BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19632_g1_i2 len=1744 path=[3225:0-832 274:833-955 682:956-1013
4983:1014-1317 4236:1318-1743]

Length=1744
                                                                      Score     E

dbj|BAI47580.1|  beta-carotene hydroxylase                              468   1e-158   Ipomoea nil [qian niu]
dbj|BAI47578.1|  beta-carotene hydroxylase                              446   6e-150   Ipomoea sp. Kenyan
dbj|BAI47579.1|  beta-carotene hydroxylase                              446   8e-150   Ipomoea obscura
gb|ABA43903.1|  beta-carotene hydroxylase                               386   1e-126   Coffea arabica [arabica coffee]
gb|ABA43899.1|  beta-carotene hydroxylase                               384   9e-126   Coffea canephora [robusta coffee]
ref|XP_002273581.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    380   2e-124   Vitis vinifera
ref|XP_009586989.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    380   4e-124   
ref|XP_009592100.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    377   7e-123   
ref|XP_006360197.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    377   8e-123   
gb|ACN86365.1|  beta-carotene hydroxylase                               376   1e-122   Diospyros kaki [Japanese persimmon]
ref|XP_011084458.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    376   1e-122   
gb|AFM82421.1|  beta-carotene hydroxylase                               375   2e-122   
gb|ADZ14893.1|  beta-carotene hydroxylase                               375   3e-122   
ref|NP_001265981.1|  beta-carotene hydroxylase                          375   5e-122   
ref|XP_009766565.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    374   1e-121   
dbj|BAE92729.1|  beta-carotene hydroxylase                              374   1e-121   Gentiana lutea
ref|XP_011076109.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    374   1e-121   
sp|B3SGL0.1|BCH_GENLU  RecName: Full=Beta-carotene 3-hydroxylase,...    374   2e-121   Gentiana lutea
gb|ADB93803.1|  beta-carotene hydroxylase                               373   2e-121   Solanum phureja x Solanum tuberosum
emb|CAB55626.2|  beta-carotene hydroxylase                              373   3e-121   Solanum lycopersicum
gb|EYU19580.1|  hypothetical protein MIMGU_mgv1a010353mg                372   4e-121   
gb|ABG46368.1|  chromoplast beta-carotene hydroxylase                   372   4e-121   Solanum lycopersicum
gb|ADF28628.1|  beta-carotene hydroxylase 2                             372   5e-121   
sp|O49814.1|BCH2_CAPAN  RecName: Full=Beta-carotene hydroxylase 2...    372   5e-121   Capsicum annuum
ref|NP_001275830.1|  beta-carotene hydroxylase                          371   9e-121   
gb|AAG33636.1|AF315289_1  beta-carotene hydroxylase                     371   1e-120   Citrus unshiu [satsuma mandarin]
gb|KDO56784.1|  hypothetical protein CISIN_1g020892mg                   371   1e-120   
emb|CAL63739.1|  beta-carotene hydroxylase                              371   1e-120   Citrus kinokuni
ref|XP_010537151.1|  PREDICTED: beta-carotene 3-hydroxylase 1, ch...    370   1e-120   
ref|XP_006422031.1|  hypothetical protein CICLE_v10005481mg             371   1e-120   
ref|XP_006353916.1|  PREDICTED: beta-carotene hydroxylase 1, chlo...    373   2e-120   
ref|XP_009780858.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    370   2e-120   
ref|NP_001234348.1|  beta-carotene hydroxylase                          369   5e-120   
gb|AIX87502.1|  carotenoid beta-ring hydroxylase 2                      369   1e-119   
gb|AGZ84227.1|  beta-carotene hydroxylase protein                       368   1e-119   
gb|AGN03857.1|  beta-carotene hydroxylase                               367   5e-119   
gb|AEB61491.1|  beta carotene hydroxylase-1                             367   5e-119   
ref|XP_007038805.1|  Beta-hydroxylase 1, 1,B1,chy1,BCH1 isoform 1       368   6e-119   
gb|AAY21681.1|  beta carotene hydoxylase                                366   7e-119   Citrus maxima [buntan]
gb|AIX87526.1|  carotenoid beta-ring hydroxylase 2                      366   8e-119   
gb|AEK86567.1|  chloroplast beta-carotene hydroxylase                   365   4e-118   
gb|KDO56785.1|  hypothetical protein CISIN_1g020892mg                   363   1e-117   
ref|XP_010105746.1|  Beta-carotene 3-hydroxylase                        365   2e-117   
gb|KHG09855.1|  Beta-carotene 3-hydroxylase 1, chloroplastic -lik...    362   2e-117   
ref|XP_008439286.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    362   2e-117   
gb|KCW46467.1|  hypothetical protein EUGRSUZ_K00294                     363   9e-117   
ref|XP_004140758.1|  PREDICTED: beta-carotene 3-hydroxylase, chlo...    360   1e-116   
ref|XP_010255227.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    360   3e-116   
ref|XP_010038447.1|  PREDICTED: beta-carotene 3-hydroxylase, chlo...    362   3e-116   
ref|XP_007152186.1|  hypothetical protein PHAVU_004G108900g             358   1e-115   
gb|KHN12938.1|  Beta-carotene 3-hydroxylase, chloroplastic              357   3e-115   
gb|ADH04291.1|  beta-carotene hydroxylase 2                             356   9e-115   
gb|KHG19691.1|  Beta-carotene 3-hydroxylase, chloroplastic              355   9e-115   
ref|XP_011046017.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    355   1e-114   
ref|XP_004496526.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    355   2e-114   
ref|XP_002513654.1|  beta-carotene hydroxylase, putative                355   2e-114   Ricinus communis
ref|NP_001241433.1|  beta-carotene 3-hydroxylase, chloroplastic-like    354   3e-114   
gb|KDP22230.1|  hypothetical protein JCGZ_26061                         353   6e-114   
ref|XP_010521360.1|  PREDICTED: beta-carotene 3-hydroxylase 1, ch...    353   6e-114   
ref|XP_011046016.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    353   8e-114   
gb|ADN29991.1|  beta-carotene hydroxylase                               353   1e-113   
gb|ABM54182.1|  beta-carotene hydroxylase                               353   1e-113   Brassica napus [oilseed rape]
ref|XP_004157181.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    352   1e-113   
gb|AHE41418.1|  beta-ring carotene hydroxylase                          352   2e-113   
gb|KHN21783.1|  Beta-carotene 3-hydroxylase, chloroplastic              350   2e-113   
gb|ABI93208.1|  beta-carotene hydroxylase 1                             352   2e-113   Adonis aestivalis var. palaestina
emb|CDX89399.1|  BnaA01g14940D                                          352   2e-113   
gb|AIX87525.1|  carotenoid beta-ring hydroxylase 1                      352   3e-113   
gb|AIX87501.1|  carotenoid beta-ring hydroxylase 1                      352   3e-113   
gb|ABL67481.1|  beta-carotene hydroxylase                               352   3e-113   Adonis aestivalis [summer pheasant's eye]
emb|CDX94423.1|  BnaC01g17610D                                          352   3e-113   
ref|XP_006372399.1|  hypothetical protein POPTR_0017s01240g             353   4e-113   
ref|XP_009139437.1|  PREDICTED: beta-carotene 3-hydroxylase 1, ch...    352   4e-113   
ref|XP_010671629.1|  PREDICTED: beta-carotene 3-hydroxylase, chlo...    352   4e-113   
sp|O49815.1|BCH1_CAPAN  RecName: Full=Beta-carotene hydroxylase 1...    352   5e-113   Capsicum annuum
gb|AFK40292.1|  unknown                                                 351   6e-113   
ref|NP_001288890.1|  beta-carotene 3-hydroxylase 1, chloroplastic       350   7e-113   
ref|XP_006413280.1|  hypothetical protein EUTSA_v10025794mg             351   8e-113   
ref|NP_001242409.1|  uncharacterized protein LOC100785541               349   4e-112   
ref|NP_001237423.1|  beta-carotene hydroxylase                          350   5e-112   
gb|KHN09301.1|  Beta-carotene 3-hydroxylase 1, chloroplastic            348   7e-112   
ref|XP_007218715.1|  hypothetical protein PRUPE_ppa009001mg             348   1e-111   
ref|NP_001239934.1|  beta-carotene hydroxylase 2, chloroplastic-like    348   1e-111   
ref|NP_001268126.1|  beta-carotene hydroxylase                          347   1e-111   
ref|XP_010448386.1|  PREDICTED: beta-carotene 3-hydroxylase 1, ch...    347   2e-111   
gb|ACS45170.1|  beta-carotene hydroxylase                               347   2e-111   Brassica rapa subsp. pekinensis [bai cai]
emb|CBI34377.3|  unnamed protein product                                347   2e-111   
gb|KHN03679.1|  Beta-carotene 3-hydroxylase 1, chloroplastic            347   2e-111   
gb|KFK29068.1|  hypothetical protein AALP_AA7G084400                    346   5e-111   
ref|XP_004308054.1|  PREDICTED: beta-carotene 3-hydroxylase, chlo...    346   6e-111   
ref|XP_008234838.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    346   6e-111   
ref|XP_010438839.1|  PREDICTED: beta-carotene 3-hydroxylase 1, ch...    346   6e-111   
ref|XP_009368730.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    346   6e-111   
gb|AAM77007.1|AF499108_1  beta-carotene hydroxylase                     345   1e-110   Vitis vinifera
gb|ACU18541.1|  unknown                                                 345   2e-110   Glycine max [soybeans]
gb|ACU23695.1|  unknown                                                 344   2e-110   Glycine max [soybeans]
gb|KEH26249.1|  beta-carotene hydroxylase                               345   2e-110   
ref|XP_002867597.1|  beta-carotene hydroxylase                          345   2e-110   
ref|XP_009377554.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    344   3e-110   
ref|XP_009375525.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    344   3e-110   
gb|KEH26252.1|  beta-carotene hydroxylase                               345   3e-110   
ref|XP_008343769.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    344   4e-110   
ref|XP_006284181.1|  hypothetical protein CARUB_v10005328mg             343   8e-110   
gb|AIT98181.1|  beta-carotene hydroxylase                               342   1e-109   
gb|ABB52074.1|  putative beta-ring carotene hydroxylase                 342   1e-109   Daucus carota subsp. sativus
gb|AAG10430.1|  beta hydroxylase                                        342   2e-109   Tagetes erecta [big marigold]
gb|EYU25142.1|  hypothetical protein MIMGU_mgv1a009955mg                343   2e-109   
ref|XP_007143466.1|  hypothetical protein PHAVU_007G074200g             344   2e-109   
gb|AAC49443.1|  beta-carotene hydroxylase                               341   4e-109   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194300.1|  beta-carotene 3-hydroxylase 1                         341   6e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008805553.1|  PREDICTED: beta-carotene 3-hydroxylase 2, ch...    341   1e-108   
ref|XP_010919115.1|  PREDICTED: beta-carotene 3-hydroxylase 2, ch...    340   1e-108   
ref|XP_003592203.1|  Beta-carotene hydroxylase                          339   2e-108   
gb|ABS76147.1|  beta-carotene hydroxylase                               340   2e-108   Elaeis oleifera
ref|XP_002865921.1|  hypothetical protein ARALYDRAFT_495328             339   2e-108   
ref|NP_200070.1|  beta-carotene hydroxylase 2                           339   3e-108   Arabidopsis thaliana [mouse-ear cress]
gb|AGQ43598.1|  beta-carotene hydroxylase                               339   3e-108   
ref|XP_010433597.1|  PREDICTED: beta-carotene 3-hydroxylase 1, ch...    338   4e-108   
ref|XP_004513181.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    338   5e-108   
gb|AGS79169.1|  beta-ring carotene hydroxylase                          338   7e-108   
emb|CAC06712.1|  beta-carotene hydroxylase                              338   1e-107   Narcissus pseudonarcissus
ref|XP_010933981.1|  PREDICTED: LOW QUALITY PROTEIN: beta-caroten...    338   2e-107   
ref|XP_006280857.1|  hypothetical protein CARUB_v10026847mg             337   2e-107   
gb|KDO56786.1|  hypothetical protein CISIN_1g020892mg                   335   3e-107   
gb|AFX79619.1|  beta-carotene hydroxylase B1                            336   4e-107   
emb|CDY65322.1|  BnaC02g44870D                                          335   5e-107   
ref|XP_006829074.1|  hypothetical protein AMTR_s00001p00259440          335   6e-107   
dbj|BAF49057.1|  beta-ring hydroxylase                                  330   9e-107   Prunus mume [ume]
ref|XP_009411429.1|  PREDICTED: beta-carotene 3-hydroxylase, chlo...    335   1e-106   
ref|XP_010442795.1|  PREDICTED: beta-carotene 3-hydroxylase 2, ch...    335   1e-106   
emb|CAC95130.2|  beta-carotene hydroxylase                              335   1e-106   Crocus sativus [saffron crocus]
gb|ABB52075.1|  putative beta-ring carotene hydroxylase                 334   2e-106   Daucus carota subsp. sativus
gb|AFI09272.1|  beta-ring hydroxylase                                   330   2e-106   
gb|AEO62170.1|  beta-carotene hydroxylase                               333   4e-106   
ref|XP_010445052.1|  PREDICTED: beta-carotene 3-hydroxylase 2, ch...    333   5e-106   
gb|KDP25394.1|  hypothetical protein JCGZ_20550                         333   6e-106   
ref|XP_004976574.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    333   6e-106   
ref|XP_009119803.1|  PREDICTED: beta-carotene 3-hydroxylase 2, ch...    332   9e-106   
ref|XP_009411428.1|  PREDICTED: beta-carotene 3-hydroxylase 2, ch...    333   1e-105   
ref|XP_011029344.1|  PREDICTED: beta-carotene 3-hydroxylase 2, ch...    333   1e-105   
ref|XP_011035341.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    331   3e-105   
ref|XP_009384515.1|  PREDICTED: beta-carotene 3-hydroxylase 2, ch...    331   5e-105   
ref|XP_009382258.1|  PREDICTED: beta-carotene 3-hydroxylase 2, ch...    330   6e-105   
gb|ACX49435.1|  beta-carotene hydroxylase 1                             328   9e-105   Zea mays [maize]
ref|XP_011084459.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    329   1e-104   
dbj|BAJ97776.1|  predicted protein                                      329   1e-104   
ref|XP_010482624.1|  PREDICTED: beta-carotene 3-hydroxylase 2, ch...    329   1e-104   
gb|AFD18925.1|  carotenoid hydroxylase                                  329   2e-104   
ref|XP_010053223.1|  PREDICTED: beta-carotene 3-hydroxylase 1, ch...    328   3e-104   
ref|XP_006476508.1|  PREDICTED: beta-carotene 3-hydroxylase 2, ch...    328   3e-104   
gb|ACX49503.1|  beta-carotene hydroxylase 1                             329   3e-104   Zea mays [maize]
gb|ACX49335.1|  beta-carotene hydroxylase 1                             329   3e-104   Zea mays [maize]
ref|XP_003580372.1|  PREDICTED: beta-carotene 3-hydroxylase, chlo...    328   4e-104   
gb|ACX49330.1|  beta-carotene hydroxylase 1                             328   4e-104   Zea mays [maize]
gb|AFW59124.1|  beta-carotene hydroxylase 1                             328   4e-104   
gb|ACX49514.1|  beta-carotene hydroxylase 1                             328   4e-104   Zea mays [maize]
gb|ACX49476.1|  beta-carotene hydroxylase 1                             328   5e-104   Zea mays [maize]
gb|ACX49433.1|  beta-carotene hydroxylase 1                             328   5e-104   Zea mays [maize]
gb|ACX49441.1|  beta-carotene hydroxylase 1                             328   6e-104   Zea mays [maize]
gb|ACX49457.1|  beta-carotene hydroxylase 1                             328   6e-104   Zea mays [maize]
gb|ACX49517.1|  beta-carotene hydroxylase 1                             328   7e-104   Zea mays [maize]
ref|NP_001105907.1|  beta-carotene hydroxylase                          328   7e-104   Zea mays [maize]
gb|ACX49516.1|  beta-carotene hydroxylase 1                             326   7e-104   Zea mays [maize]
gb|ACX49261.1|  beta-carotene hydroxylase 1                             328   7e-104   Zea mays [maize]
gb|ACX49315.1|  beta-carotene hydroxylase 1                             328   7e-104   Zea mays [maize]
gb|ACX49299.1|  beta-carotene hydroxylase 1                             328   8e-104   Zea mays [maize]
gb|ACX49278.1|  beta-carotene hydroxylase 1                             328   9e-104   Zea mays [maize]
gb|ACX49370.1|  beta-carotene hydroxylase 1                             327   1e-103   Zea mays [maize]
gb|ACX49459.1|  beta-carotene hydroxylase 1                             328   1e-103   Zea mays [maize]
gb|ACX49419.1|  beta-carotene hydroxylase 1                             327   1e-103   Zea mays [maize]
gb|ACX49436.1|  beta-carotene hydroxylase 1                             327   1e-103   Zea mays [maize]
gb|ACX49451.1|  beta-carotene hydroxylase 1                             328   1e-103   Zea mays [maize]
ref|XP_002305933.2|  hypothetical protein POPTR_0004s07230g             327   1e-103   Populus trichocarpa [western balsam poplar]
gb|ACX49526.1|  beta-carotene hydroxylase 1                             327   1e-103   Zea mays [maize]
gb|ACX49437.1|  beta-carotene hydroxylase 1                             326   2e-103   Zea mays [maize]
gb|ACX49421.1|  beta-carotene hydroxylase 1                             327   2e-103   Zea mays [maize]
ref|XP_008668663.1|  PREDICTED: beta-carotene hydroxylase isoform X1    327   2e-103   
gb|AFD18938.1|  carotenoid hydroxylase                                  327   2e-103   
ref|NP_001105865.1|  beta-carotene hydroxylase                          327   2e-103   Zea mays [maize]
gb|ACX49418.1|  beta-carotene hydroxylase 1                             327   2e-103   Zea mays [maize]
gb|AFD18929.1|  carotenoid hydroxylase                                  327   2e-103   
gb|AFD18922.1|  carotenoid hydroxylase                                  327   2e-103   
gb|ACX49363.1|  beta-carotene hydroxylase 1                             326   2e-103   Zea mays [maize]
gb|ACX49361.1|  beta-carotene hydroxylase 1                             327   2e-103   Zea mays [maize]
gb|ACX49270.1|  beta-carotene hydroxylase 1                             325   4e-103   Zea mays [maize]
gb|AFX79618.1|  beta-carotene hydroxylase A1                            326   4e-103   
gb|ACX49360.1|  beta-carotene hydroxylase 1                             326   4e-103   Zea mays [maize]
gb|KDO56783.1|  hypothetical protein CISIN_1g020892mg                   325   4e-103   
ref|XP_003592204.1|  Beta-carotene hydroxylase                          326   4e-103   
ref|XP_002509848.1|  Beta-carotene hydroxylase, putative                325   5e-103   Ricinus communis
gb|ACX49510.1|  beta-carotene hydroxylase 1                             326   5e-103   Zea mays [maize]
gb|ACX49494.1|  beta-carotene hydroxylase 1                             326   5e-103   Zea mays [maize]
ref|XP_002446979.1|  hypothetical protein SORBIDRAFT_06g026190          326   5e-103   Sorghum bicolor [broomcorn]
gb|ACX49478.1|  beta-carotene hydroxylase 1                             325   5e-103   Zea mays [maize]
gb|ACX49528.1|  beta-carotene hydroxylase 1                             326   5e-103   Zea mays [maize]
emb|CDY50294.1|  BnaA10g28380D                                          325   5e-103   
gb|ACX49353.1|  beta-carotene hydroxylase 1                             326   5e-103   Zea mays [maize]
gb|AFD18957.1|  carotenoid hydroxylase                                  325   7e-103   
gb|ACX49430.1|  beta-carotene hydroxylase 1                             326   7e-103   Zea mays [maize]
gb|ACX49440.1|  beta-carotene hydroxylase 1                             325   7e-103   Zea mays [maize]
gb|ACX49268.1|  beta-carotene hydroxylase 1                             325   8e-103   Zea mays [maize]
gb|AFD18961.1|  carotenoid hydroxylase                                  325   8e-103   
gb|AFD18905.1|  carotenoid hydroxylase                                  325   1e-102   
gb|AFD18960.1|  carotenoid hydroxylase                                  325   1e-102   
gb|AFD18958.1|  carotenoid hydroxylase                                  325   1e-102   
gb|AFD18898.1|  carotenoid hydroxylase                                  325   1e-102   
gb|AFD18904.1|  carotenoid hydroxylase                                  324   1e-102   
gb|ACG44701.1|  beta-carotene hydroxylase                               325   1e-102   Zea mays [maize]
gb|AFD18906.1|  carotenoid hydroxylase                                  324   2e-102   
dbj|BAD07291.1|  beta-ring hydroxylase                                  319   3e-102   Citrus limon [lemon]
gb|ABF93742.1|  beta-carotene hydroxylase, putative, expressed          323   3e-102   Oryza sativa Japonica Group [Japonica rice]
gb|ACX49280.1|  beta-carotene hydroxylase 1                             324   3e-102   Zea mays [maize]
gb|ACX49495.1|  beta-carotene hydroxylase 1                             324   3e-102   Zea mays [maize]
gb|ACX49371.1|  beta-carotene hydroxylase 1                             322   5e-102   Zea mays [maize]
ref|NP_001053640.1|  Os04g0578400                                       322   8e-102   Oryza sativa Japonica Group [Japonica rice]
gb|ACX49505.1|  beta-carotene hydroxylase 1                             322   1e-101   Zea mays [maize]
gb|EAZ31728.1|  hypothetical protein OsJ_15880                          322   1e-101   Oryza sativa Japonica Group [Japonica rice]
gb|ACX49356.1|  beta-carotene hydroxylase 1                             322   1e-101   Zea mays [maize]
dbj|BAD07275.1|  beta-ring hydroxylase                                  317   2e-101   Citrus unshiu [satsuma mandarin]
gb|EEC74425.1|  hypothetical protein OsI_09800                          320   2e-101   Oryza sativa Indica Group [Indian rice]
dbj|BAK01414.1|  predicted protein                                      320   2e-101   
gb|ACX49434.1|  beta-carotene hydroxylase 1                             321   4e-101   Zea mays [maize]
gb|AFX79622.1|  beta-carotene hydroxylase B2                            320   6e-101   
gb|ACX49497.1|  beta-carotene hydroxylase 1                             320   6e-101   Zea mays [maize]
ref|XP_004985901.1|  PREDICTED: beta-carotene 3-hydroxylase, chlo...    320   7e-101   
ref|XP_006652681.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    319   1e-100   
gb|ACX49496.1|  beta-carotene hydroxylase 1                             320   1e-100   Zea mays [maize]
gb|AFD18927.1|  carotenoid hydroxylase                                  319   2e-100   
gb|AFX79621.1|  beta-carotene hydroxylase A2                            318   3e-100   
ref|XP_002465958.1|  hypothetical protein SORBIDRAFT_01g048860          317   3e-100   Sorghum bicolor [broomcorn]
gb|ACX49318.1|  beta-carotene hydroxylase 1                             318   4e-100   Zea mays [maize]
gb|ACX49502.1|  beta-carotene hydroxylase 1                             318   5e-100   Zea mays [maize]
gb|ACX49485.1|  beta-carotene hydroxylase 1                             317   5e-100   Zea mays [maize]
gb|ACX49293.1|  beta-carotene hydroxylase 1                             317   5e-100   Zea mays [maize]
ref|XP_009363402.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    317   6e-100   
gb|ACX49531.1|  beta-carotene hydroxylase 1                             318   7e-100   Zea mays [maize]
gb|ACX49450.1|  beta-carotene hydroxylase 1                             317   7e-100   Zea mays [maize]
gb|ACX49504.1|  beta-carotene hydroxylase 1                             317   7e-100   Zea mays [maize]
gb|ACX49295.1|  beta-carotene hydroxylase 1                             317   8e-100   Zea mays [maize]
gb|ACX49524.1|  beta-carotene hydroxylase 1                             318   9e-100   Zea mays [maize]
gb|ACX49439.1|  beta-carotene hydroxylase 1                             317   1e-99    Zea mays [maize]
gb|ABK25382.1|  unknown                                                 317   1e-99    Picea sitchensis
gb|AFX79623.1|  beta-carotene hydroxylase D2                            316   2e-99    
ref|XP_008650403.1|  PREDICTED: beta-carotene 3-hydroxylase, chlo...    316   2e-99    
gb|ACX49340.1|  beta-carotene hydroxylase 1                             316   2e-99    Zea mays [maize]
ref|XP_004976573.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    317   3e-99    
gb|ACX49296.1|  beta-carotene hydroxylase 1                             315   5e-99    Zea mays [maize]
gb|ACX49323.1|  beta-carotene hydroxylase 1                             315   5e-99    Zea mays [maize]
gb|ACX49373.1|  beta-carotene hydroxylase 1                             315   6e-99    Zea mays [maize]
gb|ACX49374.1|  beta-carotene hydroxylase 1                             315   6e-99    Zea mays [maize]
gb|ACX49316.1|  beta-carotene hydroxylase 1                             314   6e-99    Zea mays [maize]
gb|ACX49260.1|  beta-carotene hydroxylase 1                             315   6e-99    Zea mays [maize]
gb|ACX49279.1|  beta-carotene hydroxylase 1                             315   7e-99    Zea mays [maize]
gb|ACX49319.1|  beta-carotene hydroxylase 1                             315   7e-99    Zea mays [maize]
gb|ACX49300.1|  beta-carotene hydroxylase 1                             314   7e-99    Zea mays [maize]
ref|XP_010089059.1|  Beta-carotene 3-hydroxylase                        314   8e-99    
gb|ABK24778.1|  unknown                                                 315   2e-98    Picea sitchensis
gb|EPS69050.1|  hypothetical protein M569_05711                         309   4e-98    
gb|ACX49400.1|  beta-carotene hydroxylase 1                             312   4e-98    Zea mays [maize]
ref|XP_008382459.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    311   5e-98    
ref|XP_003558926.1|  PREDICTED: beta-carotene 3-hydroxylase, chlo...    312   5e-98    
gb|ACX49347.1|  beta-carotene hydroxylase 1                             313   5e-98    Zea mays [maize]
gb|ACX49327.1|  beta-carotene hydroxylase 1                             312   8e-98    Zea mays [maize]
gb|ACX49369.1|  beta-carotene hydroxylase 1                             311   1e-97    Zea mays [maize]
ref|XP_008238944.1|  PREDICTED: beta-carotene 3-hydroxylase 1, ch...    311   1e-97    
gb|ACX49533.1|  beta-carotene hydroxylase 1                             311   2e-97    Zea mays [maize]
gb|ACX49350.1|  beta-carotene hydroxylase 1                             311   2e-97    Zea mays [maize]
ref|XP_004300813.1|  PREDICTED: beta-carotene 3-hydroxylase 1, ch...    310   2e-97    
emb|CBI22660.3|  unnamed protein product                                305   9e-97    
gb|KEH26251.1|  beta-carotene hydroxylase                               307   4e-96    
ref|NP_001048815.1|  Os03g0125100                                       308   4e-96    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001148085.1|  beta-carotene hydroxylase                          306   1e-95    Zea mays [maize]
ref|XP_007040333.1|  Beta-hydroxylase 1, 1,B1,chy1,BCH1                 306   2e-95    
gb|ACX49372.1|  beta-carotene hydroxylase 1                             305   7e-95    Zea mays [maize]
gb|EAY79324.1|  hypothetical protein OsI_34454                          303   1e-94    Oryza sativa Indica Group [Indian rice]
ref|NP_001065155.1|  Os10g0533500                                       303   1e-94    Oryza sativa Japonica Group [Japonica rice]
gb|ACF85370.1|  unknown                                                 300   3e-94    Zea mays [maize]
gb|KEH43674.1|  beta-carotene hydroxylase                               301   5e-94    
ref|XP_002985060.1|  hypothetical protein SELMODRAFT_121550             299   3e-93    
gb|AEL29210.1|  beta-carotene hydroxylase                               300   3e-93    
ref|XP_002986242.1|  hypothetical protein SELMODRAFT_14977              296   3e-93    
gb|EAZ25424.1|  hypothetical protein OsJ_09238                          299   5e-93    
ref|XP_006856040.1|  hypothetical protein AMTR_s00059p00077790          298   1e-92    
emb|CAN72150.1|  hypothetical protein VITISV_025861                     304   2e-92    
gb|ACX49367.1|  beta-carotene hydroxylase 1                             297   5e-92    
ref|XP_007211135.1|  hypothetical protein PRUPE_ppa026291mg             293   5e-92    
gb|ACX49359.1|  beta-carotene hydroxylase 1                             295   6e-92    
sp|C3VEQ1.1|BCH_ONCHC  RecName: Full=Beta-carotene 3-hydroxylase,...    296   7e-92    
ref|XP_010919116.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    296   1e-91    
gb|ACX49342.1|  beta-carotene hydroxylase 1                             293   2e-91    
gb|ACX49329.1|  beta-carotene hydroxylase 1                             293   2e-91    
gb|ACX49375.1|  beta-carotene hydroxylase 1                             293   4e-91    
gb|ACX49445.1|  beta-carotene hydroxylase 1                             292   5e-91    
gb|ACX49308.1|  beta-carotene hydroxylase 1                             292   5e-91    
gb|ACX49346.1|  beta-carotene hydroxylase 1                             292   5e-91    
gb|ACX49277.1|  beta-carotene hydroxylase 1                             292   6e-91    
gb|ACX49262.1|  beta-carotene hydroxylase 1                             292   6e-91    
gb|ACX49276.1|  beta-carotene hydroxylase 1                             292   6e-91    
gb|ACX49341.1|  beta-carotene hydroxylase 1                             295   7e-91    
gb|ACX49477.1|  beta-carotene hydroxylase 1                             291   7e-91    
gb|ACX49321.1|  beta-carotene hydroxylase 1                             291   7e-91    
gb|ACX49427.1|  beta-carotene hydroxylase 1                             291   9e-91    
ref|XP_006476509.1|  PREDICTED: beta-carotene 3-hydroxylase 2, ch...    293   9e-91    
gb|ACX49401.1|  beta-carotene hydroxylase 1                             291   1e-90    
gb|ACX49412.1|  beta-carotene hydroxylase 1                             293   2e-90    
dbj|BAK22389.1|  beta carotene hydroxylase                              287   3e-90    
gb|ACX49364.1|  beta-carotene hydroxylase 1                             290   3e-90    
gb|ACX49273.1|  beta-carotene hydroxylase 1                             290   4e-90    
gb|ACX49391.1|  beta-carotene hydroxylase 1                             290   4e-90    
gb|ACX49271.1|  beta-carotene hydroxylase 1                             290   4e-90    
gb|ACX49274.1|  beta-carotene hydroxylase 1                             290   5e-90    
gb|ACX49357.1|  beta-carotene hydroxylase 1                             289   9e-90    
gb|ACX49283.1|  beta-carotene hydroxylase 1                             288   2e-89    
ref|XP_006662543.1|  PREDICTED: beta-carotene 3-hydroxylase 1, ch...    286   3e-89    
gb|AAT84408.1|  beta carotene hydroxylase                               288   6e-89    
gb|ACX49328.1|  beta-carotene hydroxylase 1                             286   9e-89    
ref|XP_001755961.1|  predicted protein                                  285   1e-88    
ref|XP_008662349.1|  PREDICTED: beta-carotene hydroxylase isoform X2    287   3e-88    
ref|XP_002298016.2|  hypothetical protein POPTR_0001s09770g             282   6e-88    
gb|ACX49415.1|  beta-carotene hydroxylase 1                             284   8e-88    
ref|XP_008668664.1|  PREDICTED: beta-carotene hydroxylase isoform X2    283   5e-87    
ref|XP_001783685.1|  predicted protein                                  278   3e-86    
gb|ACX49259.1|  beta-carotene hydroxylase 1                             275   1e-85    
ref|XP_004143973.1|  PREDICTED: beta-carotene 3-hydroxylase 1, ch...    270   8e-82    
ref|XP_008658581.1|  PREDICTED: beta-carotene hydroxylase isoform X1    268   2e-81    
ref|XP_008437325.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    268   5e-81    
gb|EMT20046.1|  Beta-carotene hydroxylase                               265   7e-81    
gb|ACX49331.1|  beta-carotene hydroxylase 1                             258   2e-78    
gb|ACX49404.1|  beta-carotene hydroxylase 1                             256   2e-78    
gb|ACX49512.1|  beta-carotene hydroxylase 1                             257   2e-78    
dbj|BAH10591.1|  beta-ring hydroxylase                                  256   3e-78    
gb|ACX49362.1|  beta-carotene hydroxylase 1                             257   3e-78    
ref|XP_002987035.1|  hypothetical protein SELMODRAFT_125253             257   4e-78    
gb|ACX49264.1|  beta-carotene hydroxylase 1                             257   4e-78    
gb|ACX49354.1|  beta-carotene hydroxylase 1                             256   7e-78    
gb|ACX49287.1|  beta-carotene hydroxylase 1                             255   2e-77    
gb|ACX49511.1|  beta-carotene hydroxylase 1                             254   2e-77    
gb|ACX49275.1|  beta-carotene hydroxylase 1                             254   3e-77    
ref|XP_002985535.1|  hypothetical protein SELMODRAFT_122500             255   4e-77    
gb|ACX49513.1|  beta-carotene hydroxylase 1                             253   6e-77    
gb|ACX49518.1|  beta-carotene hydroxylase 1                             254   7e-77    
gb|EMS55927.1|  Beta-carotene hydroxylase                               252   7e-77    
ref|XP_010521362.1|  PREDICTED: beta-carotene 3-hydroxylase 1, ch...    254   3e-76    
gb|EMS46652.1|  Beta-carotene hydroxylase                               252   3e-76    
ref|XP_002987882.1|  hypothetical protein SELMODRAFT_126723             252   9e-76    
ref|XP_002990455.1|  hypothetical protein SELMODRAFT_131603             252   1e-75    
gb|ADN65331.1|  beta-carotene hydroxylase                               249   9e-75    
gb|ACX49501.1|  beta-carotene hydroxylase 1                             246   3e-74    
gb|KDO56787.1|  hypothetical protein CISIN_1g020892mg                   248   4e-74    
gb|ACX49507.1|  beta-carotene hydroxylase 1                             246   4e-74    
gb|ACX49523.1|  beta-carotene hydroxylase 1                             245   7e-74    
ref|XP_007038806.1|  Beta-hydroxylase 1, 1,B1,chy1,BCH1 isoform 2       247   9e-74    
gb|ACX49399.1|  beta-carotene hydroxylase 1                             246   2e-73    
gb|ACX49269.1|  beta-carotene hydroxylase 1                             244   2e-73    
gb|AAT48741.1|  beta-carotene hydroxylase                               243   5e-73    
gb|ACX49282.1|  beta-carotene hydroxylase 1                             239   8e-72    
ref|XP_006650994.1|  PREDICTED: beta-carotene 3-hydroxylase, chlo...    240   1e-71    
gb|ADI16104.1|  beta-hydroxylase                                        237   2e-71    
gb|ADI16096.1|  beta-hydroxylase                                        237   2e-71    
gb|ADI16105.1|  beta-hydroxylase                                        235   6e-71    
gb|ADI16118.1|  beta-hydroxylase                                        235   8e-71    
gb|ADI16100.1|  beta-hydroxylase                                        235   8e-71    
gb|ADI16094.1|  beta-hydroxylase                                        235   9e-71    
gb|AGE15656.1|  beta-hydroxylase                                        234   1e-70    
gb|ACX49499.1|  beta-carotene hydroxylase 1                             237   1e-70    
gb|ADI16102.1|  beta-hydroxylase                                        234   2e-70    
gb|ADI16107.1|  beta-hydroxylase                                        234   3e-70    
gb|ADI16122.1|  beta-hydroxylase                                        233   4e-70    
gb|ADI16120.1|  beta-hydroxylase                                        233   4e-70    
gb|AGE15658.1|  beta-hydroxylase                                        233   4e-70    
gb|ACX49288.1|  beta-carotene hydroxylase 1                             235   4e-70    
ref|XP_004513182.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    238   4e-70    
gb|AGD94586.1|  beta-hydroxylase                                        233   4e-70    
gb|AGE15652.1|  beta-hydroxylase                                        233   5e-70    
gb|ADI16126.1|  beta-hydroxylase                                        233   5e-70    
gb|ADI16099.1|  beta-hydroxylase                                        233   5e-70    
gb|ADI16095.1|  beta-hydroxylase                                        233   6e-70    
gb|AGE15667.1|  beta-hydroxylase                                        233   8e-70    
gb|AGE15661.1|  beta-hydroxylase                                        233   9e-70    
gb|ADI16098.1|  beta-hydroxylase                                        233   9e-70    
gb|AGE15665.1|  beta-hydroxylase                                        232   1e-69    
gb|AAS48097.1|  beta-carotene hydroxylase                               232   1e-69    
gb|ACX49365.1|  beta-carotene hydroxylase 1                             234   1e-69    
gb|ADI16116.1|  beta-hydroxylase                                        231   2e-69    
gb|AGE15660.1|  beta-hydroxylase                                        231   2e-69    
gb|ADI16142.1|  beta-hydroxylase                                        231   2e-69    
gb|AGE15666.1|  beta-hydroxylase                                        231   3e-69    
gb|ACX49498.1|  beta-carotene hydroxylase 1                             234   3e-69    
gb|ACX49289.1|  beta-carotene hydroxylase 1                             233   3e-69    
gb|ADI16119.1|  beta-hydroxylase                                        231   3e-69    
gb|ADI16135.1|  beta-hydroxylase                                        231   5e-69    
gb|AGE15647.1|  beta-hydroxylase                                        231   5e-69    
gb|AGE15655.1|  beta-hydroxylase                                        230   6e-69    
gb|AGE15646.1|  beta-hydroxylase                                        229   2e-68    
gb|AGE15662.1|  beta-hydroxylase                                        229   2e-68    
gb|AET07437.1|  beta carotene hydroxylase                               227   1e-67    
gb|AGE15654.1|  beta-hydroxylase                                        227   1e-67    
gb|ADI16131.1|  beta-hydroxylase                                        226   2e-67    
gb|ADI16130.1|  beta-hydroxylase                                        225   7e-67    
gb|AGE15657.1|  beta-hydroxylase                                        225   8e-67    
gb|KEH26250.1|  beta-carotene hydroxylase                               227   4e-66    
gb|AEQ20872.1|  beta-carotene hydroxylase                               222   4e-66    
gb|AFP65825.1|  carotene beta-ring hydroxylase                          222   7e-66    
gb|ACX49265.1|  beta-carotene hydroxylase 1                             221   2e-65    
dbj|BAE79545.1|  beta-carotene hydroxylase                              221   2e-65    
ref|XP_008650541.1|  PREDICTED: beta-carotene 3-hydroxylase 1, ch...    221   4e-65    
gb|AAL80006.1|  beta carotene hydroxylase                               220   4e-65    
gb|ADI16092.1|  beta-hydroxylase                                        219   6e-65    
gb|ACX49286.1|  beta-carotene hydroxylase 1                             219   8e-65    
gb|AAV85453.1|  beta-ring oxygenase AdKeto2                             225   1e-64    
gb|ACX49272.1|  beta-carotene hydroxylase 1                             219   1e-64    
gb|AAV85452.1|  beta-ring oxygenase AdKeto1                             225   2e-64    
gb|ACX49284.1|  beta-carotene hydroxylase 1                             217   6e-64    
ref|XP_001755690.1|  predicted protein                                  218   9e-64    
ref|XP_005644872.1|  hypothetical protein COCSUDRAFT_30875              223   3e-63    
gb|ADI16141.1|  beta-hydroxylase                                        214   5e-63    
ref|NP_001031715.1|  beta-carotene 3-hydroxylase 1                      217   2e-62    
gb|ACX49389.1|  beta-carotene hydroxylase 1                             213   3e-62    
gb|ACX49388.1|  beta-carotene hydroxylase 1                             210   2e-61    
gb|KDO76316.1|  hypothetical protein CISIN_1g027413mg                   213   3e-61    
emb|CAX36914.1|  beta-carotene hydroxylase enzyme                       210   4e-61    
ref|XP_006439490.1|  hypothetical protein CICLE_v10022121mg             213   6e-61    
gb|ABV01927.1|  beta-carotene hydroxylase 2                             208   9e-61    
gb|AIN50096.1|  carotenoid beta-ring hydroxylase                        208   1e-60    
gb|ACX49325.1|  beta-carotene hydroxylase 1                             211   1e-60    
gb|ACX49508.1|  beta-carotene hydroxylase 1                             209   2e-60    
ref|XP_006476510.1|  PREDICTED: beta-carotene 3-hydroxylase 2, ch...    213   2e-60    
ref|XP_006476511.1|  PREDICTED: beta-carotene 3-hydroxylase 2, ch...    212   3e-60    
gb|ACX49324.1|  beta-carotene hydroxylase 1                             207   3e-60    
ref|XP_001698698.1|  beta-carotene hydroxylase                          211   1e-59    
gb|ACR38695.1|  unknown                                                 207   1e-59    
gb|AEN25578.1|  beta carotene hydroxylase                               212   2e-59    
ref|XP_009363403.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    209   5e-59    
ref|XP_002503536.1|  predicted protein                                  207   9e-59    
gb|ADI16129.1|  beta-hydroxylase                                        201   8e-58    
gb|ACJ84865.1|  unknown                                                 202   3e-57    
ref|XP_002957595.1|  beta-carotene hydroxylase chloroplast precursor    205   5e-57    
gb|ABS50237.1|  beta-carotene hydroxylase                               204   5e-57    
gb|ACU44504.1|  beta-carotene hydroxylase                               198   6e-57    
ref|XP_010113136.1|  hypothetical protein L484_000137                   198   1e-56    
gb|ABB70496.1|  carotenoid hydroxylase                                  202   3e-56    
sp|Q9SPK6.1|BCH_HAEPL  RecName: Full=Beta-carotene 3-hydroxylase,...    202   1e-55    
ref|XP_007510215.1|  beta-carotene hydroxylase                          202   9e-55    
ref|XP_003055596.1|  beta-carotene hydroxylase                          202   1e-54    
ref|XP_003081631.1|  unnamed protein product                            197   2e-54    
ref|XP_008437326.1|  PREDICTED: beta-carotene 3-hydroxylase 1, ch...    196   2e-54    
gb|ACX49344.1|  beta-carotene hydroxylase 1                             189   1e-53    
ref|XP_005846632.1|  hypothetical protein CHLNCDRAFT_24463              193   2e-53    
gb|AAO53295.1|  carotenoid hydroxylase                                  192   2e-52    
gb|ACX49258.1|  beta-carotene hydroxylase 1                             185   8e-52    
gb|ADI16108.1|  beta-hydroxylase                                        180   4e-50    
gb|ADI16093.1|  beta-hydroxylase                                        170   4e-47    
ref|NP_001141074.1|  uncharacterized protein LOC100273156               173   1e-46    
gb|KFM24946.1|  Beta-carotene hydroxylase                               172   1e-45    
ref|XP_001419973.1|  predicted protein                                  162   2e-43    
gb|ACX49509.1|  beta-carotene hydroxylase 1                             158   3e-41    
gb|EMT00161.1|  Beta-carotene hydroxylase                               154   8e-41    
gb|KDO56789.1|  hypothetical protein CISIN_1g020892mg                   155   1e-40    
gb|KDO56788.1|  hypothetical protein CISIN_1g020892mg                   155   2e-40    
gb|ADI16128.1|  beta-hydroxylase                                        150   1e-39    
ref|XP_006362680.1|  PREDICTED: beta-carotene hydroxylase 1, chlo...    154   4e-39    
ref|NP_001143642.1|  uncharacterized protein LOC100276364               151   6e-39    
ref|XP_008228968.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    151   7e-39    
gb|ADC95721.1|  carotenoid beta-ring hydroxylase                        146   2e-38    
ref|XP_007208849.1|  hypothetical protein PRUPE_ppa025604mg             145   4e-37    
ref|XP_009787998.1|  PREDICTED: beta-carotene hydroxylase 2, chlo...    144   3e-36    
emb|CAI79422.2|  beta-carotene hydroxylase enzyme                       137   2e-35    
emb|CAI79420.1|  beta-carotene hydroxylase enzyme                       137   5e-35    
emb|CAI79453.1|  beta-carotene hydroxylase enzyme                       136   5e-35    
emb|CAI79421.1|  beta-carotene hydroxylase enzyme                       136   5e-35    
emb|CAI79457.1|  beta-carotene hydroxylase enzyme                       135   1e-34    
emb|CAI79432.1|  beta-carotene hydroxylase enzyme                       135   1e-34    
emb|CAI79460.1|  beta-carotene hydroxylase enzyme                       134   3e-34    
emb|CAI79427.1|  beta-carotene hydroxylase enzyme                       133   8e-34    
emb|CAI79428.1|  beta-carotene hydroxylase enzyme                       133   1e-33    
emb|CAI79419.1|  beta-carotene hydroxylase enzyme                       132   1e-33    
emb|CAI79425.1|  beta-carotene hydroxylase enzyme                       132   1e-33    
emb|CAI79439.1|  beta-carotene hydroxylase enzyme                       132   1e-33    
emb|CAI79426.1|  beta-carotene hydroxylase enzyme                       130   2e-32    
gb|ACL27571.1|  beta-carotene hydroxylase 1                             129   2e-32    
emb|CAI79445.1|  beta-carotene hydroxylase enzyme                       129   3e-32    
emb|CAI79430.1|  beta-carotene hydroxylase enzyme                       127   2e-31    
ref|NP_001119420.1|  beta-carotene hydroxylase 2                        127   7e-30    
ref|XP_007204915.1|  hypothetical protein PRUPE_ppa021528mg             123   3e-29    
gb|ACF23038.1|  ST5-18-1                                                121   3e-29    
gb|ACX42288.1|  beta-carotene hydroxylase 1                             121   7e-29    
ref|XP_007211056.1|  hypothetical protein PRUPE_ppa018632mg             123   7e-29    
gb|ACX42277.1|  beta-carotene hydroxylase 1                             120   7e-29    
emb|CAI79424.1|  beta-carotene hydroxylase enzyme                       118   3e-28    
dbj|BAE94037.1|  beta-ring hydroxylase                                  118   4e-28    
emb|CAI79423.1|  beta-carotene hydroxylase enzyme                       117   9e-28    
emb|CAI79458.1|  beta-carotene hydroxylase enzyme                       116   1e-27    
gb|AFW59119.1|  beta-carotene hydroxylase 1 isoform 1                   107   6e-24    
tpg|DAA43057.1|  TPA: hypothetical protein ZEAMMB73_554819              112   7e-24    
ref|WP_012233218.1|  beta-carotene hydroxylase                          108   1e-23    
ref|WP_020732805.1|  hypothetical protein                               107   3e-23    
gb|KDO76315.1|  hypothetical protein CISIN_1g035757mg                   103   8e-23    
emb|CAI79456.1|  beta-carotene hydroxylase enzyme                       102   1e-22    
gb|ACX49492.1|  beta-carotene hydroxylase 1                             102   7e-22    
gb|ACX49529.1|  beta-carotene hydroxylase 1                             103   1e-21    



