L +LY++G R+VLVTGTGP+GCVPAELA RS NG C +E  +AA+++NP L+E
Sbjct  199  ISEYKKVLKKLYDLGGRKVLVTGTGPMGCVPAELALRSRNGDCDVELVRAASLYNPQLVE  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI +LN ++GSD+F+A NA QM  DFI NPQA+GFVTSKIACCGQGPYNGIGLCT  SNL
Sbjct  259  MIKELNTEIGSDVFIAANARQMHMDFITNPQAFGFVTSKIACCGQGPYNGIGLCTPLSNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLD  502
            C NRD YAFWDPFHPSE+A+R++VQ ILTG+N+YM PMNLST++ +D
Sbjct  319  CQNRDLYAFWDPFHPSEKASRIIVQQILTGSNEYMYPMNLSTVLAMD  365



>ref|XP_002868396.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH44655.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=366

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L ++Y++GARRVLVTGTGP+GCVPAELAQRS NG+CA E Q+AA++FNP L++
Sbjct  197  ISEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRNGECATELQRAASLFNPQLVQ  256

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI DLN ++GS  F+A N  QM  DFI++PQAYGFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  257  MITDLNNEVGSSAFIAANTQQMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTPLSNL  316

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD +AFWDPFHPSE+A+R++ Q IL G+ +YM PMNLSTI+ +DS
Sbjct  317  CPNRDLFAFWDPFHPSEKASRIIAQQILNGSPEYMHPMNLSTILTVDS  364



>ref|XP_002325361.2| hypothetical protein POPTR_0019s04140g [Populus trichocarpa]
 gb|EEE99742.2| hypothetical protein POPTR_0019s04140g [Populus trichocarpa]
Length=364

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY KILM+LY++GARRVLVTGTGP+GCVPAELA RS NG C+ E Q+AA++FNP L++
Sbjct  195  ISEYEKILMKLYKLGARRVLVTGTGPMGCVPAELAMRSTNGGCSAELQRAASLFNPQLVQ  254

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++G+ +F+A N  Q   DFI+NPQAYGF T+K ACCGQGPYNG+GLCTAASNL
Sbjct  255  MLKGLNKKIGNTVFIAANTQQSHLDFISNPQAYGFTTAKTACCGQGPYNGLGLCTAASNL  314

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSE+ANRL+V+ I +GT KYM PMNLSTIM LD++
Sbjct  315  CPNRDLYAFWDAFHPSEKANRLIVEQIYSGTTKYMDPMNLSTIMTLDAR  363



>ref|XP_010530493.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X2 [Tarenaya 
hassleriana]
Length=302

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQ-AAAIFNPLLI  178
            +SEYRK+L +LY++GARRVLVTGTGP+GCVPAELAQRS +G+CA+E ++ AA++FNP L 
Sbjct  132  VSEYRKVLRKLYDLGARRVLVTGTGPMGCVPAELAQRSRDGECAVEQRRRAASLFNPRLA  191

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +MI DLN ++GS +F+A N  +M  DFI++PQAYGFVTSKIACCGQGPYNGIGLCT ASN
Sbjct  192  QMINDLNGEVGSSVFIAANTQRMHMDFISDPQAYGFVTSKIACCGQGPYNGIGLCTPASN  251

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            LC NRD YAFWDPFHPSE+ANR++ + ILTG+ +YM PMNLS+I+ LDS
Sbjct  252  LCPNRDLYAFWDPFHPSEKANRIIARQILTGSPQYMHPMNLSSILTLDS  300



>ref|XP_008382662.1| PREDICTED: GDSL esterase/lipase At4g28780 [Malus domestica]
Length=368

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL+RLYE+GAR+VLVTGTGPLGCVP+ELAQRS NG+C  E Q A AIFNP L++
Sbjct  199  ISEYRKILLRLYELGARKVLVTGTGPLGCVPSELAQRSQNGECNPELQNAGAIFNPQLVQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+QLGSDIF+  NA  M  DFI++PQ +GFVTSK+ACCGQGPYNG+G C   SNL
Sbjct  259  MVQGLNKQLGSDIFITANAFDMHMDFISDPQKFGFVTSKVACCGQGPYNGLGQCNRLSNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWD FHP+E+A RL+VQ I++G++KYM+PMNLSTIM LDS
Sbjct  319  CPNRDLYAFWDAFHPTEKATRLIVQQIMSGSSKYMNPMNLSTIMALDS  366



>emb|CBI28654.3| unnamed protein product [Vitis vinifera]
Length=362

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+KILMRLY++GARRVLVTGTGP+GCVPAE A RS NG+CA E QQA+A+FNP L++
Sbjct  193  ISEYQKILMRLYKLGARRVLVTGTGPMGCVPAERAMRSRNGECAAELQQASALFNPQLVQ  252

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN++  +D+F+A N  +M  DFI +PQA+GF TSKIACCGQGPYNG+GLCT  SNL
Sbjct  253  MLQGLNKKFHADVFIAANTHEMHMDFITDPQAFGFTTSKIACCGQGPYNGLGLCTVLSNL  312

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR +YAFWD FHPSE+ANRL+VQ I+TG+  YM+PMNLSTIM LDS+
Sbjct  313  CPNRGQYAFWDAFHPSEKANRLIVQQIMTGSTMYMNPMNLSTIMALDSR  361



>ref|XP_002268826.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Vitis vinifera]
Length=368

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+KILMRLY++GARRVLVTGTGP+GCVPAE A RS NG+CA E QQA+A+FNP L++
Sbjct  199  ISEYQKILMRLYKLGARRVLVTGTGPMGCVPAERAMRSRNGECAAELQQASALFNPQLVQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN++  +D+F+A N  +M  DFI +PQA+GF TSKIACCGQGPYNG+GLCT  SNL
Sbjct  259  MLQGLNKKFHADVFIAANTHEMHMDFITDPQAFGFTTSKIACCGQGPYNGLGLCTVLSNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR +YAFWD FHPSE+ANRL+VQ I+TG+  YM+PMNLSTIM LDS+
Sbjct  319  CPNRGQYAFWDAFHPSEKANRLIVQQIMTGSTMYMNPMNLSTIMALDSR  367



>ref|XP_004494759.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cicer arietinum]
Length=362

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLY++GARRVLVTGTGP+GC PAE+A +S NG+CALE Q+AAAI+NP L++
Sbjct  193  ISEYRKVLRRLYDLGARRVLVTGTGPIGCAPAEIALKSPNGECALELQRAAAIYNPQLVQ  252

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LNQ++GSDIF+A +A +M  DFI+NPQAYGFVT+K+ACCGQGPYNGIGLCT  SNL
Sbjct  253  MIKGLNQEIGSDIFIAADAYRMHMDFISNPQAYGFVTAKVACCGQGPYNGIGLCTPVSNL  312

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD Y FWD FHP+ERA++++VQ IL+G+ +YM PMNL+TIM LDS
Sbjct  313  CPNRDLYVFWDAFHPTERASKIIVQQILSGSPEYMYPMNLTTIMALDS  360



>emb|CAN67727.1| hypothetical protein VITISV_038832 [Vitis vinifera]
 emb|CBI28653.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L+RL+E+GARRVLVT TGPLGCVPAELA RS  G+CA+E Q+AA +FNP L +
Sbjct  198  ISEYRKVLIRLFELGARRVLVTATGPLGCVPAELALRSRTGECAIELQRAAGLFNPQLFQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN ++GS +F+A NA  M  DFI+NPQAYGFVTSK+ACCGQGPYNG+GLCT AS+L
Sbjct  258  MLDGLNNEIGSQVFIAANAFGMHMDFISNPQAYGFVTSKVACCGQGPYNGLGLCTVASSL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ YAFWD FHPSERANR++VQ ILTG+ +YM PMNLSTIM LDS+
Sbjct  318  CPNRNLYAFWDAFHPSERANRIIVQRILTGSTEYMYPMNLSTIMDLDSR  366



>ref|XP_006403052.1| hypothetical protein EUTSA_v10003456mg [Eutrema salsugineum]
 gb|ESQ44505.1| hypothetical protein EUTSA_v10003456mg [Eutrema salsugineum]
Length=366

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L ++Y++GARRVLVTGTGP+GCVPAELAQRS NG+C+ E Q+AA++FNP L++
Sbjct  197  ISEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRNGECSTELQRAASLFNPQLVQ  256

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI DLN ++GS  F+A N  QM  DFI+NPQAYGFV+SK+ACCGQGPYNGIGLCT  SNL
Sbjct  257  MINDLNNEVGSSAFIAANTQQMHMDFISNPQAYGFVSSKVACCGQGPYNGIGLCTPISNL  316

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD +AFWDPFHPSE+A+R++ Q IL G+ +YM PMNLSTI+ LDS
Sbjct  317  CPNRDLFAFWDPFHPSEKASRIIAQQILNGSPQYMHPMNLSTILSLDS  364



>ref|XP_007144437.1| hypothetical protein PHAVU_007G156000g [Phaseolus vulgaris]
 gb|ESW16431.1| hypothetical protein PHAVU_007G156000g [Phaseolus vulgaris]
Length=366

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL+RLYE+G RRVLVTGTGPLGCVPA+LA RS NG+C  E Q+AA IFNPLL+E
Sbjct  195  ISEYRKILLRLYELGGRRVLVTGTGPLGCVPAQLATRSRNGECVAELQEAAQIFNPLLVE  254

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M  D+N Q+GS++FVAVNA QM  +FI +PQ +GFVTSKIACCGQG +NGIGLCTAASNL
Sbjct  255  MTRDINSQVGSEVFVAVNAFQMNMNFITDPQRFGFVTSKIACCGQGRFNGIGLCTAASNL  314

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDP+HPS+RA   +VQ I +GT+  M+PMNLSTIM +DS
Sbjct  315  CPNRDTYAFWDPYHPSQRALGFIVQDIFSGTSDIMTPMNLSTIMAIDS  362



>gb|EYU33157.1| hypothetical protein MIMGU_mgv1a008646mg [Erythranthe guttata]
Length=367

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+KIL+RLYE+GARRVLVTGTGPLGCVPAELAQR  NGQCA + QQA+A+FNP L +
Sbjct  198  ISEYQKILLRLYELGARRVLVTGTGPLGCVPAELAQRGRNGQCAPDLQQASALFNPQLTQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN QLG ++F+A N      +FI+NPQ +GFVTSK+ACCGQGPYNG+GLCTA SNL
Sbjct  258  MILGLNAQLGDNVFIAANTQLTHYNFISNPQDFGFVTSKVACCGQGPYNGLGLCTALSNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSERANRL+V  I TG+ +YM+PMNLSTIM LDS+
Sbjct  318  CPNRDIYAFWDAFHPSERANRLIVSQIFTGSVEYMNPMNLSTIMALDSR  366



>ref|XP_004249922.1| PREDICTED: GDSL esterase/lipase At5g33370 [Solanum lycopersicum]
 gb|AEJ88779.1| cutin-deficient 1 protein [Solanum lycopersicum]
Length=362

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I EYRKILM +Y +GARRV+VTGTGPLGCVPAELAQRS NG+C+ E Q+AA +FNP L +
Sbjct  193  IREYRKILMNVYNLGARRVIVTGTGPLGCVPAELAQRSRNGECSPELQRAAGLFNPQLTQ  252

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN +LGSD+F+A N  QM  +FI NPQAYGF+TSK+ACCGQGPYNG+GLCT  SNL
Sbjct  253  MLQGLNSELGSDVFIAANTQQMHTNFITNPQAYGFITSKVACCGQGPYNGLGLCTPLSNL  312

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSERAN+++VQ I++GT + M+PMNLSTI+ +DS 
Sbjct  313  CPNRDVYAFWDPFHPSERANKIIVQQIMSGTTELMNPMNLSTILAMDSH  361



>ref|XP_009348740.1| PREDICTED: GDSL esterase/lipase LTL1-like [Pyrus x bretschneideri]
Length=361

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISE RKIL+++Y++G RRVLVTGTGP+GCVPAELA RS NG+CA E Q+A+A++NP LI+
Sbjct  192  ISELRKILLKMYDLGVRRVLVTGTGPMGCVPAELAMRSRNGECAAELQRASALYNPQLIQ  251

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  +N QLGSD+FVA N  + +NDFI NPQA+GF TSKIACCGQGPYNG+GLCT ASNL
Sbjct  252  MLRSVNSQLGSDVFVAANIQETRNDFIRNPQAFGFTTSKIACCGQGPYNGLGLCTRASNL  311

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSE+ NRL+V+ ILTG  KYM PMNLSTI+ LDS+
Sbjct  312  CPNRDLYAFWDAFHPSEKGNRLIVENILTGDEKYMYPMNLSTILALDSR  360



>ref|XP_002268296.2| PREDICTED: GDSL esterase/lipase At5g33370 [Vitis vinifera]
Length=384

 Score =   265 bits (678),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L+RL+E+GARRVLVT TGPLGCVPAELA RS  G+CA+E Q+AA +FNP L +
Sbjct  215  ISEYRKVLIRLFELGARRVLVTATGPLGCVPAELALRSRTGECAIELQRAAGLFNPQLFQ  274

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN ++GS +F+A NA  M  DFI+NPQAYGFVTSK+ACCGQGPYNG+GLCT AS+L
Sbjct  275  MLDGLNNEIGSQVFIAANAFGMHMDFISNPQAYGFVTSKVACCGQGPYNGLGLCTVASSL  334

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ YAFWD FHPSERANR++VQ ILTG+ +YM PMNLSTIM LDS+
Sbjct  335  CPNRNLYAFWDAFHPSERANRIIVQRILTGSTEYMYPMNLSTIMDLDSR  383



>ref|XP_003626492.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES82710.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=369

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL RLYE+GARRVLVTGTGPLGCVPAELAQ S NG+C  E Q+AA +FNP L++
Sbjct  200  ISEYRKILARLYELGARRVLVTGTGPLGCVPAELAQHSRNGECYAELQEAANLFNPQLVD  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++  LN ++GSD+F++ NA  M  DFI NP+AYGF TSK+ACCGQGPYNGIGLCT ASN+
Sbjct  260  LLGQLNSEIGSDVFISANAFAMNMDFIGNPEAYGFATSKVACCGQGPYNGIGLCTPASNI  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD Y FWD FHPS+RANRL+V+  + G+++YM PMNLSTIM+LDS+
Sbjct  320  CPNRDAYVFWDAFHPSDRANRLIVERFMIGSSEYMHPMNLSTIMLLDSR  368



>gb|KEH21597.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=356

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I EYRK L RLY++GARRVLVTGTGPLGC PAELA RS NG+C++E Q+ AA++NP L +
Sbjct  187  ICEYRKHLQRLYDLGARRVLVTGTGPLGCAPAELATRSTNGECSMELQRGAALYNPQLEQ  246

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN++LGSDIF+A N  QM  DF+ NP AYGFVTSK+ACCGQGPYNGIG+CT  SNL
Sbjct  247  MLQRLNRKLGSDIFIAANTAQMHKDFVTNPTAYGFVTSKVACCGQGPYNGIGVCTTLSNL  306

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD Y FWDPFHPSE+ANRL+V+ I++G+ +YM PMNLSTI++LD+
Sbjct  307  CPNRDLYVFWDPFHPSEKANRLIVEQIMSGSTRYMKPMNLSTILLLDA  354



>gb|EPS65950.1| hypothetical protein M569_08823, partial [Genlisea aurea]
Length=340

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLYE+G RR++VTGTGPLGCVPAELAQ S NG+C  E Q+AAA+FNP L++
Sbjct  172  ISEYKKVLKRLYELGPRRIIVTGTGPLGCVPAELAQHSQNGECVPELQKAAALFNPQLVQ  231

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ +LN+++GS  F+A N  QM  DF++NPQA+GFV+S++ACCGQGPYNG+GLCT  SNL
Sbjct  232  MLDELNREVGSHAFLAANTNQMHMDFMSNPQAFGFVSSQVACCGQGPYNGLGLCTGFSNL  291

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C+NRD+Y FWDPFHPSE+AN+L+VQ ILTGTN YM P+NL+T+M LD +
Sbjct  292  CSNRDQYVFWDPFHPSEKANKLIVQQILTGTNTYMHPLNLTTLMALDKQ  340



>gb|KHN14896.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLY++GARRVLVTGTGPLGCVP+ELAQR  NGQCA E QQAAA+FNP L +
Sbjct  201  ISEYQKLLQRLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEQ  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++ +D+F+A N  +  NDF+ NPQ +GFVTS++ACCGQGPYNGIGLCTA SNL
Sbjct  261  MLLQLNRKIATDVFIAANTGKAHNDFVTNPQQFGFVTSQVACCGQGPYNGIGLCTALSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C+NRD+YAFWD FHPSE+ANRL+V+ I++G+  YM+PMNLSTI+ LDS
Sbjct  321  CSNRDQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDS  368



>gb|KDO52501.1| hypothetical protein CISIN_1g017684mg [Citrus sinensis]
Length=292

 Score =   261 bits (668),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLY++GARRVLVTGTGPLGCVPAE A R  NGQCA + Q+AA ++NP L++
Sbjct  123  ISEYRKLLTRLYDLGARRVLVTGTGPLGCVPAERAMRGRNGQCAADLQRAADLYNPQLVQ  182

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++ DLN Q GS+IFVAVN  +MQ +FI+NP+A+GF TSK+ACCGQGPYNG+GLCT ASNL
Sbjct  183  LVKDLNSQYGSEIFVAVNTGKMQYNFISNPRAFGFTTSKVACCGQGPYNGLGLCTPASNL  242

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR  YAFWDPFHPSERAN  +VQ  +TG+ +YM PMNLSTIM LDS+
Sbjct  243  CPNRAVYAFWDPFHPSERANGFIVQEFMTGSTEYMYPMNLSTIMALDSR  291



>ref|XP_010440676.1| PREDICTED: GDSL esterase/lipase At5g33370 isoform X1 [Camelina 
sativa]
 ref|XP_010450323.1| PREDICTED: GDSL esterase/lipase At5g33370 isoform X1 [Camelina 
sativa]
Length=366

 Score =   263 bits (673),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L ++Y++GARRVLVTGTGP+GCVPAELAQRS NG+CA E Q+AA++FNP L++
Sbjct  197  ISEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRNGECATELQRAASLFNPQLVQ  256

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI DLN ++GS  F+A N  QM  DFI++PQAYGFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  257  MITDLNNEVGSSAFIAANTQQMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTPLSNL  316

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLD  502
            C NRD +AFWDPFHPSE+A+R++ Q IL G+ +YM PMNLST++ +D
Sbjct  317  CPNRDLFAFWDPFHPSEKASRIIAQQILNGSPEYMHPMNLSTVLTVD  363



>ref|XP_010530492.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Tarenaya 
hassleriana]
Length=361

 Score =   263 bits (673),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQ-AAAIFNPLLI  178
            +SEYRK+L +LY++GARRVLVTGTGP+GCVPAELAQRS +G+CA+E ++ AA++FNP L 
Sbjct  191  VSEYRKVLRKLYDLGARRVLVTGTGPMGCVPAELAQRSRDGECAVEQRRRAASLFNPRLA  250

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +MI DLN ++GS +F+A N  +M  DFI++PQAYGFVTSKIACCGQGPYNGIGLCT ASN
Sbjct  251  QMINDLNGEVGSSVFIAANTQRMHMDFISDPQAYGFVTSKIACCGQGPYNGIGLCTPASN  310

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            LC NRD YAFWDPFHPSE+ANR++ + ILTG+ +YM PMNLS+I+ LDS
Sbjct  311  LCPNRDLYAFWDPFHPSEKANRIIARQILTGSPQYMHPMNLSSILTLDS  359



>ref|XP_010043320.1| PREDICTED: GDSL esterase/lipase At5g18430-like [Eucalyptus grandis]
 gb|KCW85325.1| hypothetical protein EUGRSUZ_B02164 [Eucalyptus grandis]
Length=369

 Score =   263 bits (673),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISE++K LMRL+++GARRVLVTGTGPLGCVPAELA R  NGQC  E QQAA+++NP L++
Sbjct  200  ISEFKKQLMRLHDLGARRVLVTGTGPLGCVPAELAMRGRNGQCVAELQQAASLYNPQLLQ  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ DLN +  S +F+A N   M N+FI NP+AYGF+T+K+ACCGQGPYNGIGLCT AS L
Sbjct  260  MLKDLNNKYKSQVFIAANTQLMHNNFIANPRAYGFITAKVACCGQGPYNGIGLCTVASTL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD+YAFWDPFHPS++ANRL+VQ I++G+ KYM PMN+STIM LDS+
Sbjct  320  CPNRDQYAFWDPFHPSQKANRLIVQQIMSGSTKYMDPMNVSTIMALDSR  368



>ref|XP_011038584.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Populus euphratica]
Length=192

 Score =   257 bits (657),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  20   ILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIEMIADLN  199
            +  R+YE+GARR+LVTGTGPLGC PAE A RS NG+CA+E Q+AAA+FNP L++MI +LN
Sbjct  29   VAARVYELGARRILVTGTGPLGCAPAERATRSRNGECAVELQRAAALFNPQLVQMITELN  88

Query  200  QQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNLCANRDE  379
            +++GSD+F+A NA  M  DF+ NPQAYGFVTS++ACCGQG +NGIGLCT ASNLC NR+ 
Sbjct  89   KEIGSDVFIATNAYDMNTDFVTNPQAYGFVTSQVACCGQGRFNGIGLCTIASNLCPNREI  148

Query  380  YAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            +AFWDPFHP+ERANR++V  I+TG  KYM+PMNLSTIM LDS+
Sbjct  149  FAFWDPFHPTERANRIIVSTIVTGDTKYMNPMNLSTIMALDSR  191



>gb|KDO52499.1| hypothetical protein CISIN_1g017684mg [Citrus sinensis]
Length=343

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLY++GARRVLVTGTGPLGCVPAE A R  NGQCA + Q+AA ++NP L++
Sbjct  174  ISEYRKLLTRLYDLGARRVLVTGTGPLGCVPAERAMRGRNGQCAADLQRAADLYNPQLVQ  233

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++ DLN Q GS+IFVAVN  +MQ +FI+NP+A+GF TSK+ACCGQGPYNG+GLCT ASNL
Sbjct  234  LVKDLNSQYGSEIFVAVNTGKMQYNFISNPRAFGFTTSKVACCGQGPYNGLGLCTPASNL  293

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR  YAFWDPFHPSERAN  +VQ  +TG+ +YM PMNLSTIM LDS+
Sbjct  294  CPNRAVYAFWDPFHPSERANGFIVQEFMTGSTEYMYPMNLSTIMALDSR  342



>ref|XP_008370782.1| PREDICTED: GDSL esterase/lipase LTL1-like [Malus domestica]
Length=361

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISE RKIL+++Y++GARRVLVTGTGP+GC PAELA RS NG+CA E Q+A+A++NP LI+
Sbjct  192  ISELRKILLKMYDLGARRVLVTGTGPMGCXPAELAMRSRNGECAAELQRASALYNPQLIQ  251

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  +N QLGSD+FVA N  + +NDFI NPQA+GF TSK+ACCGQGPYNG+GLCT ASNL
Sbjct  252  MLRSVNSQLGSDVFVAANVQETRNDFIRNPQAFGFTTSKVACCGQGPYNGLGLCTRASNL  311

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSE+ NRL+V+ I TG  KYM PMNLSTI+ LDS+
Sbjct  312  CPNRDLYAFWDAFHPSEKGNRLIVENIXTGDEKYMYPMNLSTILALDSR  360



>ref|XP_009108075.1| PREDICTED: GDSL esterase/lipase At5g33370 [Brassica rapa]
Length=366

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +SEYRK+L ++Y++GARRVLVTGTGP+GCVPAELAQRS  G+C+ E Q+AA++FNP L++
Sbjct  197  VSEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRTGECSTELQRAASLFNPQLVQ  256

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI DLN ++GS  F+A N  QM  DFI++PQAYGFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  257  MINDLNNEVGSSAFIAANTQQMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTPLSNL  316

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD +AFWDPFHPSE+A+R++ Q IL G+ +YM PMNLSTI+ LDS
Sbjct  317  CPNRDLFAFWDPFHPSEKASRIIAQQILNGSPEYMHPMNLSTILTLDS  364



>emb|CDY47551.1| BnaA08g07360D [Brassica napus]
Length=366

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +SEYRK+L ++Y++GARRVLVTGTGP+GCVPAELAQRS  G+C+ E Q+AA++FNP L++
Sbjct  197  VSEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRTGECSTELQRAASLFNPQLVQ  256

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI DLN ++GS  F+A N  QM  DFI++PQAYGFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  257  MINDLNNEVGSSAFIAANTQQMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTPLSNL  316

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD +AFWDPFHPSE+A+R++ Q IL G+ +YM PMNLSTI+ LDS
Sbjct  317  CPNRDLFAFWDPFHPSEKASRIIAQQILDGSPEYMHPMNLSTILTLDS  364



>ref|XP_010447915.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Camelina sativa]
Length=367

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            ISEY+KIL RLYE+GARRV+VTGTGPLGCVPAELA   S+NG+CA E QQAAAIFNPLL+
Sbjct  197  ISEYKKILARLYELGARRVMVTGTGPLGCVPAELASSGSVNGECAPEAQQAAAIFNPLLV  256

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+  LN ++GSD+F+  NA  M  DFINNPQ +GFVTSK+ACCGQG YNG G+CT  S+
Sbjct  257  QMLQGLNSEIGSDVFIGANAFNMNADFINNPQRFGFVTSKVACCGQGAYNGRGICTPLSS  316

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC +R+ YAFWDPFHP+E+A RL+VQ I+TG+ +YM+PMNLSTIM LDS+
Sbjct  317  LCPDRNAYAFWDPFHPTEKATRLIVQQIMTGSAEYMNPMNLSTIMALDSR  366



>gb|KDO52498.1| hypothetical protein CISIN_1g017684mg [Citrus sinensis]
Length=368

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RLY++GARRVLVTGTGPLGCVPAE A R  NGQCA + Q+AA ++NP L++
Sbjct  199  ISEYRKLLTRLYDLGARRVLVTGTGPLGCVPAERAMRGRNGQCAADLQRAADLYNPQLVQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++ DLN Q GS+IFVAVN  +MQ +FI+NP+A+GF TSK+ACCGQGPYNG+GLCT ASNL
Sbjct  259  LVKDLNSQYGSEIFVAVNTGKMQYNFISNPRAFGFTTSKVACCGQGPYNGLGLCTPASNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR  YAFWDPFHPSERAN  +VQ  +TG+ +YM PMNLSTIM LDS+
Sbjct  319  CPNRAVYAFWDPFHPSERANGFIVQEFMTGSTEYMYPMNLSTIMALDSR  367



>ref|XP_006437267.1| hypothetical protein CICLE_v10033835mg [Citrus clementina]
 gb|ESR50507.1| hypothetical protein CICLE_v10033835mg [Citrus clementina]
Length=368

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K L RLYE+GARRVLVTGTGPLGCVPAELA R  +G C+ E Q+AAA++NP L++
Sbjct  198  ISEYKKQLKRLYELGARRVLVTGTGPLGCVPAELAMRGTDGGCSAELQRAAALYNPQLVQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ +LN+++G  IF+  N  QM  DF+++PQAYGFVTSKIACCGQGPYNG+GLCTA SNL
Sbjct  258  MLQELNREIGETIFIGANTQQMHMDFVSDPQAYGFVTSKIACCGQGPYNGLGLCTALSNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLD  502
            C NRD YAFWDPFHPSE+ANR++VQ I++G+ KYM+PMNLST++ LD
Sbjct  318  CPNRDLYAFWDPFHPSEKANRIIVQQIMSGSTKYMNPMNLSTVLALD  364



>emb|CDY35219.1| BnaA01g08120D [Brassica napus]
Length=346

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            ISEY+KILMRLYE+GARRV+VTGTGPLGCVPAELA   S NG+CA E QQAAAIFNPLL 
Sbjct  176  ISEYKKILMRLYELGARRVMVTGTGPLGCVPAELASSGSANGECAPEAQQAAAIFNPLLD  235

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+  LN+Q+GSD+F+  NA  M  DFINNPQ +GFVTSK+ACCGQG YNG G+CT  S+
Sbjct  236  QMLQGLNRQVGSDVFIGANAFNMNADFINNPQRFGFVTSKVACCGQGAYNGQGVCTPLSS  295

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC +R+ YAFWDPFHP+E+A RL+VQ I+TG+ +YM+PMNLSTIM LDS+
Sbjct  296  LCPDRNAYAFWDPFHPTEKATRLIVQQIMTGSVEYMNPMNLSTIMALDSR  345



>ref|XP_006484791.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Citrus sinensis]
Length=368

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K L RLYE+GARRVLVTGTGPLGCVPAELA R  +G C+ E Q+AAA++NP L++
Sbjct  198  ISEYKKQLKRLYELGARRVLVTGTGPLGCVPAELAMRGTDGGCSAELQRAAALYNPQLVQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ +LN+++G  IF+  N  QM  DF+++PQAYGFVTSKIACCGQGPYNG+GLCTA SNL
Sbjct  258  MLQELNREIGETIFIGANTQQMHMDFVSDPQAYGFVTSKIACCGQGPYNGLGLCTALSNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLD  502
            C NRD YAFWDPFHPSE+ANR++VQ I++G+ KYM+PMNLST++ LD
Sbjct  318  CPNRDLYAFWDPFHPSEKANRIIVQQIMSGSTKYMNPMNLSTVLALD  364



>ref|XP_008345728.1| PREDICTED: GDSL esterase/lipase LTL1-like [Malus domestica]
Length=361

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISE RKIL+++Y++GARRVLVTGTGP+GCVPAELA RS NG+CA E Q+A+A++NP LI+
Sbjct  192  ISELRKILLKMYDLGARRVLVTGTGPMGCVPAELAMRSRNGECAAELQRASALYNPQLIQ  251

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  +N QLGSD+FVA N  + +NDFI NPQA+GF TSK+ACCGQGPY G+GLCT ASNL
Sbjct  252  MLRSVNSQLGSDVFVAANVQETRNDFIXNPQAFGFTTSKVACCGQGPYXGLGLCTRASNL  311

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSE+ NRL+V+ I TG  KYM PMNLSTI+ LDS+
Sbjct  312  CPNRDLYAFWDAFHPSEKGNRLIVENIXTGDEKYMYPMNLSTILALDSR  360



>ref|XP_008443761.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Cucumis 
melo]
Length=366

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            I EYRKIL+RLYE+GARRVLVTGTGPLGCVPAELA R S  GQC+ E Q+AAA++NP L 
Sbjct  196  IVEYRKILLRLYELGARRVLVTGTGPLGCVPAELAMRGSTGGQCSAELQRAAALYNPKLF  255

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +MI  LN QLGS++FVAVN  QM  DFI+NP+AYGF TSK+ACCGQGPYNG+GLCT ASN
Sbjct  256  QMIKGLNSQLGSNVFVAVNTQQMHIDFISNPRAYGFETSKVACCGQGPYNGLGLCTVASN  315

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC+NRD YAFWD FHPS++AN ++V+ + +GT +YM PMNL+TI+ LDSK
Sbjct  316  LCSNRDAYAFWDAFHPSQKANGIIVKQMFSGTTQYMYPMNLTTILQLDSK  365



>ref|XP_003536954.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Glycine max]
Length=367