>dbj|BAI47580.1| beta-carotene hydroxylase [Ipomoea nil]
Length=310

 Score =   468 bits (1205),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 284/284 (100%), Positives = 284/284 (100%), Gaps = 0/284 (0%)
 Frame = +3

Query  165   MAVGISIAASSRTVYSCQFSLVRPATHSAsppsllfsplsrrfrssvlrsrrKPSLTVCF  344
             MAVGISIAASSRTVYSCQFSLVRPATHSASPPSLLFSPLSRRFRSSVLRSRRKPSLTVCF
Sbjct  1     MAVGISIAASSRTVYSCQFSLVRPATHSASPPSLLFSPLSRRFRSSVLRSRRKPSLTVCF  60

Query  345   VLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSLGITSM  524
             VLEDEKLESGGVEIRAEEIERAIEKQISASRLAEKLARKRSERFTYLVAAVMSSLGITSM
Sbjct  61    VLEDEKLESGGVEIRAEEIERAIEKQISASRLAEKLARKRSERFTYLVAAVMSSLGITSM  120

Query  525   AVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWHMHESH  704
             AVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFWARWAHRALWHASLWHMHESH
Sbjct  121   AVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFWARWAHRALWHASLWHMHESH  180

Query  705   HRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDG  884
             HRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDG
Sbjct  181   HRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDG  240

Query  885   LVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             LVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK
Sbjct  241   LVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  284


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 39/62 (63%), Gaps = 9/62 (15%)
 Frame = +1

Query  1237  ELLNVVTIRNVIAGWQI--------VEHGALFWCMQELEEVGGLNDLEVEVNRRIKMSSK  1392
              + +V   R V A  Q+        V +G LF   +ELEEVGGLNDLEVEVNRRIKMSS 
Sbjct  250   PIADVPYFRRVAAAHQLHHTDKFNGVPYG-LFLGPKELEEVGGLNDLEVEVNRRIKMSST  308

Query  1393  GR  1398
             GR
Sbjct  309   GR  310



>dbj|BAI47578.1| beta-carotene hydroxylase [Ipomoea sp. Kenyan]
Length=309

 Score =   446 bits (1147),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 272/284 (96%), Positives = 277/284 (98%), Gaps = 1/284 (0%)
 Frame = +3

Query  165   MAVGISIAASSRTVYSCQFSLVRPATHSAsppsllfsplsrrfrssvlrsrrKPSLTVCF  344
             MAVGISIAASS TVY+CQFSLVRPATHSASPPSLLFSPLSRRFRSSVL SRRKP LTVCF
Sbjct  1     MAVGISIAASSGTVYNCQFSLVRPATHSASPPSLLFSPLSRRFRSSVLSSRRKPRLTVCF  60

Query  345   VLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSLGITSM  524
             VLEDEKLESG V+IRAEEIE+AIEKQISASRLAEKLARKRSER TYLVAAVMSSLGITSM
Sbjct  61    VLEDEKLESG-VQIRAEEIEKAIEKQISASRLAEKLARKRSERSTYLVAAVMSSLGITSM  119

Query  525   AVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWHMHESH  704
             AVL+VYYRFAWQMEGG VPYTEMFGTFALSVGAAVGMEFWARWAHRALWHASLWHMHESH
Sbjct  120   AVLSVYYRFAWQMEGGAVPYTEMFGTFALSVGAAVGMEFWARWAHRALWHASLWHMHESH  179

Query  705   HRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDG  884
             H+PREGPFELNDVFAI NAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDG
Sbjct  180   HKPREGPFELNDVFAIINAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDG  239

Query  885   LVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             LVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK
Sbjct  240   LVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  283


 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 9/62 (15%)
 Frame = +1

Query  1237  ELLNVVTIRNVIAGWQI--------VEHGALFWCMQELEEVGGLNDLEVEVNRRIKMSSK  1392
              + +V   R V A  Q+        V +G LF   +ELEEVGGLNDLEVEV+RRIKMSS+
Sbjct  249   PIADVPYFRRVAAAHQLHHTDKFNGVPYG-LFLGPKELEEVGGLNDLEVEVSRRIKMSSR  307

Query  1393  GR  1398
             GR
Sbjct  308   GR  309



>dbj|BAI47579.1| beta-carotene hydroxylase [Ipomoea obscura]
Length=309

 Score =   446 bits (1146),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 272/284 (96%), Positives = 276/284 (97%), Gaps = 1/284 (0%)
 Frame = +3

Query  165   MAVGISIAASSRTVYSCQFSLVRPATHSAsppsllfsplsrrfrssvlrsrrKPSLTVCF  344
             MAVGISIAASS  VY+CQFSLVRPATHSASPPSLLFSPLSRRFRSSVL SRRKP LTVCF
Sbjct  1     MAVGISIAASSGNVYNCQFSLVRPATHSASPPSLLFSPLSRRFRSSVLSSRRKPRLTVCF  60

Query  345   VLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSLGITSM  524
             VLEDEKLESG V+IRAEEIE+AIEKQISASRLAEKLARKRSER TYLVAAVMSSLGITSM
Sbjct  61    VLEDEKLESG-VQIRAEEIEKAIEKQISASRLAEKLARKRSERSTYLVAAVMSSLGITSM  119

Query  525   AVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWHMHESH  704
             AVLAVYYRFAWQMEGG VPYTEMFGTFALSVGAAVGMEFWARWAHRALWHASLWHMHESH
Sbjct  120   AVLAVYYRFAWQMEGGAVPYTEMFGTFALSVGAAVGMEFWARWAHRALWHASLWHMHESH  179

Query  705   HRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDG  884
             H+PREGPFELNDVFAI NAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDG
Sbjct  180   HKPREGPFELNDVFAIINAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDG  239

Query  885   LVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             LVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK
Sbjct  240   LVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  283


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 39/62 (63%), Gaps = 9/62 (15%)
 Frame = +1

Query  1237  ELLNVVTIRNVIAGWQI--------VEHGALFWCMQELEEVGGLNDLEVEVNRRIKMSSK  1392
              + +V   R V A  Q+        V +G LF   +ELEEVGGLNDLEVEV+RRIKMSS 
Sbjct  249   PIADVPYFRRVAAAHQLHHTDKFNGVPYG-LFLGPKELEEVGGLNDLEVEVSRRIKMSST  307

Query  1393  GR  1398
             GR
Sbjct  308   GR  309



>gb|ABA43903.1| beta-carotene hydroxylase [Coffea arabica]
 emb|CDP05144.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   386 bits (992),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 204/234 (87%), Positives = 216/234 (92%), Gaps = 2/234 (1%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeiera--ieKQISASRLAEKLARKRSERFTYLVAA  494
             KP LTVCFVLEDE+L++  V    E  ER   + K+IS +R AEKLARKRSERFTYLVAA
Sbjct  52    KPRLTVCFVLEDEELKAQLVTSEEEAREREKAMAKRISDARTAEKLARKRSERFTYLVAA  111

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwh  674
             VMSS GITSMAVLAVYYRF WQMEGGEVPY+EMFGTFALSVGAAVGMEFWARWAH+ALWH
Sbjct  112   VMSSFGITSMAVLAVYYRFVWQMEGGEVPYSEMFGTFALSVGAAVGMEFWARWAHKALWH  171

Query  675   aSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVF  854
             ASLWHMHESHHRPREGPFELNDVFAI NAVPAIALLSYGFFHKGL+PGLCFGAGLGITVF
Sbjct  172   ASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSYGFFHKGLIPGLCFGAGLGITVF  231

Query  855   GMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             GMAYMFVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHH+DKFNGVP+GLFLGPK
Sbjct  232   GMAYMFVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHSDKFNGVPFGLFLGPK  285



>gb|ABA43899.1| beta-carotene hydroxylase [Coffea canephora]
Length=310

 Score =   384 bits (986),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 203/234 (87%), Positives = 215/234 (92%), Gaps = 2/234 (1%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeiera--ieKQISASRLAEKLARKRSERFTYLVAA  494
             KP LTVCFVLEDE+L++  V    E  ER   + K+IS +R AEKLARKRSERFTYLVAA
Sbjct  52    KPRLTVCFVLEDEELKAQLVTSEEEAREREKAMAKRISDARTAEKLARKRSERFTYLVAA  111

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwh  674
             VMSS GITSMAVLAVYYRF WQMEGGEVPY+EMFGTFALSVGAAVGMEFWARWAH+ALWH
Sbjct  112   VMSSFGITSMAVLAVYYRFVWQMEGGEVPYSEMFGTFALSVGAAVGMEFWARWAHKALWH  171

Query  675   aSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVF  854
             ASLWHMHESHHRPREGPFELNDVFAI NAVPAIALLSYGFFHKGL+PGLCFGAGLGI VF
Sbjct  172   ASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSYGFFHKGLIPGLCFGAGLGIIVF  231

Query  855   GMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             GMAYMFVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHH+DKFNGVP+GLFLGPK
Sbjct  232   GMAYMFVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHSDKFNGVPFGLFLGPK  285



>ref|XP_002273581.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic [Vitis 
vinifera]
Length=306

 Score =   380 bits (977),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 202/232 (87%), Positives = 216/232 (93%), Gaps = 3/232 (1%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             K  LTVCFV+E+EKL +  VE R+EE       QISA+R+AEKLARKRSER TYLVAAVM
Sbjct  52    KTRLTVCFVVEEEKLSTEVVENRSEETLA---SQISAARVAEKLARKRSERLTYLVAAVM  108

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SS GITSMAV+AVYYRF+WQMEGGEVP +EMFGTFALSVGAAVGMEFWARWAH+ALWHAS
Sbjct  109   SSFGITSMAVMAVYYRFSWQMEGGEVPLSEMFGTFALSVGAAVGMEFWARWAHKALWHAS  168

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHH+PREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM
Sbjct  169   LWHMHESHHKPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  228

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAHQLHH+DKFNGVPYGLFLGPK
Sbjct  229   AYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHQLHHSDKFNGVPYGLFLGPK  280



>ref|XP_009586989.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=306

 Score =   380 bits (975),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 200/232 (86%), Positives = 217/232 (94%), Gaps = 0/232 (0%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             KP LTVCFVLE+EKL +    I A+EIE  IE+Q SA+RLAEKLARKRSERFTYLVAAVM
Sbjct  50    KPKLTVCFVLENEKLNTQSEIIEAKEIEVKIEEQSSAARLAEKLARKRSERFTYLVAAVM  109

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SSLGITSMAVLA+YYRF+WQMEGGEV ++EMFGTFALS GAAVGMEFWA WAHRALWH S
Sbjct  110   SSLGITSMAVLAIYYRFSWQMEGGEVSFSEMFGTFALSFGAAVGMEFWAIWAHRALWHDS  169

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHH+PREG FELNDVFAITNAVPAIALL+YGFF+KGL+PGLCFGAGLGITVFGM
Sbjct  170   LWHMHESHHKPREGAFELNDVFAITNAVPAIALLAYGFFNKGLIPGLCFGAGLGITVFGM  229

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVHKRFPVGPIA+VPYFRR+AAAHQLHH++KFNGVPYGLFLGPK
Sbjct  230   AYMFVHDGLVHKRFPVGPIANVPYFRRIAAAHQLHHSEKFNGVPYGLFLGPK  281



>ref|XP_009592100.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Nicotiana 
tomentosiformis]
 gb|AEV23057.1| beta-carotene hydroxylase [Nicotiana tabacum]
 gb|AEV23058.1| beta-carotene hydroxylase [Nicotiana tabacum]
 gb|AFP57682.1| beta-carotene hydroxylase 2 [Nicotiana tabacum]
Length=309

 Score =   377 bits (967),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 200/238 (84%), Positives = 218/238 (92%), Gaps = 6/238 (3%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLES------GGVeiraeeieraieKQISASRLAEKLARKRSERFTY  482
             KPS TVCFVLEDEKL +        +E   EEIE  IE+QISA+RLAEKLARK+SERFTY
Sbjct  47    KPSFTVCFVLEDEKLNTLFDKLNAQLETGTEEIEMKIEEQISATRLAEKLARKKSERFTY  106

Query  483   LVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahr  662
             LVAAVMSS GITS+A++AVYYRF+WQMEGGEVP TEMFGTFALSVGAAVGMEFWARWAHR
Sbjct  107   LVAAVMSSFGITSLAIMAVYYRFSWQMEGGEVPLTEMFGTFALSVGAAVGMEFWARWAHR  166

Query  663   alwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLG  842
             ALWH SLWHMHESHH+PREGPFE+NDVFAI NAVPAIALL+YGFFHKGL+PGLCFGAGLG
Sbjct  167   ALWHDSLWHMHESHHKPREGPFEMNDVFAIINAVPAIALLNYGFFHKGLIPGLCFGAGLG  226

Query  843   ITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             ITVFGMAYMFVHDGLVHKRFPVGP+A+VPYFR+VAAAH LHH++KFNGVPYGLFLGPK
Sbjct  227   ITVFGMAYMFVHDGLVHKRFPVGPVANVPYFRKVAAAHLLHHSEKFNGVPYGLFLGPK  284



>ref|XP_006360197.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Solanum 
tuberosum]
Length=309

 Score =   377 bits (967),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 200/232 (86%), Positives = 218/232 (94%), Gaps = 1/232 (0%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             KPS TVCFVLED+KL+    E  AE+ E+ IE+QISA+RLAEKLARK+SERFTYLVAAVM
Sbjct  54    KPSFTVCFVLEDKKLKPQ-FEDEAEDFEKKIEEQISATRLAEKLARKKSERFTYLVAAVM  112

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SS GITSMAV+AVYYRF+WQMEGGEVP TEM GTFALSVGAAVGMEFWARWAH+ALWHAS
Sbjct  113   SSFGITSMAVMAVYYRFSWQMEGGEVPLTEMLGTFALSVGAAVGMEFWARWAHKALWHAS  172

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHH+PREGPFELNDVFAITNAVPAIALL+YGFFHKGL+PGLCFGAGLGITVFGM
Sbjct  173   LWHMHESHHKPREGPFELNDVFAITNAVPAIALLNYGFFHKGLIPGLCFGAGLGITVFGM  232

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVHKRFPVGP+A+VPY R+VAAAH LHH++KFNGVPYGLFLGPK
Sbjct  233   AYMFVHDGLVHKRFPVGPVANVPYLRKVAAAHSLHHSEKFNGVPYGLFLGPK  284



>gb|ACN86365.1| beta-carotene hydroxylase [Diospyros kaki]
 gb|ACT52160.1| beta-carotene hydroxylase [Diospyros kaki]
Length=312

 Score =   376 bits (966),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 215/290 (74%), Positives = 238/290 (82%), Gaps = 9/290 (3%)
 Frame = +3

Query  165   MAVGISIAASSRT--VYSCQFSLVRPATHSAsppsllfsplsrrfrssvlrsrrKPSLTV  338
             M  GISIAAS     + + ++ L+ P   S          L  R   +VLRS  + + TV
Sbjct  1     MPAGISIAASGPRSFILTRKYPLLGPGPESTISTPTCLFSLPARPFGAVLRSGSRTAKTV  60

Query  339   CFVLEDE----KLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSS  506
             CFV+++E    +LE+G    + E      +K+ISA+R+ EKLARKRSERFTYLVAAVMSS
Sbjct  61    CFVVKEEELAAQLEAGD---QDETSGVETDKRISAARVEEKLARKRSERFTYLVAAVMSS  117

Query  507   LGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLW  686
              GITSMAVLAVYYRF+WQMEGGE+PY+EMFGTFALSVGAAVGMEFWARWAHRALWHASLW
Sbjct  118   FGITSMAVLAVYYRFSWQMEGGEIPYSEMFGTFALSVGAAVGMEFWARWAHRALWHASLW  177

Query  687   HMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAY  866
             HMHESHH+P EGPFELNDVFAI NAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAY
Sbjct  178   HMHESHHKPIEGPFELNDVFAIINAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAY  237

Query  867   MFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             MFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHH+DKFNGVPYGLFLGPK
Sbjct  238   MFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHSDKFNGVPYGLFLGPK  287



>ref|XP_011084458.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic isoform 
X1 [Sesamum indicum]
Length=303

 Score =   376 bits (965),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 215/285 (75%), Positives = 234/285 (82%), Gaps = 9/285 (3%)
 Frame = +3

Query  165   MAVGISIAASSRTVYSCQFS-LVRPATHSAsppsllfsplsrrfrssvlrsrrKPSLTVC  341
             MA GI IA  SRTV   + S L+ P   S    +     LS         SR+KP+LTVC
Sbjct  1     MAAGIYIATPSRTVVHFKHSPLLGPKPSS---LAAPALRLSHSLGKFPGISRKKPNLTVC  57

Query  342   FVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSLGITS  521
             FVLEDEKL   G     E  E +  K+I A+ +AEK+ARKRSERFTYL+AAVMSS GITS
Sbjct  58    FVLEDEKLRRLG----EESGEESSRKEI-ATAVAEKVARKRSERFTYLIAAVMSSFGITS  112

Query  522   MAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWHMHES  701
             M+V+AVYYRFAWQMEGGEVPY EM GTFALSVGAAVGMEFWARWAH+ALWHASLWHMHES
Sbjct  113   MSVMAVYYRFAWQMEGGEVPYAEMLGTFALSVGAAVGMEFWARWAHKALWHASLWHMHES  172

Query  702   HHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHD  881
             HH+PREGPFELNDVFAI NAVPAIALLSYGFFHKGLVPGLCFGAGLGIT+FGMAYMFVHD
Sbjct  173   HHKPREGPFELNDVFAIINAVPAIALLSYGFFHKGLVPGLCFGAGLGITMFGMAYMFVHD  232

Query  882   GLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             GLVH+RFPVGPIA+VPYFRRVAAAHQLHH+DKFNGVPYGLF GPK
Sbjct  233   GLVHRRFPVGPIANVPYFRRVAAAHQLHHSDKFNGVPYGLFFGPK  277



>gb|AFM82421.1| beta-carotene hydroxylase [Nicotiana tabacum]
Length=309

 Score =   375 bits (964),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 199/238 (84%), Positives = 217/238 (91%), Gaps = 6/238 (3%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLES------GGVeiraeeieraieKQISASRLAEKLARKRSERFTY  482
             KPS TVCFVLEDEKL +        +E   EEIE  IE+QISA+RLAEKLARK+SERFTY
Sbjct  47    KPSFTVCFVLEDEKLNTLFDKLNAQLETGTEEIEMKIEEQISATRLAEKLARKKSERFTY  106

Query  483   LVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahr  662
             LVAAVMSS GITS+A++AVYYRF+WQMEGGEVP TEMFGTFALSVGAAVGMEFWARWAHR
Sbjct  107   LVAAVMSSFGITSLAIMAVYYRFSWQMEGGEVPLTEMFGTFALSVGAAVGMEFWARWAHR  166

Query  663   alwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLG  842
             ALWH SLWHMHESHH+PREGPFE+NDVFAI NAVPAIALL+YGFFHKGL+PGLCFGAGLG
Sbjct  167   ALWHDSLWHMHESHHKPREGPFEMNDVFAIVNAVPAIALLNYGFFHKGLIPGLCFGAGLG  226

Query  843   ITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             ITVFGMAYMFVHDGLVHKRFPVGP+A+VPY R+VAAAH LHH++KFNGVPYGLFLGPK
Sbjct  227   ITVFGMAYMFVHDGLVHKRFPVGPVANVPYLRKVAAAHSLHHSEKFNGVPYGLFLGPK  284



>gb|ADZ14893.1| beta-carotene hydroxylase [Carica papaya]
Length=305

 Score =   375 bits (963),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 196/233 (84%), Positives = 212/233 (91%), Gaps = 1/233 (0%)
 Frame = +3

Query  321   KPSLTVCFVLEDEK-LESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAV  497
             + +  VCFVLE++K +     +      +    +QI AS++AEKLARKRSERFTYLVAAV
Sbjct  48    RTTFAVCFVLEEQKQIAQIENQAEELSSKDVELEQILASKMAEKLARKRSERFTYLVAAV  107

Query  498   MSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwha  677
             MSS GITSMAV+AVYYRFAWQMEGGEVP++EMFGTFALSVGAAVGMEFWARWAHRALWHA
Sbjct  108   MSSFGITSMAVMAVYYRFAWQMEGGEVPFSEMFGTFALSVGAAVGMEFWARWAHRALWHA  167

Query  678   SLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFG  857
             SLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFF+KGLVPGLCFGAGLGITVFG
Sbjct  168   SLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFNKGLVPGLCFGAGLGITVFG  227

Query  858   MAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             MAYMFVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHH+DKFNGVPYGLFLGPK
Sbjct  228   MAYMFVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHSDKFNGVPYGLFLGPK  280



>ref|NP_001265981.1| beta-carotene hydroxylase [Solanum lycopersicum]
 gb|ABI23730.1| carotene beta-hydroxylase [Solanum lycopersicum]
Length=314

 Score =   375 bits (962),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 197/237 (83%), Positives = 213/237 (90%), Gaps = 5/237 (2%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLES-----GGVeiraeeieraieKQISASRLAEKLARKRSERFTYL  485
             KP L VCFVLE+EKL S       V     ++E   EK ++AS LAEKLARK+SERFTYL
Sbjct  52    KPRLAVCFVLENEKLNSTIESESEVIEDRIQVEINEEKSLAASWLAEKLARKKSERFTYL  111

Query  486   VAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahra  665
             VAAVMSSLGITSMA+LAVYYRF+WQMEGGEVP++EM  TF LS GAAVGME+WARWAHRA
Sbjct  112   VAAVMSSLGITSMAILAVYYRFSWQMEGGEVPFSEMLATFTLSFGAAVGMEYWARWAHRA  171

Query  666   lwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGI  845
             LWHASLWHMHESHHRPREGPFE+NDVFAITNAVPAIALLSYGFFHKG+VPGLCFGAGLGI
Sbjct  172   LWHASLWHMHESHHRPREGPFEMNDVFAITNAVPAIALLSYGFFHKGIVPGLCFGAGLGI  231

Query  846   TVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             TVFGMAYMFVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHH+DKF+GVPYGLFLGPK
Sbjct  232   TVFGMAYMFVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHSDKFDGVPYGLFLGPK  288



>ref|XP_009766565.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Nicotiana 
sylvestris]
Length=306

 Score =   374 bits (959),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 192/232 (83%), Positives = 213/232 (92%), Gaps = 0/232 (0%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             KP +T CFVLE+EKL +    I A+++    E+Q S +RLAEKLARKRSERFTYLVAAVM
Sbjct  50    KPKMTACFVLENEKLNTHSDIIEAKQMGVKNEEQRSDARLAEKLARKRSERFTYLVAAVM  109

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SSLGITSMAVLAVYYRF+WQMEGGEV ++EMFGTFALS GAAVGMEFWA WAH+ALWH S
Sbjct  110   SSLGITSMAVLAVYYRFSWQMEGGEVSFSEMFGTFALSFGAAVGMEFWAIWAHKALWHDS  169

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHH+PREG FELNDVFAITNAVPAIALL+YGFF+KGL+PGLCFGAGLGITVFGM
Sbjct  170   LWHMHESHHKPREGAFELNDVFAITNAVPAIALLAYGFFNKGLIPGLCFGAGLGITVFGM  229

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVHKRFPVGPIA+VPYFRR+AAAHQLHH++KF+GVPYGLFLGPK
Sbjct  230   AYMFVHDGLVHKRFPVGPIANVPYFRRIAAAHQLHHSEKFDGVPYGLFLGPK  281



>dbj|BAE92729.1| beta-carotene hydroxylase [Gentiana lutea]
Length=320

 Score =   374 bits (960),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 216/239 (90%), Gaps = 7/239 (3%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeirae-----eieraieKQISAS--RLAEKLARKRSERFT  479
             KP LTVCFVLE+++L+   V    +     E+ +  EK+ISAS  +LA+KLARK+SERFT
Sbjct  58    KPRLTVCFVLEEKELKGKLVVASDDDDGAGEVRKQREKEISASAEKLAQKLARKKSERFT  117

Query  480   YLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwah  659
             YLVAAVMSS GITSMAVL+VYYRF+WQMEGGE+P +EMFGTFALSVGAAVGMEFWARWAH
Sbjct  118   YLVAAVMSSFGITSMAVLSVYYRFSWQMEGGEIPLSEMFGTFALSVGAAVGMEFWARWAH  177

Query  660   ralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGL  839
              ALWHASLWHMHESHH+PREGPFELND+FAI NAVPAIALLSYGFFHKGL+PGLCFGAGL
Sbjct  178   EALWHASLWHMHESHHKPREGPFELNDIFAIINAVPAIALLSYGFFHKGLIPGLCFGAGL  237

Query  840   GITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             GITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAH LHH+DKFNGVPYGLFLGPK
Sbjct  238   GITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHTLHHSDKFNGVPYGLFLGPK  296



>ref|XP_011076109.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic [Sesamum 
indicum]
Length=314

 Score =   374 bits (959),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 215/288 (75%), Positives = 236/288 (82%), Gaps = 4/288 (1%)
 Frame = +3

Query  165   MAVGISIAASSRT-VYSCQFSLVRPATHSAsppsllfsplsrrfrssvlrsrrKPSLTVC  341
             MA  ISIA +S+T V+    + + P T S   P+L   P        +    RKPSL VC
Sbjct  1     MAASISIATTSKTTVHFKHAAFLSPRTVSVGTPTLPLCPSVLEIGRILRYKTRKPSLMVC  60

Query  342   FVLEDEKL---ESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSLG  512
              VL DEKL   E      ++ E    +E   +A+R+AEK+ARKRSERFTYLVAAVMSSLG
Sbjct  61    TVLRDEKLSRLEIPDSGTKSGEESEELESSEAAARVAEKVARKRSERFTYLVAAVMSSLG  120

Query  513   ITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWHM  692
             ITSMAV+AVYYRF+WQMEGGEVPYTEMFGTFALSVGAAVGMEFWARWAH+ALWHASLWHM
Sbjct  121   ITSMAVMAVYYRFSWQMEGGEVPYTEMFGTFALSVGAAVGMEFWARWAHKALWHASLWHM  180

Query  693   HESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMF  872
             HESHHRPREGPFELNDVFAI NAVPAIALLSYGFF+KGLVPGLCFGAGLGITVFGMAYMF
Sbjct  181   HESHHRPREGPFELNDVFAIINAVPAIALLSYGFFNKGLVPGLCFGAGLGITVFGMAYMF  240

Query  873   VHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             VHDGLVH+RFPVGPIA+VPYFRRVAAAHQLHH+DKFNGVPYGLFLG K
Sbjct  241   VHDGLVHRRFPVGPIANVPYFRRVAAAHQLHHSDKFNGVPYGLFLGHK  288



>sp|B3SGL0.1|BCH_GENLU RecName: Full=Beta-carotene 3-hydroxylase, chloroplastic; Short=GenCHYB; 
Flags: Precursor [Gentiana lutea]
 gb|ACF21782.1| beta-carotene hydroxylase [Gentiana lutea]
Length=320

 Score =   374 bits (959),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 215/239 (90%), Gaps = 7/239 (3%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeirae-----eieraieKQISAS--RLAEKLARKRSERFT  479
             KP LTVCFVLE+++L    V    +     E+ +  EK+ISAS  +LA+KLARK+SERFT
Sbjct  58    KPRLTVCFVLEEKELRGKLVVASDDDDGAGEVRKQREKEISASAEKLAQKLARKKSERFT  117

Query  480   YLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwah  659
             YLVAAVMSS GITSMAVL+VYYRF+WQMEGGE+P +EMFGTFALSVGAAVGMEFWARWAH
Sbjct  118   YLVAAVMSSFGITSMAVLSVYYRFSWQMEGGEIPLSEMFGTFALSVGAAVGMEFWARWAH  177

Query  660   ralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGL  839
              ALWHASLWHMHESHH+PREGPFELND+FAI NAVPAIALLSYGFFHKGL+PGLCFGAGL
Sbjct  178   EALWHASLWHMHESHHKPREGPFELNDIFAIINAVPAIALLSYGFFHKGLIPGLCFGAGL  237

Query  840   GITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             GITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAH LHH+DKFNGVPYGLFLGPK
Sbjct  238   GITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHTLHHSDKFNGVPYGLFLGPK  296



>gb|ADB93803.1| beta-carotene hydroxylase [Solanum phureja x Solanum tuberosum]
Length=314

 Score =   373 bits (957),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 213/289 (74%), Positives = 240/289 (83%), Gaps = 6/289 (2%)
 Frame = +3