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I+EYRKILMRLYE+GARRVLVTGTGPLGCVPA+LA RS NG+C  E QQAA IFNPLL++
Sbjct  197  ITEYRKILMRLYELGARRVLVTGTGPLGCVPAQLATRSSNGECVPELQQAAQIFNPLLVQ  256

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M  ++N Q+GSD+FVAVNA QM  +FI +PQ +GFVTSKIACCGQG +NG+GLCTA SNL
Sbjct  257  MTREINSQVGSDVFVAVNAFQMNMNFITDPQRFGFVTSKIACCGQGRFNGVGLCTALSNL  316

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDP+HPS+RA   +V+ I +GT+  M+PMNLSTIM +DS
Sbjct  317  CPNRDTYAFWDPYHPSQRALGFIVRDIFSGTSDIMTPMNLSTIMAIDS  364



>ref|XP_003543915.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLY++GARRVLVTGTGPLGCVP+ELAQR  NGQCA E QQAAA+FNP L +
Sbjct  201  ISEYQKLLKRLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEQ  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++G D+F+A N  +  NDF++NPQ +GFVTS++ACCGQGPYNG+GLCTA SNL
Sbjct  261  MLLRLNRKIGKDVFIAANTGKTHNDFVSNPQQFGFVTSQVACCGQGPYNGLGLCTALSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C+NR++YAFWD FHPSE+ANRL+V+ I++G+  YM+PMNLSTI+ LD+
Sbjct  321  CSNREQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDA  368



>ref|XP_009129278.1| PREDICTED: GDSL esterase/lipase At4g28780 [Brassica rapa]
Length=361

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            ISEY+KILMRLYE+GARRV+VTGTGPLGCVPAELA   S NG+CA E QQAAAIFNPLL 
Sbjct  191  ISEYKKILMRLYELGARRVMVTGTGPLGCVPAELASSGSANGECAPEAQQAAAIFNPLLD  250

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+  LN+Q+GSD+F+  NA  M  DFINNPQ +GFVTSK+ACCGQG YNG G+CT  S+
Sbjct  251  QMLQGLNRQVGSDVFIGANAFNMNADFINNPQRFGFVTSKVACCGQGAYNGQGVCTPLSS  310

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC +R+ YAFWDPFHP+E+A RL+VQ I+TG+ +YM+PMNLSTIM LDS+
Sbjct  311  LCPDRNAYAFWDPFHPTEKATRLIVQQIMTGSVEYMNPMNLSTIMALDSR  360



>ref|XP_006283981.1| hypothetical protein CARUB_v10005104mg [Capsella rubella]
 gb|EOA16879.1| hypothetical protein CARUB_v10005104mg [Capsella rubella]
Length=364

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            ISEY+KIL RLYE+GARRV+VTGTGPLGCVPAELA   S+NG+CA E QQAAAIFNPLL+
Sbjct  194  ISEYKKILARLYELGARRVMVTGTGPLGCVPAELASSGSVNGECAPEAQQAAAIFNPLLV  253

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+  LN+++GSD+F+  NA  M  DFINNPQ +GFVTSK+ACCGQG YNG G+CT  S+
Sbjct  254  QMLQGLNREIGSDVFIGANAFNMNADFINNPQRFGFVTSKVACCGQGAYNGRGVCTPLSS  313

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC +R+ YAFWDPFHP+E+A RL+VQ I+TG+ +YM+PMNLSTIM LDS+
Sbjct  314  LCPDRNAYAFWDPFHPTEKATRLIVQQIMTGSVEYMNPMNLSTIMALDSR  363



>ref|XP_003541357.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L +LY++GARRVLVTGTGPLGCVP+ELAQR  NGQCA E QQAAA+FNP L +
Sbjct  201  ISEYQKLLQKLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEQ  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++GSD+F+A N  +  NDF+ NPQ +GFVTS++ACCGQGPYNG+GLCTA SNL
Sbjct  261  MLLQLNRKIGSDVFIAANTGKAHNDFVTNPQQFGFVTSQVACCGQGPYNGLGLCTALSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C+NR++YAFWD FHPSE+ANRL+V+ I++G+  YM+PMNLSTI+ LD+
Sbjct  321  CSNREQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDA  368



>ref|XP_010435380.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Camelina sativa]
Length=366

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L ++Y++GARRVLVTGTGP+GCVPAELAQRS NG+CA E Q+AA++FNP L++
Sbjct  197  ISEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRNGECATELQRAASLFNPQLVQ  256

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI +LN ++GS  F+A N  QM  DFI++PQAYGFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  257  MITELNNEVGSSAFIAANTQQMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTPLSNL  316

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLD  502
            C NRD +AFWDPFHPSE+A+R++ Q IL G+ +YM PMNLST++ +D
Sbjct  317  CPNRDLFAFWDPFHPSEKASRIIAQQILNGSPEYMHPMNLSTVLTVD  363



>ref|XP_006478980.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Citrus sinensis]
Length=368

 Score =   262 bits (669),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RL+++GARRVLVTGTGPLGCVPAE A R  NGQCA + Q+AA ++NP L++
Sbjct  199  ISEYRKLLTRLHDLGARRVLVTGTGPLGCVPAERAMRGRNGQCAADLQRAADLYNPQLVQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++ DLN Q GS+IFVAVN  +MQ +FI+NP+A+GF TSK+ACCGQGPYNG+GLCT ASNL
Sbjct  259  LVKDLNSQYGSEIFVAVNTGKMQYNFISNPRAFGFTTSKVACCGQGPYNGLGLCTPASNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ YAFWDPFHPSERAN  +VQ  +TG+ +YM PMNLSTIM LDS+
Sbjct  319  CPNRNVYAFWDPFHPSERANGFIVQEFMTGSTEYMYPMNLSTIMALDSR  367



>gb|KHN05905.1| GDSL esterase/lipase [Glycine soja]
Length=379

 Score =   262 bits (670),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I+EYRKILMRLYE+GARRVLVTGTGPLGCVPA+LA RS NG+C  E QQAA IFNPLL++
Sbjct  209  ITEYRKILMRLYELGARRVLVTGTGPLGCVPAQLATRSSNGECVPELQQAAQIFNPLLVQ  268

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M  ++N Q+GSD+FVAVNA QM  +FI +PQ +GFVTSKIACCGQG +NG+GLCTA SNL
Sbjct  269  MTREINSQVGSDVFVAVNAFQMNMNFITDPQRFGFVTSKIACCGQGRFNGVGLCTALSNL  328

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDP+HPS+RA   +V+ I +GT+  M+PMNLSTIM +DS
Sbjct  329  CPNRDTYAFWDPYHPSQRALGFIVRDIFSGTSDIMTPMNLSTIMAIDS  376



>emb|CDY12384.1| BnaC08g08210D [Brassica napus]
Length=365

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +SEYRK+L ++Y++GARRVLVTGTGP+GCVPAELAQRS +G+C+ E Q+AA++FNP L++
Sbjct  196  VSEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRSGECSTELQRAASLFNPQLVQ  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI DLN ++GS  F+A N  QM  DFI++P+AYGFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  256  MINDLNNEVGSSAFIAANTQQMHMDFISDPEAYGFVTSKVACCGQGPYNGIGLCTPLSNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD +AFWDPFHPSE+A+R++ Q IL G+ +YM PMNLSTI+ LDS
Sbjct  316  CPNRDLFAFWDPFHPSEKASRIIAQQILNGSPEYMHPMNLSTILTLDS  363



>ref|XP_003524731.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
 gb|KHN42753.1| GDSL esterase/lipase [Glycine soja]
Length=372

 Score =   262 bits (669),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+KIL RLY++GARRVLVTGTGPLGCVP+ELAQR  NGQCA E QQAAA+FNP L +
Sbjct  201  ISEYQKILQRLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEQ  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++GSD+F+A N  +  NDF+ NP+ +GFVTS++ACCGQGPYNG+GLCTA SNL
Sbjct  261  MLLQLNRKIGSDVFIAANTGKAHNDFVTNPRQFGFVTSQVACCGQGPYNGLGLCTALSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C+NR+ YAFWD FHPSE+ANRL+V+ I++G+  YM+PMNLSTI+ LD+
Sbjct  321  CSNRETYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDA  368



>gb|EYU19868.1| hypothetical protein MIMGU_mgv1a008447mg [Erythranthe guttata]
Length=373

 Score =   262 bits (669),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+KIL+RLY +GARRVLVTGTGPLGCVPAELA RS NG+CA E Q+AA++F+P L +
Sbjct  203  ISEYQKILLRLYGLGARRVLVTGTGPLGCVPAELAMRSRNGECATELQRAASLFDPQLTD  262

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN Q+GS++F+A N   M NDFI NPQA+GF TSK+ACCGQGPYNG+GLCT  SNL
Sbjct  263  MLLRLNSQIGSNVFIAANTQLMNNDFIRNPQAFGFTTSKVACCGQGPYNGLGLCTQLSNL  322

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSERANRL+V  I+TG+ +YM+PMNL+TIM LDS 
Sbjct  323  CPNRDVYAFWDAFHPSERANRLIVDQIMTGSLQYMNPMNLTTIMELDSH  371



>ref|XP_003554997.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   261 bits (668),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLY++GARRVLVTGTGPLGCVP+ELAQR  NGQC  E QQAAA+FNP L +
Sbjct  201  ISEYQKLLQRLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCVPELQQAAALFNPQLEQ  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++GSD+F+A N  +  NDF+ NPQ +GFVTS++ACCGQGPYNG+GLCTA SNL
Sbjct  261  MLLQLNRKIGSDVFIAANTGKAHNDFVTNPQQFGFVTSQVACCGQGPYNGLGLCTALSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C+NR++YAFWD FHPSE+ANRL+V+ I++G+  YM+PMNLSTI+ LD+
Sbjct  321  CSNREQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDA  368



>ref|XP_004142546.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cucumis sativus]
Length=365

 Score =   261 bits (667),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            I EYRK+L+RLYE+GARRVLVTGTGPLGCVPAELA R S  GQC+ E Q+AAA++NP L+
Sbjct  195  IVEYRKLLLRLYELGARRVLVTGTGPLGCVPAELAMRGSSGGQCSEELQRAAALYNPKLL  254

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +MI  LN QLGS++FVAVN  QM  DFI+NP+AYGF TSK+ACCGQGPYNG+GLCT ASN
Sbjct  255  QMIKGLNTQLGSNVFVAVNTQQMHIDFISNPRAYGFETSKVACCGQGPYNGLGLCTVASN  314

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC+NRD YAFWD FHPSE+AN ++V+ + +GT +YM PMNL+TI+ LDSK
Sbjct  315  LCSNRDAYAFWDAFHPSEKANGIIVKQMFSGTTQYMYPMNLTTILQLDSK  364



>ref|XP_002325359.2| hypothetical protein POPTR_0019s04110g [Populus trichocarpa]
 gb|EEE99740.2| hypothetical protein POPTR_0019s04110g [Populus trichocarpa]
Length=405

 Score =   263 bits (671),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL+ +YE+GARRVLVTGTGPLGCVPAE A RS NG+CA E Q+AAA+FNP L++
Sbjct  236  ISEYRKILVSVYELGARRVLVTGTGPLGCVPAERAMRSRNGECAAELQRAAAMFNPQLVQ  295

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ +LN+++GSD+F++ NA +   DF+ NPQAYGFVTS++ACCGQG +NGIGLCT ASNL
Sbjct  296  MLMELNKEIGSDVFISANAYEANMDFVTNPQAYGFVTSQVACCGQGRFNGIGLCTIASNL  355

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NR+ +AFWDPFHP+ERANR++V  I+TG+ KYM+PMNLSTI+ LDS
Sbjct  356  CPNREIFAFWDPFHPTERANRIIVSTIVTGSTKYMNPMNLSTIIALDS  403



>ref|XP_003553269.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=371

 Score =   261 bits (668),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLY++GARRVLVTGTGPLGCVP+ELAQR  NGQCA E QQAAA+FNP L +
Sbjct  201  ISEYQKLLQRLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEQ  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++ +D+F+A N  +  NDF+ NPQ +GFVTS++ACCGQGPYNGIGLCTA SNL
Sbjct  261  MLLQLNRKIATDVFIAANTGKAHNDFVTNPQQFGFVTSQVACCGQGPYNGIGLCTALSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C+NR++YAFWD FHPSE+ANRL+V+ I++G+  YM+PMNLSTI+ LD+
Sbjct  321  CSNREQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDA  368



>ref|XP_006443290.1| hypothetical protein CICLE_v10020515mg [Citrus clementina]
 gb|ESR56530.1| hypothetical protein CICLE_v10020515mg [Citrus clementina]
Length=392

 Score =   262 bits (669),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L RL+++GARRVLVTGTGPLGCVPAE A R  NGQCA + Q+AA ++NP L++
Sbjct  223  ISEYRKLLTRLHDLGARRVLVTGTGPLGCVPAERAMRGRNGQCAADLQRAADLYNPQLVQ  282

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++ DLN Q GS+IFVAVN  +MQ +FI+NP+A+GF TSK+ACCGQGPYNG+GLCT ASNL
Sbjct  283  LVKDLNSQYGSEIFVAVNTGKMQYNFISNPRAFGFTTSKVACCGQGPYNGLGLCTPASNL  342

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ YAFWDPFHPSERAN  +VQ  +TG+ +YM PMNLSTIM LDS+
Sbjct  343  CPNRNVYAFWDPFHPSERANGFIVQEFMTGSTEYMYPMNLSTIMALDSR  391



>ref|XP_003542450.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Glycine max]
Length=372

 Score =   261 bits (667),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKILMRLYE+GARRVLVTGTGPLGCVPA+LA RS NG+C  E QQAA IFNPLL++
Sbjct  202  ISEYRKILMRLYELGARRVLVTGTGPLGCVPAQLATRSSNGECVPELQQAAQIFNPLLVQ  261

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M  ++N Q+GSD+FVAVNA QM  +FI +PQ +GFVTSKIACCGQG +NG+GLCTA SNL
Sbjct  262  MTREINSQVGSDVFVAVNAFQMNMNFITDPQRFGFVTSKIACCGQGRFNGVGLCTALSNL  321

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDP+HPS+RA   +V+ I +GT+  M+PMNLSTIM +DS
Sbjct  322  CPNRDIYAFWDPYHPSQRALGFIVRDIFSGTSDIMTPMNLSTIMAIDS  369



>gb|KDO46628.1| hypothetical protein CISIN_1g041652mg [Citrus sinensis]
Length=368

 Score =   261 bits (666),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K L RLYE+GAR+VLVTGTGPLGCVPAELA R  +G+C+ E Q+AAA++NP L++
Sbjct  198  ISEYKKQLKRLYELGARQVLVTGTGPLGCVPAELAMRGTDGECSAELQRAAALYNPQLVQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ +LN+++G  IF+  N  QM  DF+++PQAYGFVTSKIACCGQGPYNG+GLCTA SNL
Sbjct  258  MLQELNREIGETIFIGANTQQMHMDFVSDPQAYGFVTSKIACCGQGPYNGLGLCTALSNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLD  502
            C NRD YAFWDPFHPSE+ANR++VQ I+ G+ KYM+PMNLST++ LD
Sbjct  318  CPNRDLYAFWDPFHPSEKANRIIVQQIMRGSTKYMNPMNLSTVLALD  364



>gb|KHN48972.1| GDSL esterase/lipase [Glycine soja]
Length=372

 Score =   261 bits (667),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKILMRLYE+GARRVLVTGTGPLGCVPA+LA RS NG+C  E QQAA IFNPLL++
Sbjct  202  ISEYRKILMRLYELGARRVLVTGTGPLGCVPAQLATRSSNGECVPELQQAAQIFNPLLVQ  261

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M  ++N Q+GSD+FVAVNA QM  +FI +PQ +GFVTSKIACCGQG +NG+GLCTA SNL
Sbjct  262  MTREINSQVGSDVFVAVNAFQMNMNFITDPQRFGFVTSKIACCGQGRFNGVGLCTALSNL  321

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDP+HPS+RA   +V+ I +GT+  M+PMNLSTIM +DS
Sbjct  322  CPNRDIYAFWDPYHPSQRALGFIVRDIFSGTSDIMTPMNLSTIMAIDS  369



>gb|KFK24279.1| hypothetical protein AALP_AAs47157U000200 [Arabis alpina]
Length=366

 Score =   261 bits (666),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +SEYRK+L ++Y++GARRVLVTGTGP+GCVPAELAQRS  G+C+ E Q+AAA++NP L++
Sbjct  196  VSEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRTGECSTELQRAAALYNPQLVQ  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI DLN ++GS  F+A N  QM  DFI++PQAYGF+TSK+ACCGQGPYNGIGLCTA SNL
Sbjct  256  MINDLNNEVGSSAFIAANTQQMHMDFISDPQAYGFITSKVACCGQGPYNGIGLCTALSNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD +AFWDPFHPSE+A+R++ Q IL G+ +YM PMNLS+I+ +DS
Sbjct  316  CPNRDLFAFWDPFHPSEKASRIIAQQILNGSPEYMHPMNLSSILTVDS  363



>ref|XP_006283972.1| hypothetical protein CARUB_v10005096mg [Capsella rubella]
 gb|EOA16870.1| hypothetical protein CARUB_v10005096mg [Capsella rubella]
Length=366

 Score =   261 bits (666),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L ++Y++GARRVLVTGTGP+GCVPAELAQRS +G+CA E Q+AA++FNP L +
Sbjct  197  ISEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRDGECATELQRAASLFNPQLTQ  256

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI+DLN ++GS  F+A N  QM  DFI++PQ YGFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  257  MISDLNNEVGSSAFIAANTQQMHMDFISDPQRYGFVTSKVACCGQGPYNGIGLCTPLSNL  316

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDPFHPSE+A+R++ + IL G+ +YM PMNLST++ +DS
Sbjct  317  CPNRDLYAFWDPFHPSEKASRIIAEQILNGSPEYMHPMNLSTVLTVDS  364



>emb|CDY06871.1| BnaC01g09700D [Brassica napus]
Length=361

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            ISEY+KILMRLYE+GARRV+VTGTGPLGCVPAELA   S NG+CA E QQAAAIFNPLL 
Sbjct  191  ISEYKKILMRLYELGARRVMVTGTGPLGCVPAELASSGSANGECAPEAQQAAAIFNPLLD  250

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+  LN+++GSD+F+  NA  M  DFINNPQ +GFVTSK+ACCGQG YNG G+CT  S+
Sbjct  251  QMLQGLNRKVGSDVFIGANAFNMNADFINNPQRFGFVTSKVACCGQGAYNGQGVCTPLSS  310

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC +R+ YAFWDPFHP+E+A RL+VQ I+TG+ +YM+PMNLSTIM LDS+
Sbjct  311  LCPDRNAYAFWDPFHPTEKATRLIVQQIMTGSVEYMNPMNLSTIMALDSR  360



>gb|EYU39770.1| hypothetical protein MIMGU_mgv1a009318mg [Erythranthe guttata]
Length=345

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLY++G RRV+VTGTGPLGCVPAELAQ S +G+CA E Q+AA++FNP L +
Sbjct  176  ISEYKKVLKRLYKLGFRRVIVTGTGPLGCVPAELAQHSTDGECAKELQKAASLFNPQLDK  235

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN  LG D+F+A N   M  DFI NP  +GFVTSKIACCGQGPYNG+GLCT  SNL
Sbjct  236  MLKQLNHGLGKDVFIAANTNLMHMDFIANPTRFGFVTSKIACCGQGPYNGLGLCTPLSNL  295

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHPSE+ANR++VQ +LTG+N YM PMNLSTIM +DS+
Sbjct  296  CPNRDLYAFWDPFHPSEKANRMIVQQMLTGSNLYMHPMNLSTIMAMDSR  344



>ref|XP_002869473.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45732.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=357

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            ISEY+KIL RLYE+GARRV+VTGTGPLGCVPAELA   S+NG+CA E QQAAAIFNPLL+
Sbjct  187  ISEYKKILTRLYELGARRVMVTGTGPLGCVPAELASSGSVNGECAPEAQQAAAIFNPLLV  246

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+  LN+++GSD+F+  NA     DFINNPQ +GFVTSK+ACCGQG YNG G+CT  S+
Sbjct  247  QMLQGLNREIGSDVFIGANAFNTNADFINNPQRFGFVTSKVACCGQGAYNGQGVCTQLSS  306

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC +R+ YAFWDPFHP+E+A RL+VQ I+TG+ +YM+PMNLSTIM LDS+
Sbjct  307  LCPDRNAYAFWDPFHPTEKATRLIVQQIMTGSVEYMNPMNLSTIMALDSR  356



>ref|XP_011002017.1| PREDICTED: GDSL esterase/lipase At5g18430-like [Populus euphratica]
Length=364

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY K+LM+LY++GARRVLVTGTGP+GCVPAELA R  NG C+ E Q+AA+++NP L++
Sbjct  195  ISEYEKLLMKLYKLGARRVLVTGTGPMGCVPAELAMRGTNGGCSAELQRAASLYNPQLVQ  254

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++G  +FVA N  Q   DFI+NP+AYGF T+K ACCGQGPYNG+GLCTAASNL
Sbjct  255  MLKGLNKKIGKTVFVAANTQQSHLDFISNPRAYGFTTTKRACCGQGPYNGLGLCTAASNL  314

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWD FHPSE+ANRL+V+ I +GT KYM PMNLSTIM LD++
Sbjct  315  CPNRDLYAFWDAFHPSEKANRLIVEQIYSGTTKYMDPMNLSTIMTLDAR  363



>ref|XP_010674245.1| PREDICTED: GDSL esterase/lipase At5g33370 [Beta vulgaris subsp. 
vulgaris]
Length=365

 Score =   259 bits (663),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            IS+Y  IL RLYE+G RRVLVTGTGPLGCVP+E+AQR  NG CA E Q+AA++FNP L++
Sbjct  196  ISQYTMILQRLYELGPRRVLVTGTGPLGCVPSEIAQRGRNGNCADELQKAASLFNPRLVQ  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN ++GS +FVA NA QM  DFINNP++YGFVTSK+ACCGQGPYNG+GLCT  SNL
Sbjct  256  MINQLNNKIGSHVFVAANAFQMHMDFINNPRSYGFVTSKVACCGQGPYNGVGLCTVLSNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ YAFWD FHP+ERANRL+VQ IL G   YM PMNLSTI+ LDS+
Sbjct  316  CPNRNLYAFWDAFHPTERANRLIVQQILRGNTNYMHPMNLSTIIELDSR  364



>ref|XP_004495557.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cicer arietinum]
Length=368

 Score =   259 bits (663),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL +LY++G R+VLVTGTGP+GCVPAELA RS NG C +E ++A +++NP L++
Sbjct  199  ISEYRKILKKLYDLGGRKVLVTGTGPMGCVPAELAMRSRNGDCDVELERAGSLYNPQLVQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LNQ++G+DIF+A NA QM  DFI+NPQA+GFVTSK ACCGQGPYNGIGLCT  SNL
Sbjct  259  MIKGLNQEIGADIFIAANAHQMHMDFISNPQAFGFVTSKEACCGQGPYNGIGLCTPLSNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWD FHPSE+A+R++VQ ILTG+ +YM PMNLST++ +DS
Sbjct  319  CQNRDLYAFWDSFHPSEKASRIIVQQILTGSYEYMHPMNLSTLLAMDS  366



>ref|XP_007030301.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY10803.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=370

 Score =   259 bits (663),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYR++LMRLY++GARRVLVTGTGP+GCVPAELA R  NG C+ E Q+AA+++NP L +
Sbjct  201  ISEYRRLLMRLYKLGARRVLVTGTGPMGCVPAELAMRGTNGGCSEELQRAASLYNPQLAQ  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+ +G D+FV+ N  +M NDF+++P+A+GF TS+IACCGQGPYNG+GLCT  SNL
Sbjct  261  MLNGLNKNIGRDVFVSANTQKMHNDFVSDPRAFGFTTSQIACCGQGPYNGLGLCTRLSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR  YAFWDPFHPSE+ANRL+VQ I+TG+ +YM+PMNL+TIM LDS+
Sbjct  321  CPNRALYAFWDPFHPSEKANRLIVQQIMTGSTEYMNPMNLTTIMALDSR  369



>gb|KHN14884.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   259 bits (663),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLY++GARRVLVTGTGPLGCVP+ELAQR  NGQCA E QQAAA+FNP L +
Sbjct  201  ISEYQKLLQRLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEQ  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++ +D+F+A N  +  NDF+ NPQ +GFVTS++ACCGQGPYNGIGLCTA SNL
Sbjct  261  MLLQLNRKIATDVFIAANTGKAHNDFVTNPQQFGFVTSQVACCGQGPYNGIGLCTALSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C+NRD+YAFWD FHPSE+ANRL++  I++G   YM+PMNLSTI+ LD+
Sbjct  321  CSNRDQYAFWDAFHPSEKANRLILDEIMSGYKGYMNPMNLSTILALDA  368



>ref|XP_011024535.1| PREDICTED: GDSL esterase/lipase At4g28780 [Populus euphratica]
Length=370

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            +SEYRKILMRLYE+G RR+LVTGTGPLGCVPA+LA   S NG+CA EPQ+AA IFNP L 
Sbjct  200  VSEYRKILMRLYELGGRRILVTGTGPLGCVPAQLAMSGSTNGECAPEPQRAAQIFNPELF  259

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+ +LN++LGSD+F+  NA  M ++ INNPQ +GFVTSK+ACCGQG YNG+GLCT  SN
Sbjct  260  QMLQNLNRELGSDVFITANAFAMNSNLINNPQRFGFVTSKVACCGQGRYNGLGLCTVVSN  319

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            LC NR+ Y FWD FHP+ERANR++VQ ++TGT +YM+PMNLSTIM LD+K 
Sbjct  320  LCPNRNIYVFWDAFHPTERANRVLVQQLMTGTTEYMNPMNLSTIMALDAKS  370



>gb|ABX75139.1| lipase [Gossypium hirsutum]
Length=367

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L+RLY++GAR+VLVTGTGPLGCVPAELA RS +GQCA E QQAAA++NP L+E
Sbjct  196  ISEYRKLLVRLYDLGARKVLVTGTGPLGCVPAELAMRSPSGQCATELQQAAALYNPQLVE  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN QLG++IF+A N  Q  +DFI+NP AYGF TSKIACCGQGPYNG+GLCT  SNL
Sbjct  256  MVNGLNSQLGANIFIAANTQQQTSDFISNPGAYGFTTSKIACCGQGPYNGLGLCTQLSNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C+NR+EY FWD FHPSERAN ++V  IL G+  YM+PMNL+  + LD+K
Sbjct  316  CSNRNEYVFWDAFHPSERANGIIVDMILNGSTSYMNPMNLNAFLALDTK  364



>ref|XP_004494758.1| PREDICTED: GDSL esterase/lipase LTL1-like [Cicer arietinum]
Length=369

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL RLYE+GARRV+VTGTGPLGC PAELAQ S NG+C  E QQA+ +F+P L++
Sbjct  200  ISEYRKILARLYELGARRVMVTGTGPLGCAPAELAQHSRNGECFAELQQASDLFDPQLVQ  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++  LN ++GSD+F++ NA     DFI NPQA+GF TSK+ACCGQGPYNGIGLCT  SN+
Sbjct  260  LLTQLNSEIGSDVFISANAFSRNMDFIGNPQAFGFATSKVACCGQGPYNGIGLCTPLSNV  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD Y FWDP+HPSERANRL+V+  + G+ KYM PMNLSTIM+LDS+
Sbjct  320  CPNRDIYVFWDPYHPSERANRLIVEKFMIGSTKYMYPMNLSTIMLLDSR  368



>gb|KHN14886.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L +LY++GARRVLVTGTGPLGCVP+ELAQR  NGQCA E QQAAA+FNP L +
Sbjct  201  ISEYQKLLKKLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEK  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++G DIF+A N  +  NDF++NPQ +GF TS++ACCGQGPYNG+GLCTA SNL
Sbjct  261  MLLRLNRKIGKDIFIAANTGKTHNDFVSNPQQFGFFTSQVACCGQGPYNGLGLCTALSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NR++YAFWD FHPSE+ANRL+V+ I++G+  YM+PMNLSTI+ LD+
Sbjct  321  CTNREQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDA  368



>gb|KHN41491.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   259 bits (662),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLY++GARRVLVTGTGPLGCVP+ELAQR  N QCA E QQAAA+FNP L +
Sbjct  201  ISEYQKLLKRLYDLGARRVLVTGTGPLGCVPSELAQRGRNEQCAPELQQAAALFNPQLEQ  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++G D+F+A N  +  NDF++NPQ +GFVTS++ACCGQGPYNG+GLCTA SNL
Sbjct  261  MLLRLNRKIGKDVFIAANTGKTHNDFVSNPQQFGFVTSQVACCGQGPYNGLGLCTALSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C+NR++YAFWD FHPSE+ANRL+V+ I++G+  YM+PMNLSTI+ LD+
Sbjct  321  CSNREQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDA  368



>ref|XP_003553249.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   259 bits (661),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLY++GARRVLVTGTGPL CVP+ELAQR  NGQCA E QQAAA+FNP L +
Sbjct  201  ISEYQKLLQRLYDLGARRVLVTGTGPLACVPSELAQRGRNGQCAPELQQAAALFNPQLEQ  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++ +D+F+A N  +  NDF+ N Q +GFVTS++ACCGQGPYNGIGLCTA SNL
Sbjct  261  MLLQLNRKIATDVFIAANTGKAHNDFVTNAQQFGFVTSQVACCGQGPYNGIGLCTALSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C+NRD+YAFWD FHPSE+ANRL+V+ I++G+  YM+PMNLSTI+ LDS
Sbjct  321  CSNRDQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDS  368



>ref|XP_010433162.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Camelina sativa]
Length=367

 Score =   258 bits (660),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            ISEY+KIL RLYE+ ARRV+VTGTGPLGCVPAELA   S+NG+CA E QQAAAIFNPLL+
Sbjct  197  ISEYKKILARLYELEARRVMVTGTGPLGCVPAELASSGSVNGECAPEAQQAAAIFNPLLV  256

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+  LN+++GSD+F+  NA  M  DFINNPQ +GFVTSK+ACCGQG YNG G+CT  S+
Sbjct  257  QMLQGLNREIGSDVFIGANAFDMNADFINNPQRFGFVTSKVACCGQGAYNGRGICTPLSS  316

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC +R+ YAFWDPFHP+E+A RL+VQ ++TG+ +YM+PMNLSTIM LDS+
Sbjct  317  LCPDRNAYAFWDPFHPTEKATRLIVQQLMTGSVEYMNPMNLSTIMALDSR  366



>ref|NP_194607.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9SVU5.1|GDL67_ARATH RecName: Full=GDSL esterase/lipase At4g28780; AltName: Full=Extracellular 
lipase At4g28780; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA22974.1| Proline-rich APG-like protein [Arabidopsis thaliana]
 emb|CAB81466.1| Proline-rich APG-like protein [Arabidopsis thaliana]
 gb|AAM64722.1| Proline-rich APG-like protein [Arabidopsis thaliana]
 gb|AAO22802.1| putative proline-rich APG protein [Arabidopsis thaliana]
 gb|AAO42459.1| putative proline-rich APG protein [Arabidopsis thaliana]
 gb|AEE85543.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=367

 Score =   258 bits (660),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            ISEY+KIL  LYE+GARRV+VTGTGPLGCVPAELA   S+NG+CA E QQAAAIFNPLL+
Sbjct  197  ISEYKKILTSLYELGARRVMVTGTGPLGCVPAELASSGSVNGECAPEAQQAAAIFNPLLV  256