Query  165   MAVGISIAASSRTVYSCQFSLVRPATHSAsppsllfsplsrrfrssvlrsrrKPSLTVCF  344
             MA GIS +A SRT+   + +  R    +++ P +LF     R   ++L SRRKP L VCF
Sbjct  1     MAAGISASAGSRTI-CLRHNPFRGPKSASTAPPVLFFSPLTRNFGAILLSRRKPRLAVCF  59

Query  345   VLEDEKLES-----GGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
             VL++EKL S       V     ++E   EK ++A  LAEKLARK+SERFTYLVAAVMSSL
Sbjct  60    VLKNEKLNSTIQSESEVIQDQIQVEINEEKSLAACWLAEKLARKKSERFTYLVAAVMSSL  119

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMA+L+VYYRF+WQMEGGEVP++EM  TF LS GAAVGME+WARWAHRALWHASLWH
Sbjct  120   GITSMAILSVYYRFSWQMEGGEVPFSEMLATFTLSFGAAVGMEYWARWAHRALWHASLWH  179

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHHRPREGPFE+NDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM
Sbjct  180   MHESHHRPREGPFEMNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  239

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHH+DKF+GVPYGLFLGPK
Sbjct  240   FVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHSDKFDGVPYGLFLGPK  288



>emb|CAB55626.2| beta-carotene hydroxylase [Solanum lycopersicum]
Length=314

 Score =   373 bits (957),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 196/237 (83%), Positives = 212/237 (89%), Gaps = 5/237 (2%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLES-----GGVeiraeeieraieKQISASRLAEKLARKRSERFTYL  485
             KP L VCFVLE+EKL S       V     ++E   EK ++AS LAEKLARK+SERFTYL
Sbjct  52    KPRLAVCFVLENEKLNSTIESESEVIEDRIQVEINEEKSLAASWLAEKLARKKSERFTYL  111

Query  486   VAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahra  665
             VAAVMSSLGITSMA+LAVYYRF+WQMEGGEVP++EM  TF LS GAAVGME+WARWAHRA
Sbjct  112   VAAVMSSLGITSMAILAVYYRFSWQMEGGEVPFSEMLATFTLSFGAAVGMEYWARWAHRA  171

Query  666   lwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGI  845
             LWHASLWHMHESHHRPREGPFE+NDVFAITNAVPAI LLSYGFFHKG+VPGLCFGAGLGI
Sbjct  172   LWHASLWHMHESHHRPREGPFEMNDVFAITNAVPAIGLLSYGFFHKGIVPGLCFGAGLGI  231

Query  846   TVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             TVFGMAYMFVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHH+DKF+GVPYGLFLGPK
Sbjct  232   TVFGMAYMFVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHSDKFDGVPYGLFLGPK  288



>gb|EYU19580.1| hypothetical protein MIMGU_mgv1a010353mg [Erythranthe guttata]
Length=314

 Score =   372 bits (956),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 210/289 (73%), Positives = 239/289 (83%), Gaps = 5/289 (2%)
 Frame = +3

Query  165   MAVGISIAASSRTVYSCQFS-LVRPATHSAsppsllfsplsrrfrssvlrsrrKPSLTVC  341
             MA GIS+A +SRT+   + S  + P   S   P+       ++F + +   RRK +LTVC
Sbjct  1     MAAGISMATTSRTIVHSRHSPFLGPKPTSLFTPTSKLPHSLQKFHAVLRFKRRKSNLTVC  60

Query  342   FVLEDEKLESGGVeiraeei--eraieKQISASR--LAEKLARKRSERFTYLVAAVMSSL  509
             FVLE+EKL    ++   E    +     +ISA+   LAEK+ARKRSERFTYLVAAVMS+L
Sbjct  61    FVLEEEKLADWRIQDSGEGSGDDEGSGSEISAAAAGLAEKVARKRSERFTYLVAAVMSTL  120

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMAV+AVYYRFAWQMEGGEVP+ EMFGTFALSVGAAVGMEFWARWAH+ALWHASLWH
Sbjct  121   GITSMAVMAVYYRFAWQMEGGEVPFVEMFGTFALSVGAAVGMEFWARWAHKALWHASLWH  180

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHH+PREGPFELNDVFAI NA PAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM
Sbjct  181   MHESHHKPREGPFELNDVFAIINAGPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  240

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVH+RFPVGP+ADVPYFRRVA+AHQLHH++KF+GVPYGLFLGPK
Sbjct  241   FVHDGLVHRRFPVGPVADVPYFRRVASAHQLHHSEKFDGVPYGLFLGPK  289



>gb|ABG46368.1| chromoplast beta-carotene hydroxylase [Solanum lycopersicum]
Length=314

 Score =   372 bits (956),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 196/237 (83%), Positives = 212/237 (89%), Gaps = 5/237 (2%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLES-----GGVeiraeeieraieKQISASRLAEKLARKRSERFTYL  485
             KP L VCFVLE+EKL S       V     ++E   EK ++AS LAEKLARK+SERFTYL
Sbjct  52    KPRLAVCFVLENEKLNSTIESESEVIEDRIQVEINEEKSLAASWLAEKLARKKSERFTYL  111

Query  486   VAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahra  665
             VAAVMSSLGITSMA+LAVYYRF+WQMEGGEVP++EM  TF LS GAAVGME+WARWAHRA
Sbjct  112   VAAVMSSLGITSMAILAVYYRFSWQMEGGEVPFSEMLATFTLSFGAAVGMEYWARWAHRA  171

Query  666   lwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGI  845
             LWHASLWHMHESH RPREGPFE+NDVFAITNAVPAIALLSYGFFHKG+VPGLCFGAGLGI
Sbjct  172   LWHASLWHMHESHRRPREGPFEMNDVFAITNAVPAIALLSYGFFHKGIVPGLCFGAGLGI  231

Query  846   TVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             TVFGMAYMFVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHH+DKF+GVPYGLFLGPK
Sbjct  232   TVFGMAYMFVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHSDKFDGVPYGLFLGPK  288



>gb|ADF28628.1| beta-carotene hydroxylase 2 [Solanum tuberosum]
Length=314

 Score =   372 bits (955),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 213/289 (74%), Positives = 240/289 (83%), Gaps = 6/289 (2%)
 Frame = +3

Query  165   MAVGISIAASSRTVYSCQFSLVRPATHSAsppsllfsplsrrfrssvlrsrrKPSLTVCF  344
             MA GIS +A SRT+   + +  R    +++ P +LF     R   ++L SRRKP L VCF
Sbjct  1     MAAGISASAGSRTI-CLRHNPFRGPKSASTAPPVLFFSPLTRNFGAILLSRRKPRLAVCF  59

Query  345   VLEDEKLESG-----GVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
             VL++EKL S       V     ++E   EK ++A  LAEKLARK+SERFTYLVAAVMSSL
Sbjct  60    VLKNEKLNSTIQSECEVIQDQIQVEINEEKSLAACWLAEKLARKKSERFTYLVAAVMSSL  119

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMA+L+VYYRF+WQMEGGEVP++EM  TF LS GAAVGME+WARWAHRALWHASLWH
Sbjct  120   GITSMAILSVYYRFSWQMEGGEVPFSEMLATFTLSFGAAVGMEYWARWAHRALWHASLWH  179

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHHRPREGPFE+NDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM
Sbjct  180   MHESHHRPREGPFEMNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  239

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHH+DKF+GVPYGLFLGPK
Sbjct  240   FVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHSDKFDGVPYGLFLGPK  288



>sp|O49814.1|BCH2_CAPAN RecName: Full=Beta-carotene hydroxylase 2, chloroplastic; Flags: 
Precursor, partial [Capsicum annuum]
 emb|CAA70888.1| beta-carotene hydroxylase 2 [Capsicum annuum]
Length=316

 Score =   372 bits (955),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 197/232 (85%), Positives = 216/232 (93%), Gaps = 1/232 (0%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             +PS TVCFVLED+K ++   E   E+IE  IE+QISA+RLAEKLARK+SERFTYLVAAVM
Sbjct  61    RPSFTVCFVLEDDKFKTQ-FEAGEEDIEMKIEEQISATRLAEKLARKKSERFTYLVAAVM  119

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SS GITSMAV+AVYYRF WQMEGGEVP++EMFGTFALSVGAAVGMEFWARWAH+ALWHAS
Sbjct  120   SSFGITSMAVMAVYYRFYWQMEGGEVPFSEMFGTFALSVGAAVGMEFWARWAHKALWHAS  179

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHH+PREGPFELNDVFAI NAVPAIALL YGFFHKGL+PGLCFGAGLGITVFGM
Sbjct  180   LWHMHESHHKPREGPFELNDVFAIINAVPAIALLDYGFFHKGLIPGLCFGAGLGITVFGM  239

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVHKRFPVGP+A+VPY R+VAAAH LHH++KFNGVPYGLFLGPK
Sbjct  240   AYMFVHDGLVHKRFPVGPVANVPYLRKVAAAHSLHHSEKFNGVPYGLFLGPK  291



>ref|NP_001275830.1| beta-carotene hydroxylase [Citrus sinensis]
 gb|ABB49053.1| carotenoid beta-ring hydroxylase [Citrus sinensis]
Length=311

 Score =   371 bits (953),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 200/231 (87%), Positives = 212/231 (92%), Gaps = 2/231 (1%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGGVeiraeeieraieKQIS-ASRLAEKLARKRSERFTYLVAAVMS  503
             S TVCFVLE++K +S  +E   +E E     QIS A+R+AEKLARKRSERFTYLVAAVMS
Sbjct  55    SFTVCFVLEEKK-QSTQIETFTDEEEEESGTQISTAARVAEKLARKRSERFTYLVAAVMS  113

Query  504   SLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSL  683
             S GITSMAV+AVYYRF WQMEGGEVP  EMFGTFALSVGAAVGMEFWARWAH+ALWHASL
Sbjct  114   SFGITSMAVMAVYYRFWWQMEGGEVPLAEMFGTFALSVGAAVGMEFWARWAHKALWHASL  173

Query  684   WHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMA  863
             WHMHESHHRPREGPFELNDVFAI NAVPAIALLS+GFFHKGLVPGLCFGAGLGITVFGMA
Sbjct  174   WHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMA  233

Query  864   YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHH+DKF+GVPYGLFLGPK
Sbjct  234   YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHSDKFHGVPYGLFLGPK  284



>gb|AAG33636.1|AF315289_1 beta-carotene hydroxylase [Citrus unshiu]
Length=311

 Score =   371 bits (953),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 200/231 (87%), Positives = 212/231 (92%), Gaps = 2/231 (1%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGGVeiraeeieraieKQIS-ASRLAEKLARKRSERFTYLVAAVMS  503
             S TVCFVLE++K +S  +E   +E E     QIS A+R+AEKLARKRSERFTYLVAAVMS
Sbjct  55    SFTVCFVLEEKK-QSTQIETFTDEEEEESGTQISTAARVAEKLARKRSERFTYLVAAVMS  113

Query  504   SLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSL  683
             S GITSMAV+AVYYRF WQMEGGEVP  EMFGTFALSVGAAVGMEFWARWAH+ALWHASL
Sbjct  114   SFGITSMAVMAVYYRFWWQMEGGEVPLAEMFGTFALSVGAAVGMEFWARWAHKALWHASL  173

Query  684   WHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMA  863
             WHMHESHHRPREGPFELNDVFAI NAVPAIALLS+GFFHKGLVPGLCFGAGLGITVFGMA
Sbjct  174   WHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMA  233

Query  864   YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHH+DKF+GVPYGLFLGPK
Sbjct  234   YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHSDKFHGVPYGLFLGPK  284



>gb|KDO56784.1| hypothetical protein CISIN_1g020892mg [Citrus sinensis]
Length=311

 Score =   371 bits (953),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 201/231 (87%), Positives = 212/231 (92%), Gaps = 2/231 (1%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGGVeiraeeieraieKQIS-ASRLAEKLARKRSERFTYLVAAVMS  503
             S TVCFVLE++K +S  +E   EE E     QIS A+R+AEKLARKRSERFTYLVAAVMS
Sbjct  55    SFTVCFVLEEKK-QSTQIETFTEEEEEESGTQISTAARVAEKLARKRSERFTYLVAAVMS  113

Query  504   SLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSL  683
             S GITSMAV+AVYYRF WQMEGGEVP  EMFGTFALSVGAAVGMEFWARWAH+ALWHASL
Sbjct  114   SFGITSMAVMAVYYRFWWQMEGGEVPLAEMFGTFALSVGAAVGMEFWARWAHKALWHASL  173

Query  684   WHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMA  863
             WHMHESHHRPREGPFELNDVFAI NAVPAIALLS+GFFHKGLVPGLCFGAGLGITVFGMA
Sbjct  174   WHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMA  233

Query  864   YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHH+DKF+GVPYGLFLGPK
Sbjct  234   YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHSDKFHGVPYGLFLGPK  284



>emb|CAL63739.1| beta-carotene hydroxylase [Citrus kinokuni]
Length=311

 Score =   371 bits (952),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 201/231 (87%), Positives = 212/231 (92%), Gaps = 2/231 (1%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGGVeiraeeieraieKQIS-ASRLAEKLARKRSERFTYLVAAVMS  503
             S TVCFVLE++K +S  +E   EE E     QIS A+R+AEKLARKRSERFTYLVAAVMS
Sbjct  55    SFTVCFVLEEKK-QSTQIETFTEEEEEESGTQISTAARVAEKLARKRSERFTYLVAAVMS  113

Query  504   SLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSL  683
             S GITSMAV+AVYYRF WQMEGGEVP  EMFGTFALSVGAAVGMEFWARWAH+ALWHASL
Sbjct  114   SFGITSMAVMAVYYRFWWQMEGGEVPLAEMFGTFALSVGAAVGMEFWARWAHKALWHASL  173

Query  684   WHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMA  863
             WHMHESHHRPREGPFELNDVFAI NAVPAIALLS+GFFHKGLVPGLCFGAGLGITVFGMA
Sbjct  174   WHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMA  233

Query  864   YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHH+DKF+GVPYGLFLGPK
Sbjct  234   YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHSDKFHGVPYGLFLGPK  284



>ref|XP_010537151.1| PREDICTED: beta-carotene 3-hydroxylase 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=306

 Score =   370 bits (951),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 195/232 (84%), Positives = 213/232 (92%), Gaps = 1/232 (0%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             + S TVCFVLE+++ +S  +E   +E   +++ +I ASRLAEKL RK+SERFTYLVAAVM
Sbjct  49    RRSFTVCFVLEEQR-QSAQIENPLDESSSSVDAEILASRLAEKLERKKSERFTYLVAAVM  107

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SS GITSMAV+AVYYRF+WQMEGGEVP +EMFGTFALSVGAAVGMEFWARWAHRALWHAS
Sbjct  108   SSFGITSMAVMAVYYRFSWQMEGGEVPISEMFGTFALSVGAAVGMEFWARWAHRALWHAS  167

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHH+PREGPFELNDVFAI NAVPAI LLSYGFF+KGLVPGLCFGAGLGITVFGM
Sbjct  168   LWHMHESHHKPREGPFELNDVFAIINAVPAIGLLSYGFFNKGLVPGLCFGAGLGITVFGM  227

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHHTDKF GVPYGLFLGPK
Sbjct  228   AYMFVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHTDKFKGVPYGLFLGPK  279



>ref|XP_006422031.1| hypothetical protein CICLE_v10005481mg [Citrus clementina]
 gb|AAG10793.1|AF296158_1 beta-carotene hydroxylase [Citrus unshiu]
 gb|ESR35271.1| hypothetical protein CICLE_v10005481mg [Citrus clementina]
Length=311

 Score =   371 bits (952),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 201/231 (87%), Positives = 212/231 (92%), Gaps = 2/231 (1%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGGVeiraeeieraieKQIS-ASRLAEKLARKRSERFTYLVAAVMS  503
             S TVCFVLE++K +S  +E   EE E     QIS A+R+AEKLARKRSERFTYLVAAVMS
Sbjct  55    SFTVCFVLEEKK-QSTQIETFTEEEEEESGTQISTAARVAEKLARKRSERFTYLVAAVMS  113

Query  504   SLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSL  683
             S GITSMAV+AVYYRF WQMEGGEVP  EMFGTFALSVGAAVGMEFWARWAH+ALWHASL
Sbjct  114   SFGITSMAVMAVYYRFWWQMEGGEVPLAEMFGTFALSVGAAVGMEFWARWAHKALWHASL  173

Query  684   WHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMA  863
             WHMHESHHRPREGPFELNDVFAI NAVPAIALLS+GFFHKGLVPGLCFGAGLGITVFGMA
Sbjct  174   WHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMA  233

Query  864   YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHH+DKF+GVPYGLFLGPK
Sbjct  234   YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHSDKFHGVPYGLFLGPK  284



>ref|XP_006353916.1| PREDICTED: beta-carotene hydroxylase 1, chloroplastic-like [Solanum 
tuberosum]
Length=369

 Score =   373 bits (957),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 213/289 (74%), Positives = 240/289 (83%), Gaps = 6/289 (2%)
 Frame = +3

Query  165   MAVGISIAASSRTVYSCQFSLVRPATHSAsppsllfsplsrrfrssvlrsrrKPSLTVCF  344
             MA GIS +A SRT+   + +  R    +++ P +LF     R   ++L SRRKP L VCF
Sbjct  56    MAAGISASAGSRTI-CLRHNPFRGPKSASTAPPVLFFSPLTRNFGAILLSRRKPRLAVCF  114

Query  345   VLEDEKLES-----GGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
             VL++EKL S       V     ++E   EK ++A  LAEKLARK+SERFTYLVAAVMSSL
Sbjct  115   VLKNEKLNSTIQSESEVIQDQIQVEINEEKSLAACWLAEKLARKKSERFTYLVAAVMSSL  174

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMA+L+VYYRF+WQMEGGEVP++EM  TF LS GAAVGME+WARWAHRALWHASLWH
Sbjct  175   GITSMAILSVYYRFSWQMEGGEVPFSEMLATFTLSFGAAVGMEYWARWAHRALWHASLWH  234

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHHRPREGPFE+NDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM
Sbjct  235   MHESHHRPREGPFEMNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  294

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHH+DKF+GVPYGLFLGPK
Sbjct  295   FVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHSDKFDGVPYGLFLGPK  343



>ref|XP_009780858.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Nicotiana 
sylvestris]
Length=309

 Score =   370 bits (951),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 196/238 (82%), Positives = 216/238 (91%), Gaps = 6/238 (3%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLES------GGVeiraeeieraieKQISASRLAEKLARKRSERFTY  482
             KPS TVCFVL DEKL +        +E   EEIE  IE+QISA+RLAEKLARK+SERFTY
Sbjct  47    KPSFTVCFVLGDEKLNTQFDKLNAQLETGTEEIELKIEEQISATRLAEKLARKKSERFTY  106

Query  483   LVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahr  662
             L+AAVMSS GITS+A++AVYYRF+WQMEGGE+P TEMFGTFALSVGAAVGMEFWARWAHR
Sbjct  107   LLAAVMSSFGITSLAIMAVYYRFSWQMEGGEMPLTEMFGTFALSVGAAVGMEFWARWAHR  166

Query  663   alwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLG  842
             ALWH SLWHMHESHH+PREGPFE+NDVFAI NAVPAIALL+YGFFHKGL+PGLCFGAGLG
Sbjct  167   ALWHDSLWHMHESHHKPREGPFEMNDVFAIVNAVPAIALLNYGFFHKGLIPGLCFGAGLG  226

Query  843   ITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             ITVFGMAYMFVHDGLVHKRFPVGP+A+VPY R+VAAAH LHH++KFNGVPYGLFLGPK
Sbjct  227   ITVFGMAYMFVHDGLVHKRFPVGPVANVPYLRKVAAAHSLHHSEKFNGVPYGLFLGPK  284



>ref|NP_001234348.1| beta-carotene hydroxylase [Solanum lycopersicum]
 emb|CAB55625.1| beta-carotene hydroxylase [Solanum lycopersicum]
Length=309

 Score =   369 bits (948),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 196/232 (84%), Positives = 215/232 (93%), Gaps = 1/232 (0%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             KPS TVCFVLEDEKL+    +  AE+ E+ IE+QI A+RLAEKLARK+SERFTYLVAA+M
Sbjct  54    KPSFTVCFVLEDEKLKPQ-FDDEAEDFEKKIEEQILATRLAEKLARKKSERFTYLVAAIM  112

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SS GITSMAV+AVYYRF+WQMEGGEVP TEM GTFALSVGAAVGMEFWARWAH+ALWHAS
Sbjct  113   SSFGITSMAVMAVYYRFSWQMEGGEVPVTEMLGTFALSVGAAVGMEFWARWAHKALWHAS  172

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHH+PREGPFELNDVFAITNAVPAIALL+YGFFHKGL+ GLCFGAGLGITVFGM
Sbjct  173   LWHMHESHHKPREGPFELNDVFAITNAVPAIALLNYGFFHKGLIAGLCFGAGLGITVFGM  232

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVHKRFPVGP+A+VPY R+VAAAH LHH++KFNGVPYGLF GPK
Sbjct  233   AYMFVHDGLVHKRFPVGPVANVPYLRKVAAAHSLHHSEKFNGVPYGLFFGPK  284



>gb|AIX87502.1| carotenoid beta-ring hydroxylase 2 [Lycium barbarum]
Length=312

 Score =   369 bits (946),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 215/236 (91%), Gaps = 4/236 (2%)
 Frame = +3

Query  321   KPSLTVCFVL-EDEKLESGGVeiraee---ieraieKQISASRLAEKLARKRSERFTYLV  488
             KP L VCFVL ED KL++   EI   +        E++  A+RLAEKLARK+SERFTYLV
Sbjct  52    KPRLKVCFVLAEDGKLDARKTEIETIKDEIEAEINEEKSLAARLAEKLARKKSERFTYLV  111

Query  489   AAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahral  668
             AAVMSSLGITSMAVLAVYYRF+WQMEGGEVP++EMFGTFALS GAAVGME+WARWAHRAL
Sbjct  112   AAVMSSLGITSMAVLAVYYRFSWQMEGGEVPFSEMFGTFALSFGAAVGMEYWARWAHRAL  171

Query  669   whaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGIT  848
             WHASLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGL+PGLCFGAGLGIT
Sbjct  172   WHASLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLIPGLCFGAGLGIT  231

Query  849   VFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             VFGMAYMFVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHH+++F+GVPYGLFLGPK
Sbjct  232   VFGMAYMFVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHSEQFDGVPYGLFLGPK  287



>gb|AGZ84227.1| beta-carotene hydroxylase protein, partial [Lycium barbarum]
Length=312

 Score =   368 bits (945),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 215/236 (91%), Gaps = 4/236 (2%)
 Frame = +3

Query  321   KPSLTVCFVL-EDEKLESGGVeiraee---ieraieKQISASRLAEKLARKRSERFTYLV  488
             KP L VCFVL ED KL++   EI   +        E++  A+RLAEKLARK+SERFTYLV
Sbjct  52    KPRLKVCFVLAEDGKLDARKTEIETIKDEIEAEINEEKSLAARLAEKLARKKSERFTYLV  111

Query  489   AAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahral  668
             AAVMSSLGITSMAVLAVYYRF+WQMEGGEVP++EMFGTFALS GAAVGME+WARWAHRAL
Sbjct  112   AAVMSSLGITSMAVLAVYYRFSWQMEGGEVPFSEMFGTFALSFGAAVGMEYWARWAHRAL  171

Query  669   whaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGIT  848
             WHASLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGL+PGLCFGAGLGIT
Sbjct  172   WHASLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLIPGLCFGAGLGIT  231

Query  849   VFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             VFGMAYMFVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHH+++F+GVPYGLFLGPK
Sbjct  232   VFGMAYMFVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHSEQFDGVPYGLFLGPK  287



>gb|AGN03857.1| beta-carotene hydroxylase [Scutellaria baicalensis]
Length=312

 Score =   367 bits (942),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 214/239 (90%), Gaps = 7/239 (3%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESG---GVeiraeeieraieKQ--ISA-SRLAEKLARKRSERFTY  482
             KP+L VCFVLEDEK  SG   GV   +E+       Q  ISA +R+AEK+ARKRSERFTY
Sbjct  49    KPNLMVCFVLEDEKSSSGTELGVLDSSEKESGEENGQERISAEARVAEKVARKRSERFTY  108

Query  483   LVAAVMSSLGITSMAVLAVYYRFAWQMEGG-EVPYTEMFGTFALSVGAAVGMEFwarwah  659
             LVAAVMSS GITSMAVLAVY RF+WQMEGG EVPY EMFGTFALSVGAAVGMEFWARWAH
Sbjct  109   LVAAVMSSFGITSMAVLAVYCRFSWQMEGGGEVPYAEMFGTFALSVGAAVGMEFWARWAH  168

Query  660   ralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGL  839
             +ALWHASLWHMHESHH+PREGPFELNDVFAI NAVPAIALLSYGFFHKGLVPGLCFGAGL
Sbjct  169   KALWHASLWHMHESHHKPREGPFELNDVFAIVNAVPAIALLSYGFFHKGLVPGLCFGAGL  228

Query  840   GITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             GITVFG+AYMFVHDGLVH+RFPVGP+A+VPYFRRVA+AHQLHH+DKF GVPYGLFLGPK
Sbjct  229   GITVFGIAYMFVHDGLVHRRFPVGPVANVPYFRRVASAHQLHHSDKFQGVPYGLFLGPK  287



>gb|AEB61491.1| beta carotene hydroxylase-1 [Morus indica]
Length=303

 Score =   367 bits (941),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 196/229 (86%), Positives = 211/229 (92%), Gaps = 1/229 (0%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
             LTVC ++ED+K  +   E  A EI   ++ QIS  R+AEKLARKRSERFTYLVAAV+SSL
Sbjct  51    LTVCVLMEDKKRGASPAEKSAVEIPVNVDPQIS-QRVAEKLARKRSERFTYLVAAVLSSL  109

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMAV+AVYYRF WQMEGGE+PY+EMFGTFALSVGAAVGMEFWARWAHRALWHASLW+
Sbjct  110   GITSMAVMAVYYRFHWQMEGGEIPYSEMFGTFALSVGAAVGMEFWARWAHRALWHASLWN  169

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHHRPREGPFELNDVFAI NAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM
Sbjct  170   MHESHHRPREGPFELNDVFAIVNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  229

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIA+VPYFR+VAAAHQLHH+DKF GVPYGLFLGPK
Sbjct  230   FVHDGLVHKRFPVGPIANVPYFRKVAAAHQLHHSDKFEGVPYGLFLGPK  278



>ref|XP_007038805.1| Beta-hydroxylase 1, 1,B1,chy1,BCH1 isoform 1 [Theobroma cacao]
 gb|EOY23306.1| Beta-hydroxylase 1, 1,B1,chy1,BCH1 isoform 1 [Theobroma cacao]
Length=340

 Score =   368 bits (944),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 195/234 (83%), Positives = 210/234 (90%), Gaps = 2/234 (1%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeirae--eieraieKQISASRLAEKLARKRSERFTYLVAA  494
             K S  VCFVLE++K  +  +   AE    +    + +  +RLAEKLARKRSERFTYLVAA
Sbjct  46    KRSFAVCFVLEEQKQSAPQIVNLAEEGSEDARDSQILIQARLAEKLARKRSERFTYLVAA  105

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwh  674
             VMSS GITSMAV+AVYYRF+WQMEGGEVP +EMFGTFALSVGAAVGMEFWARWAHRALWH
Sbjct  106   VMSSFGITSMAVMAVYYRFSWQMEGGEVPLSEMFGTFALSVGAAVGMEFWARWAHRALWH  165

Query  675   aSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVF  854
             ASLWHMHESHHRPREGPFELNDVFAI NAVPAIALLSYGFF+KGLVPGLCFGAGLGITVF
Sbjct  166   ASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSYGFFNKGLVPGLCFGAGLGITVF  225

Query  855   GMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             GMAYMFVHDGLVHKRFPVGPIA+VPYFR+VAAAHQLHH+DKFNGVPYGLFLGPK
Sbjct  226   GMAYMFVHDGLVHKRFPVGPIANVPYFRKVAAAHQLHHSDKFNGVPYGLFLGPK  279



>gb|AAY21681.1| beta carotene hydoxylase [Citrus maxima]
Length=311

 Score =   366 bits (940),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 200/231 (87%), Positives = 210/231 (91%), Gaps = 2/231 (1%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGGVeiraeeieraieKQIS-ASRLAEKLARKRSERFTYLVAAVMS  503
             S TVCFVLE++K +S  +E   EE E     QIS A+R+AEKLARKRSERFTYLVAAVMS
Sbjct  55    SFTVCFVLEEKK-QSTQIETFTEEEEEESGTQISTAARVAEKLARKRSERFTYLVAAVMS  113

Query  504   SLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSL  683
             S GITSMAV+AVYYRF WQMEGGEVP  EMFGTFALSVGAAVGMEFWARWAH+ALWHASL
Sbjct  114   SFGITSMAVMAVYYRFWWQMEGGEVPLAEMFGTFALSVGAAVGMEFWARWAHKALWHASL  173

Query  684   WHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMA  863
             WHMHESHHRPREGPFELNDVFAI NAVPAIALLS GFFHKGLVPGLCFGAGLGITVFGMA
Sbjct  174   WHMHESHHRPREGPFELNDVFAIINAVPAIALLSVGFFHKGLVPGLCFGAGLGITVFGMA  233

Query  864   YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             YMFVHDGLVHKRFPVGPIA VPYFRRVAAAHQLHH+DKF+GVPYGLFLGPK
Sbjct  234   YMFVHDGLVHKRFPVGPIAGVPYFRRVAAAHQLHHSDKFHGVPYGLFLGPK  284



>gb|AIX87526.1| carotenoid beta-ring hydroxylase 2 [Lycium ruthenicum]
Length=312

 Score =   366 bits (940),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 197/236 (83%), Positives = 213/236 (90%), Gaps = 4/236 (2%)
 Frame = +3

Query  321   KPSLTVCFVL-EDEKLESGGVeiraeei---eraieKQISASRLAEKLARKRSERFTYLV  488
              P L VCFVL ED KL++   EI   +        E++  A+RLAEKLARK+SERFTYLV
Sbjct  52    NPRLKVCFVLAEDGKLDARKTEIETIKDEIDAEINEEKSLAARLAEKLARKKSERFTYLV  111

Query  489   AAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahral  668
             AAVMSSLGITSMAVLAVYYRF+WQMEGGEVP +EMFGTFALS GAAVGME+WARWAHRAL
Sbjct  112   AAVMSSLGITSMAVLAVYYRFSWQMEGGEVPLSEMFGTFALSFGAAVGMEYWARWAHRAL  171

Query  669   whaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGIT  848
             WHASLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGL+PGLCFGAGLGIT
Sbjct  172   WHASLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLIPGLCFGAGLGIT  231

Query  849   VFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             VFGMAYMFVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHH+++F+GVPYGLFLGPK
Sbjct  232   VFGMAYMFVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHSEQFDGVPYGLFLGPK  287



>gb|AEK86567.1| chloroplast beta-carotene hydroxylase [Cucurbita moschata]
Length=310

 Score =   365 bits (936),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 194/232 (84%), Positives = 210/232 (91%), Gaps = 1/232 (0%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             K  LTVC ++ED+   S  VE  A+E    I  QI +  +AEKLARK+SERFTYLVAAVM
Sbjct  50    KTLLTVCVLVEDQS-SSSEVENLADEKLLIIVPQIPSPHVAEKLARKKSERFTYLVAAVM  108

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SS GITSMAV+AVYYRF WQMEGGE+P++EMFGTFALSVGAAVGMEFWARWAHRALWHAS
Sbjct  109   SSFGITSMAVMAVYYRFHWQMEGGEIPFSEMFGTFALSVGAAVGMEFWARWAHRALWHAS  168

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHH+PREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM
Sbjct  169   LWHMHESHHKPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  228

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVHKRFPVGPIA+VPYFR+VAAAHQLHH++K NGVPYGLFLGPK
Sbjct  229   AYMFVHDGLVHKRFPVGPIANVPYFRKVAAAHQLHHSEKLNGVPYGLFLGPK  280



>gb|KDO56785.1| hypothetical protein CISIN_1g020892mg [Citrus sinensis]
Length=320

 Score =   363 bits (933),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 212/240 (88%), Gaps = 11/240 (5%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGGVeiraeeieraieKQIS-ASRLAEKLARKRSERFTYLVAAVMS  503
             S TVCFVLE++K +S  +E   EE E     QIS A+R+AEKLARKRSERFTYLVAAVMS
Sbjct  55    SFTVCFVLEEKK-QSTQIETFTEEEEEESGTQISTAARVAEKLARKRSERFTYLVAAVMS  113

Query  504   SLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSL  683
             S GITSMAV+AVYYRF WQMEGGEVP  EMFGTFALSVGAAVGMEFWARWAH+ALWHASL
Sbjct  114   SFGITSMAVMAVYYRFWWQMEGGEVPLAEMFGTFALSVGAAVGMEFWARWAHKALWHASL  173

Query  684   WHMHE---------SHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAG  836
             WHMHE         SHHRPREGPFELNDVFAI NAVPAIALLS+GFFHKGLVPGLCFGAG
Sbjct  174   WHMHEKVIFGISLQSHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAG  233

Query  837   LGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             LGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHH+DKF+GVPYGLFLGPK
Sbjct  234   LGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHSDKFHGVPYGLFLGPK  293



>ref|XP_010105746.1| Beta-carotene 3-hydroxylase [Morus notabilis]
 gb|EXC05966.1| Beta-carotene 3-hydroxylase [Morus notabilis]
Length=385

 Score =   365 bits (938),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 194/229 (85%), Positives = 209/229 (91%), Gaps = 1/229 (0%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
             LT+C ++ED+K  +   E  A EI   ++ QIS  R AEKLARKRSERFTYL+AAV+SS 
Sbjct  133   LTICVLMEDKKRGASPAENSAVEIPVNVDPQIS-QRAAEKLARKRSERFTYLIAAVLSSF  191

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMAV+AVYYRF WQMEGGEVPY+EMFGTFALSVGAAVGMEFWARWAHRALWHASLW+
Sbjct  192   GITSMAVMAVYYRFHWQMEGGEVPYSEMFGTFALSVGAAVGMEFWARWAHRALWHASLWN  251

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHHRPREGPFELNDVFAI NAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM
Sbjct  252   MHESHHRPREGPFELNDVFAIVNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  311

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIA+VPYFR+VAAAHQLHH+DKF GVPYGLFLGPK
Sbjct  312   FVHDGLVHKRFPVGPIANVPYFRKVAAAHQLHHSDKFEGVPYGLFLGPK  360



>gb|KHG09855.1| Beta-carotene 3-hydroxylase 1, chloroplastic -like protein [Gossypium 
arboreum]
Length=300

 Score =   362 bits (930),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 207/285 (73%), Positives = 237/285 (83%), Gaps = 11/285 (4%)
 Frame = +3

Query  165   MAVGISIAASSRTVYSCQFSLVRPATHSAsppsllfsplsrrfrssvlrsrrKPSLTVCF  344
             MAVG+S A + +   S  F L++PA         +F PL    + +   +RRK S  VCF
Sbjct  1     MAVGLSAAVTPKPFRS--FPLLKPAP--------IFHPLLHLPKITTYGARRKKSFAVCF  50

Query  345   VLEDEKLESGGVeiraeeieraieKQI-SASRLAEKLARKRSERFTYLVAAVMSSLGITS  521
             V+++E+ +S   +I  +  E   ++QI   +RL+EKLARKRSERFTYLVAAVMSS GITS
Sbjct  51    VVDEEQKQSAPTQIVEQGFEEVRDRQILIPARLSEKLARKRSERFTYLVAAVMSSFGITS  110

Query  522   MAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWHMHES  701
             M+V+AVYYRF WQMEGGEVP +EMFGTF L+VGAAVGMEFWARWAHRALWHASLWHMHES
Sbjct  111   MSVMAVYYRFWWQMEGGEVPLSEMFGTFTLAVGAAVGMEFWARWAHRALWHASLWHMHES  170

Query  702   HHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHD  881
             HHRPREGPFELNDVFAITNAVPAIALLSYGFF+KGLVPGLCFGAGLGIT+FGMAYMFVHD
Sbjct  171   HHRPREGPFELNDVFAITNAVPAIALLSYGFFNKGLVPGLCFGAGLGITMFGMAYMFVHD  230

Query  882   GLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             GLVHKRFPVGPIA+VPYFR+VAAAHQLHH++KFNGVPYGLFLGPK
Sbjct  231   GLVHKRFPVGPIANVPYFRKVAAAHQLHHSEKFNGVPYGLFLGPK  275



>ref|XP_008439286.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic [Cucumis 
melo]
 gb|AID51467.1| beta-carotene hydroxylase [Cucumis melo var. makuwa]
Length=310

 Score =   362 bits (930),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/229 (81%), Positives = 209/229 (91%), Gaps = 1/229 (0%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
             LTVC ++ED+   SG V   ++E    +  QI +  ++E+LARK+SERFTYLVAA+MSS 
Sbjct  53    LTVCVLVEDQN-SSGEVHSLSDEESPIVVPQIPSPHVSERLARKKSERFTYLVAAIMSSF  111

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMAV+AVYYRF WQMEGGE+P++EMFGTF+LSVGAAVGMEFWARWAHRALWH+SLWH
Sbjct  112   GITSMAVMAVYYRFYWQMEGGEIPFSEMFGTFSLSVGAAVGMEFWARWAHRALWHSSLWH  171

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHH+PREGPFELND+FAI NAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM
Sbjct  172   MHESHHKPREGPFELNDIFAIINAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  231