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+  LN+++GSD+F+  NA     DFINNPQ +GFVTSK+ACCGQG YNG G+CT  S 
Sbjct  257  QMLQGLNREIGSDVFIGANAFNTNADFINNPQRFGFVTSKVACCGQGAYNGQGVCTPLST  316

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC++R+ YAFWDPFHP+E+A RL+VQ I+TG+ +YM+PMNLSTIM LDS+
Sbjct  317  LCSDRNAYAFWDPFHPTEKATRLIVQQIMTGSVEYMNPMNLSTIMALDSR  366



>ref|XP_007151673.1| hypothetical protein PHAVU_004G066300g [Phaseolus vulgaris]
 gb|ESW23667.1| hypothetical protein PHAVU_004G066300g [Phaseolus vulgaris]
Length=370

 Score =   258 bits (660),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L +LY++GARRVLVTGTGPLGCVP+ELAQR  NGQCA E Q+AAA+FNP L +
Sbjct  200  ISEYQKLLQKLYDLGARRVLVTGTGPLGCVPSELAQRGTNGQCAAELQRAAALFNPQLEQ  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN++LG D+F+A N  +  NDF++NPQ +GFVT+K+ACCGQGPYNG+GLCT  SNL
Sbjct  260  MLLQLNRKLGKDVFIAANTGKTHNDFVSNPQQFGFVTAKVACCGQGPYNGLGLCTPLSNL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NR +YAFWD FHPSE+ANRL+V+ I++G+  YM+PMNLSTI+ LD+
Sbjct  320  CPNRGQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDA  367



>ref|XP_008235540.1| PREDICTED: GDSL esterase/lipase At4g28780 [Prunus mume]
Length=374

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQ-RSINGQCALEPQQAAAIFNPLLI  178
            I+E+RKILM LYE+GARRVLVTGTGPLGCVP+ELAQ RS NG+C  E Q AAAIFNP L+
Sbjct  204  ITEFRKILMNLYELGARRVLVTGTGPLGCVPSELAQSRSRNGECNPELQGAAAIFNPQLV  263

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+  LN QLGSD+FV  NA  M+ DFI+NPQ +GFVT+K+ACCGQGPYNG+G C   SN
Sbjct  264  QMLQGLNTQLGSDVFVTANAFDMKADFISNPQKFGFVTAKVACCGQGPYNGMGQCNPTSN  323

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC NR+ YAFWD FHP+E+A RL+V+ I+TG+ KYM+PMNLSTIM LDS+
Sbjct  324  LCPNRNLYAFWDAFHPTEKATRLIVKQIMTGSTKYMNPMNLSTIMALDSR  373



>ref|XP_007030303.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY10805.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=367

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+L +LY++GARRVLVTGTGPLGCVPAELA RS++GQCA + Q+AAA++NP L++
Sbjct  196  ISEYRKLLRKLYDLGARRVLVTGTGPLGCVPAELAMRSLSGQCAPDLQRAAALYNPQLVQ  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN ++G+ +F+A N  Q  NDFI+NP+AYGF TSK+ACCGQGP+NG+GLCT  SNL
Sbjct  256  MINGLNSEIGAKVFIAANTQQQTNDFISNPRAYGFATSKVACCGQGPFNGLGLCTLLSNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR++Y FWDPFHPSERANR++V  IL G+  ++SPMNLST++ LD K
Sbjct  316  CPNRNQYVFWDPFHPSERANRIIVDTILRGSTDHVSPMNLSTLLALDYK  364



>ref|XP_003554733.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I EYRK+LMRLY++GARRV+VTGTGP+GCVPAELA R  NG C+ E Q+AA+++NP L  
Sbjct  201  IVEYRKLLMRLYDLGARRVIVTGTGPMGCVPAELAMRGTNGGCSAELQRAASLYNPQLTH  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN+++G ++F+A N   M NDF++NP AYGF TS+IACCGQGPYNGIGLCT  SNL
Sbjct  261  MIQGLNKKIGKEVFIAANTALMHNDFVSNPAAYGFTTSQIACCGQGPYNGIGLCTPLSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NR+ +AFWDPFHPSE+ANRL+V+ I++G+ +YM PMNLST++ LD+++
Sbjct  321  CPNRNSHAFWDPFHPSEKANRLIVEQIMSGSKRYMKPMNLSTVLALDARK  370



>ref|XP_002303095.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE82368.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=370

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            +SEYRK+LMRLY++G RR+LVTGTGPLGCVPAELA   S NG+CA EPQ+AA IFNP L 
Sbjct  200  VSEYRKLLMRLYDLGGRRILVTGTGPLGCVPAELAMSGSTNGECAPEPQRAAQIFNPQLF  259

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+ +LN++LGSD+F+  NA  M  D IN+PQ +GFVTSK+ACCGQG YNG+GLCT  SN
Sbjct  260  QMLQNLNRELGSDVFITANAFAMNTDLINSPQRFGFVTSKVACCGQGLYNGLGLCTVVSN  319

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC NR+ Y FWD FHP+ERANR++VQ ++TGT +YM+PMNLSTIM LD+K
Sbjct  320  LCPNRNVYVFWDAFHPTERANRVLVQQLMTGTTEYMNPMNLSTIMALDAK  369



>ref|XP_007151676.1| hypothetical protein PHAVU_004G066600g [Phaseolus vulgaris]
 gb|ESW23670.1| hypothetical protein PHAVU_004G066600g [Phaseolus vulgaris]
Length=370

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L +LY++GARRVLVTGTGPLGCVP+ELAQR  NGQCA E Q+AAA+FNP L +
Sbjct  200  ISEYQKLLQKLYDLGARRVLVTGTGPLGCVPSELAQRGTNGQCAAELQRAAALFNPQLEQ  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN++LG D+F+A N  +  NDF++NPQ +GF+T+K+ACCGQGPYNG+GLCT  SNL
Sbjct  260  MLLQLNRKLGKDVFIAANTGKTHNDFVSNPQQFGFITAKVACCGQGPYNGLGLCTPLSNL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NR +YAFWD FHPSE+ANRL+V+ I++G+  YM+PMNLSTI+ LD+
Sbjct  320  CPNRGQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDA  367



>gb|ACU23670.1| unknown [Glycine max]
Length=372

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKILMRLYE+GARRVLVTGTGPLGCVPA+LA RS NG+C  E QQAA IFNPLL++
Sbjct  202  ISEYRKILMRLYELGARRVLVTGTGPLGCVPAQLATRSSNGECVPELQQAAQIFNPLLVQ  261

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M  ++N Q+GSD+FVAVNA QM  +FI +PQ +GFVTSKIACCGQG +NG+GLC A SNL
Sbjct  262  MTREINSQVGSDVFVAVNAFQMNMNFITDPQRFGFVTSKIACCGQGRFNGVGLCAALSNL  321

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWDP+HPS+RA   +V+ I +GT+  M+PMN STIM +DS
Sbjct  322  CPNRDIYAFWDPYHPSQRALGFIVRDIFSGTSDIMTPMNFSTIMAIDS  369



>gb|KFK29417.1| hypothetical protein AALP_AA7G132000 [Arabis alpina]
Length=367

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            ISEY+KIL RLYE+GARRV+VTGTGPLGCVPAELA   S NG+CA E Q+AAAIFNPLL 
Sbjct  197  ISEYKKILTRLYELGARRVMVTGTGPLGCVPAELASSGSANGECAPEAQKAAAIFNPLLN  256

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+  LN+++GSD+F+  NA  M  DFINNPQ +GFVTSK+ACCGQG YNG G+CT  S+
Sbjct  257  QMLQGLNREIGSDVFIGANAFDMNADFINNPQRFGFVTSKVACCGQGAYNGQGVCTQLSS  316

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC +R+ YAFWDPFHP+E+A RL+VQ I+TG+ KYM+PMNLSTIM LDS+
Sbjct  317  LCPDRNAYAFWDPFHPTEKAIRLIVQQIMTGSAKYMNPMNLSTIMALDSR  366



>ref|XP_003554996.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L +LY++GARRVLVTGTGPLGCVP+ELAQR  NGQCA E QQAA +FNP L +
Sbjct  201  ISEYQKLLKKLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAPELQQAATLFNPQLEK  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++G DIF+A N  +  NDF++NPQ +GF TS++ACCGQGPYNG+GLCTA SNL
Sbjct  261  MLLRLNRKIGKDIFIAANTGKTHNDFVSNPQQFGFFTSQVACCGQGPYNGLGLCTALSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NR++YAFWD FHPSE+ANRL+V+ I++G+  YM+PMNLSTI+ LD+
Sbjct  321  CTNREQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDA  368



>ref|XP_006854343.1| hypothetical protein AMTR_s00039p00143210 [Amborella trichopoda]
 gb|ERN15810.1| hypothetical protein AMTR_s00039p00143210 [Amborella trichopoda]
Length=362

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I EY KIL RLYE+GARRVLVTGTGP+GCVPAELA RS NGQC  E Q+A+A+FNP L++
Sbjct  194  IPEYSKILARLYELGARRVLVTGTGPMGCVPAELAMRSRNGQCDPELQRASALFNPQLVQ  253

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN Q GS++F++ NA  M  DFI+NP A+GFVTSK+ACCGQGPYNG+GLCTA SNL
Sbjct  254  MLGQLNNQFGSNVFISANAFNMHMDFISNPGAFGFVTSKVACCGQGPYNGLGLCTALSNL  313

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            CA+R +YAFWDPFHPSE A+R++V+  +TGT +YM PMNLSTI+ +D+
Sbjct  314  CADRSKYAFWDPFHPSESASRIIVRQFMTGTTEYMHPMNLSTILQMDN  361



>ref|XP_003553275.1| PREDICTED: GDSL esterase/lipase At5g33370 [Glycine max]
 gb|KHN14883.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   257 bits (656),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L +LY++GARRVLVTGTGPLGCVP+ELAQR  NGQCA E QQAA +FNP L +
Sbjct  200  ISEYQKLLQKLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAAELQQAAELFNPQLEQ  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++G D F+A N  +M N+F+ NPQ +GF+TS+IACCGQGPYNG+GLCT  SNL
Sbjct  260  MLLQLNRKIGKDTFIAANTGKMHNNFVTNPQQFGFITSQIACCGQGPYNGLGLCTPLSNL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD+YAFWD FHPSE+ANRL+V+ I++G+  YM+PMNLSTI+ LD+
Sbjct  320  CPNRDQYAFWDAFHPSEKANRLIVEEIMSGSKIYMNPMNLSTILALDA  367



>ref|XP_004489545.1| PREDICTED: GDSL esterase/lipase LTL1-like [Cicer arietinum]
Length=366

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L +LY++GARRVLVTGTGPLGCVP+ELAQR  NGQC+ E Q+AA++FNP L  
Sbjct  197  ISEYQKLLQKLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCSTELQKAASLFNPQLES  256

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++G D+F+A N  +M N+F++NP  +GF TSK+ACCGQGPYNG+GLCTA SNL
Sbjct  257  MLLALNKKIGRDVFIAANTAKMHNNFVSNPSQFGFKTSKVACCGQGPYNGLGLCTAVSNL  316

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C+NR+ YAFWD FHPSE+ANRL+VQ I++G+  YM+PMNLSTI+ LD+
Sbjct  317  CSNRELYAFWDAFHPSEKANRLIVQEIMSGSKAYMNPMNLSTILALDA  364



>ref|XP_008796408.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Phoenix dactylifera]
Length=371

 Score =   256 bits (654),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+KIL  LYE+GARRVLVTGTGPLGCVPAELA RS NGQC  E  +A+ +FNP LI+
Sbjct  202  ISEYKKILASLYELGARRVLVTGTGPLGCVPAELALRSRNGQCDSELNRASDLFNPQLIQ  261

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++  LN+Q GSD+FVAVN+ +M  DFI+NPQAYGFVTSK+ACCGQGPYNGIGLCT+ S+L
Sbjct  262  LLNQLNRQFGSDVFVAVNSRKMHMDFISNPQAYGFVTSKVACCGQGPYNGIGLCTSLSSL  321

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NR+ Y+FWD +HP+E+ANR++V   +TG+ +YM+PMNLSTI+ +D++ 
Sbjct  322  CPNRNVYSFWDQYHPTEKANRIIVSQFMTGSTEYMNPMNLSTILAMDARS  371



>ref|XP_006412910.1| hypothetical protein EUTSA_v10025523mg [Eutrema salsugineum]
 gb|ESQ54363.1| hypothetical protein EUTSA_v10025523mg [Eutrema salsugineum]
Length=367

 Score =   256 bits (653),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            ISEY+KIL RLYE+GARRV+VTGTGPLGCVPA+LA   S +G+CA E QQAAAIFNPLL 
Sbjct  197  ISEYKKILARLYELGARRVMVTGTGPLGCVPAQLASSGSADGECAPEAQQAAAIFNPLLD  256

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+ +LN++ GSD+F+  NA  M  DFINNPQ +GFVTSK+ACCGQG YNG G+CT  S+
Sbjct  257  QMLQELNREFGSDVFIGANAFNMNADFINNPQRFGFVTSKVACCGQGAYNGQGVCTPLSS  316

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC +R+ YAFWDPFHP+E+A RL+VQ I+TG+ +YM+PMNLSTIM LDS+
Sbjct  317  LCPDRNAYAFWDPFHPTEKATRLIVQQIMTGSVEYMNPMNLSTIMALDSR  366



>gb|ACU23289.1| unknown [Glycine max]
Length=370

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L +LY++GARRVLVTGTGPLGCVP+ELAQR  NGQCA E QQAA +FNP L +
Sbjct  200  ISEYQKLLQKLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCATELQQAAELFNPQLEQ  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++G D F+A N  +M N+F+ NPQ +GF+TS+IACCGQGPYNG+GLCT  SNL
Sbjct  260  MLLQLNRKIGKDTFIAANTGKMHNNFVTNPQQFGFITSQIACCGQGPYNGLGLCTPLSNL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD+YAFWD FHPSE+ANRL+V+ I++G   YM+PMNLSTI+ LD+
Sbjct  320  CPNRDQYAFWDAFHPSEKANRLIVEEIMSGFKIYMNPMNLSTILALDA  367



>ref|XP_007133949.1| hypothetical protein PHAVU_010G005800g [Phaseolus vulgaris]
 gb|ESW05943.1| hypothetical protein PHAVU_010G005800g [Phaseolus vulgaris]
Length=369

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL+ LYE+GARRVLVTGTGPLGCVPAELA  S NG+CA E Q+A  +FNP L++
Sbjct  200  ISEYRKILVDLYELGARRVLVTGTGPLGCVPAELAMHSRNGECATELQRAVNMFNPQLVQ  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++ +LN Q+GS +F++ NA  M  DF+ +PQAYGFVTSK+ACCGQG YNGIGLCT ASNL
Sbjct  260  LLQELNAQIGSHVFISANAFAMHLDFVTDPQAYGFVTSKVACCGQGAYNGIGLCTPASNL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NR+ YAFWD FHPSE ANRL+V   +TG+  YM PMNLSTI+ LDS
Sbjct  320  CPNRNLYAFWDAFHPSETANRLIVDKFMTGSTDYMHPMNLSTILALDS  367



>ref|XP_006443292.1| hypothetical protein CICLE_v10020640mg [Citrus clementina]
 gb|ESR56532.1| hypothetical protein CICLE_v10020640mg [Citrus clementina]
 gb|KDO52503.1| hypothetical protein CISIN_1g017181mg [Citrus sinensis]
Length=290

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+LMRLYE+GARRVLVTGTGPLGCVPAELA R  NG C+ E Q+A +++NP L +
Sbjct  120  ISEYRKLLMRLYELGARRVLVTGTGPLGCVPAELALRGSNGGCSAELQRATSLYNPQLEQ  179