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIA+VPYFR+VAAAHQLHH+DKFNGVPYGLFLGPK
Sbjct  232   FVHDGLVHKRFPVGPIANVPYFRKVAAAHQLHHSDKFNGVPYGLFLGPK  280



>gb|KCW46467.1| hypothetical protein EUGRSUZ_K00294, partial [Eucalyptus grandis]
Length=370

 Score =   363 bits (932),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 197/247 (80%), Positives = 205/247 (83%), Gaps = 18/247 (7%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVei------------------raeeieraieKQISASRLAEKLA  455
             LTVCFVLED K     VE                    +         QISASR  E+LA
Sbjct  97    LTVCFVLEDLKQGPSPVETETETETETETASPEDGPGDSAAAAAGRPDQISASRATERLA  156

Query  456   RKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGM  635
             RKRSERFTYLVAAVMSS GITSMAV+AVYYRFAWQMEGG+VP +EMFGTF LSVGAAVGM
Sbjct  157   RKRSERFTYLVAAVMSSFGITSMAVMAVYYRFAWQMEGGQVPMSEMFGTFFLSVGAAVGM  216

Query  636   EFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVP  815
             EFWARWAHRALWHASLWHMHESHHRPR+GPFELNDVFAI NAVPAIALLSYGFFHKGLVP
Sbjct  217   EFWARWAHRALWHASLWHMHESHHRPRDGPFELNDVFAIINAVPAIALLSYGFFHKGLVP  276

Query  816   GLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPY  995
             GLCFGAGLGITVFGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAAAH LHH+DKFNGVPY
Sbjct  277   GLCFGAGLGITVFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAAAHTLHHSDKFNGVPY  336

Query  996   GLFLGPK  1016
             GLFLGPK
Sbjct  337   GLFLGPK  343



>ref|XP_004140758.1| PREDICTED: beta-carotene 3-hydroxylase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN57410.1| hypothetical protein Csa_3G183920 [Cucumis sativus]
Length=310

 Score =   360 bits (925),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 186/232 (80%), Positives = 210/232 (91%), Gaps = 1/232 (0%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             K  LTVC ++E +   SG V+  ++E    +  QI +  ++E+LARK+SERFTYLVAAVM
Sbjct  50    KTLLTVCVLVEGQN-SSGKVDNLSDEESPIVVPQIPSPHVSERLARKKSERFTYLVAAVM  108

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             S+ GITSMAV+AVYYRF WQMEGGE+P++EMFGTF+LSVGAAVGMEFWARWAHRALWH+S
Sbjct  109   STFGITSMAVMAVYYRFYWQMEGGEIPFSEMFGTFSLSVGAAVGMEFWARWAHRALWHSS  168

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHH+PREGPFELND+FAI NAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM
Sbjct  169   LWHMHESHHKPREGPFELNDIFAIINAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  228

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVHKRFPVGPIA+VPYFR+VAAAHQLHH+DKFNGVPYGLFLGPK
Sbjct  229   AYMFVHDGLVHKRFPVGPIANVPYFRKVAAAHQLHHSDKFNGVPYGLFLGPK  280



>ref|XP_010255227.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Nelumbo 
nucifera]
Length=318

 Score =   360 bits (924),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 198/292 (68%), Positives = 231/292 (79%), Gaps = 8/292 (3%)
 Frame = +3

Query  165   MAVGISIAASSRTVYSCQFSLVRPATHSAsppsllfsplsrrfrssvlrsrrKPSLTVCF  344
             M  GISIAA ++T    Q S + P   S   PS +F   + R    +  +++   +T+CF
Sbjct  1     MTAGISIAAGAKTYGFGQNSFMGPRATSFIRPSSIFFSPAIRRPLKIFPAKKSMRMTICF  60

Query  345   VLEDEK--------LESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             VLE++K        + +                ++  +R+AE+LARK+SER+TYL+AA+M
Sbjct  61    VLEEKKQDSSSGSSIRTSRAPEHNTGESSDEINRVVPARVAERLARKKSERYTYLIAAIM  120

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SSLGITSMAV AVYYRF+WQMEGGEVP +EM GTF+LSVGAAVGMEFWARWAHRALWHAS
Sbjct  121   SSLGITSMAVAAVYYRFSWQMEGGEVPVSEMLGTFSLSVGAAVGMEFWARWAHRALWHAS  180

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHHRPREGPFELNDVFAI NAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM
Sbjct  181   LWHMHESHHRPREGPFELNDVFAIINAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  240

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVH+RFPVGPIA+VPYFR+VAAAH++HH+DKFNGVPYGLFLGPK
Sbjct  241   AYMFVHDGLVHRRFPVGPIANVPYFRKVAAAHRIHHSDKFNGVPYGLFLGPK  292



>ref|XP_010038447.1| PREDICTED: beta-carotene 3-hydroxylase, chloroplastic-like [Eucalyptus 
grandis]
Length=364

 Score =   362 bits (928),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 197/247 (80%), Positives = 205/247 (83%), Gaps = 18/247 (7%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVei------------------raeeieraieKQISASRLAEKLA  455
             LTVCFVLED K     VE                    +         QISASR  E+LA
Sbjct  91    LTVCFVLEDLKQGPSPVETETETETETETASPEDGPGDSAAAAAGRPDQISASRATERLA  150

Query  456   RKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGM  635
             RKRSERFTYLVAAVMSS GITSMAV+AVYYRFAWQMEGG+VP +EMFGTF LSVGAAVGM
Sbjct  151   RKRSERFTYLVAAVMSSFGITSMAVMAVYYRFAWQMEGGQVPMSEMFGTFFLSVGAAVGM  210

Query  636   EFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVP  815
             EFWARWAHRALWHASLWHMHESHHRPR+GPFELNDVFAI NAVPAIALLSYGFFHKGLVP
Sbjct  211   EFWARWAHRALWHASLWHMHESHHRPRDGPFELNDVFAIINAVPAIALLSYGFFHKGLVP  270

Query  816   GLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPY  995
             GLCFGAGLGITVFGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAAAH LHH+DKFNGVPY
Sbjct  271   GLCFGAGLGITVFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAAAHTLHHSDKFNGVPY  330

Query  996   GLFLGPK  1016
             GLFLGPK
Sbjct  331   GLFLGPK  337



>ref|XP_007152186.1| hypothetical protein PHAVU_004G108900g [Phaseolus vulgaris]
 gb|ESW24180.1| hypothetical protein PHAVU_004G108900g [Phaseolus vulgaris]
Length=305

 Score =   358 bits (918),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 190/229 (83%), Positives = 210/229 (92%), Gaps = 1/229 (0%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
              TVC + +D K +S  +EI  +E +     Q+ + +LAEKLARK SERFTYL+AA+MSSL
Sbjct  52    FTVCVLTQDPK-QSTHMEIEEQEQQSPPPPQVLSPKLAEKLARKESERFTYLIAALMSSL  110

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             G+TSMAVLAVYYRFAWQMEGGEVP +EMFGTFAL+VGAAVGMEFWARWAHRALWHASLWH
Sbjct  111   GVTSMAVLAVYYRFAWQMEGGEVPLSEMFGTFALAVGAAVGMEFWARWAHRALWHASLWH  170

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGL+PGLCFGAGLGITVFGMAYM
Sbjct  171   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLIPGLCFGAGLGITVFGMAYM  230

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIA+VPYFRRVA+AHQLHH++KF+GVPYGLFLGPK
Sbjct  231   FVHDGLVHKRFPVGPIANVPYFRRVASAHQLHHSEKFDGVPYGLFLGPK  279



>gb|KHN12938.1| Beta-carotene 3-hydroxylase, chloroplastic [Glycine soja]
Length=301

 Score =   357 bits (915),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 205/229 (90%), Gaps = 6/229 (3%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
              TVC + ED K      + + +E E  +  Q+ ++R+AEKLARK+S+RFTYLVAAVMSS 
Sbjct  56    FTVCVLTEDPK------QTKKDEQEEQVNPQVVSARVAEKLARKKSQRFTYLVAAVMSSF  109

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMAV AVYYRF+WQMEGG+VP++EM GTF+LSVGAAV MEFWARWAHRALWHASLWH
Sbjct  110   GITSMAVFAVYYRFSWQMEGGDVPWSEMLGTFSLSVGAAVAMEFWARWAHRALWHASLWH  169

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHHRPREGPFELNDVFAI NAVPAI LLSYGFFHKGLVPGLCFGAGLGITVFGMAYM
Sbjct  170   MHESHHRPREGPFELNDVFAIINAVPAIVLLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  229

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHH+DKFNGVPYGLFLGPK
Sbjct  230   FVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHSDKFNGVPYGLFLGPK  278



>gb|ADH04291.1| beta-carotene hydroxylase 2 [Capsicum annuum]
 gb|ADH04292.1| beta-carotene hydroxylase 2 [Capsicum annuum]
 gb|ADH04293.1| beta-carotene hydroxylase 2 [Capsicum annuum]
 gb|ADH04294.1| beta-carotene hydroxylase 2 [Capsicum annuum]
 gb|ADH04295.1| beta-carotene hydroxylase 2 [Capsicum annuum]
 gb|ADH04296.1| beta-carotene hydroxylase 2 [Capsicum annuum]
 gb|ADH04297.1| beta-carotene hydroxylase 2 [Capsicum annuum]
 gb|AFA50498.1| beta-carotene hydroxylase 2 [Capsicum annuum]
Length=315

 Score =   356 bits (914),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 207/291 (71%), Positives = 236/291 (81%), Gaps = 8/291 (3%)
 Frame = +3

Query  165   MAVGISIAASSRTVYSCQFSLVRPATHSAsppsllfsplsrrfrssvlrsrrKPSLTVCF  344
             MA  ISI+ASSR +   +     P  + A+ P LLF         ++LRSRRKP L  CF
Sbjct  1     MAAEISISASSRAICLQRNPFPAP-KYFATAPPLLFFSPLTCNLDAILRSRRKPRLAACF  59

Query  345   VLEDEKL-------ESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMS  503
             VL+D+KL       +S    I  E      E++  A RLAEK ARK+SERFTYLVAAVMS
Sbjct  60    VLKDDKLYTAQSGKQSDTEAIGDEIEVETNEEKSLAVRLAEKFARKKSERFTYLVAAVMS  119

Query  504   SLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSL  683
             SLGITSMAV++VYYRF+WQMEGGE+P++EMF TFAL+ GAA+GME+WARWAHRALWHASL
Sbjct  120   SLGITSMAVISVYYRFSWQMEGGEMPFSEMFCTFALAFGAAIGMEYWARWAHRALWHASL  179

Query  684   WHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMA  863
             WHMHESHHRPREGPFELND+FAI NAVPAIALLS+GF HKGL+PGLCFGAGLGITVFGMA
Sbjct  180   WHMHESHHRPREGPFELNDIFAIINAVPAIALLSFGFNHKGLIPGLCFGAGLGITVFGMA  239

Query  864   YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             YMFVHDGLVHKRFPVGPIA+VPYF+RVAAAHQLHH+DKF+GVPYGLFLGPK
Sbjct  240   YMFVHDGLVHKRFPVGPIANVPYFQRVAAAHQLHHSDKFDGVPYGLFLGPK  290



>gb|KHG19691.1| Beta-carotene 3-hydroxylase, chloroplastic [Gossypium arboreum]
Length=304

 Score =   355 bits (912),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 191/234 (82%), Positives = 206/234 (88%), Gaps = 5/234 (2%)
 Frame = +3

Query  330   LTVCFVLEDEK----LESGGVeiraeeieraieKQI-SASRLAEKLARKRSERFTYLVAA  494
             L++CFVLE++K    L    +       E    KQI     +AEKLARK+SERFTYLVAA
Sbjct  46    LSICFVLEEQKDVEPLTLVNLVEEGSGSEDFGNKQILIPPHVAEKLARKKSERFTYLVAA  105

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwh  674
             VMSS GITSMA++AVYYRF+WQMEGGEVP +EMFGTFALSVGAAVGMEFWARWAHRALWH
Sbjct  106   VMSSFGITSMAIMAVYYRFSWQMEGGEVPLSEMFGTFALSVGAAVGMEFWARWAHRALWH  165

Query  675   aSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVF  854
             ASLWHMHESHHRPREGPFELNDVFAI NAVPAIALLSYGFF+KGLVPGLCFGAGLGITVF
Sbjct  166   ASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSYGFFNKGLVPGLCFGAGLGITVF  225

Query  855   GMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             GMAYMFVHDGLVHKRFPVGPIADVPYFR+VAAAHQLHH++KF GVPYGLFLGPK
Sbjct  226   GMAYMFVHDGLVHKRFPVGPIADVPYFRKVAAAHQLHHSEKFQGVPYGLFLGPK  279



>ref|XP_011046017.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like isoform 
X2 [Populus euphratica]
Length=296

 Score =   355 bits (911),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 209/236 (89%), Gaps = 3/236 (1%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGG--VeiraeeieraieKQISASRLAEKLARKRSERFTYLVAA  494
             K SL VCFV+ED+   S       + E  +   E QIS  R+AE+L RKR ER TYL+AA
Sbjct  52    KTSLAVCFVVEDQTKPSSAHIENQQEEVPKDVNENQISTPRVAERLERKRKERVTYLIAA  111

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwh  674
             VMSSLGITSMAV+AVYYRF W +EGGEVP +EMFGTFALSVGAAVGMEFWARWAHRALWH
Sbjct  112   VMSSLGITSMAVMAVYYRFYW-LEGGEVPLSEMFGTFALSVGAAVGMEFWARWAHRALWH  170

Query  675   aSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVF  854
             ASLWHMHESHHRPR+GPFELNDVFAITNAVPAI+LLSYGFF+KGLVPGLCFGAGLGITVF
Sbjct  171   ASLWHMHESHHRPRDGPFELNDVFAITNAVPAISLLSYGFFNKGLVPGLCFGAGLGITVF  230

Query  855   GMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPKVT  1022
             G+AYMFVHDGLVHKRFPVGPIADVPYFR+VAAAH++HH+DKFNGVPYGLFLGP+V+
Sbjct  231   GIAYMFVHDGLVHKRFPVGPIADVPYFRKVAAAHKIHHSDKFNGVPYGLFLGPRVS  286



>ref|XP_004496526.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Cicer 
arietinum]
Length=308

 Score =   355 bits (911),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 202/232 (87%), Gaps = 1/232 (0%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             + S TVC ++ED K  +   E   E        QI    L+ KLARK SERFTYL+AA+M
Sbjct  52    RTSFTVCVLMEDPKQINTDEEELVEPPINKSNSQIQL-LLSNKLARKNSERFTYLIAAIM  110

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SS G+TSMA+ AVYYRF+WQMEGGEVP+ EMFGTFALSVGAAVGMEFWARWAH+ALWHAS
Sbjct  111   SSFGVTSMAIFAVYYRFSWQMEGGEVPWYEMFGTFALSVGAAVGMEFWARWAHKALWHAS  170

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHHRPREGPFELND+FAI NAVPAIALLSYGFF+KGLVPGLCFGAGLGITVFG+
Sbjct  171   LWHMHESHHRPREGPFELNDIFAIINAVPAIALLSYGFFNKGLVPGLCFGAGLGITVFGI  230

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVHKRFPVGPIA+VPYFRRVA+AHQLHH+DKFNGVPYGLFLGPK
Sbjct  231   AYMFVHDGLVHKRFPVGPIANVPYFRRVASAHQLHHSDKFNGVPYGLFLGPK  282



>ref|XP_002513654.1| beta-carotene hydroxylase, putative [Ricinus communis]
 gb|EEF49057.1| beta-carotene hydroxylase, putative [Ricinus communis]
Length=303

 Score =   355 bits (910),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 191/232 (82%), Positives = 203/232 (88%), Gaps = 1/232 (0%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             K    +CFVLED K +S   E   EE    +  QI   R+AE+LARKRSERFTYLVAAVM
Sbjct  48    KTGFAICFVLEDLK-QSVETENPVEEENEKVNYQILTPRVAERLARKRSERFTYLVAAVM  106

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SS GITSMAV+A YYRF WQMEGGEVP  EMFGTF+LSVGAAVGMEFWARWAHRALWHAS
Sbjct  107   SSFGITSMAVMACYYRFYWQMEGGEVPLAEMFGTFSLSVGAAVGMEFWARWAHRALWHAS  166

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHHRPREGPFELNDVFAITNAVPAI LL YGFF+KGL PGLCFGAGLGITVFGM
Sbjct  167   LWHMHESHHRPREGPFELNDVFAITNAVPAIGLLYYGFFNKGLFPGLCFGAGLGITVFGM  226

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVHKRFPVGPIA+VPYFR+VAAAHQLHH++KFNGVPYGLFLGPK
Sbjct  227   AYMFVHDGLVHKRFPVGPIANVPYFRKVAAAHQLHHSEKFNGVPYGLFLGPK  278



>ref|NP_001241433.1| beta-carotene 3-hydroxylase, chloroplastic-like [Glycine max]
 gb|AEP95765.1| beta-carotene hydroxylase 4 [Glycine max]
Length=301

 Score =   354 bits (909),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 205/229 (90%), Gaps = 6/229 (3%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
              TVC + ED K      +I+ +E E  +  Q+ ++R+AEKLARK+S+RFTYLVAAVMSS 
Sbjct  56    FTVCVLTEDPK------QIKKDEQEEQVNPQVVSARVAEKLARKKSQRFTYLVAAVMSSF  109

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMAV AVYYRF+WQMEGG+VP++EM GTF+LSVGAAV ME WARWAHRALWHASLWH
Sbjct  110   GITSMAVFAVYYRFSWQMEGGDVPWSEMLGTFSLSVGAAVAMELWARWAHRALWHASLWH  169

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHHRPREGPFELNDVFAI NAVPAI LLSYGFFHKGLVPGLCFGAGLGITVFGMAYM
Sbjct  170   MHESHHRPREGPFELNDVFAIINAVPAIVLLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  229

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHH+DKFNGVPYGLFLGPK
Sbjct  230   FVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHSDKFNGVPYGLFLGPK  278



>gb|KDP22230.1| hypothetical protein JCGZ_26061 [Jatropha curcas]
Length=301

 Score =   353 bits (907),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 187/232 (81%), Positives = 203/232 (88%), Gaps = 1/232 (0%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             K    +CFVLE+ K +S  V+ R  E    +  QI   R+ E+LARKRSERFTYLVAAVM
Sbjct  47    KTRFAICFVLEESK-QSIQVDNRIAEELEEVNYQILTPRVTERLARKRSERFTYLVAAVM  105

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SS GITSMAV+A YYRF WQMEGG+VP  E+FGTF+LSVGAAVGMEFWARWAHRALWHAS
Sbjct  106   SSFGITSMAVMACYYRFYWQMEGGDVPLVELFGTFSLSVGAAVGMEFWARWAHRALWHAS  165

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHHRPREGPFELNDVFAI NA+PAI LLSYGFF+KGL PGLCFGAGLGITVFGM
Sbjct  166   LWHMHESHHRPREGPFELNDVFAIINAIPAIGLLSYGFFNKGLFPGLCFGAGLGITVFGM  225

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVHKRFPVGPIA+VPYFR+VAAAHQLHH+DKFNGVPYGLFLGPK
Sbjct  226   AYMFVHDGLVHKRFPVGPIANVPYFRKVAAAHQLHHSDKFNGVPYGLFLGPK  277



>ref|XP_010521360.1| PREDICTED: beta-carotene 3-hydroxylase 1, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=304

 Score =   353 bits (907),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 186/231 (81%), Positives = 206/231 (89%), Gaps = 1/231 (0%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             + S  VCFV+ED++ +S  +E   +E    ++ ++ ASRLAEKL RK+SERFTYLVAAVM
Sbjct  49    RRSFAVCFVVEDQR-QSSQIESPRDEGASPVDAELLASRLAEKLERKKSERFTYLVAAVM  107

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SS G TSMAVLAVYYRF+WQMEGGEVP +EMFGTFALSVGAAVGMEFWARWAHRALWHAS
Sbjct  108   SSFGFTSMAVLAVYYRFSWQMEGGEVPMSEMFGTFALSVGAAVGMEFWARWAHRALWHAS  167

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHH+ REGPFELNDVFA+ NAVPA+ L SYGFF+KG VPGLCFGAGLGITVFG+
Sbjct  168   LWHMHESHHKAREGPFELNDVFAVINAVPAVGLFSYGFFNKGFVPGLCFGAGLGITVFGI  227

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGP  1013
             AYMFVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHHTDKF GVPYGLFLGP
Sbjct  228   AYMFVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHTDKFKGVPYGLFLGP  278



>ref|XP_011046016.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like isoform 
X1 [Populus euphratica]
Length=309

 Score =   353 bits (906),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 188/234 (80%), Positives = 207/234 (88%), Gaps = 3/234 (1%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGG--VeiraeeieraieKQISASRLAEKLARKRSERFTYLVAA  494
             K SL VCFV+ED+   S       + E  +   E QIS  R+AE+L RKR ER TYL+AA
Sbjct  52    KTSLAVCFVVEDQTKPSSAHIENQQEEVPKDVNENQISTPRVAERLERKRKERVTYLIAA  111

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwh  674
             VMSSLGITSMAV+AVYYRF W +EGGEVP +EMFGTFALSVGAAVGMEFWARWAHRALWH
Sbjct  112   VMSSLGITSMAVMAVYYRFYW-LEGGEVPLSEMFGTFALSVGAAVGMEFWARWAHRALWH  170

Query  675   aSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVF  854
             ASLWHMHESHHRPR+GPFELNDVFAITNAVPAI+LLSYGFF+KGLVPGLCFGAGLGITVF
Sbjct  171   ASLWHMHESHHRPRDGPFELNDVFAITNAVPAISLLSYGFFNKGLVPGLCFGAGLGITVF  230

Query  855   GMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             G+AYMFVHDGLVHKRFPVGPIADVPYFR+VAAAH++HH+DKFNGVPYGLFLGP+
Sbjct  231   GIAYMFVHDGLVHKRFPVGPIADVPYFRKVAAAHKIHHSDKFNGVPYGLFLGPR  284



>gb|ADN29991.1| beta-carotene hydroxylase [Brassica napus]
 gb|ADN29992.1| beta-carotene hydroxylase [Brassica napus]
 emb|CDX92728.1| BnaC07g39860D [Brassica napus]
Length=300

 Score =   353 bits (905),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 206/229 (90%), Gaps = 0/229 (0%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
              +VC+V+E+++  S        E   AI+ ++ A RLAEKL RK+SERFTYL+AAVMSS 
Sbjct  44    FSVCYVVEEQRQSSPVDNDERLESSNAIDPELLALRLAEKLERKKSERFTYLIAAVMSSF  103

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMAV+AVYYRF+WQMEGG +P +EMFGTFALSVGAAVGMEFWARWAHRALWHASLW+
Sbjct  104   GITSMAVMAVYYRFSWQMEGGAIPMSEMFGTFALSVGAAVGMEFWARWAHRALWHASLWN  163

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHH+PREGPFELNDVFAI NAVPAI+LLSYGFF+KGLVPGLCFGAGLGITVFG+AYM
Sbjct  164   MHESHHKPREGPFELNDVFAIINAVPAISLLSYGFFNKGLVPGLCFGAGLGITVFGIAYM  223

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIADVPY R+VAAAHQLHHTDKF+GVPYGLFLGPK
Sbjct  224   FVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFDGVPYGLFLGPK  272



>gb|ABM54182.1| beta-carotene hydroxylase [Brassica napus]
Length=300

 Score =   353 bits (905),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 206/229 (90%), Gaps = 0/229 (0%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
              +VC+V+E+++  S        E   AI+ ++ A RLAEKL RK+SERFTYL+AAVMSS 
Sbjct  44    FSVCYVVEEQRQSSPVDNDERLESTNAIDPELLALRLAEKLERKKSERFTYLIAAVMSSF  103

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMAV+AVYYRF+WQMEGG +P +EMFGTFALSVGAAVGMEFWARWAHRALWHASLW+
Sbjct  104   GITSMAVMAVYYRFSWQMEGGAIPMSEMFGTFALSVGAAVGMEFWARWAHRALWHASLWN  163

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHH+PREGPFELNDVFAI NAVPAI+LLSYGFF+KGLVPGLCFGAGLGITVFG+AYM
Sbjct  164   MHESHHKPREGPFELNDVFAIINAVPAISLLSYGFFNKGLVPGLCFGAGLGITVFGIAYM  223

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIADVPY R+VAAAHQLHHTDKF+GVPYGLFLGPK
Sbjct  224   FVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFDGVPYGLFLGPK  272



>ref|XP_004157181.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Cucumis 
sativus]
Length=281

 Score =   352 bits (902),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 182/228 (80%), Positives = 206/228 (90%), Gaps = 1/228 (0%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             K  LTVC ++E +   SG V+  ++E    +  QI +  ++E+LARK+SERFTYLVAAVM
Sbjct  50    KTLLTVCVLVEGQN-SSGKVDNLSDEESPIVVPQIPSPHVSERLARKKSERFTYLVAAVM  108

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             S+ GITSMAV+AVYYRF WQMEGGE+P++EMFGTF+LSVGAAVGMEFWARWAHRALWH+S
Sbjct  109   STFGITSMAVMAVYYRFYWQMEGGEIPFSEMFGTFSLSVGAAVGMEFWARWAHRALWHSS  168

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHH+PREGPFELND+FAI NAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM
Sbjct  169   LWHMHESHHKPREGPFELNDIFAIINAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  228

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLF  1004
             AYMFVHDGLVHKRFPVGPIA+VPYFR+VAAAHQLHH+DKFNGVPYGLF
Sbjct  229   AYMFVHDGLVHKRFPVGPIANVPYFRKVAAAHQLHHSDKFNGVPYGLF  276



>gb|AHE41418.1| beta-ring carotene hydroxylase [Lycium chinense]
Length=304

 Score =   352 bits (904),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 213/236 (90%), Gaps = 9/236 (4%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKL----ESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLV  488
             KPS TVCFVLEDEKL    ESG  EI  +       +QISA+ LAEKLARK+SERFTYLV
Sbjct  49    KPSFTVCFVLEDEKLKPQFESGAEEIEKKIE-----EQISATHLAEKLARKKSERFTYLV  103

Query  489   AAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahral  668
             AAVMSS GITSMAV+AVYYRF WQMEGG+VP +EMFGTFALSVGAAVGMEFWARWAHRAL
Sbjct  104   AAVMSSFGITSMAVMAVYYRFYWQMEGGQVPLSEMFGTFALSVGAAVGMEFWARWAHRAL  163

Query  669   whaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGIT  848
             WHASLWHMHESHH+PREGPFELNDVFAI NA+PAIALL+YGFFHKGL+PGLCFGAGLGIT
Sbjct  164   WHASLWHMHESHHKPREGPFELNDVFAIINAIPAIALLNYGFFHKGLIPGLCFGAGLGIT  223

Query  849   VFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             VFGMAYMFVHDGLVHKRFPVGP+ADVPYFR+VAAAH LHH++KF GVPYGLFLGPK
Sbjct  224   VFGMAYMFVHDGLVHKRFPVGPVADVPYFRKVAAAHSLHHSEKFKGVPYGLFLGPK  279



>gb|KHN21783.1| Beta-carotene 3-hydroxylase, chloroplastic [Glycine soja]
Length=250

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 204/229 (89%), Gaps = 5/229 (2%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
              TVC + ED K     ++   +E E+ I + +SA  +AEKLARK+S+RFTYLVAAVMSS 
Sbjct  4     FTVCVLTEDSK----EIKTVEQEQEQVIPQAVSAG-VAEKLARKKSQRFTYLVAAVMSSF  58

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMAV AVYYRF+WQMEGG+VP++EM GTF+LSVGAAV MEFWARWAHRALWHASLWH
Sbjct  59    GITSMAVFAVYYRFSWQMEGGDVPWSEMLGTFSLSVGAAVAMEFWARWAHRALWHASLWH  118

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHHRPREGPFELNDVFAI NAVPAIALLSYG FHKGLVPGLCFGAGLGITVFGMAYM
Sbjct  119   MHESHHRPREGPFELNDVFAIINAVPAIALLSYGIFHKGLVPGLCFGAGLGITVFGMAYM  178

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHH+DKFNG PYGLFLGPK
Sbjct  179   FVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHSDKFNGAPYGLFLGPK  227



>gb|ABI93208.1| beta-carotene hydroxylase 1 [Adonis aestivalis var. palaestina]
Length=309

 Score =   352 bits (903),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 180/232 (78%), Positives = 208/232 (90%), Gaps = 2/232 (1%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGGVeiraeeieraieKQISAS--RLAEKLARKRSERFTYLVAAVM  500
             +LT+CFV E  +          E+    + +Q++++  R+AEKLARK+SERFTYL+AA+M
Sbjct  53    ALTICFVAERTRGREIPQIEEDEKNMDEVFEQMNSASVRVAEKLARKKSERFTYLIAALM  112

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SS+GITSMA+L+VYYRF+WQMEGG++P TEM GTFALSVGAAVGMEFWARWAHRALWHAS
Sbjct  113   SSMGITSMAILSVYYRFSWQMEGGDIPVTEMLGTFALSVGAAVGMEFWARWAHRALWHAS  172

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHH+PREGPFELNDVFAI NAVPAIALL++GFFHKGL+PGLCFGAGLGITVFGM
Sbjct  173   LWHMHESHHKPREGPFELNDVFAIINAVPAIALLNFGFFHKGLIPGLCFGAGLGITVFGM  232

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVH+RFPVGPIA+VPYFR+VAAAHQ+HHTDKF GVPYGLFLGPK
Sbjct  233   AYMFVHDGLVHRRFPVGPIANVPYFRKVAAAHQIHHTDKFQGVPYGLFLGPK  284



>emb|CDX89399.1| BnaA01g14940D [Brassica napus]
Length=304

 Score =   352 bits (903),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 185/234 (79%), Positives = 206/234 (88%), Gaps = 5/234 (2%)
 Frame = +3

Query  330   LTVCFVLEDEKLES-----GGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAA  494
             L+VC+V+ D +  S        E  +     AI+ +  A RLAEKL RK+SERFTYL+AA
Sbjct  45    LSVCYVVSDRRQSSPINNDESPEKTSSLDTNAIDAEYLALRLAEKLERKKSERFTYLIAA  104

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwh  674
             VMSS GITSMA++AVYYRF+WQMEGGE+P +EMFGTFALSVGAAVGMEFWARWAH+ALWH
Sbjct  105   VMSSFGITSMAIMAVYYRFSWQMEGGEIPMSEMFGTFALSVGAAVGMEFWARWAHKALWH  164

Query  675   aSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVF  854
             ASLW+MHESHH+PREGPFELNDVFAI NAVPAIALLSYGFF+KGLVPGLCFGAGLGITVF
Sbjct  165   ASLWNMHESHHKPREGPFELNDVFAIVNAVPAIALLSYGFFNKGLVPGLCFGAGLGITVF  224

Query  855   GMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             G+AYMFVHDGLVHKRFPVGPIADVPY R+VAAAHQLHHTDKF+GVPYGLFLGPK
Sbjct  225   GIAYMFVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFDGVPYGLFLGPK  278



>gb|AIX87525.1| carotenoid beta-ring hydroxylase 1 [Lycium ruthenicum]
Length=301

 Score =   352 bits (902),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 213/236 (90%), Gaps = 9/236 (4%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKL----ESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLV  488
             KPS TVCFVLEDEKL    ESG  EI  +       +QISA+ LAEKLARK+SERFTYLV
Sbjct  46    KPSFTVCFVLEDEKLKPQFESGAEEIEKKIE-----EQISATHLAEKLARKKSERFTYLV  100

Query  489   AAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahral  668
             AAVMSS GITSMAV+AVYYRF WQMEGG+VP +EMFGTFALSVGAAVGMEFWARWAHRAL
Sbjct  101   AAVMSSFGITSMAVMAVYYRFYWQMEGGQVPLSEMFGTFALSVGAAVGMEFWARWAHRAL  160

Query  669   whaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGIT  848
             WHASLWHMHESHH+PREGPFELNDVFAI NA+PAIALL+YGFFHKGL+PGLCFGAGLGIT
Sbjct  161   WHASLWHMHESHHKPREGPFELNDVFAIINAIPAIALLNYGFFHKGLIPGLCFGAGLGIT  220

Query  849   VFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             VFGMAYMFVHDGLVHKRFPVGP+ADVPYFR+VAAAH LHH++KF GVPYGLFLGPK
Sbjct  221   VFGMAYMFVHDGLVHKRFPVGPVADVPYFRKVAAAHSLHHSEKFKGVPYGLFLGPK  276



>gb|AIX87501.1| carotenoid beta-ring hydroxylase 1 [Lycium barbarum]
Length=304

 Score =   352 bits (903),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 213/236 (90%), Gaps = 9/236 (4%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKL----ESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLV  488
             KPS TVCFVLEDEKL    ESG  EI  +       +QISA+ LAEKLARK+SERFTYLV
Sbjct  49    KPSFTVCFVLEDEKLKPQFESGAEEIEKKIE-----EQISATHLAEKLARKKSERFTYLV  103

Query  489   AAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahral  668
             AAVMSS GITSMAV+AVYYRF WQMEGG+VP +EMFGTFALSVGAAVGMEFWARWAHRAL
Sbjct  104   AAVMSSFGITSMAVMAVYYRFYWQMEGGQVPLSEMFGTFALSVGAAVGMEFWARWAHRAL  163

Query  669   whaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGIT  848
             WHASLWHMHESHH+PREGPFELNDVFAI NA+PAIALL+YGFFHKGL+PGLCFGAGLGIT
Sbjct  164   WHASLWHMHESHHKPREGPFELNDVFAIINAIPAIALLNYGFFHKGLIPGLCFGAGLGIT  223

Query  849   VFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             VFGMAYMFVHDGLVHKRFPVGP+ADVPYFR+VAAAH LHH++KF GVPYGLFLGPK
Sbjct  224   VFGMAYMFVHDGLVHKRFPVGPVADVPYFRKVAAAHSLHHSEKFKGVPYGLFLGPK  279



>gb|ABL67481.1| beta-carotene hydroxylase [Adonis aestivalis]
Length=309

 Score =   352 bits (903),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 180/232 (78%), Positives = 208/232 (90%), Gaps = 2/232 (1%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGGVeiraeeieraieKQISAS--RLAEKLARKRSERFTYLVAAVM  500
             +LT+CFV E  +          E+    + +Q++++  R+AEKLARK+SERFTYL+AA+M
Sbjct  53    ALTICFVAERTRGREIPQIEEDEKNMDEVFEQMNSASVRVAEKLARKKSERFTYLIAALM  112

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SS+GITSMA+L+VYYRF+WQMEGG++P TEM GTFALSVGAAVGMEFWARWAHRALWHAS
Sbjct  113   SSMGITSMAILSVYYRFSWQMEGGDIPVTEMLGTFALSVGAAVGMEFWARWAHRALWHAS  172

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHH+PREGPFELNDVFAI NAVPAIALL++GFFHKGL+PGLCFGAGLGITVFGM
Sbjct  173   LWHMHESHHKPREGPFELNDVFAIINAVPAIALLNFGFFHKGLIPGLCFGAGLGITVFGM  232

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVH+RFPVGPIA+VPYFR+VAAAHQ+HHTDKF GVPYGLFLGPK
Sbjct  233   AYMFVHDGLVHRRFPVGPIANVPYFRKVAAAHQIHHTDKFQGVPYGLFLGPK  284



>emb|CDX94423.1| BnaC01g17610D [Brassica napus]
Length=304

 Score =   352 bits (902),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 184/234 (79%), Positives = 205/234 (88%), Gaps = 5/234 (2%)
 Frame = +3

Query  330   LTVCFVLEDEKLES-----GGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAA  494
             L+VC+V+ D +  S        E  +     AI+ +  A RLAEKL RK+SERFTYL+AA
Sbjct  45    LSVCYVVSDRRQSSPINNDESPEKTSSLDTNAIDAEYLALRLAEKLERKKSERFTYLIAA  104

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwh  674
             VMSS GITSMA++AVYYRF WQMEGGE+P +EMFGTFALSVGAAVGMEFWARWAH+ALWH
Sbjct  105   VMSSFGITSMAIMAVYYRFTWQMEGGEIPMSEMFGTFALSVGAAVGMEFWARWAHKALWH  164

Query  675   aSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVF  854
             ASLW+MHESHH+PREGPFELNDVFAI NAVPAIALLSYGFF+KGL+PGLCFGAGLGITVF
Sbjct  165   ASLWNMHESHHKPREGPFELNDVFAIVNAVPAIALLSYGFFNKGLIPGLCFGAGLGITVF  224

Query  855   GMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             G+AYMFVHDGLVHKRFPVGPIADVPY R+VAAAHQLHHTDKF+GVPYGLFLGPK
Sbjct  225   GIAYMFVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFDGVPYGLFLGPK  278



>ref|XP_006372399.1| hypothetical protein POPTR_0017s01240g [Populus trichocarpa]
 gb|ERP50196.1| hypothetical protein POPTR_0017s01240g [Populus trichocarpa]
Length=354

 Score =   353 bits (907),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 188/234 (80%), Positives = 207/234 (88%), Gaps = 3/234 (1%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGG--VeiraeeieraieKQISASRLAEKLARKRSERFTYLVAA  494
             K SL VCFV+ED+   S       + E  +   E QIS  R+AE+L RKR ER TYL+AA
Sbjct  97    KTSLAVCFVVEDQTKPSSAHIENQQEEVPKDVNENQISTPRVAERLERKRKERVTYLIAA  156

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwh  674
             VMSSLGITSMAV+AVYYRF W +EGGEVP +EMFGTFALSVGAAVGMEFWARWAHRALWH
Sbjct  157   VMSSLGITSMAVMAVYYRFYW-LEGGEVPLSEMFGTFALSVGAAVGMEFWARWAHRALWH  215