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  +N+++G  +F+A N  Q   DF++NPQAYGF T+K+ACCGQGP NG+GLCTA SNL
Sbjct  180  MLQGINRKIGQTVFIAANTQQTHMDFVSNPQAYGFTTAKVACCGQGPNNGLGLCTALSNL  239

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NR  YAFWDPFHPSE+ANRL+V+ I +G+  YM+PMNLST+M LDS
Sbjct  240  CPNRQLYAFWDPFHPSEKANRLIVEQIFSGSTNYMTPMNLSTVMALDS  287



>ref|XP_003521785.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=365

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I EYRK+LMRLY++GARRV+VTGTGP+GCVPAELA R  NG C+ E Q+AA+++NP L  
Sbjct  196  IVEYRKLLMRLYDLGARRVIVTGTGPMGCVPAELAMRGTNGGCSAELQRAASLYNPQLTH  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN+++G D+F+A N   M NDF++NP AYGF TS+IACCGQGPYNGIGLCT  S+L
Sbjct  256  MIQGLNKKIGKDVFIAANTALMHNDFVSNPAAYGFTTSQIACCGQGPYNGIGLCTPLSDL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NR+ +AFWDPFHPSE++NRL+V+ I++G+ +YM PMNLST++ LD+++
Sbjct  316  CPNRNLHAFWDPFHPSEKSNRLIVEQIMSGSKRYMKPMNLSTVISLDARK  365



>ref|XP_010940685.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Elaeis guineensis]
Length=364

 Score =   254 bits (648),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +SEY+KIL  LYE+GARRVLVTGTGPLGCVPAELA RS  GQC  E  +A+ +FNP LI+
Sbjct  195  MSEYKKILAGLYELGARRVLVTGTGPLGCVPAELALRSRTGQCDPELNRASNLFNPQLIQ  254

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++ +LN Q+GSD+FV+VN   M  DFI++PQAYGFVTSK+ACCGQGPYNGIGLCT  SN+
Sbjct  255  VLNELNGQIGSDVFVSVNVYTMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTVLSNV  314

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ YAFWD FHP+ERANR++V   + GT KYMSPMNLSTI+ +DS+
Sbjct  315  CPNRNIYAFWDAFHPTERANRMLVSQFMAGTTKYMSPMNLSTILAMDSR  363



>ref|XP_010528706.1| PREDICTED: GDSL esterase/lipase LTL1-like [Tarenaya hassleriana]
Length=369

 Score =   254 bits (648),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +SEYRKIL+RLYE+GARR+LV GTGP+GCVPA+LAQRS NG+C  E Q+AAA++NP L +
Sbjct  200  LSEYRKILIRLYELGARRILVLGTGPIGCVPAQLAQRSRNGECVAETQRAAALYNPQLSQ  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ DLN QLG ++F++ N   MQ+DFI NP A+GF  SK ACCGQG YNG+GLCTA SNL
Sbjct  260  MLQDLNSQLGDNVFISGNINDMQDDFITNPSAFGFEDSKTACCGQGRYNGVGLCTAVSNL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YA+WDP+HP+ERAN ++V+ I+TG+ KYM+PMNLST++ LDSK
Sbjct  320  CPNRDVYAWWDPYHPTERANGIIVRRIMTGSTKYMNPMNLSTVIALDSK  368



>gb|ACU23502.1| unknown [Glycine max]
Length=370

 Score =   254 bits (648),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I EYRK+LMRLY++GARRV+VTGTGP+GCVPAELA R  NG C+ E Q+AA+++NP L  
Sbjct  201  IVEYRKLLMRLYDLGARRVIVTGTGPMGCVPAELAMRGTNGGCSAELQRAASLYNPQLTH  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN+++G ++F+A N   M NDF++NP AYGF TS+IACCGQGPYNGIGLCT   NL
Sbjct  261  MIQGLNKKIGKEVFIAANTALMHNDFVSNPAAYGFTTSQIACCGQGPYNGIGLCTPLFNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NR+ +AFWDPFHPSE+ANRL+V+ I++G  +YM PMNLST++ LD+++
Sbjct  321  CPNRNSHAFWDPFHPSEKANRLIVEQIMSGFKRYMKPMNLSTVLALDARK  370



>ref|XP_003626493.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES82711.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=362

 Score =   254 bits (648),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRS-INGQCALEPQQAAAIFNPLLI  178
            ISEYRK+L RLY++GARRVLVTGTGP+GC PAELA R   NGQC++E ++AA+++NP L+
Sbjct  192  ISEYRKVLRRLYDLGARRVLVTGTGPMGCAPAELAMRGGPNGQCSVELERAASLYNPQLV  251

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +MI  LNQ++GSDIFVA +A +M  D+I NPQAYGF TSK+ACCGQGPYNG+GLCT ASN
Sbjct  252  DMIRSLNQEIGSDIFVAADAYRMHMDYITNPQAYGFATSKVACCGQGPYNGLGLCTPASN  311

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC NR+  AFWD FHPSE+AN+++V  IL G+ +YM PMNLSTIM LDS+
Sbjct  312  LCPNRELNAFWDAFHPSEKANKIIVNRILRGSAQYMYPMNLSTIMALDSR  361



>emb|CDX92063.1| BnaC03g33650D [Brassica napus]
Length=366

 Score =   254 bits (648),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY KIL +LYE+GARRVLVTGTG +GC PAELAQ S NG+C    Q AAA+FNP L++
Sbjct  196  ISEYGKILRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVD  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +IA +N ++G D+FVA NA QM  D+++NP+ +GFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  256  LIASVNAEIGQDVFVAANAYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGLCTPISNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWD FHP+E+ANR++V  ILTG++KYM PMNLST+M+LDS  
Sbjct  316  CPNRDLYAFWDAFHPTEKANRIIVNQILTGSSKYMHPMNLSTVMLLDSSR  365



>ref|XP_004495029.1| PREDICTED: GDSL esterase/lipase At4g28780-like isoform X2 [Cicer 
arietinum]
Length=367

 Score =   254 bits (648),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +SEY KILMRL+E+GARRVLVTGTGPLGCVP++LA RS NG+C  E QQAA IFN LL++
Sbjct  198  VSEYHKILMRLFELGARRVLVTGTGPLGCVPSQLATRSTNGECVNELQQAAQIFNSLLVQ  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M  DLN QLGSD+F+AVNA QM  +FI NPQ +GFVTSK+ACCGQG +NG+GLCT  SNL
Sbjct  258  MTKDLNTQLGSDVFIAVNAYQMNMNFITNPQDFGFVTSKMACCGQGRFNGVGLCTTLSNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHP++RA   +V+ +  G++ YM+PMNLSTI+ +D+ 
Sbjct  318  CPNRDVYAFWDPFHPTQRALEFIVRDMFNGSSYYMNPMNLSTIIAMDAN  366



>ref|XP_006387004.1| hypothetical protein POPTR_2251s00200g [Populus trichocarpa]
 gb|ERP45918.1| hypothetical protein POPTR_2251s00200g [Populus trichocarpa]
Length=163

 Score =   246 bits (629),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  23   LMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIEMIADLNQ  202
            +  +YE+GARRVLVTGTGPLGCVPAE A RS NG+CA E Q+AAA+FNP L++M+ +LN+
Sbjct  1    MQSVYELGARRVLVTGTGPLGCVPAERAMRSRNGECAAELQRAAAMFNPQLVQMLMELNK  60

Query  203  QLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNLCANRDEY  382
            ++GSD+F++ NA +   DF+ NPQAYGFVTS++ACCGQG +NGIGLCT ASNLC NR+ +
Sbjct  61   EIGSDVFISANAYEANMDFVTNPQAYGFVTSQVACCGQGRFNGIGLCTIASNLCPNREIF  120

Query  383  AFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            AFWDPFHP+ERANR++V  I+TG+ KYM+PMNLSTI+ LDS
Sbjct  121  AFWDPFHPTERANRIIVSTIVTGSTKYMNPMNLSTIIALDS  161



>ref|XP_004495028.1| PREDICTED: GDSL esterase/lipase At4g28780-like isoform X1 [Cicer 
arietinum]
Length=368

 Score =   253 bits (647),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +SEY KILMRL+E+GARRVLVTGTGPLGCVP++LA RS NG+C  E QQAA IFN LL++
Sbjct  199  VSEYHKILMRLFELGARRVLVTGTGPLGCVPSQLATRSTNGECVNELQQAAQIFNSLLVQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M  DLN QLGSD+F+AVNA QM  +FI NPQ +GFVTSK+ACCGQG +NG+GLCT  SNL
Sbjct  259  MTKDLNTQLGSDVFIAVNAYQMNMNFITNPQDFGFVTSKMACCGQGRFNGVGLCTTLSNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHP++RA   +V+ +  G++ YM+PMNLSTI+ +D+ 
Sbjct  319  CPNRDVYAFWDPFHPTQRALEFIVRDMFNGSSYYMNPMNLSTIIAMDAN  367



>gb|KHN35335.1| GDSL esterase/lipase [Glycine soja]
Length=349

 Score =   253 bits (646),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 141/170 (83%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I EYRK+LMRLY++GARR +VTGTGP+GCVPAELA R  NG C+ E Q+AA+++NP L  
Sbjct  180  IVEYRKLLMRLYDLGARRAIVTGTGPMGCVPAELAMRGTNGGCSAELQRAASLYNPQLTH  239

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN+++G D+F+A N   M NDF++NP AYGF TS+IACCGQGPYNGIGLCT  S+L
Sbjct  240  MIQGLNKKIGKDVFIAANTALMHNDFVSNPAAYGFTTSQIACCGQGPYNGIGLCTPLSDL  299

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NR+ +AFWDPFHPSE++NRL+V+ I++G+ +YM PMNLST++ LD+++
Sbjct  300  CPNRNLHAFWDPFHPSEKSNRLIVEQIMSGSKRYMKPMNLSTVISLDARK  349



>ref|XP_007151675.1| hypothetical protein PHAVU_004G066500g [Phaseolus vulgaris]
 gb|ESW23669.1| hypothetical protein PHAVU_004G066500g [Phaseolus vulgaris]
Length=370

 Score =   253 bits (647),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLY++G RR+LVTGTGPLGCVP+ELAQR  NGQCA E Q+AA +FNP L +
Sbjct  200  ISEYQKLLQRLYDLGPRRILVTGTGPLGCVPSELAQRGRNGQCAPELQRAAELFNPQLEQ  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN++LG D+F+A N  +M N+F++NPQ +GFVT+K+ACCGQGPYNG+GLCT  SNL
Sbjct  260  MLLQLNRKLGKDVFIAANTGKMHNNFVSNPQQFGFVTAKVACCGQGPYNGLGLCTPLSNL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C+NR EYAFWD FHPSE+ANRL+ + I++G+  YM+PMNLSTI+ LD+
Sbjct  320  CSNRGEYAFWDAFHPSEKANRLIAEEIMSGSKAYMNPMNLSTILDLDA  367



>ref|XP_008364335.1| PREDICTED: GDSL esterase/lipase LTL1-like [Malus domestica]
Length=368

 Score =   253 bits (647),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL++LYE+GARRVLVT TG LGCVP+ELAQRS NG+C  E Q AAAIFNP L++
Sbjct  199  ISEYRKILLKLYELGARRVLVTSTGSLGCVPSELAQRSRNGECVAELQNAAAIFNPQLVQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN+QLGS++F+  NA  M  DFI+NP+  GFVTSK+ACCGQG +NG+G C   SNL
Sbjct  259  MIQGLNRQLGSNVFITANAFDMNMDFISNPEKSGFVTSKVACCGQGRFNGLGQCNPTSNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWD FHP+E+ANRL+V+ I++G++KYM+PMNLST+M LDS
Sbjct  319  CPNRDLYAFWDAFHPTEKANRLIVKQIMSGSSKYMNPMNLSTMMALDS  366



>gb|EYU39533.1| hypothetical protein MIMGU_mgv1a008571mg [Erythranthe guttata]
Length=369

 Score =   253 bits (647),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLYE+G RRV+VTGTGPLGCVPAELA  S NG+CA + Q AA++FNP L++
Sbjct  200  ISEYKKVLQRLYELGPRRVIVTGTGPLGCVPAELALHSNNGECAEQLQLAASLFNPQLVQ  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI +LNQ +G+D+FVA N  QM  DFI+NP+ +GF TSKIACCGQGPYNG+GLCT  SNL
Sbjct  260  MIDELNQDIGTDVFVAANTNQMHMDFISNPEQFGFQTSKIACCGQGPYNGLGLCTPFSNL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD Y FWD FHPSERANR++V  I  G+  YM PMNLSTI+ LDS+
Sbjct  320  CPNRDLYVFWDAFHPSERANRMIVDQIFGGSTTYMHPMNLSTIVTLDSR  368



>ref|XP_008810810.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Phoenix dactylifera]
Length=365

 Score =   253 bits (647),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+KIL RLYE+GARRV+VTGTGPLGCVP+ELAQR  NG+CA E Q+AA++FNP L  
Sbjct  196  ISEYKKILGRLYELGARRVMVTGTGPLGCVPSELAQRGRNGECAAELQRAASLFNPQLDR  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
             + +LN++ GSD+F++ NA +M  D+I++P +YGFVTSKIACCGQGPYNG+GLCTAASNL
Sbjct  256  TLIELNRKFGSDVFISANAFKMHMDYISDPGSYGFVTSKIACCGQGPYNGLGLCTAASNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ Y+FWD FHP+E+ANR++V   + G+++YM+PMNLSTI+ +D+ 
Sbjct  316  CPNRNLYSFWDAFHPTEKANRIIVSQFMIGSSEYMNPMNLSTILAMDAS  364



>ref|XP_002521156.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF41307.1| zinc finger protein, putative [Ricinus communis]
Length=369

 Score =   253 bits (647),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQ-RSINGQCALEPQQAAAIFNPLLI  178
            +SEY+KILM LYE+GARRVLVTGTGPLGCVPAELA   S NG+C+ EPQ+AAAI+N  L 
Sbjct  199  VSEYKKILMELYELGARRVLVTGTGPLGCVPAELAYFGSRNGECSPEPQRAAAIYNSQLF  258

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+  LN Q+G D+F++ NA  M  D IN PQ +GFVTSKIACCGQGPYNG+G CT  SN
Sbjct  259  QMLQRLNSQIGYDVFISTNAFDMNLDLINKPQEFGFVTSKIACCGQGPYNGLGTCTVLSN  318

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            LC NRD Y FWDPFHP+ERA+R++VQ ++TG+ KYM+PMNLSTIM LD+
Sbjct  319  LCKNRDLYVFWDPFHPTERASRVIVQQLMTGSTKYMNPMNLSTIMALDA  367



>gb|KGN66731.1| hypothetical protein Csa_1G665920 [Cucumis sativus]
Length=357

 Score =   253 bits (646),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            + +Y  +L+RLYE+GARRVLVTGTGPLGCVPAELA R S  GQC+ E Q+AAA++NP L+
Sbjct  187  LPDYVNLLIRLYELGARRVLVTGTGPLGCVPAELAMRGSSGGQCSEELQRAAALYNPKLL  246

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +MI  LN QLGS++FVAVN  QM  DFI+NP+AYGF TSK+ACCGQGPYNG+GLCT ASN
Sbjct  247  QMIKGLNTQLGSNVFVAVNTQQMHIDFISNPRAYGFETSKVACCGQGPYNGLGLCTVASN  306

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC+NRD YAFWD FHPSE+AN ++V+ + +GT +YM PMNL+TI+ LDSK
Sbjct  307  LCSNRDAYAFWDAFHPSEKANGIIVKQMFSGTTQYMYPMNLTTILQLDSK  356



>ref|XP_002522022.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40426.1| zinc finger protein, putative [Ricinus communis]
Length=369