Query  675   aSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVF  854
             ASLWHMHESHHRPR+GPFELNDVFAITNAVPAI+LLSYGFF+KGLVPGLCFGAGLGITVF
Sbjct  216   ASLWHMHESHHRPRDGPFELNDVFAITNAVPAISLLSYGFFNKGLVPGLCFGAGLGITVF  275

Query  855   GMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             G+AYMFVHDGLVHKRFPVGPIADVPYFR+VAAAH++HH+DKFNGVPYGLFLGP+
Sbjct  276   GIAYMFVHDGLVHKRFPVGPIADVPYFRKVAAAHKIHHSDKFNGVPYGLFLGPR  329



>ref|XP_009139437.1| PREDICTED: beta-carotene 3-hydroxylase 1, chloroplastic [Brassica 
rapa]
Length=306

 Score =   352 bits (902),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 185/234 (79%), Positives = 206/234 (88%), Gaps = 5/234 (2%)
 Frame = +3

Query  330   LTVCFVLEDEKLES-----GGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAA  494
             L+VC+V+ D +  S        E  +     AI+ +  A RLAEKL RK+SERFTYL+AA
Sbjct  45    LSVCYVVSDRRQSSPINNDESPEKTSSLDTNAIDAEYLALRLAEKLERKKSERFTYLIAA  104

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwh  674
             VMSS GITSMA++AVYYRF+WQMEGGE+P +EMFGTFALSVGAAVGMEFWARWAH+ALWH
Sbjct  105   VMSSFGITSMAIMAVYYRFSWQMEGGEIPMSEMFGTFALSVGAAVGMEFWARWAHKALWH  164

Query  675   aSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVF  854
             ASLW+MHESHH+PREGPFELNDVFAI NAVPAIALLSYGFF+KGLVPGLCFGAGLGITVF
Sbjct  165   ASLWNMHESHHKPREGPFELNDVFAIVNAVPAIALLSYGFFNKGLVPGLCFGAGLGITVF  224

Query  855   GMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             G+AYMFVHDGLVHKRFPVGPIADVPY R+VAAAHQLHHTDKF+GVPYGLFLGPK
Sbjct  225   GIAYMFVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFDGVPYGLFLGPK  278



>ref|XP_010671629.1| PREDICTED: beta-carotene 3-hydroxylase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=326

 Score =   352 bits (903),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 189/245 (77%), Positives = 204/245 (83%), Gaps = 18/245 (7%)
 Frame = +3

Query  333   TVCFVLEDEKL-----------------ESGGVeiraeeieraieKQISASRLAEKLARK  461
             T+CFVLE+ KL                 +S GV I     +    +QI+A+RL EKLARK
Sbjct  58    TICFVLEERKLSGFVETESTSTSGKEDDDSSGVIITRVSTDNDD-RQIAAARLLEKLARK  116

Query  462   RSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEF  641
             +SER TYLVAAVMSS G+ SMAV+AVYYRF WQMEGGEVP TEM GTFALS GAAVGMEF
Sbjct  117   KSERSTYLVAAVMSSFGVISMAVMAVYYRFYWQMEGGEVPVTEMLGTFALSFGAAVGMEF  176

Query  642   warwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGL  821
             WARWAH+ALWHASLWHMHESHH+PREGPFELNDVFAI NAVPAI LLSYGFFHKGL PGL
Sbjct  177   WARWAHKALWHASLWHMHESHHKPREGPFELNDVFAIINAVPAIGLLSYGFFHKGLAPGL  236

Query  822   CFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGL  1001
             CFGAGLGITVFG+AYMFVHDGLVHKRFPVGPIADVPYFR VAAAH+LHH+DKFNGVPYGL
Sbjct  237   CFGAGLGITVFGIAYMFVHDGLVHKRFPVGPIADVPYFRMVAAAHKLHHSDKFNGVPYGL  296

Query  1002  FLGPK  1016
             FLGPK
Sbjct  297   FLGPK  301



>sp|O49815.1|BCH1_CAPAN RecName: Full=Beta-carotene hydroxylase 1, chloroplastic; Flags: 
Precursor [Capsicum annuum]
 emb|CAA70427.1| beta-carotene hydrolase [Capsicum annuum]
Length=315

 Score =   352 bits (902),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 204/291 (70%), Positives = 233/291 (80%), Gaps = 8/291 (3%)
 Frame = +3

Query  165   MAVGISIAASSRTVYSCQFSLVRPATHSAsppsllfsplsrrfrssvlrsrrKPSLTVCF  344
             MA  ISI+ASSR +   +     P  + A+ P LLF         ++LRSRRKP L  CF
Sbjct  1     MAAEISISASSRAICLQRNPFPAP-KYFATAPPLLFFSPLTCNLDAILRSRRKPRLAACF  59

Query  345   VLEDEKL-------ESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMS  503
             VL+D+KL       +S    I  E      E++  A RLAEK ARK+SERFTYLVAAVMS
Sbjct  60    VLKDDKLYTAQSGKQSDTEAIGDEIEVETNEEKSLAVRLAEKFARKKSERFTYLVAAVMS  119

Query  504   SLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSL  683
             SLGITSMAV++VYYRF+WQMEGGE+P++EMF TFAL+ GAA+GME+WARWAHRALWHASL
Sbjct  120   SLGITSMAVISVYYRFSWQMEGGEMPFSEMFCTFALAFGAAIGMEYWARWAHRALWHASL  179

Query  684   WHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMA  863
             WHMHESHHRPREGPFELND+FAI NAVPAIA  S+GF HKGL+PG+CFGAGLGITVFGMA
Sbjct  180   WHMHESHHRPREGPFELNDIFAIINAVPAIAFFSFGFNHKGLIPGICFGAGLGITVFGMA  239

Query  864   YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             YMFVHDGLVHKRFPVGPIA VPYF+RVAAAHQLHH+DKF+GVPYGLFLGPK
Sbjct  240   YMFVHDGLVHKRFPVGPIAKVPYFQRVAAAHQLHHSDKFDGVPYGLFLGPK  290



>gb|AFK40292.1| unknown [Lotus japonicus]
Length=309

 Score =   351 bits (901),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  420   QISASRLAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFG  599
             QI ++R+AEKLARK+SERFTYLVAAVMSSLG+TSMA+LAVYYRF+WQMEGG++P +EMFG
Sbjct  86    QIMSARVAEKLARKKSERFTYLVAAVMSSLGVTSMAILAVYYRFSWQMEGGQIPMSEMFG  145

Query  600   TFALSVGAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIAL  779
             TFALSVGAAVGMEFWARWAH+ALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAIAL
Sbjct  146   TFALSVGAAVGMEFWARWAHKALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIAL  205

Query  780   LSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQ  959
             LSYGFF +GLVPGLCFGAGLGITVFG+AYMFVHDGLVHKRFPVGPIA+VPYFRRVA+AHQ
Sbjct  206   LSYGFFPQGLVPGLCFGAGLGITVFGIAYMFVHDGLVHKRFPVGPIANVPYFRRVASAHQ  265

Query  960   LHHTDKFNGVPYGLFLGP  1013
             L H+DKFNGVPYGLFLGP
Sbjct  266   LRHSDKFNGVPYGLFLGP  283



>ref|NP_001288890.1| beta-carotene 3-hydroxylase 1, chloroplastic [Brassica rapa]
 gb|AAS55552.1| putative beta-carotene hydroxylase [Brassica rapa]
 gb|AAZ81472.1| beta-carotene hydroxylase [Brassica rapa]
 emb|CDY50189.1| BnaA03g47590D [Brassica napus]
Length=300

 Score =   350 bits (899),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 183/229 (80%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
              +VC+V+E+++  S        E    I+ ++ A RLAEKL RK+SERFTYL+AAVMSS 
Sbjct  44    FSVCYVVEEQRQSSPVDNDERPERTNVIDPELLALRLAEKLERKKSERFTYLIAAVMSSF  103

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMAV+AVYYRF+WQMEGG +P +EMFGTFALSVGAAVGMEFWARWAHRALWHASLW+
Sbjct  104   GITSMAVMAVYYRFSWQMEGGVIPMSEMFGTFALSVGAAVGMEFWARWAHRALWHASLWN  163

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHH+PREGPFELNDVFAI NAVPAI LLSYGFF+KGLVPGLCFGAGLGITVFG+AYM
Sbjct  164   MHESHHKPREGPFELNDVFAIINAVPAIGLLSYGFFNKGLVPGLCFGAGLGITVFGIAYM  223

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIADVPY R+VAAAHQLHHTDKF+GVPYGLFLGPK
Sbjct  224   FVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFDGVPYGLFLGPK  272



>ref|XP_006413280.1| hypothetical protein EUTSA_v10025794mg [Eutrema salsugineum]
 gb|ESQ54733.1| hypothetical protein EUTSA_v10025794mg [Eutrema salsugineum]
Length=309

 Score =   351 bits (900),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 204/232 (88%), Gaps = 5/232 (2%)
 Frame = +3

Query  333   TVCFVLEDEKLESGGVeiraeeieraieKQISAS----RLAEKLARKRSERFTYLVAAVM  500
             +VC+V+E E+ +S  ++        +    I A     RLAEKL RK+SERFTYL+AAVM
Sbjct  47    SVCYVVE-ERRQSSPIDNDERPESTSSTTAIDAEFLALRLAEKLERKKSERFTYLIAAVM  105

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SS GITSMA++AVYYRF+WQMEGGE+P  EMFGTFALSVGAAVGMEFWARWAHRALWHAS
Sbjct  106   SSFGITSMAIMAVYYRFSWQMEGGEIPMLEMFGTFALSVGAAVGMEFWARWAHRALWHAS  165

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LW+MHESHH+PREGPFELNDVFAI NAVPAIALLSYGFF+KGLVPGLCFGAGLGITVFG+
Sbjct  166   LWNMHESHHKPREGPFELNDVFAIVNAVPAIALLSYGFFNKGLVPGLCFGAGLGITVFGI  225

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVHKRFPVGPIADVPY R+VAAAHQLHHTDKF+GVPYGLFLGPK
Sbjct  226   AYMFVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFDGVPYGLFLGPK  277



>ref|NP_001242409.1| uncharacterized protein LOC100785541 [Glycine max]
 gb|ACU17762.1| unknown [Glycine max]
Length=314

 Score =   349 bits (896),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 184/233 (79%), Positives = 203/233 (87%), Gaps = 3/233 (1%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESG---GVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAV  497
             + TVC +++D K  +      + +         +Q+ + +LAEKLARK SERFTYLVAAV
Sbjct  53    TFTVCVLMQDPKQGTHMEIEPQEQPPPPPPPPAQQVLSPKLAEKLARKESERFTYLVAAV  112

Query  498   MSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwha  677
             MSS GITSMAV AVY RF+WQMEGGEVP++EMFGTFALSVGAAVGMEFWARWAHRALWHA
Sbjct  113   MSSFGITSMAVFAVYCRFSWQMEGGEVPWSEMFGTFALSVGAAVGMEFWARWAHRALWHA  172

Query  678   SLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFG  857
             SLWHMHESHHRPREGPFELNDVFAI NAVPAIALLSYGFF+KGLVPGLCFGAGLGITVFG
Sbjct  173   SLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSYGFFNKGLVPGLCFGAGLGITVFG  232

Query  858   MAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             MAYMFVH GLVHKRFPVGPIA+VPY RRVA+AHQLHH++KFNGVPYGLFLGPK
Sbjct  233   MAYMFVHAGLVHKRFPVGPIANVPYLRRVASAHQLHHSEKFNGVPYGLFLGPK  285



>ref|NP_001237423.1| beta-carotene hydroxylase [Glycine max]
 gb|AAS88426.1| beta-carotene hydroxylase [Glycine max]
Length=334

 Score =   350 bits (897),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 204/229 (89%), Gaps = 5/229 (2%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
              TVC + ED K     ++   +E E+ I + +SA  +AEKLARK+S+RFTYLVAAVMSS 
Sbjct  88    FTVCVLTEDSK----EIKTVEQEQEQVIPQAVSAG-VAEKLARKKSQRFTYLVAAVMSSF  142

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMAV AVYYRF+WQMEGG+VP++EM GTF+LSVGAAV MEFWARWAHRALWHASLWH
Sbjct  143   GITSMAVFAVYYRFSWQMEGGDVPWSEMLGTFSLSVGAAVAMEFWARWAHRALWHASLWH  202

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHHRPREGPFELNDVFAI NAVPAIALLSYG FHKGLVPGLCFGAGLGITVFGMAYM
Sbjct  203   MHESHHRPREGPFELNDVFAIINAVPAIALLSYGIFHKGLVPGLCFGAGLGITVFGMAYM  262

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHH+DKFNG PYGLFLGPK
Sbjct  263   FVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHSDKFNGAPYGLFLGPK  311



>gb|KHN09301.1| Beta-carotene 3-hydroxylase 1, chloroplastic [Glycine soja]
Length=312

 Score =   348 bits (894),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 185/232 (80%), Positives = 202/232 (87%), Gaps = 2/232 (1%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGG--VeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             + TVC +++D K  +                 +Q+ + +LAEKLARK SERFTYLVAAVM
Sbjct  52    TFTVCVLMQDPKQGTHMEIEPQEQPPPPPPPAQQVLSPKLAEKLARKESERFTYLVAAVM  111

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SS GITSMAV AVY RF+WQMEGGEVP++EMFGTFALSVGAAVGMEFWARWAHRALWHAS
Sbjct  112   SSFGITSMAVFAVYCRFSWQMEGGEVPWSEMFGTFALSVGAAVGMEFWARWAHRALWHAS  171

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHHRPREGPFELNDVFAI NAVPAIALLSYGFF+KGLVPGLCFGAGLGITVFGM
Sbjct  172   LWHMHESHHRPREGPFELNDVFAIINAVPAIALLSYGFFNKGLVPGLCFGAGLGITVFGM  231

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             AYMFVHDGLVHKRFPVGPIA+VPY RRVA+AHQLHH++KFNGVPYGLFLGPK
Sbjct  232   AYMFVHDGLVHKRFPVGPIANVPYLRRVASAHQLHHSEKFNGVPYGLFLGPK  283



>ref|XP_007218715.1| hypothetical protein PRUPE_ppa009001mg [Prunus persica]
 gb|EMJ19914.1| hypothetical protein PRUPE_ppa009001mg [Prunus persica]
Length=310

 Score =   348 bits (892),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 207/236 (88%), Gaps = 5/236 (2%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQIS----ASRLAEKLARKRSERFTYLV  488
             K   TV  V+ED+K +S  +E   E+ + A + QI     + R+AEKL+RK+SERFTYLV
Sbjct  51    KLCFTVYVVMEDQK-QSTHLENCTEKAQEAAQSQIPIVIPSVRVAEKLSRKKSERFTYLV  109

Query  489   AAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahral  668
             AAVMSS GITSMAV+AVYYRF WQMEGG VP +EM GTFALSVGAAVGMEFWARWAH+AL
Sbjct  110   AAVMSSFGITSMAVMAVYYRFYWQMEGGNVPLSEMLGTFALSVGAAVGMEFWARWAHKAL  169

Query  669   whaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGIT  848
             WHASLWHMHESHHRPREGPFELNDVFA+ NAVPAIALL+YGFFHKGLVPGLCFGAGLGIT
Sbjct  170   WHASLWHMHESHHRPREGPFELNDVFAVINAVPAIALLNYGFFHKGLVPGLCFGAGLGIT  229

Query  849   VFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             VFGMAYMFVHDGLVHKRFPVGPIA+VPY R+VAAAHQLHH++KF GVPYGLFLGPK
Sbjct  230   VFGMAYMFVHDGLVHKRFPVGPIANVPYLRKVAAAHQLHHSEKFEGVPYGLFLGPK  285



>ref|NP_001239934.1| beta-carotene hydroxylase 2, chloroplastic-like [Glycine max]
 gb|AEP95766.1| beta-carotene hydroxylase 5 [Glycine max]
Length=308

 Score =   348 bits (892),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 186/230 (81%), Positives = 209/230 (91%), Gaps = 1/230 (0%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSS  506
             + TVC +++D K +   +EI+A+E   +  +Q+ + +LAEKLARK SE FTYL+AAVMSS
Sbjct  51    TFTVCVLMQDPK-QGTQMEIQAQEPPPSPPQQVLSQKLAEKLARKESESFTYLIAAVMSS  109

Query  507   LGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLW  686
              GITSMAV AVYYRFAWQMEGGEVP +E+FGTFALSVGAAVGMEFWARWAHRALWHASLW
Sbjct  110   FGITSMAVFAVYYRFAWQMEGGEVPLSEIFGTFALSVGAAVGMEFWARWAHRALWHASLW  169

Query  687   HMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAY  866
             HMHESHHRPREGPFELNDVFAI NAVPAIALLSYGFF+KGLVPGLCFGAGLGITVFGMAY
Sbjct  170   HMHESHHRPREGPFELNDVFAIINAVPAIALLSYGFFNKGLVPGLCFGAGLGITVFGMAY  229

Query  867   MFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             MFVHDGLVHKRFPVGPIA+VPY RRVA+AHQLHH++KF+GVPYGLF+GPK
Sbjct  230   MFVHDGLVHKRFPVGPIANVPYLRRVASAHQLHHSEKFDGVPYGLFMGPK  279



>ref|NP_001268126.1| beta-carotene hydroxylase [Vitis vinifera]
 gb|AFP28800.1| beta-carotene hydroxylase 1 [Vitis vinifera]
Length=299

 Score =   347 bits (891),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 205/231 (89%), Gaps = 9/231 (4%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             + SL VC VLE +K+E G        IE   +   S++R +E+LARK++ER+TYLVAA+M
Sbjct  52    RRSLKVCLVLE-KKIEDG--------IEIEDDSPESSNRASERLARKKAERYTYLVAAMM  102

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SSLGITSMA++AVYYRF+WQMEGGE+P  EM GTFALSVGAAVGMEFWARWAH+ALWHAS
Sbjct  103   SSLGITSMAIVAVYYRFSWQMEGGEIPVLEMLGTFALSVGAAVGMEFWARWAHKALWHAS  162

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHHRPREGPFELNDVFAI NAVPAI+LLSYG F+KGLVPGLCFGAGLGITVFGM
Sbjct  163   LWHMHESHHRPREGPFELNDVFAIINAVPAISLLSYGLFNKGLVPGLCFGAGLGITVFGM  222

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGP  1013
             AYMFVHDGLVH+RFPVGPIA+VPY R+VA+AHQLHH+DKFNGVPYGLFLGP
Sbjct  223   AYMFVHDGLVHRRFPVGPIANVPYLRKVASAHQLHHSDKFNGVPYGLFLGP  273



>ref|XP_010448386.1| PREDICTED: beta-carotene 3-hydroxylase 1, chloroplastic [Camelina 
sativa]
Length=310

 Score =   347 bits (891),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 204/233 (88%), Gaps = 4/233 (2%)
 Frame = +3

Query  327   SLTVCFVLEDEK----LESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAA  494
             S +VC+V+E+ +    +E+      +     AI+ +  A RLAEKL RK+SERFTYL+AA
Sbjct  45    SFSVCYVVEERRQSSPIENDERPEESTSSTTAIDAEYLALRLAEKLERKKSERFTYLIAA  104

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwh  674
             V+SS GITSMAV+AVYYRF+WQMEGGE+   EMFGTFALSVGAAVGMEFWARWAHRALWH
Sbjct  105   VLSSFGITSMAVMAVYYRFSWQMEGGEISMLEMFGTFALSVGAAVGMEFWARWAHRALWH  164

Query  675   aSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVF  854
             ASLW+MHESHH+PREGPFELNDVFAI NAVPAI LLSYGFF+KGLVPGLCFGAGLGITVF
Sbjct  165   ASLWNMHESHHKPREGPFELNDVFAIVNAVPAIGLLSYGFFNKGLVPGLCFGAGLGITVF  224

Query  855   GMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGP  1013
             G+AYMFVHDGLVHKRFPVGPIADVPY R+VAAAHQLHHTDKFNGVPYGLFLGP
Sbjct  225   GIAYMFVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFNGVPYGLFLGP  277



>gb|ACS45170.1| beta-carotene hydroxylase [Brassica rapa subsp. pekinensis]
Length=306

 Score =   347 bits (891),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 184/234 (79%), Positives = 205/234 (88%), Gaps = 5/234 (2%)
 Frame = +3

Query  330   LTVCFVLEDEKLES-----GGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAA  494
             L+VC+V+ D +  S        E  +     AI+ +  A RLAEKL RK+SERFTYL+AA
Sbjct  45    LSVCYVVSDRRQSSPINNDESPEKTSSLDTNAIDAEYLALRLAEKLERKKSERFTYLIAA  104

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwh  674
             VMSS GITSMA++AVYYRF+WQMEGGE+P +EMFGTFALSVGAAVGMEFWARWAH+ALWH
Sbjct  105   VMSSFGITSMAIMAVYYRFSWQMEGGEIPMSEMFGTFALSVGAAVGMEFWARWAHKALWH  164

Query  675   aSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVF  854
             ASLW+MHESHH+PREGPFELNDVFAI NAVPAIALLSYGFF+KGLVPGL FGAGLGITVF
Sbjct  165   ASLWNMHESHHKPREGPFELNDVFAIVNAVPAIALLSYGFFNKGLVPGLRFGAGLGITVF  224

Query  855   GMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             G+AYMFVHDGLVHKRFPVGPIADVPY R+VAAAHQLHHTDKF+GVPYGLFLGPK
Sbjct  225   GIAYMFVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFDGVPYGLFLGPK  278



>emb|CBI34377.3| unnamed protein product [Vitis vinifera]
Length=299

 Score =   347 bits (890),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 205/231 (89%), Gaps = 9/231 (4%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             + SL VC VLE +K+E G        IE   +   S++R +E+LARK++ER+TYLVAA+M
Sbjct  52    RRSLKVCLVLE-KKIEDG--------IEIEDDSPESSNRASERLARKKAERYTYLVAAMM  102

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SSLGITSMA++AVYYRF+WQMEGGE+P  EM GTFALSVGAAVGMEFWARWAH+ALWHAS
Sbjct  103   SSLGITSMAIVAVYYRFSWQMEGGEIPVLEMLGTFALSVGAAVGMEFWARWAHKALWHAS  162

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHHRPREGPFELNDVFAI NAVPAI+LLSYG F+KGLVPGLCFGAGLGITVFGM
Sbjct  163   LWHMHESHHRPREGPFELNDVFAIINAVPAISLLSYGLFNKGLVPGLCFGAGLGITVFGM  222

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGP  1013
             AYMFVHDGLVH+RFPVGPIA+VPY R+VA+AHQLHH+DKFNGVPYGLFLGP
Sbjct  223   AYMFVHDGLVHRRFPVGPIANVPYLRKVASAHQLHHSDKFNGVPYGLFLGP  273



>gb|KHN03679.1| Beta-carotene 3-hydroxylase 1, chloroplastic [Glycine soja]
Length=298

 Score =   347 bits (889),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 186/230 (81%), Positives = 209/230 (91%), Gaps = 1/230 (0%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSS  506
             + TVC +++D K +   +EI+A+E   +  +Q+ + +LAEKLARK SE FTYL+AAVMSS
Sbjct  41    TFTVCVLMQDPK-QGTQMEIQAQEPPPSPPQQVLSQKLAEKLARKESESFTYLIAAVMSS  99

Query  507   LGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLW  686
              GITSMAV AVYYRFAWQMEGGEVP +E+FGTFALSVGAAVGMEFWARWAHRALWHASLW
Sbjct  100   FGITSMAVFAVYYRFAWQMEGGEVPLSEIFGTFALSVGAAVGMEFWARWAHRALWHASLW  159

Query  687   HMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAY  866
             HMHESHHRPREGPFELNDVFAI NAVPAIALLSYGFF+KGLVPGLCFGAGLGITVFGMAY
Sbjct  160   HMHESHHRPREGPFELNDVFAIINAVPAIALLSYGFFNKGLVPGLCFGAGLGITVFGMAY  219

Query  867   MFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             MFVHDGLVHKRFPVGPIA+VPY RRVA+AHQLHH++KF+GVPYGLF+GPK
Sbjct  220   MFVHDGLVHKRFPVGPIANVPYLRRVASAHQLHHSEKFDGVPYGLFMGPK  269



>gb|KFK29068.1| hypothetical protein AALP_AA7G084400 [Arabis alpina]
Length=310

 Score =   346 bits (888),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 203/230 (88%), Gaps = 1/230 (0%)
 Frame = +3

Query  330   LTVCFVLEDEKLES-GGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSS  506
              +VC+V+E+ K  S   ++    E   +  ++  A RLAEKL RK+SERFTYL+AAVMSS
Sbjct  45    FSVCYVVEERKQSSISPIDNEQSESTSSSAEEFLALRLAEKLERKKSERFTYLIAAVMSS  104

Query  507   LGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLW  686
              GITSMA++AVYYRF+WQMEGGE+  +EMFGTFALSVGAAVGMEFWARWAH+ALWHASLW
Sbjct  105   FGITSMAIMAVYYRFSWQMEGGEISISEMFGTFALSVGAAVGMEFWARWAHKALWHASLW  164

Query  687   HMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAY  866
             +MHESHH+PREG FELNDVFAI NAVPAI LLSYGFF+KGLVPGLCFGAGLGITVFG+AY
Sbjct  165   NMHESHHKPREGAFELNDVFAIVNAVPAIGLLSYGFFNKGLVPGLCFGAGLGITVFGIAY  224

Query  867   MFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             MFVHDGLVHKRFPVGPIADVPY R+VAAAHQLHHTDKFNGVPYGLFLGPK
Sbjct  225   MFVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFNGVPYGLFLGPK  274



>ref|XP_004308054.1| PREDICTED: beta-carotene 3-hydroxylase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=311

 Score =   346 bits (888),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 184/237 (78%), Positives = 204/237 (86%), Gaps = 5/237 (2%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQ-----ISASRLAEKLARKRSERFTYL  485
             K  LTV  V+ED+K  +  V+   E  + +         I + R AE+LA+K+SERFTYL
Sbjct  50    KLCLTVYVVMEDQKRNTTEVDTSDEIPQESSPSSEIPIVIPSLRGAERLAKKKSERFTYL  109

Query  486   VAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahra  665
             VAAVMSS GITSMAV+AVYYRF WQMEGG VP +EMFGTFALSVGAAVGMEFWARWAH+A
Sbjct  110   VAAVMSSFGITSMAVMAVYYRFYWQMEGGNVPVSEMFGTFALSVGAAVGMEFWARWAHKA  169

Query  666   lwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGI  845
             LWHASLWHMHESHH+PREGPFELNDVFAI NAVPAIALL+YGFFHKG VPGLCFGAGLGI
Sbjct  170   LWHASLWHMHESHHKPREGPFELNDVFAIINAVPAIALLNYGFFHKGYVPGLCFGAGLGI  229

Query  846   TVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             TVFGMAYMFVHDGLVHKRFPVGPIA+VPYFR+VAAAHQLHH++KF GVPYGLFLGP+
Sbjct  230   TVFGMAYMFVHDGLVHKRFPVGPIANVPYFRKVAAAHQLHHSEKFKGVPYGLFLGPQ  286



>ref|XP_008234838.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Prunus 
mume]
Length=310

 Score =   346 bits (887),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 208/236 (88%), Gaps = 5/236 (2%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQIS----ASRLAEKLARKRSERFTYLV  488
             K   TV  V+ED+K +S  +E  +E+ + A E QI     + R+AEKL+RK+SERFTYLV
Sbjct  51    KLCFTVYVVMEDQK-QSIHLENCSEKAQEAAESQIPIVIPSVRVAEKLSRKKSERFTYLV  109

Query  489   AAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahral  668
             AAVMSS GITSMAV+AVYYRF WQMEGG VP +EM GTFALSVGAAVGMEFWARWAH+AL
Sbjct  110   AAVMSSFGITSMAVMAVYYRFYWQMEGGNVPLSEMLGTFALSVGAAVGMEFWARWAHKAL  169

Query  669   whaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGIT  848
             WHASLWHMHESHHRPREGPFELNDVFA+ NAVPAIALL+YGFFHKGLVPGLCFGAGLGIT
Sbjct  170   WHASLWHMHESHHRPREGPFELNDVFAVINAVPAIALLNYGFFHKGLVPGLCFGAGLGIT  229

Query  849   VFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             VFGMAYMFVHDGLVHKRFPVGPIA+VPY R+VAAAHQLHH++KF GVPYGLFLGPK
Sbjct  230   VFGMAYMFVHDGLVHKRFPVGPIANVPYLRKVAAAHQLHHSEKFEGVPYGLFLGPK  285



>ref|XP_010438839.1| PREDICTED: beta-carotene 3-hydroxylase 1, chloroplastic-like 
[Camelina sativa]
Length=311

 Score =   346 bits (888),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 203/232 (88%), Gaps = 4/232 (2%)
 Frame = +3

Query  330   LTVCFVLEDEK----LESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAV  497
              +VC+V+E+ +    +E+      +     AI+ +  A RLAEKL RK+SERFTYL+AAV
Sbjct  47    FSVCYVVEERRQSSPIENDERPEESTSSTTAIDAEYLALRLAEKLERKKSERFTYLIAAV  106

Query  498   MSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwha  677
             +SS GITSMAV+AVYYRF+WQMEGGE+   EMFGTFALSVGAAVGMEFWARWAHRALWHA
Sbjct  107   LSSFGITSMAVMAVYYRFSWQMEGGEISMLEMFGTFALSVGAAVGMEFWARWAHRALWHA  166

Query  678   SLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFG  857
             SLW+MHESHH+PREGPFELNDVFAI NAVPAI LLSYGFF+KGLVPGLCFGAGLGITVFG
Sbjct  167   SLWNMHESHHKPREGPFELNDVFAIVNAVPAIGLLSYGFFNKGLVPGLCFGAGLGITVFG  226

Query  858   MAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGP  1013
             +AYMFVHDGLVHKRFPVGPIADVPY R+VAAAHQLHHTDKFNGVPYGLFLGP
Sbjct  227   IAYMFVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFNGVPYGLFLGP  278



>ref|XP_009368730.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Pyrus 
x bretschneideri]
Length=309

 Score =   346 bits (887),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 187/236 (79%), Positives = 205/236 (87%), Gaps = 5/236 (2%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQIS----ASRLAEKLARKRSERFTYLV  488
             K   TV  V+ED+K +   ++  A +   A + QI     + R+AE+L+RK+SERF YLV
Sbjct  50    KLCFTVYVVMEDQK-QITNLDNSAGKSPEAADSQIPIVIPSVRVAERLSRKKSERFAYLV  108

Query  489   AAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahral  668
             AAVMSSLGITSMAV+AVYYRF WQMEGG VP +EM GTFALSVGAAVGMEFWARWAH+AL
Sbjct  109   AAVMSSLGITSMAVMAVYYRFYWQMEGGTVPLSEMLGTFALSVGAAVGMEFWARWAHKAL  168

Query  669   whaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGIT  848
             WHASLWHMHESHHRPREGPFELNDVFAI NAVPAIALLSYGFFHKGLVPGLCFGAGLGIT
Sbjct  169   WHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSYGFFHKGLVPGLCFGAGLGIT  228

Query  849   VFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             VFGMAYMFVHDGLVHKRFPVGPIADVPY R+VAAAHQLHH++KF GVPYGLFLGPK
Sbjct  229   VFGMAYMFVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHSEKFEGVPYGLFLGPK  284



>gb|AAM77007.1|AF499108_1 beta-carotene hydroxylase [Vitis vinifera]
Length=299

 Score =   345 bits (885),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 203/231 (88%), Gaps = 9/231 (4%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVM  500
             + SL VC VLE E +E G        IE   +   S++R +E+LARK++ER+TYLVAA+M
Sbjct  52    RRSLKVCLVLEKE-IEDG--------IEIEDDSPESSNRASERLARKKAERYTYLVAAMM  102

Query  501   SSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaS  680
             SSLGITSMA++AVYYR +WQMEGGE+P  EM GTFALSVGAAVGMEFWARWAH+ALWHAS
Sbjct  103   SSLGITSMAIVAVYYRLSWQMEGGEIPVLEMLGTFALSVGAAVGMEFWARWAHKALWHAS  162

Query  681   LWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGM  860
             LWHMHESHHRPREGPFELNDVFAI NAVPAI+LLSYG F+KGLVPGLCFGAGLGITVFGM
Sbjct  163   LWHMHESHHRPREGPFELNDVFAIINAVPAISLLSYGLFNKGLVPGLCFGAGLGITVFGM  222

Query  861   AYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGP  1013
             AYMFVHDGLVH+RFPVGPIA+VPY R+VA+AHQLHH+DKFNGVPYGLFLGP
Sbjct  223   AYMFVHDGLVHRRFPVGPIANVPYLRKVASAHQLHHSDKFNGVPYGLFLGP  273



>gb|ACU18541.1| unknown [Glycine max]
Length=308

 Score =   345 bits (884),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 185/230 (80%), Positives = 208/230 (90%), Gaps = 1/230 (0%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSS  506
             + TVC +++D K +   +EI+A+E   +  +Q+ + +LAEKLARK SE FTYL+AAVMSS
Sbjct  51    TFTVCVLMQDPK-QGTQMEIQAQEPPPSPPQQVLSQKLAEKLARKESESFTYLIAAVMSS  109

Query  507   LGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLW  686
              GITSMAV AVYYRFAWQMEGGEVP +E+FGTFALSVGAAVGMEFWARWAHRALWHASLW
Sbjct  110   FGITSMAVFAVYYRFAWQMEGGEVPLSEIFGTFALSVGAAVGMEFWARWAHRALWHASLW  169

Query  687   HMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAY  866
             HMHESHHRPREGPFE NDVFAI NAVPAIALLSYGFF+KGLVPGLCFGAGLGITVFGMAY
Sbjct  170   HMHESHHRPREGPFEPNDVFAIINAVPAIALLSYGFFNKGLVPGLCFGAGLGITVFGMAY  229

Query  867   MFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             MFVHDGLVHKRFPVGPIA+VPY RRVA+AHQLHH++KF+GVPYGLF+GPK
Sbjct  230   MFVHDGLVHKRFPVGPIANVPYLRRVASAHQLHHSEKFDGVPYGLFMGPK  279



>gb|ACU23695.1| unknown [Glycine max]
Length=301

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 185/229 (81%), Positives = 202/229 (88%), Gaps = 5/229 (2%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
              TVC + ED K     ++   +E E+ I + +SA  +AEKLARK+S+RFTYLVAAVMSS 
Sbjct  55    FTVCVLTEDSK----EIKTVEQEQEQVIPQAVSAG-VAEKLARKKSQRFTYLVAAVMSSF  109

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMAV AVYYRF+WQMEGG+VP++EM GTF+LSVGAAV MEFWARWAHRALWHASLWH
Sbjct  110   GITSMAVFAVYYRFSWQMEGGDVPWSEMLGTFSLSVGAAVAMEFWARWAHRALWHASLWH  169

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHHRPREGPFELNDVFAI NAVPAIALLSYG FHKGLVPGLCFGAGLGITVFGMAYM
Sbjct  170   MHESHHRPREGPFELNDVFAIINAVPAIALLSYGIFHKGLVPGLCFGAGLGITVFGMAYM  229

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLV KRFPVGPIA+VPYFRRVAAA QLHH+DKFNG PYGLFLGPK
Sbjct  230   FVHDGLVRKRFPVGPIANVPYFRRVAAARQLHHSDKFNGAPYGLFLGPK  278



>gb|KEH26249.1| beta-carotene hydroxylase [Medicago truncatula]
Length=314

 Score =   345 bits (885),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 182/235 (77%), Positives = 205/235 (87%), Gaps = 5/235 (2%)
 Frame = +3

Query  327   SLTVCFVLEDEK----LESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAA  494
             S T+C ++ED K    +E    +    +    I  Q+ + ++AEKLARK+SERFTYLVAA
Sbjct  54    SFTLCVLMEDPKRDTQMEIEEEKSTTLQENNYIIPQVVSLKMAEKLARKKSERFTYLVAA  113

Query  495   VMSSLGITSMAVLAVYYRFAWQMEG-GEVPYTEMFGTFALSVGAAVGMEFwarwahralw  671
             VMSSLGITSMAVL+VY RF+WQMEG GE+P++EMFGTFALSVGAAVGMEFWARWAH+ALW
Sbjct  114   VMSSLGITSMAVLSVYLRFSWQMEGSGEIPWSEMFGTFALSVGAAVGMEFWARWAHKALW  173

Query  672   haSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITV  851
             HASLWHMHESHHR REG FELNDVFAI NAVPAIALL++GFFHKGLVPGLCFGAGLGITV
Sbjct  174   HASLWHMHESHHRAREGAFELNDVFAIINAVPAIALLNFGFFHKGLVPGLCFGAGLGITV  233

Query  852   FGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FGMAYMFVHDGLVH+RF VGPIA+VPYFRRVAAAH+LHH+DKF GVPYGLFLGPK
Sbjct  234   FGMAYMFVHDGLVHRRFSVGPIANVPYFRRVAAAHKLHHSDKFEGVPYGLFLGPK  288



>ref|XP_002867597.1| beta-carotene hydroxylase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43856.1| beta-carotene hydroxylase [Arabidopsis lyrata subsp. lyrata]
Length=305

 Score =   345 bits (884),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 182/233 (78%), Positives = 201/233 (86%), Gaps = 5/233 (2%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISAS----RLAEKLARKRSERFTYLVAAV  497
              +VC+V+E E+ ++  +E        +    I A     RLAEKL RK+SER TYL+AAV
Sbjct  42    FSVCYVVE-ERRQNSPIENDERPESTSSTTAIDAEYLALRLAEKLERKKSERSTYLIAAV  100

Query  498   MSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwha  677
             +SS GITSMAV+AVYYRF+WQMEGGE+   EMFGTFALSVGAAVGMEFWARWAHRALWHA
Sbjct  101   LSSFGITSMAVMAVYYRFSWQMEGGEISMLEMFGTFALSVGAAVGMEFWARWAHRALWHA  160