 Score =   253 bits (647),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSIN-GQCALEPQQAAAIFNPLLI  178
            ISEY+K+LM LY++GARRVLVTGTGPLGCVPAELA R  N G C+ E Q+AA+++NP L+
Sbjct  199  ISEYKKLLMALYKLGARRVLVTGTGPLGCVPAELAMRGANNGGCSAELQRAASLYNPQLV  258

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+  LN+++G  +F+  N  QM  DFI++PQAYGF TSK+ACCGQGPYNG+GLCT ASN
Sbjct  259  QMLNGLNRKIGKTVFIGANTQQMHMDFISSPQAYGFTTSKVACCGQGPYNGLGLCTLASN  318

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC NR  YAFWDPFHPSE+ANRL+V+ I +GT  YM PMNLSTIM LD++
Sbjct  319  LCPNRGLYAFWDPFHPSEKANRLIVEQIFSGTTNYMVPMNLSTIMALDAR  368



>emb|CDY42916.1| BnaC05g47350D [Brassica napus]
Length=366

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 138/170 (81%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY KIL +LYE+GARRVLVTGTG +GC PAELAQ S NG+C    Q AAA+FNP L+ 
Sbjct  196  ISEYGKILRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPQLVN  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +IA +N ++G D+FVA NA QM  D++ NP+ +GFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  256  LIASVNAEIGQDVFVAANAYQMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGLCTPISNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWD FHP+E+ANR++V  ILTG++KYM PMNLST+M+LDS  
Sbjct  316  CPNRDLYAFWDAFHPTEKANRIIVNQILTGSSKYMHPMNLSTVMLLDSSR  365



>ref|NP_187079.1| Li-tolerant lipase 1 [Arabidopsis thaliana]
 sp|Q9M8Y5.1|LTL1_ARATH RecName: Full=GDSL esterase/lipase LTL1; AltName: Full=Extracellular 
lipase LTL1; AltName: Full=Lithium-tolerant lipase 1; 
Short=AtLTL1; Short=Li-tolerant lipase 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF26785.1|AC016829_9 putative GDSL-motif lipase/acylhydrolase [Arabidopsis thaliana]
 gb|AAM61681.1| putative GDSL-motif lipase/acylhydrolase [Arabidopsis thaliana]
 gb|AEE74063.1| Li-tolerant lipase 1 [Arabidopsis thaliana]
Length=366

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY KIL +LYE+GARRVLVTGTG +GC PAELAQ S NG+C    Q AAA+FNP L++
Sbjct  196  ISEYGKILRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPQLVD  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +IA +N ++G D+FVA NA QM  D+++NP+ +GFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  256  LIASVNAEIGQDVFVAANAYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGLCTPVSNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWD FHP+E+ANR++V  ILTG++KYM PMNLST M+LDS +
Sbjct  316  CPNRDLYAFWDAFHPTEKANRIIVNQILTGSSKYMHPMNLSTAMLLDSSK  365



>ref|XP_006408203.1| hypothetical protein EUTSA_v10020986mg [Eutrema salsugineum]
 gb|ESQ49656.1| hypothetical protein EUTSA_v10020986mg [Eutrema salsugineum]
Length=366

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY KIL +LYE+GARRVLVTGTG +GC PAELAQ S NG+C    Q AAA+FNP L++
Sbjct  196  ISEYAKILRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVD  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +IA +N ++G D+F+A NA QM  D+++NP+ +GFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  256  LIASVNAEIGQDVFIAANAYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGLCTPISNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWD FHP+E+ANR++V  IL+G++KYM PMNLST+M+LDS  
Sbjct  316  CPNRDLYAFWDAFHPTEKANRIIVNQILSGSSKYMHPMNLSTVMLLDSSR  365



>ref|XP_006443291.1| hypothetical protein CICLE_v10020640mg [Citrus clementina]
 ref|XP_006478981.1| PREDICTED: GDSL esterase/lipase At5g18430-like [Citrus sinensis]
 gb|ESR56531.1| hypothetical protein CICLE_v10020640mg [Citrus clementina]
 gb|KDO52502.1| hypothetical protein CISIN_1g017181mg [Citrus sinensis]
Length=376

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRK+LMRLYE+GARRVLVTGTGPLGCVPAELA R  NG C+ E Q+A +++NP L +
Sbjct  206  ISEYRKLLMRLYELGARRVLVTGTGPLGCVPAELALRGSNGGCSAELQRATSLYNPQLEQ  265

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  +N+++G  +F+A N  Q   DF++NPQAYGF T+K+ACCGQGP NG+GLCTA SNL
Sbjct  266  MLQGINRKIGQTVFIAANTQQTHMDFVSNPQAYGFTTAKVACCGQGPNNGLGLCTALSNL  325

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NR  YAFWDPFHPSE+ANRL+V+ I +G+  YM+PMNLST+M LDS
Sbjct  326  CPNRQLYAFWDPFHPSEKANRLIVEQIFSGSTNYMTPMNLSTVMALDS  373



>ref|XP_010413520.1| PREDICTED: GDSL esterase/lipase LTL1 [Camelina sativa]
Length=366

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 138/170 (81%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY KIL RLYE+GARRVLVTGTG +GC PAELAQ S NG+C    Q AAA+FNP L++
Sbjct  196  ISEYAKILRRLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVD  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +IA +N ++G D+FVA N+ QM  D+++NP+ +GFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  256  LIASVNAEIGQDVFVAANSYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGLCTPVSNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWD FHP+E+ANR++V  ILTG+ KYM PMNLST M+LDS  
Sbjct  316  CPNRDLYAFWDAFHPTEKANRIIVNQILTGSAKYMHPMNLSTAMLLDSSR  365



>ref|XP_009124003.1| PREDICTED: GDSL esterase/lipase LTL1-like [Brassica rapa]
Length=366

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 138/170 (81%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY K+L +LYE+GARRVLVTGTG +GC PAELAQ S NG+C    Q AAA+FNP L+ 
Sbjct  196  ISEYGKVLRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPQLVN  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +IA +N ++G D+FVA NA QM  D++ NP+ +GFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  256  LIASVNAEIGQDVFVAANAYQMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGLCTPISNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWD FHP+E+ANR++V  ILTG++KYM PMNLST+M+LDS  
Sbjct  316  CPNRDLYAFWDAFHPTEKANRIIVNQILTGSSKYMHPMNLSTVMLLDSSR  365



>emb|CDY49349.1| BnaA05g33110D [Brassica napus]
Length=366

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 138/170 (81%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY K+L +LYE+GARRVLVTGTG +GC PAELAQ S NG+C    Q AAA+FNP L+ 
Sbjct  196  ISEYGKVLRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPQLVN  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +IA +N ++G D+FVA NA QM  D++ NP+ +GFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  256  LIASVNAEIGQDVFVAANAYQMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGLCTPISNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWD FHP+E+ANR++V  ILTG++KYM PMNLST+M+LDS  
Sbjct  316  CPNRDLYAFWDAFHPTEKANRIIVNQILTGSSKYMHPMNLSTVMLLDSSR  365



>ref|XP_010463906.1| PREDICTED: GDSL esterase/lipase LTL1 [Camelina sativa]
Length=366

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 138/170 (81%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY KIL RLYE+GARRVLVTGTG +GC PAELAQ S NG+C    Q AAA+FNP L++
Sbjct  196  ISEYAKILRRLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVD  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +IA +N ++G D+FVA N+ QM  D+++NP+ +GFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  256  LIASVNAEIGQDVFVAANSYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGLCTPVSNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWD FHP+E+ANR++V  ILTG+ KYM PMNLST M+LDS  
Sbjct  316  CPNRDIYAFWDAFHPTEKANRIIVNQILTGSAKYMHPMNLSTAMLLDSSR  365



>ref|XP_009134760.1| PREDICTED: GDSL esterase/lipase LTL1 [Brassica rapa]
Length=366

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY KIL +LYE+GARRVLVTGTG +GC PAELAQ S NG+C    Q AAA+FNP L++
Sbjct  196  ISEYGKILRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVD  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +IA +N ++G ++FVA NA QM  D+++NP+ +GFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  256  LIASVNAEIGQEVFVAANAYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGLCTPISNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWD FHP+E+ANR++V  ILTG++KYM PMNLST+M+LDS  
Sbjct  316  CPNRDLYAFWDAFHPTEKANRIIVNQILTGSSKYMHPMNLSTVMLLDSSR  365



>ref|XP_010485798.1| PREDICTED: GDSL esterase/lipase LTL1-like [Camelina sativa]
Length=392

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 138/170 (81%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY KIL RLYE+GARRVLVTGTG +GC PAELAQ S NG+C    Q AAA+FNP L++
Sbjct  222  ISEYAKILRRLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVD  281

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +IA +N ++G D+FVA N+ QM  D+++NP+ +GFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  282  LIASVNAEIGQDVFVAANSYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGLCTPVSNL  341

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWD FHP+E+ANR++V  ILTG+ KYM PMNLST M+LDS  
Sbjct  342  CPNRDIYAFWDAFHPTEKANRIIVNQILTGSAKYMHPMNLSTAMLLDSSR  391



>ref|XP_002884438.1| Li-tolerant lipase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60697.1| Li-tolerant lipase 1 [Arabidopsis lyrata subsp. lyrata]
Length=366

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 138/170 (81%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY KIL +LYE+GARRVLVTGTG +GC PAELAQ S NG+C    Q AAA+FNP L++
Sbjct  196  ISEYGKILRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVD  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +IA +N ++G D+FVA NA QM  D++ NP+ +GFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  256  LIASVNAEIGQDVFVAANAYQMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGLCTPISNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWD FHP+E+ANR++V  ILTG++KYM PMNLST M+LDS  
Sbjct  316  CPNRDLYAFWDAFHPTEKANRIIVNQILTGSSKYMHPMNLSTAMLLDSSR  365



>ref|XP_007147237.1| hypothetical protein PHAVU_006G107400g [Phaseolus vulgaris]
 gb|ESW19231.1| hypothetical protein PHAVU_006G107400g [Phaseolus vulgaris]
Length=365

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 141/170 (83%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I EYRK+LMRLY++GARRV+VTGTGP+GCVPAELA R  +G C+ E Q+AA+++NP L  
Sbjct  196  IVEYRKLLMRLYDLGARRVIVTGTGPMGCVPAELALRGTSGGCSAELQRAASLYNPQLQH  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI  LN+++G D+F+A N   M NDF+NNP AYGF TS+IACCGQGPYNGIGLCT  SNL
Sbjct  256  MIQGLNKKIGKDVFIAANTALMHNDFVNNPAAYGFTTSRIACCGQGPYNGIGLCTPLSNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C +R+ +AFWDPFHPSE+A+R++V+ I++G+ +YM PMNLST++ LD+ +
Sbjct  316  CPDRNLHAFWDPFHPSEKASRIIVEQIMSGSKRYMKPMNLSTVLALDATK  365



>ref|XP_007201335.1| hypothetical protein PRUPE_ppa007652mg [Prunus persica]
 gb|EMJ02534.1| hypothetical protein PRUPE_ppa007652mg [Prunus persica]
Length=360

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 142/169 (84%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I+E+RKIL+RL+E+GARRVLVTGTGPLGCVP+ELA RS N +C  E Q AAAIFNP L++
Sbjct  192  ITEFRKILLRLFELGARRVLVTGTGPLGCVPSELA-RSGNDECDPELQGAAAIFNPQLVQ  250

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ +LN QLGSD+FV  NA  M+ DFI++PQ +GFVT+K+ACCGQGPYNG+G C   SNL
Sbjct  251  MLQELNTQLGSDVFVTANAFDMKEDFISDPQKFGFVTAKVACCGQGPYNGMGQCNPTSNL  310

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C +R+ YAFWD FHP+E+A RL+V+ I+TG+ KYM+PMNLSTIM LDS+
Sbjct  311  CPDRNLYAFWDAFHPTEKATRLIVKQIMTGSTKYMNPMNLSTIMALDSR  359



>gb|KEH42418.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=371

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +S+YR ILMRL+++GARRVLVTG GPLGC+PA+LA RSING+C  E QQAA  FN LL++
Sbjct  202  VSQYRNILMRLFDLGARRVLVTGVGPLGCIPAQLATRSINGECVNEIQQAAQFFNQLLLQ  261

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M  DLN QLG D+F+  NA QM  + I NPQ +GFVTSK+ACCGQG +NG+GLCTA SN+
Sbjct  262  MTKDLNTQLGCDVFIVANAYQMNMNLITNPQNFGFVTSKVACCGQGRFNGVGLCTALSNI  321

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD YAFWDPFHP+ERA R +VQ I  GT+ +MSPMNLSTI+ +DS 
Sbjct  322  CPNRDLYAFWDPFHPTERALRFIVQDIFNGTSDFMSPMNLSTIIAMDSN  370



>ref|XP_008345732.1| PREDICTED: GDSL esterase/lipase At5g18430-like [Malus domestica]
Length=370

 Score =   251 bits (641),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKILM LY++GARRVLVTGTGP+GC PAELA RS NG C+ E  +AAA++NP L +
Sbjct  201  ISEYRKILMNLYQLGARRVLVTGTGPMGCAPAELAARSTNGGCSAELLRAAALYNPQLTQ  260

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+A LN++LG D+F++ N  QM  DFINNPQA+GF  SK+ACCGQGPYNG GLCT  SNL
Sbjct  261  MLAGLNKKLGKDVFISANTRQMHADFINNPQAFGFTXSKVACCGQGPYNGQGLCTFLSNL  320

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NR+ Y FWD FHPSE+ANR+  + I TG+  YMSPMNLSTI+ LDS
Sbjct  321  CPNRNLYXFWDAFHPSEKANRMYAEMITTGSTDYMSPMNLSTILALDS  368



>ref|XP_008789479.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Phoenix dactylifera]
Length=364

 Score =   251 bits (641),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +SEYRKIL  LYE+GARRVLVTGTGPLGCVPAELA RS  G C  E   A+ +FNP LI+
Sbjct  195  MSEYRKILAGLYELGARRVLVTGTGPLGCVPAELALRSRTGHCDPELNGASNLFNPQLIQ  254

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++ +LN Q+GSD+F +VN   M  DFI++PQAYGFVTSKIACCGQGPYNGIGLCT  SN+
Sbjct  255  VVNELNSQIGSDVFFSVNVYSMHMDFISDPQAYGFVTSKIACCGQGPYNGIGLCTVLSNV  314

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD +AFWD FHP+ERANR++V+  + GT KYMSP+NLSTI+ +D++
Sbjct  315  CPNRDIFAFWDAFHPTERANRILVRQFMAGTTKYMSPLNLSTILAMDAR  363



>ref|XP_006297961.1| hypothetical protein CARUB_v10014002mg [Capsella rubella]
 gb|EOA30859.1| hypothetical protein CARUB_v10014002mg [Capsella rubella]
Length=367

 Score =   251 bits (640),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 137/170 (81%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY K+L +LYE+GARRVLVTGTG +GC PAELAQ S NG+C    Q AAA+FNP L++
Sbjct  197  ISEYGKVLRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVD  256

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +IA +N ++G D+FVA NA QM  D++ NP+ +GFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  257  LIASVNAEIGQDVFVAANAYQMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGLCTPISNL  316

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWD FHP+E+ANR++V  ILTG+ KYM PMNLST M+LDS  
Sbjct  317  CPNRDLYAFWDAFHPTEKANRIIVNQILTGSAKYMHPMNLSTAMLLDSTR  366



>ref|XP_010936081.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Elaeis guineensis]
Length=368

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY++IL  LYE+GARRVLVTGTGPLGCVPAELA RS  G+C  E  +A+ +FNP LI+
Sbjct  199  ISEYKQILASLYELGARRVLVTGTGPLGCVPAELALRSTTGRCDPELNRASDLFNPQLIQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
             + ++N Q+GSD+FVAVN+ +M +DFI+NPQAYGF TSKIACCGQGPYNGIGLCT  S++
Sbjct  259  ALTEINSQIGSDVFVAVNSRKMHSDFISNPQAYGFATSKIACCGQGPYNGIGLCTPLSSV  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NR+ YAFWD +HP+E+ANR++V   +TG+ +YM+PMNLSTI+ +D++ 
Sbjct  319  CPNRNLYAFWDQYHPTEKANRIIVSQFMTGSTEYMNPMNLSTILAMDARS  368