Query  678   SLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFG  857
             SLW+MHESHH+PREGPFELNDVFAI NAVPAI LLSYGFF+KGLVPGLCFGAGLGITVFG
Sbjct  161   SLWNMHESHHKPREGPFELNDVFAIVNAVPAIGLLSYGFFNKGLVPGLCFGAGLGITVFG  220

Query  858   MAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             +AYMFVHDGLVHKRFPVGPIADVPY R+VAAAHQLHHTDKFNGVPYGLFLGPK
Sbjct  221   IAYMFVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFNGVPYGLFLGPK  273



>ref|XP_009377554.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009377602.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Pyrus 
x bretschneideri]
Length=308

 Score =   344 bits (883),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  423   ISASRLAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGT  602
             I + R+AE+L+RK+SERFTYLVAAVMSS GITSMAV+AVYYRF WQMEGG VP +EM GT
Sbjct  86    IPSVRVAERLSRKKSERFTYLVAAVMSSFGITSMAVMAVYYRFYWQMEGGNVPMSEMLGT  145

Query  603   FALSVGAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALL  782
             FALSVGAAVGMEFWARWAH+ALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAIALL
Sbjct  146   FALSVGAAVGMEFWARWAHKALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALL  205

Query  783   SYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQL  962
             +YGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIA+VPY R+VAAAHQL
Sbjct  206   NYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIANVPYLRKVAAAHQL  265

Query  963   HHTDKFNGVPYGLFLGPK  1016
             HH++KF+GVPYGLFLGPK
Sbjct  266   HHSEKFDGVPYGLFLGPK  283



>ref|XP_009375525.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009375526.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Pyrus 
x bretschneideri]
Length=308

 Score =   344 bits (882),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  423   ISASRLAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGT  602
             I + R+AE+L+RK+SERFTYLVAAVMSS GITSMAV+AVYYRF WQMEGG VP +EM GT
Sbjct  86    IPSVRVAERLSRKKSERFTYLVAAVMSSFGITSMAVMAVYYRFYWQMEGGNVPMSEMLGT  145

Query  603   FALSVGAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALL  782
             FALSVGAAVGMEFWARWAH+ALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAIALL
Sbjct  146   FALSVGAAVGMEFWARWAHKALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALL  205

Query  783   SYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQL  962
             +YGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIA+VPY R+VAAAHQL
Sbjct  206   NYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIANVPYLRKVAAAHQL  265

Query  963   HHTDKFNGVPYGLFLGPK  1016
             HH++KF+GVPYGLFLGPK
Sbjct  266   HHSEKFDGVPYGLFLGPK  283



>gb|KEH26252.1| beta-carotene hydroxylase [Medicago truncatula]
Length=330

 Score =   345 bits (884),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 183/236 (78%), Positives = 206/236 (87%), Gaps = 5/236 (2%)
 Frame = +3

Query  327   SLTVCFVLEDEK----LESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAA  494
             S T+C ++ED K    +E    +    +    I  Q+ + ++AEKLARK+SERFTYLVAA
Sbjct  54    SFTLCVLMEDPKRDTQMEIEEEKSTTLQENNYIIPQVVSLKMAEKLARKKSERFTYLVAA  113

Query  495   VMSSLGITSMAVLAVYYRFAWQMEG-GEVPYTEMFGTFALSVGAAVGMEFwarwahralw  671
             VMSSLGITSMAVL+VY RF+WQMEG GE+P++EMFGTFALSVGAAVGMEFWARWAH+ALW
Sbjct  114   VMSSLGITSMAVLSVYLRFSWQMEGSGEIPWSEMFGTFALSVGAAVGMEFWARWAHKALW  173

Query  672   haSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITV  851
             HASLWHMHESHHR REG FELNDVFAI NAVPAIALL++GFFHKGLVPGLCFGAGLGITV
Sbjct  174   HASLWHMHESHHRAREGAFELNDVFAIINAVPAIALLNFGFFHKGLVPGLCFGAGLGITV  233

Query  852   FGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPKV  1019
             FGMAYMFVHDGLVH+RF VGPIA+VPYFRRVAAAH+LHH+DKF GVPYGLFLGPKV
Sbjct  234   FGMAYMFVHDGLVHRRFSVGPIANVPYFRRVAAAHKLHHSDKFEGVPYGLFLGPKV  289



>ref|XP_008343769.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Malus 
domestica]
Length=311

 Score =   344 bits (882),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  423   ISASRLAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGT  602
             I + R+AE+L+RK+SERFTYLVAAVMSS GITSMAV+AVYYRF WQMEGG VP +EM GT
Sbjct  86    IPSVRVAERLSRKKSERFTYLVAAVMSSFGITSMAVMAVYYRFYWQMEGGNVPMSEMLGT  145

Query  603   FALSVGAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALL  782
             FALSVGAAVGMEFWARWAH+ALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAIALL
Sbjct  146   FALSVGAAVGMEFWARWAHKALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALL  205

Query  783   SYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQL  962
             +YGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIA+VPY R+VAAAHQL
Sbjct  206   NYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIANVPYLRKVAAAHQL  265

Query  963   HHTDKFNGVPYGLFLGPK  1016
             HH++KF GVPYGLFLGPK
Sbjct  266   HHSEKFEGVPYGLFLGPK  283



>ref|XP_006284181.1| hypothetical protein CARUB_v10005328mg [Capsella rubella]
 gb|EOA17079.1| hypothetical protein CARUB_v10005328mg [Capsella rubella]
Length=305

 Score =   343 bits (879),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 184/233 (79%), Positives = 200/233 (86%), Gaps = 5/233 (2%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQIS----ASRLAEKLARKRSERFTYLVAAV  497
              +VC+V+ DE+ +   +E      E      I     A RLAEKL RK+SERFTYL+AAV
Sbjct  42    FSVCYVV-DERRQFSPIENDERPEESTSSTAIDPEYLALRLAEKLERKKSERFTYLIAAV  100

Query  498   MSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwha  677
             MSS GITSMAV+AVYYRF+WQMEGGE+   EMFGTFALSVGAAVGMEFWARWAHRALWHA
Sbjct  101   MSSFGITSMAVMAVYYRFSWQMEGGEISMLEMFGTFALSVGAAVGMEFWARWAHRALWHA  160

Query  678   SLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFG  857
             SLW+MHESHH+PREG FELNDVFAI NAVPAI LLSYGFF+KGLVPGLCFGAGLGITVFG
Sbjct  161   SLWNMHESHHKPREGAFELNDVFAIVNAVPAIGLLSYGFFNKGLVPGLCFGAGLGITVFG  220

Query  858   MAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             +AYMFVHDGLVHKRFPVGPIADVPY R+VAAAHQLHHTDKFNGVPYGLFLGPK
Sbjct  221   IAYMFVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFNGVPYGLFLGPK  273



>gb|AIT98181.1| beta-carotene hydroxylase [Medicago sativa]
Length=309

 Score =   342 bits (878),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 183/228 (80%), Positives = 199/228 (87%), Gaps = 3/228 (1%)
 Frame = +3

Query  336   VCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSLGI  515
             VC ++ED K          EEIE    K      +A+KLARK+S+RFTYLVAAVMSS G+
Sbjct  59    VCVLMEDPK--HTNQMKTEEEIEPPNSKPSPQFLVAQKLARKKSQRFTYLVAAVMSSFGV  116

Query  516   TSMAVLAVYYRFAWQMEG-GEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWHM  692
             TSMA+LAVYYRF+WQMEG GEVP++EMFGTFALSVGAAVGME+WARWAH  LWHASLWHM
Sbjct  117   TSMAILAVYYRFSWQMEGSGEVPWSEMFGTFALSVGAAVGMEYWARWAHEVLWHASLWHM  176

Query  693   HESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMF  872
             HESHHRPREGPFELNDVFAI NAVPAIALLSYGFF+KGLVPGLCFGAGLGITVFG+AYMF
Sbjct  177   HESHHRPREGPFELNDVFAIINAVPAIALLSYGFFNKGLVPGLCFGAGLGITVFGIAYMF  236

Query  873   VHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             VHDGLVHKRFPVGPIA+VPYF RVAAAHQLHH+DKF GVPYGLFLGPK
Sbjct  237   VHDGLVHKRFPVGPIANVPYFTRVAAAHQLHHSDKFKGVPYGLFLGPK  284



>gb|ABB52074.1| putative beta-ring carotene hydroxylase [Daucus carota subsp. 
sativus]
Length=309

 Score =   342 bits (878),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 183/236 (78%), Positives = 200/236 (85%), Gaps = 5/236 (2%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQISAS----RLAEKLARKRSERFTYLV  488
             K   TVCFV+E    +S G      + +    ++I A     R+ E+ ARK+SERFTYLV
Sbjct  46    KSLTTVCFVVEPRN-DSSGKPENNADRDEVSREEIEAGSCSVRVEERRARKKSERFTYLV  104

Query  489   AAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahral  668
             AAVMSSLGITSMAVLAVYYRF+WQMEGGE+PY+EM GTFALSVGAAVGMEFWARWAH AL
Sbjct  105   AAVMSSLGITSMAVLAVYYRFSWQMEGGEIPYSEMIGTFALSVGAAVGMEFWARWAHEAL  164

Query  669   whaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGIT  848
             WHASLWHMHESHH+PREG FELNDVFAI NAVPAIALL+YGFFHKG  PGLCFGAGLGIT
Sbjct  165   WHASLWHMHESHHKPREGAFELNDVFAIMNAVPAIALLAYGFFHKGYFPGLCFGAGLGIT  224

Query  849   VFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             VFG+AYMFVHDGLVHKRF VGPIADVPYFR+VAAAHQLHH +KF GVPYGLFLGPK
Sbjct  225   VFGIAYMFVHDGLVHKRFAVGPIADVPYFRKVAAAHQLHHMEKFKGVPYGLFLGPK  280



>gb|AAG10430.1| beta hydroxylase [Tagetes erecta]
Length=309

 Score =   342 bits (878),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 190/199 (95%), Gaps = 1/199 (1%)
 Frame = +3

Query  423   ISASRLAE-KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFG  599
             ++ +RL E K+ RK+SERFTYLVAA+MS+ GITSMAV+AVYYRF+WQMEGGE+PY EMFG
Sbjct  85    MNRNRLVEEKMERKKSERFTYLVAAIMSTFGITSMAVMAVYYRFSWQMEGGEIPYVEMFG  144

Query  600   TFALSVGAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIAL  779
             TFALSVGAAVGME+WARWAH ALWHASLWHMHESHH+PREGPFELNDVFAITNAVPAIAL
Sbjct  145   TFALSVGAAVGMEYWARWAHEALWHASLWHMHESHHKPREGPFELNDVFAITNAVPAIAL  204

Query  780   LSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQ  959
             LSYGFFHKG++PGLCFGAGLGITVFGMAYMFVHDGLVH+RF VGPIA+VPY RRVAAAHQ
Sbjct  205   LSYGFFHKGIIPGLCFGAGLGITVFGMAYMFVHDGLVHRRFQVGPIANVPYLRRVAAAHQ  264

Query  960   LHHTDKFNGVPYGLFLGPK  1016
             LHHT+KFNGVPYGLFLGPK
Sbjct  265   LHHTEKFNGVPYGLFLGPK  283



>gb|EYU25142.1| hypothetical protein MIMGU_mgv1a009955mg [Erythranthe guttata]
Length=326

 Score =   343 bits (879),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 191/202 (95%), Gaps = 2/202 (1%)
 Frame = +3

Query  417   KQISAS--RLAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTE  590
              QISA+  R+AEKLARK+SER TYL+AAVMSSLGITSMA++AVYYRFAWQMEGGE+PY E
Sbjct  100   DQISAAAARVAEKLARKKSERSTYLIAAVMSSLGITSMAIVAVYYRFAWQMEGGEIPYAE  159

Query  591   MFGTFALSVGAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPA  770
             MFGTF L+VGAAVGME WARWAH ALWHASLWHMHESHH+PREG FELNDVFAITNAVPA
Sbjct  160   MFGTFLLAVGAAVGMEMWARWAHEALWHASLWHMHESHHKPREGAFELNDVFAITNAVPA  219

Query  771   IALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAA  950
             IALL YGF+ KGL+PGLCFGAGLGITVFGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAA
Sbjct  220   IALLYYGFYTKGLIPGLCFGAGLGITVFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAA  279

Query  951   AHQLHHTDKFNGVPYGLFLGPK  1016
             AHQLHH++KFNGVPYGLFLGPK
Sbjct  280   AHQLHHSEKFNGVPYGLFLGPK  301



>ref|XP_007143466.1| hypothetical protein PHAVU_007G074200g [Phaseolus vulgaris]
 gb|ESW15460.1| hypothetical protein PHAVU_007G074200g [Phaseolus vulgaris]
Length=361

 Score =   344 bits (882),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 201/228 (88%), Gaps = 3/228 (1%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
              +VC + ED K     V+I+  E E+     + ++++ EK A+++S+RFTYLVAAVMSS 
Sbjct  113   FSVCVLTEDRK---RNVQIKTNEEEQEASPGVVSAKMEEKSAKRKSQRFTYLVAAVMSSF  169

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMAV AVYYRF+WQMEGG+ P++EM GTF+LSVGAAV MEFWARWAHRALWHASLWH
Sbjct  170   GITSMAVFAVYYRFSWQMEGGDFPWSEMLGTFSLSVGAAVAMEFWARWAHRALWHASLWH  229

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MH+SHHRPREGPFELNDVFAI NAVPAIALLSYGF H+GLVPGLCFGAGLGITVFGMAYM
Sbjct  230   MHQSHHRPREGPFELNDVFAIVNAVPAIALLSYGFLHRGLVPGLCFGAGLGITVFGMAYM  289

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGP  1013
             FVHDGLVHKRFPVGPIA+VPYFRRVAAAHQLHHTDKFNGVPYGLFLGP
Sbjct  290   FVHDGLVHKRFPVGPIANVPYFRRVAAAHQLHHTDKFNGVPYGLFLGP  337



>gb|AAC49443.1| beta-carotene hydroxylase, partial [Arabidopsis thaliana]
Length=294

 Score =   341 bits (874),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 200/233 (86%), Gaps = 5/233 (2%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISAS----RLAEKLARKRSERFTYLVAAV  497
              +VC+V+E E+ ++  +E        +    I A     RLAEKL RK+SER TYL+AA+
Sbjct  29    FSVCYVVE-ERRQNSPIENDERPESTSSTNAIDAEYLALRLAEKLERKKSERSTYLIAAM  87

Query  498   MSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwha  677
             +SS GITSMAV+AVYYRF+WQMEGGE+   EMFGTFALSVGAAVGMEFWARWAHRALWHA
Sbjct  88    LSSFGITSMAVMAVYYRFSWQMEGGEISMLEMFGTFALSVGAAVGMEFWARWAHRALWHA  147

Query  678   SLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFG  857
             SLW+MHESHH+PREGPFELNDVFAI NA PAI LLSYGFF+KGLVPGLCFGAGLGITVFG
Sbjct  148   SLWNMHESHHKPREGPFELNDVFAIVNAGPAIGLLSYGFFNKGLVPGLCFGAGLGITVFG  207

Query  858   MAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             +AYMFVHDGLVHKRFPVGPIADVPY R+VAAAHQLHHTDKFNGVPYGLFLGPK
Sbjct  208   IAYMFVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFNGVPYGLFLGPK  260



>ref|NP_194300.1| beta-carotene 3-hydroxylase 1 [Arabidopsis thaliana]
 sp|Q9SZZ8.1|BCH1_ARATH RecName: Full=Beta-carotene 3-hydroxylase 1, chloroplastic; Short=AtB1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF85797.1|AF125576_1 beta-carotene hydroxylase [Arabidopsis thaliana]
 gb|AAF85798.1|AF125577_1 beta-carotene hydroxylase [Arabidopsis thaliana]
 gb|AAK44035.1|AF370220_1 putative beta-carotene hydroxylase [Arabidopsis thaliana]
 emb|CAB43701.1| beta-carotene hydroxylase [Arabidopsis thaliana]
 emb|CAB81380.1| beta-carotene hydroxylase [Arabidopsis thaliana]
 gb|AAM44971.1| putative beta-carotene hydroxylase [Arabidopsis thaliana]
 gb|AEE85098.1| beta-carotene 3-hydroxylase 1 [Arabidopsis thaliana]
Length=310

 Score =   341 bits (874),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 200/233 (86%), Gaps = 5/233 (2%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISAS----RLAEKLARKRSERFTYLVAAV  497
              +VC+V+E E+ ++  +E        +    I A     RLAEKL RK+SER TYL+AA+
Sbjct  45    FSVCYVVE-ERRQNSPIENDERPESTSSTNAIDAEYLALRLAEKLERKKSERSTYLIAAM  103

Query  498   MSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwha  677
             +SS GITSMAV+AVYYRF+WQMEGGE+   EMFGTFALSVGAAVGMEFWARWAHRALWHA
Sbjct  104   LSSFGITSMAVMAVYYRFSWQMEGGEISMLEMFGTFALSVGAAVGMEFWARWAHRALWHA  163

Query  678   SLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFG  857
             SLW+MHESHH+PREGPFELNDVFAI NA PAI LLSYGFF+KGLVPGLCFGAGLGITVFG
Sbjct  164   SLWNMHESHHKPREGPFELNDVFAIVNAGPAIGLLSYGFFNKGLVPGLCFGAGLGITVFG  223

Query  858   MAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             +AYMFVHDGLVHKRFPVGPIADVPY R+VAAAHQLHHTDKFNGVPYGLFLGPK
Sbjct  224   IAYMFVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFNGVPYGLFLGPK  276



>ref|XP_008805553.1| PREDICTED: beta-carotene 3-hydroxylase 2, chloroplastic-like 
[Phoenix dactylifera]
Length=324

 Score =   341 bits (874),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 183/236 (78%), Positives = 200/236 (85%), Gaps = 4/236 (2%)
 Frame = +3

Query  321   KPSLTVCFVLED----EKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLV  488
             + S  VCFVL      E  E+    I    +    E++I   R AEK+ARK+SER TYL 
Sbjct  60    RRSAAVCFVLGQSRGSEMEEAEETAISDAAVAEEEERRILLDRTAEKIARKQSERRTYLA  119

Query  489   AAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahral  668
             AAVMSSLGITSMAV AVYYRF WQMEGG VP TEMFGTFALSVGAAVGME+WARWAHRAL
Sbjct  120   AAVMSSLGITSMAVAAVYYRFYWQMEGGAVPMTEMFGTFALSVGAAVGMEYWARWAHRAL  179

Query  669   whaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGIT  848
             WHASLWHMHESHHRPR+GPFELNDVFAI NAVPAI+LLS+GFF +GLVPGLCFGAGLGIT
Sbjct  180   WHASLWHMHESHHRPRDGPFELNDVFAIINAVPAISLLSFGFFTRGLVPGLCFGAGLGIT  239

Query  849   VFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             +FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAHQ+HH DKF+GVPYGLFLGPK
Sbjct  240   LFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHQIHHMDKFDGVPYGLFLGPK  295



>ref|XP_010919115.1| PREDICTED: beta-carotene 3-hydroxylase 2, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=325

 Score =   340 bits (873),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 180/234 (77%), Positives = 199/234 (85%), Gaps = 4/234 (2%)
 Frame = +3

Query  327   SLTVCFVL----EDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAA  494
             S  VCFV+      E  E+  +E      E    ++I   R AEK+ARK++ER TYL AA
Sbjct  62    SAAVCFVVGQNRSSEMKEAAEIESSDLAAEEEEARRILLDRTAEKIARKQAERRTYLAAA  121

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwh  674
             V+SSLGITSMAV AVYYRF WQMEGGEVP TEM GTF LSVGAAVGMEFWARWAHRALWH
Sbjct  122   VLSSLGITSMAVAAVYYRFYWQMEGGEVPLTEMLGTFTLSVGAAVGMEFWARWAHRALWH  181

Query  675   aSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVF  854
             ASLWHMHESHHRPR+GPFELNDVFAI NAVPAI+LLS+GFF++GLVPGLCFGAGLGIT+F
Sbjct  182   ASLWHMHESHHRPRDGPFELNDVFAIINAVPAISLLSFGFFNRGLVPGLCFGAGLGITLF  241

Query  855   GMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             GMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAHQ+HH DKF+GVPYGLFLGPK
Sbjct  242   GMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHQIHHMDKFDGVPYGLFLGPK  295



>ref|XP_003592203.1| Beta-carotene hydroxylase [Medicago truncatula]
 gb|AES62454.1| beta-carotene hydroxylase [Medicago truncatula]
Length=296

 Score =   339 bits (870),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 196/230 (85%), Gaps = 15/230 (7%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
              TVC + ED K  S              + +     +A+KLARK+S+RFTYLVAAVMSS 
Sbjct  56    FTVCVLTEDPKHTS--------------QLKTEEEIVAQKLARKKSQRFTYLVAAVMSSF  101

Query  510   GITSMAVLAVYYRFAWQMEG-GEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLW  686
             G+TSMA+LAVYYRF+WQMEG GEVP++EMFGTFALSVGAAVGMEFWARWAH  LWHASLW
Sbjct  102   GVTSMAILAVYYRFSWQMEGSGEVPWSEMFGTFALSVGAAVGMEFWARWAHEILWHASLW  161

Query  687   HMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAY  866
             HMH+SHHRPREG FELNDVFAI NAVPAIALLSYGFF+KGL+PGLCFGAGLGITVFG+AY
Sbjct  162   HMHQSHHRPREGAFELNDVFAIINAVPAIALLSYGFFNKGLLPGLCFGAGLGITVFGIAY  221

Query  867   MFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             MFVHDGLVHKRFPVGPIA+VPYF RVAAAHQLHH+DKF GVPYGLFLGPK
Sbjct  222   MFVHDGLVHKRFPVGPIANVPYFTRVAAAHQLHHSDKFKGVPYGLFLGPK  271



>gb|ABS76147.1| beta-carotene hydroxylase [Elaeis oleifera]
Length=325

 Score =   340 bits (872),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 181/234 (77%), Positives = 200/234 (85%), Gaps = 4/234 (2%)
 Frame = +3

Query  327   SLTVCFVL----EDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAA  494
             S  VCFV+      E  E+  +E      E    ++I   R AEK+ARK++ER TYL AA
Sbjct  62    SAAVCFVVGQNRSSEMKEAVEIESSDPAAEEEEARRILLDRTAEKIARKQAERRTYLAAA  121

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwh  674
             V+SSLGITSMAV AVYYRF WQMEGGEVP TEM GTFALSVGAAVGMEFWARWAHRALWH
Sbjct  122   VLSSLGITSMAVAAVYYRFYWQMEGGEVPLTEMLGTFALSVGAAVGMEFWARWAHRALWH  181

Query  675   aSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVF  854
             ASLWHMHESHHRPR+GPFELNDVFAI NAVPAI+LLS+GFF++GLVPGLCFGAGLGIT+F
Sbjct  182   ASLWHMHESHHRPRDGPFELNDVFAIINAVPAISLLSFGFFNRGLVPGLCFGAGLGITLF  241

Query  855   GMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             GMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAHQ+HH DKF+GVPYGLFLGPK
Sbjct  242   GMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHQIHHMDKFDGVPYGLFLGPK  295



>ref|XP_002865921.1| hypothetical protein ARALYDRAFT_495328 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42180.1| hypothetical protein ARALYDRAFT_495328 [Arabidopsis lyrata subsp. 
lyrata]
Length=297

 Score =   339 bits (869),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 196/228 (86%), Gaps = 2/228 (1%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
             LT+CFV+E+ K  S        E   +  + +  SRL +K  +K+SERFTYL+AAVMSS 
Sbjct  42    LTICFVVEERKQSSP--MDDKPESTTSSSEILMTSRLLKKAEKKKSERFTYLIAAVMSSF  99

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMA++AVYYRF+WQM+GGEVP +EMFGTFALSVGA VGMEFWARWAHRALWH SLW+
Sbjct  100   GITSMAIMAVYYRFSWQMKGGEVPLSEMFGTFALSVGAVVGMEFWARWAHRALWHDSLWN  159

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHH+PREG FELNDVFAI NAVPAI LL YGFF+KGLVPGLCFGAGLGITVFGMAYM
Sbjct  160   MHESHHKPREGAFELNDVFAIINAVPAIGLLYYGFFNKGLVPGLCFGAGLGITVFGMAYM  219

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGP  1013
             FVHDGLVHKRFPVGPIA+VPY R+VAAAHQLHHTDKF GVPYGLFLGP
Sbjct  220   FVHDGLVHKRFPVGPIANVPYLRKVAAAHQLHHTDKFKGVPYGLFLGP  267



>ref|NP_200070.1| beta-carotene hydroxylase 2 [Arabidopsis thaliana]
 sp|Q9LTG0.1|BCH2_ARATH RecName: Full=Beta-carotene 3-hydroxylase 2, chloroplastic; Short=AtB2; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA98075.1| beta-carotene hydroxylase [Arabidopsis thaliana]
 gb|AAL67090.1| putative beta-carotene hydroxylase [Arabidopsis thaliana]
 gb|AAM51300.1| putative beta-carotene hydroxylase [Arabidopsis thaliana]
 gb|AED96235.1| beta-carotene hydroxylase 2 [Arabidopsis thaliana]
Length=303

 Score =   339 bits (869),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 196/228 (86%), Gaps = 0/228 (0%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
             LTVCFV+E+ K  S   +    E   +  + +  SRL +K  +K+SERFTYL+AAVMSS 
Sbjct  46    LTVCFVVEERKQSSPMDDDNKPESTTSSSEILMTSRLLKKAEKKKSERFTYLIAAVMSSF  105

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMA++AVYYRF+WQM+GGEV   EMFGTFALSVGAAVGMEFWARWAHRALWH SLW+
Sbjct  106   GITSMAIMAVYYRFSWQMKGGEVSVLEMFGTFALSVGAAVGMEFWARWAHRALWHDSLWN  165

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHH+PREG FELNDVFAITNAVPAI LL YGF +KGLVPGLCFGAGLGIT+FGMAYM
Sbjct  166   MHESHHKPREGAFELNDVFAITNAVPAIGLLYYGFLNKGLVPGLCFGAGLGITMFGMAYM  225

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGP  1013
             FVHDGLVHKRFPVGPIA+VPY R+VAAAHQLHHTDKF GVPYGLFLGP
Sbjct  226   FVHDGLVHKRFPVGPIANVPYLRKVAAAHQLHHTDKFKGVPYGLFLGP  273



>gb|AGQ43598.1| beta-carotene hydroxylase [Fragaria x ananassa]
Length=311

 Score =   339 bits (869),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 182/237 (77%), Positives = 202/237 (85%), Gaps = 5/237 (2%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQ-----ISASRLAEKLARKRSERFTYL  485
             K  LTV  V+ED+K  +  V+   E  + +         I + R AE+LA+K+S RFTYL
Sbjct  50    KLCLTVYVVMEDQKRNTTEVDTSDEIPQESSPSSEIPIVIPSLRGAERLAKKKSGRFTYL  109

Query  486   VAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahra  665
             VAAVMSS GITSMAV+AVYYRF WQMEGG VP +EMFGTFALSVGAAVGMEFWARWAH+A
Sbjct  110   VAAVMSSFGITSMAVMAVYYRFYWQMEGGNVPVSEMFGTFALSVGAAVGMEFWARWAHKA  169

Query  666   lwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGI  845
             LWHASLWHMHESHH+P EGPFELNDVFAI NAVPAIALL+YGFFHKG VPGLCFGAGLGI
Sbjct  170   LWHASLWHMHESHHKPGEGPFELNDVFAIINAVPAIALLNYGFFHKGYVPGLCFGAGLGI  229

Query  846   TVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             TVFGMAYMFVHDGLVHKRFPVGPIA+VPYFR+VAAAHQLHH++KF GVPYGLFLGP+
Sbjct  230   TVFGMAYMFVHDGLVHKRFPVGPIANVPYFRKVAAAHQLHHSEKFKGVPYGLFLGPQ  286



>ref|XP_010433597.1| PREDICTED: beta-carotene 3-hydroxylase 1, chloroplastic-like 
[Camelina sativa]
Length=310

 Score =   338 bits (868),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 202/232 (87%), Gaps = 5/232 (2%)
 Frame = +3

Query  330   LTVCFVLEDE----KLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAV  497
              +VC+V+E+     K+E+      +     AI+ +  A RLAEKL RK+SERFTYL+AAV
Sbjct  47    FSVCYVVEERRQSSKIENDERPEESTSSTTAIDAEYLALRLAEKLERKKSERFTYLIAAV  106

Query  498   MSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwha  677
             +SS GITSMAV+AVYYRF+WQMEGGE+   EMFGTFALSVGAAVGMEFWARWAHRALWHA
Sbjct  107   LSSFGITSMAVMAVYYRFSWQMEGGEISMLEMFGTFALSVGAAVGMEFWARWAHRALWHA  166

Query  678   SLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFG  857
             SLW+MHESHH+PREGPFELNDVFAI NAVPAI LLSYGFF+KGLVPGL FGAGLGITVFG
Sbjct  167   SLWNMHESHHKPREGPFELNDVFAIVNAVPAIGLLSYGFFNKGLVPGL-FGAGLGITVFG  225

Query  858   MAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGP  1013
             +AYMFVHDGLVHKRFPVGPIADVPY R+VAAAHQLHHTDKFNGVPYGLFLGP
Sbjct  226   IAYMFVHDGLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFNGVPYGLFLGP  277



>ref|XP_004513181.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like isoform 
X1 [Cicer arietinum]
Length=311

 Score =   338 bits (868),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 177/235 (75%), Positives = 202/235 (86%), Gaps = 5/235 (2%)
 Frame = +3

Query  327   SLTVCFVLEDEK----LESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAA  494
             S T+C ++ D K    +E    +   +        Q+ + ++ EKL RK+SER TYL+AA
Sbjct  51    SFTLCVLMNDPKQNTQIEIEEEKSPLQGENDNNYSQVVSPKMEEKLKRKKSERLTYLIAA  110

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGG-EVPYTEMFGTFALSVGAAVGMEFwarwahralw  671
             VMSSLGITSMAVL+VYYRF+WQMEGG E+ ++EMFGTFALSVGAAVGMEFWARWAH+ALW
Sbjct  111   VMSSLGITSMAVLSVYYRFSWQMEGGGEILWSEMFGTFALSVGAAVGMEFWARWAHKALW  170

Query  672   haSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITV  851
             HASLWHMHESHHR REGPFELNDVFAI NAVPAIALL++GFFHKGL+PGLCFGAGLGITV
Sbjct  171   HASLWHMHESHHRAREGPFELNDVFAIINAVPAIALLNFGFFHKGLIPGLCFGAGLGITV  230

Query  852   FGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FGMAYMFVHDGLVHKRF VGPIA+VPYFRRVAAAH+LHH+DKF+GVPYGLFLGPK
Sbjct  231   FGMAYMFVHDGLVHKRFSVGPIANVPYFRRVAAAHKLHHSDKFHGVPYGLFLGPK  285



>gb|AGS79169.1| beta-ring carotene hydroxylase [Fagopyrum tataricum]
Length=312

 Score =   338 bits (867),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 183/245 (75%), Positives = 204/245 (83%), Gaps = 15/245 (6%)
 Frame = +3

Query  327   SLTVCFVLEDEKLES---------------GGVeiraeeieraieKQISASRLAEKLARK  461
             S T+ FVLE+++L                 G  +         I++QISA RLAEKLARK
Sbjct  43    SFTISFVLEEKRLGHVSLPPSPKDDEVRLLGDFDSLTVPSPEDIDRQISAVRLAEKLARK  102

Query  462   RSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEF  641
              SERFTYL+AAVMS+ GI+SMAVLAVYYRF  QM+GGEVP+TEM GTFALSVGAAVGMEF
Sbjct  103   ESERFTYLIAAVMSTFGISSMAVLAVYYRFHCQMDGGEVPFTEMVGTFALSVGAAVGMEF  162

Query  642   warwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGL  821
             WARWAH ALWHASL HMHESHH+PREG FELNDVFA+ NAVPAIALL+YGF+H+GLVPGL
Sbjct  163   WARWAHEALWHASLRHMHESHHKPREGAFELNDVFAVINAVPAIALLNYGFYHRGLVPGL  222

Query  822   CFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGL  1001
             CFGAGLGITVFGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAHQLHH++KF GVPYGL
Sbjct  223   CFGAGLGITVFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHQLHHSEKFKGVPYGL  282

Query  1002  FLGPK  1016
             FLGPK
Sbjct  283   FLGPK  287



>emb|CAC06712.1| beta-carotene hydroxylase [Narcissus pseudonarcissus]
Length=308

 Score =   338 bits (866),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 168/198 (85%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  423   ISASRLAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGT  602
             IS SR  E++ RKRSER TYL+AA+MSSLGITSMA+++VYYRFAWQME GE+P TEM GT
Sbjct  82    ISKSRTTERMERKRSERTTYLIAAMMSSLGITSMAIVSVYYRFAWQMEEGEIPVTEMLGT  141

Query  603   FALSVGAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALL  782
             FALSVGAAVGMEFWARWAHRALWHASLWHMHESHH+PR+GPFELNDVFA+ NAVPAI+LL
Sbjct  142   FALSVGAAVGMEFWARWAHRALWHASLWHMHESHHKPRDGPFELNDVFAVINAVPAISLL  201

Query  783   SYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQL  962
              YGFF++GLVPGLCFGAGLGIT++GMAYMFVHDGLVH+RFPVGPIADVPYFRRVAAAH++
Sbjct  202   YYGFFNRGLVPGLCFGAGLGITLYGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAAAHRI  261

Query  963   HHTDKFNGVPYGLFLGPK  1016
             HHT+KFNGVPYGLFLGPK
Sbjct  262   HHTEKFNGVPYGLFLGPK  279



>ref|XP_010933981.1| PREDICTED: LOW QUALITY PROTEIN: beta-carotene 3-hydroxylase 2, 
chloroplastic-like [Elaeis guineensis]
Length=327

 Score =   338 bits (866),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 182/238 (76%), Positives = 206/238 (87%), Gaps = 6/238 (3%)
 Frame = +3

Query  321   KPSLTVCFVL----EDEKLESGGVeiraeeieraieKQ--ISASRLAEKLARKRSERFTY  482
             +P+  VCFV+      E  E  G+   A     A E++  I  +R AEK+ARK+SER TY
Sbjct  60    RPAAAVCFVVGQSGRSEITEETGISDAAAAARPAEEEERRILLNRTAEKMARKQSERRTY  119

Query  483   LVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahr  662
             L+AAVMSSLGITSMA+ AVYYRF WQMEGGEVP TEM+GTFALSVGAAVGMEFWARWAHR
Sbjct  120   LMAAVMSSLGITSMAIAAVYYRFYWQMEGGEVPVTEMWGTFALSVGAAVGMEFWARWAHR  179

Query  663   alwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLG  842
             ALWHASLWH+HESHHRPR+GPFELNDVFAI NAVPAI+LLS+GFF++GL+PGLCFGAGLG
Sbjct  180   ALWHASLWHVHESHHRPRDGPFELNDVFAIINAVPAISLLSFGFFNRGLLPGLCFGAGLG  239

Query  843   ITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             IT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAHQ+HH DKF+GVPYGLFLGPK
Sbjct  240   ITIFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHQIHHGDKFDGVPYGLFLGPK  297



>ref|XP_006280857.1| hypothetical protein CARUB_v10026847mg [Capsella rubella]
 gb|EOA13755.1| hypothetical protein CARUB_v10026847mg [Capsella rubella]
Length=304

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 198/228 (87%), Gaps = 0/228 (0%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
             LTVCFV+E+ K  S   + + E    +  + ++ SRL +K  +K++ER TYL+AAVMSS 
Sbjct  46    LTVCFVVEERKQSSPMDDDKPESTTSSSHQFLATSRLLKKAEKKKTERLTYLIAAVMSSF  105

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             G+TSMA++AVYYRF+WQM+GGEVP +EMFGTFAL+VGAAVGMEFWARWAHRALWH SLW+
Sbjct  106   GVTSMAIMAVYYRFSWQMKGGEVPISEMFGTFALAVGAAVGMEFWARWAHRALWHDSLWN  165

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHH+ REG FELNDVFAI NAVPAI LL YGFF+KGLVPGLCFGAGLGITVFGMAYM
Sbjct  166   MHESHHKAREGAFELNDVFAIINAVPAIGLLYYGFFNKGLVPGLCFGAGLGITVFGMAYM  225

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGP  1013
             FVHDGLVHKRFPVGPIA+VPY R+VAAAHQLHHTDKF GVPYGLFLGP
Sbjct  226   FVHDGLVHKRFPVGPIANVPYLRKVAAAHQLHHTDKFKGVPYGLFLGP  273



>gb|KDO56786.1| hypothetical protein CISIN_1g020892mg [Citrus sinensis]
Length=272

 Score =   335 bits (859),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 195/214 (91%), Gaps = 2/214 (1%)
 Frame = +3

Query  327  SLTVCFVLEDEKLESGGVeiraeeieraieKQIS-ASRLAEKLARKRSERFTYLVAAVMS  503
            S TVCFVLE++K +S  +E   EE E     QIS A+R+AEKLARKRSERFTYLVAAVMS
Sbjct  55   SFTVCFVLEEKK-QSTQIETFTEEEEEESGTQISTAARVAEKLARKRSERFTYLVAAVMS  113

Query  504  SLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSL  683
            S GITSMAV+AVYYRF WQMEGGEVP  EMFGTFALSVGAAVGMEFWARWAH+ALWHASL
Sbjct  114  SFGITSMAVMAVYYRFWWQMEGGEVPLAEMFGTFALSVGAAVGMEFWARWAHKALWHASL  173