>gb|KFK37853.1| hypothetical protein AALP_AA3G037800 [Arabis alpina]
Length=366

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 137/170 (81%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY KIL +LYE+GARRVLVTGTG +GC PAELAQ S NG+C    Q AAA+FNP L+ 
Sbjct  196  ISEYGKILRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQAAAALFNPQLVY  255

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +I  +N ++G D+FVA NA QM  D+++NP+ +GFVTSK+ACCGQGPYNGIGLCT  SNL
Sbjct  256  LIKSINSEIGQDVFVAANAYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGLCTPISNL  315

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSKE  511
            C NRD YAFWD FHP+E+ANR++V  ILTG+ KYM PMNLST+M++DS  
Sbjct  316  CPNRDLYAFWDAFHPTEKANRIIVNQILTGSTKYMHPMNLSTVMLVDSTR  365



>emb|CDP04257.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL RL+E+GA RV+VTGTGPLGCVPAELA RS NG+CA E Q AA++FNP L E
Sbjct  195  ISEYRKILQRLHEVGAERVIVTGTGPLGCVPAELAMRSSNGECADELQTAASLFNPQLAE  254

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++GSD+FVA N  +   DFI NPQA+GF T+KIACCGQGPYNGIGLCT  SNL
Sbjct  255  MLTGLNKEIGSDVFVAANTNRAHMDFIANPQAFGFETAKIACCGQGPYNGIGLCTPFSNL  314

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLD  502
            C NR  Y FWD FHP+ERANRL+VQ +  G+  YM+PMNLSTI +LD
Sbjct  315  CPNRGTYVFWDAFHPTERANRLIVQQMFNGSTFYMNPMNLSTIRILD  361



>ref|XP_003533553.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=371

 Score =   249 bits (636),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I+ Y K L RLY++GARRVLVTGTGPLGC PAELA R  NG+C+ + Q+AAA++NP L +
Sbjct  200  ITRYSKHLQRLYDLGARRVLVTGTGPLGCAPAELAMRGKNGECSADLQRAAALYNPQLEQ  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ +LN++LGSD+F+A N   M ND+I NP AYGF TSK+ACCGQGPYNG+GLC   SNL
Sbjct  260  MLLELNKKLGSDVFIAANTALMHNDYITNPNAYGFNTSKVACCGQGPYNGMGLCLPVSNL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ +AFWDPFHP+E+AN+LVV+ I++G+ KYM PMNLSTI+ LD++
Sbjct  320  CPNRELHAFWDPFHPTEKANKLVVEQIMSGSTKYMKPMNLSTILALDAR  368



>ref|XP_011084724.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Sesamum indicum]
Length=367

 Score =   249 bits (635),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+K+L RLY +G  RV+VTGTGPLGCVPAELA  S NG+CA E  +AA ++NP L +
Sbjct  198  ISEYKKVLRRLYTLGVLRVIVTGTGPLGCVPAELALHSRNGECAEELMEAAQLYNPQLQD  257

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ DLN ++G  +F+A N  QM  DFI+ PQ +GF+TSKIACCGQGPYNGIGLCT  SNL
Sbjct  258  MLKDLNDEIGRKVFIAANTNQMHMDFISEPQRFGFITSKIACCGQGPYNGIGLCTPFSNL  317

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD Y FWDPFHPSE+ANR++VQ IL G NKYM PMNL T++ +DSK
Sbjct  318  CPNRDLYVFWDPFHPSEKANRIIVQQILNGDNKYMHPMNLRTMLAMDSK  366



>gb|AEY85024.1| zinc finger protein [Cajanus cajan]
Length=369

 Score =   248 bits (634),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYR ILMRLYE+GARRVLVTGTGPLGCVP++LA RS NG+C  + Q+A+ IFNPLL++
Sbjct  199  ISEYRNILMRLYELGARRVLVTGTGPLGCVPSQLATRSRNGECVPQLQEASQIFNPLLVQ  258

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M   +N Q+GS++FVAVNA QM  +FI +PQ +GFVTSKIACCGQG +NG+G CTA SNL
Sbjct  259  MTRQINSQVGSEVFVAVNAFQMNMNFITDPQRFGFVTSKIACCGQGRFNGLGTCTAVSNL  318

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NRD YAFWD +HPS+RA   +V+ I +GT+  M+PMNLSTIM  DS
Sbjct  319  CPNRDTYAFWDAYHPSQRALGFIVRGIFSGTSDIMTPMNLSTIMAFDS  366



>gb|KHN13664.1| GDSL esterase/lipase [Glycine soja]
Length=362

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I+ Y K L RLY +GARRVLVTG+GPLGC PAELA R  NG+C+ + Q+AA+++NP L +
Sbjct  191  INRYSKHLQRLYNLGARRVLVTGSGPLGCAPAELAMRGKNGECSADLQRAASLYNPQLEQ  250

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ +LN+++GSD+F+A N   M NDFI NP AYGF TSK+ACCGQGPYNG+GLC   SNL
Sbjct  251  MLLELNKKIGSDVFIAANTALMHNDFITNPNAYGFNTSKVACCGQGPYNGMGLCLPVSNL  310

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD +AFWDPFHP+E+AN+LVV+ I++G+ KYM PMNLSTI+ LD++
Sbjct  311  CPNRDLHAFWDPFHPTEKANKLVVEQIMSGSTKYMKPMNLSTILTLDAR  359



>gb|KEH28987.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=370

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 135/171 (79%), Gaps = 2/171 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKILM LYE+GARRVLVTGTGPLGCVPAELA +  NG+C +  Q A  +FNP L+E
Sbjct  199  ISEYRKILMNLYELGARRVLVTGTGPLGCVPAELAMQGRNGECGVPLQTATNLFNPQLVE  258

Query  182  MIADLNQQLG--SDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAAS  355
            +I  LN ++G  + +F+  NA  M  DF++NPQAYGF TSK ACCGQGP+NG+GLCT AS
Sbjct  259  LINQLNSEIGGPNHVFIYANAFAMHLDFVSNPQAYGFETSKQACCGQGPFNGVGLCTPAS  318

Query  356  NLCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            NLC NRD YAFWDPFHPSERANRL+V   +TGT  YM P NLST++ +DS+
Sbjct  319  NLCPNRDLYAFWDPFHPSERANRLIVDKFMTGTTDYMHPYNLSTLIAMDSR  369



>ref|XP_009371058.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At4g28780 
[Pyrus x bretschneideri]
Length=356

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEYRKIL++LYE+GA RVLVT TGPLGCVP+ELAQRSING+C  E Q AAAIFNP L+ 
Sbjct  187  ISEYRKILLKLYELGAXRVLVTSTGPLGCVPSELAQRSINGECVTELQNAAAIFNPQLVX  246

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M   LN QLGSD+F+  NA  M  DFI+NP+ +GFVTSK+ACCGQG +NG+  C   SN+
Sbjct  247  MTQGLNMQLGSDVFITANAFDMNMDFISNPEKFGFVTSKVACCGQGRFNGLRQCNPTSNV  306

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLD  502
              NRD YAFWD FHP+E+ANRL+V+ I++G++KYM+PMNLST+M LD
Sbjct  307  YPNRDLYAFWDAFHPTEKANRLIVKQIMSGSSKYMNPMNLSTMMALD  353



>ref|XP_003552505.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=371

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I+ Y K L RLY +GARRVLVTG+GPLGC PAELA R  NG+C+ + Q+AA+++NP L +
Sbjct  200  INRYSKHLQRLYNLGARRVLVTGSGPLGCAPAELAMRGKNGECSADLQRAASLYNPQLEQ  259

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+ +LN+++GSD+F+A N   M NDFI NP AYGF TSK+ACCGQGPYNG+GLC   SNL
Sbjct  260  MLLELNKKIGSDVFIAANTALMHNDFITNPNAYGFNTSKVACCGQGPYNGMGLCLPVSNL  319

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NRD +AFWDPFHP+E+AN+LVV+ I++G+ KYM PMNLSTI+ LD++
Sbjct  320  CPNRDLHAFWDPFHPTEKANKLVVEQIMSGSTKYMKPMNLSTILTLDAR  368



>ref|XP_003626500.1| GDSL esterase/lipase [Medicago truncatula]
Length=294

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I EYRK+L RLY++GARRVLVTGTGPLGCVPAE+A R  +G C+ E Q+AA ++NP L  
Sbjct  125  IIEYRKLLERLYDIGARRVLVTGTGPLGCVPAEMAMRGTDGGCSAELQRAATLYNPQLQH  184

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M+  LN+++G D+F+A N   + +DF+ NP+AYGF+TS+IACCGQG YNGIGLCT  SNL
Sbjct  185  MVQGLNKKIGKDVFIATNTALIHSDFVTNPKAYGFITSRIACCGQGAYNGIGLCTPLSNL  244

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLD  502
            C +RD YAFWD FHPSE+AN+++V+ IL+G+ +YM+PMNLSTI+ LD
Sbjct  245  CPDRDLYAFWDAFHPSEKANKIIVERILSGSKRYMNPMNLSTILALD  291



>ref|XP_010918935.1| PREDICTED: GDSL esterase/lipase LTL1 [Elaeis guineensis]
Length=364

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            I EY+KIL  L+E+GARR++VTGTGPLGCVPAELA+RS +G C  E Q+AAA+FNP LI+
Sbjct  195  IFEYKKILRTLHELGARRIMVTGTGPLGCVPAELAERSRDGSCDPELQRAAALFNPQLIQ  254

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            ++ +LN  LGSDI+++ NA +M  D++++P AYGFVTSKIACCGQGPYNG+GLCT ASNL
Sbjct  255  ILNELNTDLGSDIYISANAFKMHMDYVSDPAAYGFVTSKIACCGQGPYNGLGLCTVASNL  314

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C+NR+ Y+FWD +HP+E+ANR++V   + G+++YM+PMNLSTI+ LD+ 
Sbjct  315  CSNRNLYSFWDAYHPTEKANRIIVNQFMIGSSEYMNPMNLSTILALDAS  363



>ref|XP_008810066.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Phoenix dactylifera]
Length=366

 Score =   246 bits (628),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            ISEY+KIL RLYE+GARRVLVTGTGPLGC PAELAQRS+NG C  E   AA  FN LL++
Sbjct  197  ISEYKKILARLYELGARRVLVTGTGPLGCAPAELAQRSLNGDCDPELLGAADQFNSLLLQ  256

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
             + +LN   GSDIF++ NA +   DFI++P+AYGFVTSK+ACCGQGPYNG+GLCT ASNL
Sbjct  257  TLKELNNHFGSDIFISANAFRTHMDFISDPEAYGFVTSKVACCGQGPYNGLGLCTVASNL  316

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            CANR+ YAFWD FHP+E  NR++V   + G+ +YM PMNLSTI+ +D+
Sbjct  317  CANRNLYAFWDAFHPTEIGNRIIVSQFMIGSAEYMHPMNLSTILAMDA  364



>ref|XP_009405750.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Musa acuminata 
subsp. malaccensis]
Length=363

 Score =   246 bits (628),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +SEY+KIL RLYE+G+RRVLVTG GPLGCVPAELA RS  G C  E Q+   ++NP L++
Sbjct  194  VSEYKKILSRLYELGSRRVLVTGIGPLGCVPAELALRSRTGACDPELQRVPDLYNPQLMQ  253

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            +++DLN Q GS +FVAVNA +M  DFI NP AYGF+TS++ACCGQGPYNGIGLCT  SNL
Sbjct  254  LLSDLNTQYGSSVFVAVNAYKMHMDFITNPGAYGFITSRVACCGQGPYNGIGLCTILSNL  313

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            C NR+ YAFWD FHP+E+ANR++V   +TG  +YMSPMNLS+I+ +D++
Sbjct  314  CPNRNVYAFWDAFHPTEKANRIIVSQFMTGLEEYMSPMNLSSILAMDAR  362



>ref|XP_007162645.1| hypothetical protein PHAVU_001G168200g [Phaseolus vulgaris]
 gb|ESW34639.1| hypothetical protein PHAVU_001G168200g [Phaseolus vulgaris]
Length=393

 Score =   246 bits (629),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            +S+Y+KILMRLYE+GARRVLVTGTGPLGC+P++LA +S +G+C  E Q+A  IFNPLL  
Sbjct  224  VSQYKKILMRLYELGARRVLVTGTGPLGCLPSQLATKSTDGECVPELQEAMKIFNPLLDN  283

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            MI DLN QLG+ IF+AVNA  +  ++I NPQ YGFVT+K+ACCGQGPYNG+GLCT  S+L
Sbjct  284  MIKDLNSQLGNQIFIAVNAFLINMNYITNPQKYGFVTAKVACCGQGPYNGLGLCTPQSSL  343

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C +RD YAFWD FHPS+RA   +V AI  GT++ MSPMNL+TIM LDS
Sbjct  344  CPDRDAYAFWDGFHPSQRAVEFIVDAIFNGTSELMSPMNLTTIMALDS  391



>ref|XP_010038336.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Eucalyptus grandis]
 gb|KCW50154.1| hypothetical protein EUGRSUZ_K03589 [Eucalyptus grandis]
Length=374

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 137/170 (81%), Gaps = 1/170 (1%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQR-SINGQCALEPQQAAAIFNPLLI  178
            +SEY+KIL RLY++GARRVLVTGTGPLGCVPAELA R S NG+CA   Q+AA IFNP L 
Sbjct  204  VSEYKKILRRLYDLGARRVLVTGTGPLGCVPAELAMRGSRNGECAPRLQEAARIFNPELA  263

Query  179  EMIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASN  358
            +M+  LN ++GS++F++ NA +M  DFI++P  YGF TSKIACCG GPYNG+G C AA+N
Sbjct  264  QMLKQLNSEIGSEVFISANAFKMNMDFISDPGRYGFKTSKIACCGLGPYNGLGTCNAAAN  323

Query  359  LCANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDSK  508
            LC +R  Y FWDPFHP+ERANR++V  I  GT +YM+PMNLSTIM +DS+
Sbjct  324  LCRDRKAYVFWDPFHPTERANRIIVDQIFKGTTEYMNPMNLSTIMAMDSR  373



>ref|XP_003520622.2| PREDICTED: GDSL esterase/lipase At4g28780-like [Glycine max]
Length=328

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    ISEYRKILMRLYEMGARRVLVTGTGPLGCVPAELAQRSINGQCALEPQQAAAIFNPLLIE  181
            IS+YR+ILMRLYE+GARRVLVTGTGPLGCVP++LA RS NG+C  E QQA  IFNPLL  
Sbjct  159  ISQYRRILMRLYELGARRVLVTGTGPLGCVPSQLAMRSSNGECLAELQQATQIFNPLLDN  218

Query  182  MIADLNQQLGSDIFVAVNAMQMQNDFINNPQAYGFVTSKIACCGQGPYNGIGLCTAASNL  361
            M  DLN QLG+  FV+VNA  M  DFI NPQ YGFVTSK+A CGQGPYNG+G C   S+L
Sbjct  219  MTKDLNSQLGAHTFVSVNAFLMNIDFITNPQKYGFVTSKMASCGQGPYNGLGPCNPLSDL  278

Query  362  CANRDEYAFWDPFHPSERANRLVVQAILTGTNKYMSPMNLSTIMVLDS  505
            C NR  YAFWD FHPS+RA   +V  I  GT+  MSP+NLSTIMVLDS
Sbjct  279  CQNRYAYAFWDAFHPSQRALEFIVDEIFKGTSNLMSPINLSTIMVLDS  326



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1210457312932