Query  684  WHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMA  863
            WHMHESHHRPREGPFELNDVFAI NAVPAIALLS+GFFHKGLVPGLCFGAGLGITVFGMA
Sbjct  174  WHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMA  233

Query  864  YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLH  965
            YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQ++
Sbjct  234  YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQVN  267



>gb|AFX79619.1| beta-carotene hydroxylase B1 [Triticum aestivum]
Length=303

 Score =   336 bits (861),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +3

Query  435   RLAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALS  614
             R+AE+ ARK+SER TYLVAAVMSSLG+TSMA+ +VYYRFAWQMEGGEVP TEM GTFALS
Sbjct  86    RVAERKARKQSERRTYLVAAVMSSLGVTSMAIASVYYRFAWQMEGGEVPMTEMLGTFALS  145

Query  615   VGAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGF  794
             VGAAVGMEFWA+WAH+ALWHASLWHMHESHHRPR+GPFELNDVFAI NA PAIALL+YGF
Sbjct  146   VGAAVGMEFWAQWAHKALWHASLWHMHESHHRPRDGPFELNDVFAIINAGPAIALLAYGF  205

Query  795   FHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTD  974
             FH+GL+PGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAAAH++HH D
Sbjct  206   FHRGLIPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAAAHKIHHMD  265

Query  975   KFNGVPYGLFLGPK  1016
             KF GVPYGLFLGPK
Sbjct  266   KFEGVPYGLFLGPK  279



>emb|CDY65322.1| BnaC02g44870D [Brassica napus]
Length=301

 Score =   335 bits (860),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 197/228 (86%), Gaps = 3/228 (1%)
 Frame = +3

Query  333   TVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSLG  512
             TVCFVLE++K  S    +  +    +    ++ SRL +K  RK+ ERFTYL+AA+MSS G
Sbjct  49    TVCFVLEEQKQSS---PMDDKPESTSSPDILTTSRLLKKAERKKFERFTYLIAAMMSSFG  105

Query  513   ITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWHM  692
             +TSMA++AVYYRF+WQM+GGEVP +EMFGTFALSVGAAVGMEFWARWAHR LWHASLW+M
Sbjct  106   VTSMAIMAVYYRFSWQMKGGEVPLSEMFGTFALSVGAAVGMEFWARWAHRVLWHASLWNM  165

Query  693   HESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMF  872
             HESHH+PREG FELNDVFAI NAVPAI LL YGFF+KG VPGLCFGAGLGIT+FG+AYMF
Sbjct  166   HESHHKPREGAFELNDVFAIINAVPAIGLLYYGFFNKGFVPGLCFGAGLGITMFGIAYMF  225

Query  873   VHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             VHDGLVHKRFPVGPIA+VPY R+VAAAHQLHHTDKF GVPYGLFLGPK
Sbjct  226   VHDGLVHKRFPVGPIANVPYLRKVAAAHQLHHTDKFKGVPYGLFLGPK  273



>ref|XP_006829074.1| hypothetical protein AMTR_s00001p00259440 [Amborella trichopoda]
 gb|ERM96490.1| hypothetical protein AMTR_s00001p00259440 [Amborella trichopoda]
Length=294

 Score =   335 bits (859),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 199/231 (86%), Gaps = 15/231 (6%)
 Frame = +3

Query  330   LTVCFVLED--EKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMS  503
              TVCFV+E+  EK +  GV              ++   + EK+ARKRSER  YL+AAV+S
Sbjct  49    FTVCFVMEEQREKEKFQGVV-------------VAREDVPEKIARKRSERHAYLLAAVLS  95

Query  504   SLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSL  683
             SLGIT++A  AVYYRFAWQ +GGEVP TEMFGTF+LSVGAAVGMEFWARWAHRALWHASL
Sbjct  96    SLGITTLAAAAVYYRFAWQFQGGEVPVTEMFGTFSLSVGAAVGMEFWARWAHRALWHASL  155

Query  684   WHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMA  863
             WHMHESHHRPREGPFELNDVFAI N+VPAI+LLSYGFF+KGLVPGLCFGAGLGITVFG+A
Sbjct  156   WHMHESHHRPREGPFELNDVFAIINSVPAISLLSYGFFNKGLVPGLCFGAGLGITVFGIA  215

Query  864   YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             YMFVHDGLVH+RFPVGPIA+VPYFR+VAAAHQ+HH DKF+GVPYGLFLGPK
Sbjct  216   YMFVHDGLVHRRFPVGPIANVPYFRKVAAAHQIHHADKFDGVPYGLFLGPK  266



>dbj|BAF49057.1| beta-ring hydroxylase [Prunus mume]
Length=188

 Score =   330 bits (847),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  456   RKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGM  635
             RKRSERFTYLVAAVMSS GITSMAV+AVYYRF WQMEGG VP +EM GTFALSVGAAVGM
Sbjct  2     RKRSERFTYLVAAVMSSFGITSMAVMAVYYRFYWQMEGGNVPLSEMLGTFALSVGAAVGM  61

Query  636   EFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVP  815
             EFWARWAH+ALWHASLWHMHESHHRPREGPFELNDVFA+ NAVPAIALL+YGFFHKGLVP
Sbjct  62    EFWARWAHKALWHASLWHMHESHHRPREGPFELNDVFAVINAVPAIALLNYGFFHKGLVP  121

Query  816   GLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPY  995
             GLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIA+VPY R+VAAAHQLHH++KF GVPY
Sbjct  122   GLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIANVPYLRKVAAAHQLHHSEKFEGVPY  181

Query  996   GLFLGPK  1016
             GLFLGPK
Sbjct  182   GLFLGPK  188



>ref|XP_009411429.1| PREDICTED: beta-carotene 3-hydroxylase, chloroplastic-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=317

 Score =   335 bits (860),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 174/214 (81%), Positives = 193/214 (90%), Gaps = 7/214 (3%)
 Frame = +3

Query  435   RLAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALS  614
             R+ E+ ARK+ ER TYL+AAVMSSLGITSMAV AVYYRF+WQMEGGE+P TEMFGTFALS
Sbjct  101   RMEERAARKQEERRTYLIAAVMSSLGITSMAVAAVYYRFSWQMEGGEIPLTEMFGTFALS  160

Query  615   VGAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGF  794
             VGAAVGMEFWARWAHRALWHASLWHMHESHHRPR+GPFELNDVFAI NAVPAI+L++YGF
Sbjct  161   VGAAVGMEFWARWAHRALWHASLWHMHESHHRPRDGPFELNDVFAIINAVPAISLMAYGF  220

Query  795   FHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTD  974
             F++GL+PGLCFGAGLGIT+FG+AYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAHQ+HH D
Sbjct  221   FNRGLLPGLCFGAGLGITLFGVAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHQIHHMD  280

Query  975   KFNGVPYGLFLGPKV--TN*SNL*IQLFISCRFD  1070
             KF GVPYGLFLGPKV  TN      +L   CRF 
Sbjct  281   KFEGVPYGLFLGPKVMPTN-----TELGPRCRFQ  309



>ref|XP_010442795.1| PREDICTED: beta-carotene 3-hydroxylase 2, chloroplastic [Camelina 
sativa]
Length=302

 Score =   335 bits (858),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 199/229 (87%), Gaps = 1/229 (0%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
             LTVCFV+E+ K +S  ++    E   +  + ++ +RL +K  RK++ER TY +AAVMSS 
Sbjct  46    LTVCFVVEERK-QSFPMDEDKPESTTSSLEMLARTRLIKKAERKKTERMTYFIAAVMSSF  104

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITS+A++AVYYRF WQM+GGEVP +EMFGTFAL+VGAAVGMEFWARWAHRALWH SLW+
Sbjct  105   GITSLAIIAVYYRFYWQMKGGEVPASEMFGTFALAVGAAVGMEFWARWAHRALWHDSLWN  164

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHH+PREG FELNDVFAI NAVPAI LL YGFF+KGLVPGLCFGAGLGIT+FGMAYM
Sbjct  165   MHESHHKPREGAFELNDVFAIINAVPAIGLLYYGFFNKGLVPGLCFGAGLGITMFGMAYM  224

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIA+VPY R+VAAAHQLHHTDKF GVPYGLFLGPK
Sbjct  225   FVHDGLVHKRFPVGPIANVPYLRKVAAAHQLHHTDKFKGVPYGLFLGPK  273



>emb|CAC95130.2| beta-carotene hydroxylase [Crocus sativus]
Length=305

 Score =   335 bits (858),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 197/229 (86%), Gaps = 8/229 (3%)
 Frame = +3

Query  333   TVCFVLEDEKLESGGVeiraeeieraieKQISAS-RLAEKLARKRSERFTYLVAAVMSSL  509
             TV FVL +EK             +   EK I+ S R AE+ ARKRSER TYL+ AVMSS 
Sbjct  54    TVFFVLAEEK-------TTPFLDDVEEEKSIAPSNRAAERSARKRSERTTYLITAVMSSF  106

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMA  AVYYRFAWQMEGG+VP TEM GTFALSVGAAVGMEFWARWAHRALWHASLWH
Sbjct  107   GITSMAAAAVYYRFAWQMEGGDVPVTEMAGTFALSVGAAVGMEFWARWAHRALWHASLWH  166

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHHRPREGPFELNDVFAI NAVPAIALL++GFFH+GL+PGLCFGAGLGIT+FG+AYM
Sbjct  167   MHESHHRPREGPFELNDVFAIINAVPAIALLNFGFFHRGLLPGLCFGAGLGITLFGIAYM  226

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVH+RFPVGPIADVPYF+RVAAAHQ+HH++KF GVPYGLF+GPK
Sbjct  227   FVHDGLVHRRFPVGPIADVPYFQRVAAAHQIHHSEKFEGVPYGLFMGPK  275



>gb|ABB52075.1| putative beta-ring carotene hydroxylase [Daucus carota subsp. 
sativus]
Length=303

 Score =   334 bits (857),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 201/239 (84%), Gaps = 9/239 (4%)
 Frame = +3

Query  321   KPSLTVCFVLEDEKLESGGVeiraeeieraieKQI-------SASRLAEKLARKRSERFT  479
             K  L++CF +E+   ES      AEE  R +EKQI         SR  E++ARK++ERFT
Sbjct  44    KRKLSLCFAVEEN--ESPVAAAEAEESSREVEKQIIESFTVAGGSRAEERMARKKTERFT  101

Query  480   YLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwah  659
             YLVAAVMSS GITSMAV AVY RFAWQMEGGEVP++EM  TF+L+ GAAVGME+WARWAH
Sbjct  102   YLVAAVMSSFGITSMAVFAVYSRFAWQMEGGEVPHSEMLATFSLAFGAAVGMEYWARWAH  161

Query  660   ralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGL  839
             +ALWH SLWHMHESHH+PREG FELNDVFAI NAVPAIALL+YGFFHKGL PGLCFGAGL
Sbjct  162   KALWHDSLWHMHESHHKPREGAFELNDVFAIINAVPAIALLAYGFFHKGLFPGLCFGAGL  221

Query  840   GITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             GITVFGMAYMFVHDGLVHKRFPVGP+A+VPY R+VAAAHQLHH +KFNGVPYGLFLGP+
Sbjct  222   GITVFGMAYMFVHDGLVHKRFPVGPVANVPYLRKVAAAHQLHHMEKFNGVPYGLFLGPQ  280



>gb|AFI09272.1| beta-ring hydroxylase, partial [Gardenia jasminoides]
Length=197

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 180/193 (93%), Gaps = 9/193 (5%)
 Frame = +3

Query  465   SERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFw  644
             SER TYLVAAVMSS GITSMAVLAVYYRFAWQMEGGEVPY+EMFGTFALSVGAAVGMEFW
Sbjct  1     SERSTYLVAAVMSSFGITSMAVLAVYYRFAWQMEGGEVPYSEMFGTFALSVGAAVGMEFW  60

Query  645   arwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLC  824
             ARWAH+ALWHASLWHMHESHH+PREG FELNDVFAI NAVPAIALLSYGFFHKGLVPGLC
Sbjct  61    ARWAHKALWHASLWHMHESHHKPREGLFELNDVFAIINAVPAIALLSYGFFHKGLVPGLC  120

Query  825   FGA---------GLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDK  977
             FGA         GLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHH+DK
Sbjct  121   FGAIYIYDFHMQGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHSDK  180

Query  978   FNGVPYGLFLGPK  1016
             FNGVPYGLFLGPK
Sbjct  181   FNGVPYGLFLGPK  193



>gb|AEO62170.1| beta-carotene hydroxylase [Narcissus tazetta var. chinensis]
Length=303

 Score =   333 bits (855),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = +3

Query  423   ISASRLAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGT  602
             IS SR AE++ RKRSER TYL+AAVMSSLGITSMA+++VYYRFAWQ+E GE+P TEM GT
Sbjct  77    ISKSRTAERMERKRSERTTYLIAAVMSSLGITSMAIVSVYYRFAWQLEEGEIPVTEMLGT  136

Query  603   FALSVGAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALL  782
             FALSVGAAVGMEFWARWAHRALWHASLWHMHESHHRPR+GPFELNDVFA+ NAVPAI+LL
Sbjct  137   FALSVGAAVGMEFWARWAHRALWHASLWHMHESHHRPRDGPFELNDVFAVINAVPAISLL  196

Query  783   SYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQL  962
              YGFF++GLVPGLCFGAGLGIT FG+AYMFVHDGLVH+RFPVGPIADVPYFRRVAAAHQ+
Sbjct  197   YYGFFNRGLVPGLCFGAGLGITQFGIAYMFVHDGLVHRRFPVGPIADVPYFRRVAAAHQI  256

Query  963   HHTDKFNGVPYGLFLGP  1013
             HH++KF+GVPYGLFLGP
Sbjct  257   HHSEKFSGVPYGLFLGP  273



>ref|XP_010445052.1| PREDICTED: beta-carotene 3-hydroxylase 2, chloroplastic-like 
[Camelina sativa]
Length=302

 Score =   333 bits (854),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 197/229 (86%), Gaps = 1/229 (0%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
             LTVCFV+E+ K +S  ++    E   +  + ++ +RL +K  RK++ER TY +AAVMSS 
Sbjct  46    LTVCFVIEERK-QSFPMDEDKPESTTSSLEMLATTRLIKKAERKKTERMTYFIAAVMSSF  104

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMA++AVYYRF WQM+GGEVP +EMF TFAL+VGAAVGMEFWARWAHRALWH SLW+
Sbjct  105   GITSMAIIAVYYRFYWQMKGGEVPASEMFATFALAVGAAVGMEFWARWAHRALWHDSLWN  164

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHH+PREG FELNDVFAI NAVPAI LL YGFF+ GLVPGLCFGAGLGIT+FGMAYM
Sbjct  165   MHESHHKPREGAFELNDVFAIINAVPAIGLLYYGFFNNGLVPGLCFGAGLGITMFGMAYM  224

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIA+VPY R+VAAAHQLHHTDKF GVPYGLFLGPK
Sbjct  225   FVHDGLVHKRFPVGPIANVPYLRKVAAAHQLHHTDKFKGVPYGLFLGPK  273



>gb|KDP25394.1| hypothetical protein JCGZ_20550 [Jatropha curcas]
Length=310

 Score =   333 bits (854),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = +3

Query  432   SRLAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFAL  611
             SR+ EKLARK+SER+TYLVAA++SS+GITSMA +AVYYRF+WQMEGGE+P  EMFGTFAL
Sbjct  90    SRVEEKLARKKSERYTYLVAAILSSIGITSMAAMAVYYRFSWQMEGGEIPGLEMFGTFAL  149

Query  612   SVGAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYG  791
             SVGAAVGMEFWARWAHRALWHASLWHMHESHHR R+GPFE+NDVFAI NAVPAIALLS G
Sbjct  150   SVGAAVGMEFWARWAHRALWHASLWHMHESHHRARDGPFEVNDVFAIINAVPAIALLSCG  209

Query  792   FFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHT  971
             FF+KGL+PGLCFGAGLGIT+FGMAYMFVHDGLVH RFPVGPIA+VP+ RRVAAAHQLHH+
Sbjct  210   FFNKGLIPGLCFGAGLGITIFGMAYMFVHDGLVHCRFPVGPIANVPFLRRVAAAHQLHHS  269

Query  972   DKFNGVPYGLFLGPK  1016
             DKF+GVPYGLFLGPK
Sbjct  270   DKFDGVPYGLFLGPK  284



>ref|XP_004976574.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=311

 Score =   333 bits (854),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +3

Query  453   ARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVG  632
             ARK+SER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP TEMFGTFALSVGAAVG
Sbjct  102   ARKQSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVTEMFGTFALSVGAAVG  161

Query  633   MEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLV  812
             MEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAI+LLSYGFFH+G V
Sbjct  162   MEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAISLLSYGFFHRGFV  221

Query  813   PGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVP  992
             PGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF GVP
Sbjct  222   PGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEGVP  281

Query  993   YGLFLGPK  1016
             YGLFLGPK
Sbjct  282   YGLFLGPK  289



>ref|XP_009119803.1| PREDICTED: beta-carotene 3-hydroxylase 2, chloroplastic [Brassica 
rapa]
Length=303

 Score =   332 bits (852),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 194/229 (85%), Gaps = 15/229 (7%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSS  506
             ++T+CFV+ED+K     +              ++ SRL EK  RK+SERFTYL+AA+MSS
Sbjct  61    NITICFVIEDQKQSCPDI--------------LTTSRL-EKEERKKSERFTYLIAAMMSS  105

Query  507   LGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLW  686
              GITSMA+++VYYRF WQM+G EVP +EMFGTFA S+GA VGMEFWARWAH ALWHASLW
Sbjct  106   FGITSMAIMSVYYRFYWQMKGVEVPVSEMFGTFAFSIGAVVGMEFWARWAHEALWHASLW  165

Query  687   HMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAY  866
             +MHESHH+PREG FELNDVFAI NAVPAI LL YGFF+KGLVPGLCFGAGLGITVFGMAY
Sbjct  166   NMHESHHKPREGAFELNDVFAIINAVPAIGLLYYGFFNKGLVPGLCFGAGLGITVFGMAY  225

Query  867   MFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGP  1013
             MFVHDGLVHKRFPVGPIA+VPYFR+VAAAHQLHHTDKF GVPYGLFLGP
Sbjct  226   MFVHDGLVHKRFPVGPIANVPYFRKVAAAHQLHHTDKFKGVPYGLFLGP  274



>ref|XP_009411428.1| PREDICTED: beta-carotene 3-hydroxylase 2, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=322

 Score =   333 bits (853),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +3

Query  435   RLAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALS  614
             R+ E+ ARK+ ER TYL+AAVMSSLGITSMAV AVYYRF+WQMEGGE+P TEMFGTFALS
Sbjct  101   RMEERAARKQEERRTYLIAAVMSSLGITSMAVAAVYYRFSWQMEGGEIPLTEMFGTFALS  160

Query  615   VGAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGF  794
             VGAAVGMEFWARWAHRALWHASLWHMHESHHRPR+GPFELNDVFAI NAVPAI+L++YGF
Sbjct  161   VGAAVGMEFWARWAHRALWHASLWHMHESHHRPRDGPFELNDVFAIINAVPAISLMAYGF  220

Query  795   FHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTD  974
             F++GL+PGLCFGAGLGIT+FG+AYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAHQ+HH D
Sbjct  221   FNRGLLPGLCFGAGLGITLFGVAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHQIHHMD  280

Query  975   KFNGVPYGLFLGPK  1016
             KF GVPYGLFLGPK
Sbjct  281   KFEGVPYGLFLGPK  294



>ref|XP_011029344.1| PREDICTED: beta-carotene 3-hydroxylase 2, chloroplastic-like 
[Populus euphratica]
Length=350

 Score =   333 bits (855),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 196/229 (86%), Gaps = 2/229 (1%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSS  506
             +L  C V+E    +S  V+   +  +    K +S  R+ ++LA KRSER+TYLVAAV+SS
Sbjct  100   NLNSCSVVEKRAEDSIEVKDDDKVPDLDDVKAVS--RVEDRLATKRSERYTYLVAAVLSS  157

Query  507   LGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLW  686
             +GITSMA +AVYYRF WQMEGGEVP  E+FGTFALSVGA VGMEFWARWAHRALWHASLW
Sbjct  158   VGITSMAAMAVYYRFLWQMEGGEVPLLEIFGTFALSVGAVVGMEFWARWAHRALWHASLW  217

Query  687   HMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAY  866
             HMHESHHRPR GPFELNDVFA+ NAVPAIAL SYGFF+KGL+PGLCFGAGLGITVFGMAY
Sbjct  218   HMHESHHRPRNGPFELNDVFAVINAVPAIALFSYGFFNKGLLPGLCFGAGLGITVFGMAY  277

Query  867   MFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGP  1013
             MFVHDGLVH+RFPVGP+A+VPY RRVAAAHQLHH DKF+GVPYGLFLGP
Sbjct  278   MFVHDGLVHRRFPVGPVANVPYLRRVAAAHQLHHADKFDGVPYGLFLGP  326



>ref|XP_011035341.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Populus 
euphratica]
Length=309

 Score =   331 bits (849),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 182/234 (78%), Positives = 203/234 (87%), Gaps = 3/234 (1%)
 Frame = +3

Query  321   KPSLTVCFVLEDE-KLESGGVeiraeeieraieK-QISASRLAEKLARKRSERFTYLVAA  494
             K S  VCFV+ED+ K  S  +E + EE  + + K QI   R+AE+LARK+ ER TYL+AA
Sbjct  52    KTSFAVCFVVEDQTKPISAHLENQQEEEPKDVNKNQILTPRVAERLARKQRERDTYLIAA  111

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwh  674
             VMSSLGITS AVLAVYYRF W +EGG+  + EMFGTFALSVGAAVGMEFWARWAH+ LWH
Sbjct  112   VMSSLGITSTAVLAVYYRFYW-LEGGKASWPEMFGTFALSVGAAVGMEFWARWAHKELWH  170

Query  675   aSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVF  854
             ASLW+MHESHHRPR+GPFELNDVFAI NAVPAI+L +YGFF+KGLVPGLCFGAGLGITVF
Sbjct  171   ASLWNMHESHHRPRDGPFELNDVFAIINAVPAISLAAYGFFNKGLVPGLCFGAGLGITVF  230

Query  855   GMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             GMAYMFVHDGLVHKRFPVGPIADVPYF RVAAAHQ+HH+DKFNGVPYGLFLG K
Sbjct  231   GMAYMFVHDGLVHKRFPVGPIADVPYFTRVAAAHQIHHSDKFNGVPYGLFLGHK  284



>ref|XP_009384515.1| PREDICTED: beta-carotene 3-hydroxylase 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=320

 Score =   331 bits (849),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +3

Query  426   SASRLAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTF  605
             S  R AE+ ARKRSER  YL+AAV+SSLGITS AV AVYYRF+WQMEGGEVP TEMFGTF
Sbjct  94    SERRTAERTARKRSERRAYLIAAVLSSLGITSTAVAAVYYRFSWQMEGGEVPVTEMFGTF  153

Query  606   ALSVGAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLS  785
             ALSVGAAVGMEFWARWAHRALWHASLW+MHESHHRPR+GPFELNDVFAI NAVPAI+L++
Sbjct  154   ALSVGAAVGMEFWARWAHRALWHASLWNMHESHHRPRDGPFELNDVFAIINAVPAISLMA  213

Query  786   YGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLH  965
             YGF ++GL+PGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++H
Sbjct  214   YGFLNRGLLPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIH  273

Query  966   HTDKFNGVPYGLFLGPK  1016
             H DKF+GVPYGLFLGPK
Sbjct  274   HMDKFDGVPYGLFLGPK  290



>ref|XP_009382258.1| PREDICTED: beta-carotene 3-hydroxylase 2, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=306

 Score =   330 bits (847),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 176/235 (75%), Positives = 205/235 (87%), Gaps = 8/235 (3%)
 Frame = +3

Query  321   KPSLTVCFVLED---EKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVA  491
             +P+L V +VL++   E+  +GG   + +      E++ S     E++ARK+SER TYL+A
Sbjct  48    RPTL-VSYVLKEVGKEEAHNGGYASKEDAHGGEGEREASE----ERMARKQSERRTYLIA  102

Query  492   AVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralw  671
             AVMSS GITSMAV +VYYRF+WQMEGGEVP TEMFGTFALSVGAAVGMEFWARWAHRALW
Sbjct  103   AVMSSFGITSMAVASVYYRFSWQMEGGEVPLTEMFGTFALSVGAAVGMEFWARWAHRALW  162

Query  672   haSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITV  851
             HASLWHMHESHHRPR+GPFELNDVFAI NAVPAI+L++YGF ++GL+PGLCFGAGLGIT+
Sbjct  163   HASLWHMHESHHRPRDGPFELNDVFAIINAVPAISLMAYGFLNRGLLPGLCFGAGLGITL  222

Query  852   FGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAHQ+HH DKF+GVPYGLFLGPK
Sbjct  223   FGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHQIHHMDKFDGVPYGLFLGPK  277



>gb|ACX49435.1| beta-carotene hydroxylase 1 [Zea mays]
Length=251

 Score =   328 bits (840),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  444   EKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGA  623
             EK  RKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGA
Sbjct  10    EKETRKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGA  69

Query  624   AVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHK  803
             AVGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+
Sbjct  70    AVGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHR  129

Query  804   GLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFN  983
             G+VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF 
Sbjct  130   GIVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFG  189

Query  984   GVPYGLFLGPK  1016
             GVPYGLFLGPK
Sbjct  190   GVPYGLFLGPK  200



>ref|XP_011084459.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic isoform 
X2 [Sesamum indicum]
Length=283

 Score =   329 bits (843),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 197/285 (69%), Positives = 216/285 (76%), Gaps = 29/285 (10%)
 Frame = +3

Query  165   MAVGISIAASSRTVYSCQFS-LVRPATHSAsppsllfsplsrrfrssvlrsrrKPSLTVC  341
             MA GI IA  SRTV   + S L+ P   S    +     LS         SR+KP+LTVC
Sbjct  1     MAAGIYIATPSRTVVHFKHSPLLGPKPSS---LAAPALRLSHSLGKFPGISRKKPNLTVC  57

Query  342   FVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSLGITS  521
             FVLEDEKL   G     E  E +  K+I A+ +AEK+ARKRSERFTYL+AAVMSS GITS
Sbjct  58    FVLEDEKLRRLG----EESGEESSRKEI-ATAVAEKVARKRSERFTYLIAAVMSSFGITS  112

Query  522   MAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWHMHES  701
             M+V+AVYYRFAWQME                    VGMEFWARWAH+ALWHASLWHMHES
Sbjct  113   MSVMAVYYRFAWQME--------------------VGMEFWARWAHKALWHASLWHMHES  152

Query  702   HHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHD  881
             HH+PREGPFELNDVFAI NAVPAIALLSYGFFHKGLVPGLCFGAGLGIT+FGMAYMFVHD
Sbjct  153   HHKPREGPFELNDVFAIINAVPAIALLSYGFFHKGLVPGLCFGAGLGITMFGMAYMFVHD  212

Query  882   GLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             GLVH+RFPVGPIA+VPYFRRVAAAHQLHH+DKFNGVPYGLF GPK
Sbjct  213   GLVHRRFPVGPIANVPYFRRVAAAHQLHHSDKFNGVPYGLFFGPK  257



>dbj|BAJ97776.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=297

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             K+SER TYLVAAVMSSLG+TSMA+ +VYYRFAWQMEGGEVP TEM GTFALSVGAAVGME
Sbjct  88    KQSERRTYLVAAVMSSLGVTSMAIASVYYRFAWQMEGGEVPMTEMLGTFALSVGAAVGME  147

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWA+WAH+ALWHASLWHMHESHHRPR+GPFELNDVFAI NAVPAIALL+YGFFH+GLVPG
Sbjct  148   FWAQWAHKALWHASLWHMHESHHRPRDGPFELNDVFAIINAVPAIALLAYGFFHRGLVPG  207

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAAAH++HH DKF GVPYG
Sbjct  208   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAAAHKIHHMDKFEGVPYG  267

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  268   LFLGPK  273



>ref|XP_010482624.1| PREDICTED: beta-carotene 3-hydroxylase 2, chloroplastic-like 
[Camelina sativa]
Length=302

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 196/229 (86%), Gaps = 1/229 (0%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
             LTVCFV+ + K +S  ++    E   +  + ++ SRL +K  RK++ER TY +AAVMSS 
Sbjct  46    LTVCFVVGERK-QSFPMDEDKPESTTSSLEMLATSRLLKKAERKKTERMTYFIAAVMSSF  104

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITSMA++AVYYRF WQM+GGEVP +EMF TFAL+VGAAVGMEFWARWAHRALWH SLW+
Sbjct  105   GITSMAIIAVYYRFYWQMKGGEVPASEMFATFALAVGAAVGMEFWARWAHRALWHDSLWN  164

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHH+ REG FELNDVFAI NAVPAI LL YGFF+KGLVPGLCFGAGLGIT+FGMAYM
Sbjct  165   MHESHHKQREGAFELNDVFAIINAVPAIGLLYYGFFNKGLVPGLCFGAGLGITMFGMAYM  224

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             FVHDGLVHKRFPVGPIA+VPY R+VAAAHQLHHTDKF GVPYGLFLGPK
Sbjct  225   FVHDGLVHKRFPVGPIANVPYLRKVAAAHQLHHTDKFKGVPYGLFLGPK  273



>gb|AFD18925.1| carotenoid hydroxylase [Zea mays]
Length=310

 Score =   329 bits (843),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +3

Query  453   ARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVG  632
             ARKRSER TYLVAAVMSSLG+TSMAV A+YYRF+WQMEGG VP +EMFGTFALSVGAAVG
Sbjct  101   ARKRSERRTYLVAAVMSSLGVTSMAVAALYYRFSWQMEGGAVPVSEMFGTFALSVGAAVG  160

Query  633   MEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLV  812
             MEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAI+LL+YGFFH+GLV
Sbjct  161   MEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAVPAISLLAYGFFHRGLV  220

Query  813   PGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVP  992
             PGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF GVP
Sbjct  221   PGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEGVP  280

Query  993   YGLFLGPK  1016
             YGLFLGPK
Sbjct  281   YGLFLGPK  288



>ref|XP_010053223.1| PREDICTED: beta-carotene 3-hydroxylase 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW77486.1| hypothetical protein EUGRSUZ_D01823 [Eucalyptus grandis]
Length=302

 Score =   328 bits (842),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  417   KQISASRLAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMF  596
              ++   R+ EKLARKR ER TYLVAA+MSSLGI+SMA ++VYYRF+WQMEGGE P  EMF
Sbjct  75    NRVIIPRVTEKLARKRLERHTYLVAAIMSSLGISSMAAMSVYYRFSWQMEGGEFPTLEMF  134

Query  597   GTFALSVGAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIA  776
             GTFALSVGAAVGMEFWARWAHR LWHASLWHMHESHHRPR+GPFELNDVF I NA+PAIA
Sbjct  135   GTFALSVGAAVGMEFWARWAHRELWHASLWHMHESHHRPRDGPFELNDVFVIINAIPAIA  194

Query  777   LLSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAH  956
             LLSYGF ++GL+PGLCFGAGLGIT FGMAYMFVHDGLVH+RFPVGPIA+VPY R+VAAAH
Sbjct  195   LLSYGFLNRGLLPGLCFGAGLGITTFGMAYMFVHDGLVHRRFPVGPIANVPYLRKVAAAH  254

Query  957   QLHHTDKFNGVPYGLFLGPK  1016
             QLHH+DKF GVPYGLFLGPK
Sbjct  255   QLHHSDKFEGVPYGLFLGPK  274



>ref|XP_006476508.1| PREDICTED: beta-carotene 3-hydroxylase 2, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=291

 Score =   328 bits (841),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/233 (74%), Positives = 201/233 (86%), Gaps = 3/233 (1%)
 Frame = +3

Query  321   KP-SLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAV  497
             KP SL++CFV ED+   +  VE +     +   K  S +   E+ ARKRSER TYLVAA+
Sbjct  46    KPKSLSMCFVTEDKNEGTTKVEKKTFVQAQNEIKFFSPAE--ERQARKRSERQTYLVAAI  103

Query  498   MSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwha  677
             +SSLGI+SMAVLA+++RF+WQ EG E+   EMFGTFALSVGAAVGMEFWARWAHRALWHA
Sbjct  104   VSSLGISSMAVLAIHHRFSWQTEGCELQLLEMFGTFALSVGAAVGMEFWARWAHRALWHA  163

Query  678   SLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFG  857
             SLWHMH+SHH+PR+GPFELND+FA+ NAVPAIALLSYGFFHKG+VPGLCFGAGLGITVFG
Sbjct  164   SLWHMHKSHHKPRDGPFELNDIFAVINAVPAIALLSYGFFHKGIVPGLCFGAGLGITVFG  223

Query  858   MAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             MAYMFVHDGLVH+RFPVGPIA VPY R+VAAAHQLHH++KFNG+PYGLFLGP+
Sbjct  224   MAYMFVHDGLVHRRFPVGPIAHVPYLRKVAAAHQLHHSEKFNGLPYGLFLGPQ  276



>gb|ACX49503.1| beta-carotene hydroxylase 1 [Zea mays]
Length=314

 Score =   329 bits (843),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  74    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  133

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  134   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  193

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             LVPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  194   LVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  253

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  254   VPYGLFLGPK  263



>gb|ACX49335.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49336.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49338.1| beta-carotene hydroxylase 1 [Zea mays]
Length=319

 Score =   329 bits (843),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  79    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  138

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  139   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  198

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             LVPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  199   LVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  258

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  259   VPYGLFLGPK  268



>ref|XP_003580372.1| PREDICTED: beta-carotene 3-hydroxylase, chloroplastic [Brachypodium 
distachyon]
Length=313

 Score =   328 bits (842),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  444   EKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGA  623
             E+ ARK SER TYLVAAV+SSLG+TSMA+ +VYYRFAWQMEGGEVP TEM GTFALSVGA
Sbjct  99    ERKARKHSERRTYLVAAVLSSLGVTSMAIASVYYRFAWQMEGGEVPMTEMLGTFALSVGA  158

Query  624   AVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHK  803
             AVGMEFWA+WAHRALWHASLWHMHESHHRPR+GPFELNDVFAI NAVPAI LL+YGFFH+
Sbjct  159   AVGMEFWAQWAHRALWHASLWHMHESHHRPRDGPFELNDVFAIINAVPAICLLAYGFFHR  218

Query  804   GLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFN  983
             GL+PGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF 
Sbjct  219   GLIPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFE  278

Query  984   GVPYGLFLGPK  1016
             GVPYGLFLGPK
Sbjct  279   GVPYGLFLGPK  289



>gb|ACX49330.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49334.1| beta-carotene hydroxylase 1 [Zea mays]
Length=314

 Score =   328 bits (842),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  74    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  133

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  134   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  193

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             LVPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  194   LVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  253

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  254   VPYGLFLGPK  263



>gb|AFW59124.1| beta-carotene hydroxylase 1 [Zea mays]
Length=290

 Score =   328 bits (840),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  79    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  138

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  139   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  198

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  199   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  258

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  259   VPYGLFLGPK  268



>gb|ACX49514.1| beta-carotene hydroxylase 1 [Zea mays]
Length=309

 Score =   328 bits (841),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  444   EKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGA  623
             EK  RKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGA
Sbjct  78    EKETRKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGA  137

Query  624   AVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHK  803
             AVGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+
Sbjct  138   AVGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHR  197

Query  804   GLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFN  983
             G+VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+ HH DKF 
Sbjct  198   GIVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXHHMDKFG  257

Query  984   GVPYGLFLGPK  1016
             GVPYGLFLGPK
Sbjct  258   GVPYGLFLGPK  268



>gb|ACX49476.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49479.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49480.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49481.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49484.1| beta-carotene hydroxylase 1 [Zea mays]
Length=299

 Score =   328 bits (840),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  85    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  144

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  145   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  204

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  205   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  264

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  265   VPYGLFLGPK  274



>gb|ACX49433.1| beta-carotene hydroxylase 1 [Zea mays]
Length=319

 Score =   328 bits (842),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  79    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  138

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  139   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  198

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  199   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  258

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  259   VPYGLFLGPK  268



>gb|ACX49441.1| beta-carotene hydroxylase 1 [Zea mays]
Length=314

 Score =   328 bits (841),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  74    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  133

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  134   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  193

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  194   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  253

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  254   VPYGLFLGPK  263



>gb|ACX49457.1| beta-carotene hydroxylase 1 [Zea mays]
Length=301

 Score =   328 bits (840),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  74    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  133

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  134   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  193

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  194   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  253

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  254   VPYGLFLGPK  263



>gb|ACX49517.1| beta-carotene hydroxylase 1 [Zea mays]
Length=325

 Score =   328 bits (842),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  85    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  144

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHR+LWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  145   VGMEFWARWAHRSLWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  204

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  205   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  264

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  265   VPYGLFLGPK  274



>ref|NP_001105907.1| beta-carotene hydroxylase [Zea mays]
 ref|XP_008662348.1| PREDICTED: beta-carotene hydroxylase isoform X1 [Zea mays]
 gb|AAX45524.1| beta-carotene hydroxylase [Zea mays]
 gb|AAX45525.1| beta-carotene hydroxylase [Zea mays]
 gb|ACX49395.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49432.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49442.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49460.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49461.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49462.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49465.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49467.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49468.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49469.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49471.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49472.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49473.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49482.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49483.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|AFP28220.1| beta-carotene hydroxylase [synthetic construct]
 gb|AFW59122.1| beta-carotene hydroxylase 1 isoform 1 [Zea mays]
 gb|AFW59123.1| beta-carotene hydroxylase 1 isoform 2 [Zea mays]
Length=319

 Score =   328 bits (841),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  79    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  138

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  139   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  198

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  199   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  258

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  259   VPYGLFLGPK  268



>gb|ACX49516.1| beta-carotene hydroxylase 1 [Zea mays]
Length=266

 Score =   326 bits (836),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  36    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  95

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  96    VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  155

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+ HH DKF G
Sbjct  156   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXHHMDKFGG  215

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  216   VPYGLFLGPK  225



>gb|ACX49261.1| beta-carotene hydroxylase 1 [Zea mays]
Length=325

 Score =   328 bits (841),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  85    KKARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  144

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  145   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  204

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  205   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  264

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  265   VPYGLFLGPK  274



>gb|ACX49315.1| beta-carotene hydroxylase 1 [Zea mays]
Length=324

 Score =   328 bits (841),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  84    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  143

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  144   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  203

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  204   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  263

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  264   VPYGLFLGPK  273



>gb|ACX49299.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49303.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49304.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49306.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49310.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49312.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49314.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49320.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49416.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49417.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49426.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49429.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49452.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49500.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49506.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49515.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49521.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49525.1| beta-carotene hydroxylase 1 [Zea mays]
Length=314

 Score =   328 bits (840),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  74    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  133

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  134   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  193

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  194   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  253

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  254   VPYGLFLGPK  263



>gb|ACX49278.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49297.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49301.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49317.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49431.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49438.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49447.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49448.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49449.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49520.1| beta-carotene hydroxylase 1 [Zea mays]
Length=325

 Score =   328 bits (841),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  85    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  144

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  145   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  204

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  205   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  264

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  265   VPYGLFLGPK  274



>gb|ACX49370.1| beta-carotene hydroxylase 1 [Zea mays]
Length=314

 Score =   327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  74    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  133

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  134   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  193

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  194   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  253

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  254   VPYGLFLGPK  263



>gb|ACX49459.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49463.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49466.1| beta-carotene hydroxylase 1 [Zea mays]
Length=321

 Score =   328 bits (840),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  81    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  140

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  141   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  200

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  201   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  260

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  261   VPYGLFLGPK  270



>gb|ACX49419.1| beta-carotene hydroxylase 1 [Zea mays]
Length=306

 Score =   327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  66    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  125

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  126   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  185

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  186   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  245

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  246   VPYGLFLGPK  255



>gb|ACX49436.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49464.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49470.1| beta-carotene hydroxylase 1 [Zea mays]
Length=309

 Score =   327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  79    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  138

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  139   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  198

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+ HH DKF G
Sbjct  199   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXHHMDKFGG  258

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  259   VPYGLFLGPK  268



>gb|ACX49451.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49453.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49454.1| beta-carotene hydroxylase 1 [Zea mays]
Length=327

 Score =   328 bits (840),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  87    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  146

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  147   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  206

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  207   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  266

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  267   VPYGLFLGPK  276



>ref|XP_002305933.2| hypothetical protein POPTR_0004s07230g [Populus trichocarpa]
 gb|EEE86444.2| hypothetical protein POPTR_0004s07230g [Populus trichocarpa]
Length=309

 Score =   327 bits (838),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 180/234 (77%), Positives = 203/234 (87%), Gaps = 3/234 (1%)
 Frame = +3

Query  321   KPSLTVCFVLE-DEKLESGGVeiraeeieraieK-QISASRLAEKLARKRSERFTYLVAA  494
             K S  VCFV+E   K  S  +E + EE  + + K QI   R+AE+LARK+ ER TYL+AA
Sbjct  52    KTSFAVCFVVEYQTKPISAHLENQQEEEPKDVNKNQILTPRVAERLARKQRERDTYLIAA  111

Query  495   VMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwh  674
             VMSSLGITS AVLAVYYRF W +EGG+V + EMFGTFALSVGAAVGMEFWARWAH+ LWH
Sbjct  112   VMSSLGITSTAVLAVYYRFYW-LEGGKVSWPEMFGTFALSVGAAVGMEFWARWAHKELWH  170

Query  675   aSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVF  854
             ASLW+MHESHHRPR+GPFELNDVFAI NAVPAI+L++YGFF++GLVPGLCFGAGLGITVF
Sbjct  171   ASLWNMHESHHRPRDGPFELNDVFAIINAVPAISLVAYGFFNEGLVPGLCFGAGLGITVF  230

Query  855   GMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             GMAYMFVHDGLVHKRFPVGPIADVPYF RVAAAHQ+HH++KFNGVPYGLFLG K
Sbjct  231   GMAYMFVHDGLVHKRFPVGPIADVPYFTRVAAAHQIHHSEKFNGVPYGLFLGHK  284



>gb|ACX49526.1| beta-carotene hydroxylase 1 [Zea mays]
Length=307

 Score =   327 bits (838),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  67    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  126

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  127   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  186

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  187   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  246

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  247   VPYGLFLGPK  256



>gb|ACX49437.1| beta-carotene hydroxylase 1 [Zea mays]
Length=283

 Score =   326 bits (835),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  53    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  112

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  113   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  172

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+ HH DKF G
Sbjct  173   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXHHMDKFGG  232

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  233   VPYGLFLGPK  242



>gb|ACX49421.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49424.1| beta-carotene hydroxylase 1 [Zea mays]
Length=304

 Score =   327 bits (837),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  74    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  133

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  134   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  193

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+ HH DKF G
Sbjct  194   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXHHMDKFGG  253

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  254   VPYGLFLGPK  263



>ref|XP_008668663.1| PREDICTED: beta-carotene hydroxylase isoform X1 [Zea mays]
 gb|ADC96676.1| beta-carotene hydroxylase [Zea mays]
 gb|AFD18928.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18941.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18942.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18943.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18944.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18945.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18946.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18947.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18948.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18949.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18950.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18951.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18952.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18953.1| carotenoid hydroxylase [Zea mays]
 gb|AFG29853.1| carotenoid hydroxylase [Zea mays]
 tpg|DAA36356.1| TPA: beta-carotene hydroxylase [Zea mays]
Length=309

 Score =   327 bits (838),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             KRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGG VP +EMFGTFALSVGAAVGME
Sbjct  102   KRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGAVPVSEMFGTFALSVGAAVGME  161

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAI+LL+YGFFH+GLVPG
Sbjct  162   FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAVPAISLLAYGFFHRGLVPG  221

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF GVPYG
Sbjct  222   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEGVPYG  281

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  282   LFLGPK  287



>gb|AFD18938.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18956.1| carotenoid hydroxylase [Zea mays]
 gb|AFD19005.1| carotenoid hydroxylase [Zea mays]
 gb|AFD19006.1| carotenoid hydroxylase [Zea mays]
 gb|AFD19007.1| carotenoid hydroxylase [Zea mays]
Length=307

 Score =   327 bits (837),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             KRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGG VP +EMFGTFALSVGAAVGME
Sbjct  100   KRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGAVPVSEMFGTFALSVGAAVGME  159

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAI+LL+YGFFH+GLVPG
Sbjct  160   FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAVPAISLLAYGFFHRGLVPG  219

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF GVPYG
Sbjct  220   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEGVPYG  279

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  280   LFLGPK  285



>ref|NP_001105865.1| beta-carotene hydroxylase [Zea mays]
 gb|AAX45523.1| beta-carotene hydroxylase [Zea mays]
 gb|AFD18896.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18897.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18939.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18940.1| carotenoid hydroxylase [Zea mays]
Length=308

 Score =   327 bits (837),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             KRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGG VP +EMFGTFALSVGAAVGME
Sbjct  101   KRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGAVPVSEMFGTFALSVGAAVGME  160

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAI+LL+YGFFH+GLVPG
Sbjct  161   FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAVPAISLLAYGFFHRGLVPG  220

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF GVPYG
Sbjct  221   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEGVPYG  280

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  281   LFLGPK  286



>gb|ACX49418.1| beta-carotene hydroxylase 1 [Zea mays]
Length=306

 Score =   327 bits (837),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  66    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  125

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  126   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  185

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  186   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  245

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  246   VPYGLFLGPK  255



>gb|AFD18929.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18930.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18931.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18932.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18933.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18934.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18935.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18936.1| carotenoid hydroxylase [Zea mays]
Length=312

 Score =   327 bits (837),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             KRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGG VP +EMFGTFALSVGAAVGME
Sbjct  105   KRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGAVPVSEMFGTFALSVGAAVGME  164

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAI+LL+YGFFH+GLVPG
Sbjct  165   FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAVPAISLLAYGFFHRGLVPG  224

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF GVPYG
Sbjct  225   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEGVPYG  284

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  285   LFLGPK  290



>gb|AFD18922.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18923.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18924.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18926.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18937.1| carotenoid hydroxylase [Zea mays]
Length=310

 Score =   327 bits (837),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             KRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGG VP +EMFGTFALSVGAAVGME
Sbjct  103   KRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGAVPVSEMFGTFALSVGAAVGME  162

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAI+LL+YGFFH+GLVPG
Sbjct  163   FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAVPAISLLAYGFFHRGLVPG  222

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF GVPYG
Sbjct  223   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEGVPYG  282

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  283   LFLGPK  288



>gb|ACX49363.1| beta-carotene hydroxylase 1 [Zea mays]
Length=300

 Score =   326 bits (836),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAV+SSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  89    KEARKRSERRTYLVAAVLSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  148

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  149   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  208

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             LVPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+ HH DKF G
Sbjct  209   LVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXHHMDKFGG  268

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  269   VPYGLFLGPK  278



>gb|ACX49361.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49493.1| beta-carotene hydroxylase 1 [Zea mays]
Length=319

 Score =   327 bits (837),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAV+SSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  89    KEARKRSERRTYLVAAVLSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  148

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  149   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  208

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             LVPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+ HH DKF G
Sbjct  209   LVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXHHMDKFGG  268

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  269   VPYGLFLGPK  278



>gb|ACX49270.1| beta-carotene hydroxylase 1 [Zea mays]
Length=287

 Score =   325 bits (833),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  73    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  132

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  133   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  192

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRR AA+H++HH DKF G
Sbjct  193   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRREAASHKIHHMDKFGG  252

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  253   VPYGLFLGPK  262



>gb|AFX79618.1| beta-carotene hydroxylase A1 [Triticum aestivum]
 gb|AFX79620.1| beta-carotene hydroxylase D1 [Triticum aestivum]
Length=303

 Score =   326 bits (835),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             K+SER TYLVAAVMSSLG+TSMA+ +VYYRFAWQMEGGEVP TEM GTFALSVGAAVGME
Sbjct  94    KQSERRTYLVAAVMSSLGVTSMAIASVYYRFAWQMEGGEVPMTEMLGTFALSVGAAVGME  153

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWA+WAH+ALWHASLWHMHESHHRPR+GPFELNDVFAI NA PAIALL+YGFFH+GL+PG
Sbjct  154   FWAQWAHKALWHASLWHMHESHHRPRDGPFELNDVFAIINAGPAIALLAYGFFHRGLIPG  213

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAAAH++HH DKF GVPYG
Sbjct  214   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAAAHKIHHMDKFEGVPYG  273

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  274   LFLGPK  279



>gb|ACX49360.1| beta-carotene hydroxylase 1 [Zea mays]
Length=319

 Score =   326 bits (836),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAV+SSLG+TSMAV AVYYRF WQMEGGEVP  E  GTFALSVGAA
Sbjct  89    KEARKRSERRTYLVAAVLSSLGVTSMAVAAVYYRFXWQMEGGEVPVIETLGTFALSVGAA  148

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  149   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  208

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             LVPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+ HH DKF G
Sbjct  209   LVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXHHMDKFGG  268

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  269   VPYGLFLGPK  278



>gb|KDO56783.1| hypothetical protein CISIN_1g020892mg [Citrus sinensis]
Length=291

 Score =   325 bits (833),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 194/231 (84%), Gaps = 22/231 (10%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGGVeiraeeieraieKQIS-ASRLAEKLARKRSERFTYLVAAVMS  503
             S TVCFVLE++K +S  +E   EE E     QIS A+R+AEKLARKRSERFTYLVAAVMS
Sbjct  55    SFTVCFVLEEKK-QSTQIETFTEEEEEESGTQISTAARVAEKLARKRSERFTYLVAAVMS  113

Query  504   SLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSL  683
             S GITSMAV+AVYYRF WQME                    VGMEFWARWAH+ALWHASL
Sbjct  114   SFGITSMAVMAVYYRFWWQME--------------------VGMEFWARWAHKALWHASL  153

Query  684   WHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMA  863
             WHMHESHHRPREGPFELNDVFAI NAVPAIALLS+GFFHKGLVPGLCFGAGLGITVFGMA
Sbjct  154   WHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMA  213

Query  864   YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHH+DKF+GVPYGLFLGPK
Sbjct  214   YMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHSDKFHGVPYGLFLGPK  264



>ref|XP_003592204.1| Beta-carotene hydroxylase [Medicago truncatula]
 gb|AES62455.1| beta-carotene hydroxylase [Medicago truncatula]
Length=320

 Score =   326 bits (836),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 178/254 (70%), Positives = 196/254 (77%), Gaps = 39/254 (15%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
              TVC + ED K  S              + +     +A+KLARK+S+RFTYLVAAVMSS 
Sbjct  56    FTVCVLTEDPKHTS--------------QLKTEEEIVAQKLARKKSQRFTYLVAAVMSSF  101

Query  510   GITSMAVLAVYYRFAWQMEG-GEVPYTEMFGTFALSVGAAV-------------------  629
             G+TSMA+LAVYYRF+WQMEG GEVP++EMFGTFALSVGAAV                   
Sbjct  102   GVTSMAILAVYYRFSWQMEGSGEVPWSEMFGTFALSVGAAVSLVTISQLGNFGDKIQLGM  161

Query  630   -----GMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGF  794
                  GMEFWARWAH  LWHASLWHMH+SHHRPREG FELNDVFAI NAVPAIALLSYGF
Sbjct  162   IHFQVGMEFWARWAHEILWHASLWHMHQSHHRPREGAFELNDVFAIINAVPAIALLSYGF  221

Query  795   FHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTD  974
             F+KGL+PGLCFGAGLGITVFG+AYMFVHDGLVHKRFPVGPIA+VPYF RVAAAHQLHH+D
Sbjct  222   FNKGLLPGLCFGAGLGITVFGIAYMFVHDGLVHKRFPVGPIANVPYFTRVAAAHQLHHSD  281

Query  975   KFNGVPYGLFLGPK  1016
             KF GVPYGLFLGPK
Sbjct  282   KFKGVPYGLFLGPK  295



>ref|XP_002509848.1| Beta-carotene hydroxylase, putative [Ricinus communis]
 gb|EEF51235.1| Beta-carotene hydroxylase, putative [Ricinus communis]
Length=300

 Score =   325 bits (834),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 193/228 (85%), Gaps = 2/228 (1%)
 Frame = +3

Query  330   LTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSSL  509
             L++C V++ +  E   V  + E       KQ   SR+  KLARK+ ERFTYLVAA++SS 
Sbjct  50    LSICLVMDKKAEEFLDVMDKHENDVNK--KQPLNSRVERKLARKKLERFTYLVAAILSST  107

Query  510   GITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWH  689
             GITS+A ++VYYRF+WQMEGGE P  EMFGTFALSVGAAVGMEFWARWAHRALWHASLW 
Sbjct  108   GITSIAAMSVYYRFSWQMEGGEFPALEMFGTFALSVGAAVGMEFWARWAHRALWHASLWK  167

Query  690   MHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYM  869
             MHESHH+ REGPFELNDVFAI NAVPAIALLSYGF +KGL+PGLCFGAGLGITVFGMAYM
Sbjct  168   MHESHHKSREGPFELNDVFAIINAVPAIALLSYGFNNKGLLPGLCFGAGLGITVFGMAYM  227

Query  870   FVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGP  1013
             FVHDGLVH+RF VGPIA+VPY RRVAAAHQLHH+DKF GVPYGLFLGP
Sbjct  228   FVHDGLVHRRFSVGPIANVPYLRRVAAAHQLHHSDKFGGVPYGLFLGP  275



>gb|ACX49510.1| beta-carotene hydroxylase 1 [Zea mays]
Length=321

 Score =   326 bits (836),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRS R TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  85    KEARKRSXRRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  144

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  145   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  204

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  205   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  264

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  265   VPYGLFLGPK  274



>gb|ACX49494.1| beta-carotene hydroxylase 1 [Zea mays]
Length=319

 Score =   326 bits (835),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  79    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  138

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  139   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  198

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRR AA+H++HH DKF G
Sbjct  199   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRREAASHKIHHMDKFGG  258

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  259   VPYGLFLGPK  268



>ref|XP_002446979.1| hypothetical protein SORBIDRAFT_06g026190 [Sorghum bicolor]
 gb|EES11307.1| hypothetical protein SORBIDRAFT_06g026190 [Sorghum bicolor]
Length=312

 Score =   326 bits (835),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAA+MSSLG TSMAV AVY RF+WQMEGGEVP +EM GTFALSVGAA
Sbjct  101   KKARKRSERRTYLVAAMMSSLGFTSMAVAAVYSRFSWQMEGGEVPVSEMLGTFALSVGAA  160

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAI LL+YGFFH+G
Sbjct  161   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAICLLAYGFFHRG  220

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             LVPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF G
Sbjct  221   LVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEG  280

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  281   VPYGLFLGPK  290



>gb|ACX49478.1| beta-carotene hydroxylase 1 [Zea mays]
Length=299

 Score =   325 bits (833),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  456   RKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGM  635
             RKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAAVGM
Sbjct  88    RKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAAVGM  147

Query  636   EFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVP  815
             EFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G+VP
Sbjct  148   EFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRGIVP  207

Query  816   GLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPY  995
             GLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF GVPY
Sbjct  208   GLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGGVPY  267

Query  996   GLFLGPK  1016
             GLFLGPK
Sbjct  268   GLFLGPK  274



>gb|ACX49528.1| beta-carotene hydroxylase 1 [Zea mays]
Length=325

 Score =   326 bits (836),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  85    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  144

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  145   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  204

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRR AA+H++HH DKF G
Sbjct  205   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRREAASHKIHHMDKFGG  264

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  265   VPYGLFLGPK  274



>emb|CDY50294.1| BnaA10g28380D [Brassica napus]
Length=311

 Score =   325 bits (834),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 191/227 (84%), Gaps = 15/227 (7%)
 Frame = +3

Query  327   SLTVCFVLEDEKLESGGVeiraeeieraieKQISASRLAEKLARKRSERFTYLVAAVMSS  506
             ++T+CFV+ED+K     +              ++ SRL EK  RK+SERFTYL+AA+MSS
Sbjct  61    NITICFVIEDQKQSCPDI--------------LTTSRL-EKEERKKSERFTYLIAAMMSS  105

Query  507   LGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLW  686
              GITSMA+++VYYRF WQM+G EVP +EMFGTFA S+GA VGMEFWARWAH ALWHASLW
Sbjct  106   FGITSMAIMSVYYRFYWQMKGVEVPVSEMFGTFAFSIGAVVGMEFWARWAHEALWHASLW  165

Query  687   HMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAY  866
             +MHESHH+PREG FELNDVFAI NAVPAI LL YGFF+KGLVPGLCFGAGLGITVFGMAY
Sbjct  166   NMHESHHKPREGAFELNDVFAIINAVPAIGLLYYGFFNKGLVPGLCFGAGLGITVFGMAY  225

Query  867   MFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFL  1007
             MFVHDGLVHKRFPVGPIA+VPYFR+VAAAHQLHHTDKF GVPYGL +
Sbjct  226   MFVHDGLVHKRFPVGPIANVPYFRKVAAAHQLHHTDKFKGVPYGLLI  272



>gb|ACX49353.1| beta-carotene hydroxylase 1 [Zea mays]
Length=319

 Score =   326 bits (835),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAV+SSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  89    KEARKRSERRTYLVAAVLSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  148

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  149   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  208

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+ HH DKF G
Sbjct  209   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXHHMDKFGG  268

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  269   VPYGLFLGPK  278



>gb|AFD18957.1| carotenoid hydroxylase [Zea mays]
Length=308

 Score =   325 bits (833),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             KRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGG VP +EMFGTFALSVGAAVGME
Sbjct  101   KRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGAVPVSEMFGTFALSVGAAVGME  160

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAI+LL+YGFFH+GLVPG
Sbjct  161   FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAVPAISLLAYGFFHRGLVPG  220

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRV AAH++HH DKF GVPYG
Sbjct  221   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVGAAHKIHHMDKFEGVPYG  280

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  281   LFLGPK  286



>gb|ACX49430.1| beta-carotene hydroxylase 1 [Zea mays]
Length=325

 Score =   326 bits (835),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQ EGGEVP  E  GTFALSVGAA
Sbjct  85    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQXEGGEVPVIETLGTFALSVGAA  144

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  145   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  204

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  205   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  264

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  265   VPYGLFLGPK  274



>gb|ACX49440.1| beta-carotene hydroxylase 1 [Zea mays]
Length=314

 Score =   325 bits (834),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER  YLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  74    KEARKRSERRXYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  133

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  134   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  193

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  194   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  253

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  254   VPYGLFLGPK  263



>gb|ACX49268.1| beta-carotene hydroxylase 1 [Zea mays]
Length=322

 Score =   325 bits (834),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  82    KKARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  141

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  142   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  201

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRR AA+H++HH DKF G
Sbjct  202   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRREAASHKIHHMDKFGG  261

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  262   VPYGLFLGPK  271



>gb|AFD18961.1| carotenoid hydroxylase [Zea mays]
Length=308

 Score =   325 bits (833),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             KRSER TYLVAAVMSSLG+TSMAV AVYYR +WQMEGG VP +EMFGTFALSVGAAVGME
Sbjct  101   KRSERRTYLVAAVMSSLGVTSMAVAAVYYRISWQMEGGAVPVSEMFGTFALSVGAAVGME  160

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAI+LL+YGFFH+GLVPG
Sbjct  161   FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAVPAISLLAYGFFHRGLVPG  220

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF GVPYG
Sbjct  221   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEGVPYG  280

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  281   LFLGPK  286



>gb|AFD18905.1| carotenoid hydroxylase [Zea mays]
Length=308

 Score =   325 bits (832),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             KRSER TYLVAAVMSSLG+TSMAV AVYYR +WQMEGG VP +EMFGTFALSVGAAVGME
Sbjct  101   KRSERRTYLVAAVMSSLGVTSMAVAAVYYRISWQMEGGAVPVSEMFGTFALSVGAAVGME  160

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAI+LL+YGFFH+GLVPG
Sbjct  161   FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAVPAISLLAYGFFHRGLVPG  220

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF GVPYG
Sbjct  221   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEGVPYG  280

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  281   LFLGPK  286



>gb|AFD18960.1| carotenoid hydroxylase [Zea mays]
Length=308

 Score =   325 bits (832),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             KRSER TYLVAAVMSSLG+TSMAV AVYYR +WQMEGG VP +EMFGTFALSVGAAVGME
Sbjct  101   KRSERRTYLVAAVMSSLGVTSMAVAAVYYRISWQMEGGAVPVSEMFGTFALSVGAAVGME  160

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAI+LL+YGFFH+GLVPG
Sbjct  161   FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAVPAISLLAYGFFHRGLVPG  220

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF GVPYG
Sbjct  221   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEGVPYG  280

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  281   LFLGPK  286



>gb|AFD18958.1| carotenoid hydroxylase [Zea mays]
 gb|AFD19004.1| carotenoid hydroxylase [Zea mays]
Length=307

 Score =   325 bits (832),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             KRSER TYLVAAVMSSLG+TSMAV AVYYR +WQMEGG VP +EMFGTFALSVGAAVGME
Sbjct  100   KRSERRTYLVAAVMSSLGVTSMAVAAVYYRISWQMEGGAVPVSEMFGTFALSVGAAVGME  159

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAI+LL+YGFFH+GLVPG
Sbjct  160   FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAVPAISLLAYGFFHRGLVPG  219

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF GVPYG
Sbjct  220   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEGVPYG  279

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  280   LFLGPK  285



>gb|AFD18898.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18899.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18900.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18901.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18902.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18903.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18907.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18908.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18909.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18910.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18911.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18912.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18913.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18914.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18915.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18916.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18917.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18918.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18919.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18920.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18921.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18954.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18955.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18959.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18962.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18963.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18964.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18965.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18966.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18967.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18968.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18969.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18970.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18971.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18972.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18973.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18974.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18975.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18976.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18977.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18978.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18979.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18980.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18981.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18982.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18983.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18984.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18985.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18986.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18987.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18988.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18989.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18990.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18991.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18992.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18993.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18994.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18995.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18996.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18997.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18998.1| carotenoid hydroxylase [Zea mays]
 gb|AFD18999.1| carotenoid hydroxylase [Zea mays]
 gb|AFD19000.1| carotenoid hydroxylase [Zea mays]
 gb|AFD19001.1| carotenoid hydroxylase [Zea mays]
 gb|AFD19002.1| carotenoid hydroxylase [Zea mays]
 gb|AFD19003.1| carotenoid hydroxylase [Zea mays]
Length=308

 Score =   325 bits (832),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             KRSER TYLVAAVMSSLG+TSMAV AVYYR +WQMEGG VP +EMFGTFALSVGAAVGME
Sbjct  101   KRSERRTYLVAAVMSSLGVTSMAVAAVYYRISWQMEGGAVPVSEMFGTFALSVGAAVGME  160

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAI+LL+YGFFH+GLVPG
Sbjct  161   FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAVPAISLLAYGFFHRGLVPG  220

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF GVPYG
Sbjct  221   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEGVPYG  280

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  281   LFLGPK  286



>gb|AFD18904.1| carotenoid hydroxylase [Zea mays]
Length=304

 Score =   324 bits (831),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             KRSER TYLVAAVMSSLG+TSMAV AVYYR +WQMEGG VP +EMFGTFALSVGAAVGME
Sbjct  97    KRSERRTYLVAAVMSSLGVTSMAVAAVYYRISWQMEGGAVPVSEMFGTFALSVGAAVGME  156

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAI+LL+YGFFH+GLVPG
Sbjct  157   FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAVPAISLLAYGFFHRGLVPG  216

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF GVPYG
Sbjct  217   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEGVPYG  276

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  277   LFLGPK  282



>gb|ACG44701.1| beta-carotene hydroxylase [Zea mays]
Length=314

 Score =   325 bits (832),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  74    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  133

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  134   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  193

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYF RVAA+H++HH DKF G
Sbjct  194   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFLRVAASHKIHHMDKFGG  253

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  254   VPYGLFLGPK  263



>gb|AFD18906.1| carotenoid hydroxylase [Zea mays]
Length=308

 Score =   324 bits (831),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             KRSER TYLVAAVMSSLG+TSMAV AVYYR  WQMEGG VP +EMFGTFALSVGAAVGME
Sbjct  101   KRSERRTYLVAAVMSSLGVTSMAVAAVYYRITWQMEGGAVPVSEMFGTFALSVGAAVGME  160

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAI+LL+YGFFH+GLVPG
Sbjct  161   FWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAVPAISLLAYGFFHRGLVPG  220

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF GVPYG
Sbjct  221   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEGVPYG  280

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  281   LFLGPK  286



>dbj|BAD07291.1| beta-ring hydroxylase [Citrus limon]
Length=176

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +3

Query  483   LVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahr  662
             LVAAVMSS GITSMAV+AVYYRF WQMEGGEVP TEMFGTFALSVGAAVGMEFWARWAH+
Sbjct  1     LVAAVMSSFGITSMAVMAVYYRFWWQMEGGEVPLTEMFGTFALSVGAAVGMEFWARWAHK  60

Query  663   alwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLG  842
             ALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAIALLS+GFFHKGLVPGLCFGAGLG
Sbjct  61    ALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLG  120

Query  843   ITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLG  1010
             ITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHH+DKF+GVPYGLFLG
Sbjct  121   ITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHSDKFHGVPYGLFLG  176



>gb|ABF93742.1| beta-carotene hydroxylase, putative, expressed [Oryza sativa 
Japonica Group]
Length=285

 Score =   323 bits (827),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 179/187 (96%), Gaps = 1/187 (1%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEG-GEVPYTEMFGTFALSVGAAVGM  635
             K+SER TYLVAAVMSSLGITSMA  AVYYRFAWQMEG GE+P TEMFGTFALSVGAAVGM
Sbjct  70    KQSERRTYLVAAVMSSLGITSMAAAAVYYRFAWQMEGSGEIPVTEMFGTFALSVGAAVGM  129

Query  636   EFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVP  815
             EFWARWAHRALWHASLWHMHESHHRPR+GPFELNDVFAITNAVPA++LL+YGFF +GLVP
Sbjct  130   EFWARWAHRALWHASLWHMHESHHRPRDGPFELNDVFAITNAVPAMSLLAYGFFTRGLVP  189

Query  816   GLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPY  995
             GLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAHQ+HH DKF GVPY
Sbjct  190   GLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHQIHHMDKFEGVPY  249

Query  996   GLFLGPK  1016
             GLFLGPK
Sbjct  250   GLFLGPK  256



>gb|ACX49280.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49281.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49522.1| beta-carotene hydroxylase 1 [Zea mays]
Length=325

 Score =   324 bits (831),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  85    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  144

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  145   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  204

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRR  A+H++HH DKF G
Sbjct  205   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRREGASHKIHHMDKFGG  264

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  265   VPYGLFLGPK  274



>gb|ACX49495.1| beta-carotene hydroxylase 1 [Zea mays]
Length=319

 Score =   324 bits (830),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  79    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  138

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  139   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  198

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRR  A+H++HH DKF G
Sbjct  199   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRREGASHKIHHMDKFGG  258

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  259   VPYGLFLGPK  268



>gb|ACX49371.1| beta-carotene hydroxylase 1 [Zea mays]
Length=287

 Score =   322 bits (825),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRS R TYLVAAVMSSLG+TSMAV AVY+RF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  47    KEARKRSXRRTYLVAAVMSSLGVTSMAVAAVYHRFSWQMEGGEVPVIETLGTFALSVGAA  106

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  107   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  166

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H++HH DKF G
Sbjct  167   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKIHHMDKFGG  226

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  227   VPYGLFLGPK  236



>ref|NP_001053640.1| Os04g0578400 [Oryza sativa Japonica Group]
 emb|CAE03252.1| OSJNBa0011J08.7 [Oryza sativa Japonica Group]
 dbj|BAF15554.1| Os04g0578400 [Oryza sativa Japonica Group]
 emb|CAH66735.1| H0404F02.11 [Oryza sativa Indica Group]
 gb|EAY95258.1| hypothetical protein OsI_17081 [Oryza sativa Indica Group]
 dbj|BAG87491.1| unnamed protein product [Oryza sativa Japonica Group]
Length=309

 Score =   322 bits (826),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             K SER TYLVAAVMSSLG TSMAV AVYYRF WQ+EGG+VP TEMFGTFALSVGAAVGME
Sbjct  102   KLSERRTYLVAAVMSSLGFTSMAVAAVYYRFHWQLEGGDVPMTEMFGTFALSVGAAVGME  161

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWA+WAHR+LWHASLWHMHESHHR REGPFELNDVFAITNAVPAI+LL+YGFFH+G+VPG
Sbjct  162   FWAQWAHRSLWHASLWHMHESHHRAREGPFELNDVFAITNAVPAISLLAYGFFHRGIVPG  221

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HHTDKF GVPYG
Sbjct  222   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHTDKFEGVPYG  281

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  282   LFLGPK  287



>gb|ACX49505.1| beta-carotene hydroxylase 1 [Zea mays]
Length=314

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K  RKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  74    KKTRKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  133

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  134   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  193

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRR  A+H++HH DKF G
Sbjct  194   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRREGASHKIHHMDKFGG  253

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  254   VPYGLFLGPK  263



>gb|EAZ31728.1| hypothetical protein OsJ_15880 [Oryza sativa Japonica Group]
Length=310

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             K SER TYLVAAVMSSLG TSMAV AVYYRF WQ+EGG+VP TEMFGTFALSVGAAVGME
Sbjct  103   KLSERRTYLVAAVMSSLGFTSMAVAAVYYRFHWQLEGGDVPMTEMFGTFALSVGAAVGME  162

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWA+WAHR+LWHASLWHMHESHHR REGPFELNDVFAITNAVPAI+LL+YGFFH+G+VPG
Sbjct  163   FWAQWAHRSLWHASLWHMHESHHRAREGPFELNDVFAITNAVPAISLLAYGFFHRGIVPG  222

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HHTDKF GVPYG
Sbjct  223   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHTDKFEGVPYG  282

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  283   LFLGPK  288



>gb|ACX49356.1| beta-carotene hydroxylase 1 [Zea mays]
Length=300

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAV+SSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  89    KEARKRSERRTYLVAAVLSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  148

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  149   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  208

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             LVPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+   HH DKF G
Sbjct  209   LVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASXXXHHMDKFGG  268

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  269   VPYGLFLGPK  278



>dbj|BAD07275.1| beta-ring hydroxylase [Citrus unshiu]
 dbj|BAD07283.1| beta-ring hydroxylase [Citrus sinensis]
Length=176

 Score =   317 bits (811),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/176 (94%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +3

Query  483   LVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGMEFwarwahr  662
             LVAAVMSS GITSMAV+AVYYRF WQMEGGEVP  EMFGTFALSVGAAVGMEFWARWAH+
Sbjct  1     LVAAVMSSFGITSMAVMAVYYRFWWQMEGGEVPLAEMFGTFALSVGAAVGMEFWARWAHK  60

Query  663   alwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLG  842
             ALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAIALLS+GFFHKGLVPGLCFGAGLG
Sbjct  61    ALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLG  120

Query  843   ITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLG  1010
             ITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHH+DKF+GVPYGLFLG
Sbjct  121   ITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHSDKFHGVPYGLFLG  176



>gb|EEC74425.1| hypothetical protein OsI_09800 [Oryza sativa Indica Group]
Length=284

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 1/187 (1%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEG-GEVPYTEMFGTFALSVGAAVGM  635
             K+SER TYLVAAVMSSLGITSMA  AVYYRFAWQMEG GE+P TEMFGTFALSVGAAVGM
Sbjct  69    KQSERRTYLVAAVMSSLGITSMAAAAVYYRFAWQMEGSGEIPVTEMFGTFALSVGAAVGM  128

Query  636   EFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVP  815
             EFWARWAHRALWHASLWHMHESHHRPR+GPFELNDVFAI NAVPA++LL+YGFF +GLVP
Sbjct  129   EFWARWAHRALWHASLWHMHESHHRPRDGPFELNDVFAIINAVPAMSLLAYGFFTRGLVP  188

Query  816   GLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPY  995
             GLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAHQ+HH DKF GVPY
Sbjct  189   GLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHQIHHMDKFEGVPY  248

Query  996   GLFLGPK  1016
             GLFLGPK
Sbjct  249   GLFLGPK  255



>dbj|BAK01414.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=287

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  438   LAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSV  617
             ++E+ ARK SER TYLVAA+MSSLGITSMA  AVYYRFAWQMEGGE+P TEM GT ALSV
Sbjct  66    VSERAARKESERRTYLVAALMSSLGITSMAAAAVYYRFAWQMEGGEIPVTEMLGTLALSV  125

Query  618   GAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFF  797
             GAAVGMEFWARWAHRALWHASLWHMHESHH PR+GPFELNDVFAI NAVPA+ALL++GFF
Sbjct  126   GAAVGMEFWARWAHRALWHASLWHMHESHHLPRDGPFELNDVFAIINAVPAMALLAFGFF  185

Query  798   HKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDK  977
             ++GL+PGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPI +VPYFRRVAAAHQ+HH DK
Sbjct  186   NRGLLPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIENVPYFRRVAAAHQIHHMDK  245

Query  978   FNGVPYGLFLGPK  1016
             F+ VPYGLFLGPK
Sbjct  246   FDSVPYGLFLGPK  258



>gb|ACX49434.1| beta-carotene hydroxylase 1 [Zea mays]
Length=314

 Score =   321 bits (822),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  85    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  144

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  145   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  204

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+    DKF G
Sbjct  205   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXXXXDKFGG  264

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  265   VPYGLFLGPK  274



>gb|AFX79622.1| beta-carotene hydroxylase B2 [Triticum aestivum]
Length=298

 Score =   320 bits (819),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  438   LAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSV  617
             ++E+ ARK SER TYLVAA+MSSLGITSMA  AVYYRFAWQMEGGE+P TEM GT ALSV
Sbjct  78    VSERAARKESERRTYLVAALMSSLGITSMAAAAVYYRFAWQMEGGEIPVTEMLGTLALSV  137

Query  618   GAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFF  797
             GAAVGMEFWARWAHRALWHASLW MHESHH PR+GPFELNDVFAI NAVPA+ALL++GFF
Sbjct  138   GAAVGMEFWARWAHRALWHASLWDMHESHHLPRDGPFELNDVFAIVNAVPAMALLAFGFF  197

Query  798   HKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDK  977
             ++GLVPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPI +VPYFRRVAAAHQ+HH DK
Sbjct  198   NRGLVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIENVPYFRRVAAAHQIHHMDK  257

Query  978   FNGVPYGLFLGPK  1016
             F+ VPYGLFLGPK
Sbjct  258   FDSVPYGLFLGPK  270



>gb|ACX49497.1| beta-carotene hydroxylase 1 [Zea mays]
Length=319

 Score =   320 bits (821),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  79    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  138

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  139   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  198

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+R   GPIADVPYFRRVAA+H++HH DKF G
Sbjct  199   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRXXXGPIADVPYFRRVAASHKIHHMDKFGG  258

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  259   VPYGLFLGPK  268



>ref|XP_004985901.1| PREDICTED: beta-carotene 3-hydroxylase, chloroplastic-like [Setaria 
italica]
Length=309

 Score =   320 bits (820),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             K+SER TYLVAAVMSSLGITSMA  AVYYRFAWQMEGGE+P TEM GTFALSVGAAVGME
Sbjct  95    KQSERRTYLVAAVMSSLGITSMAAAAVYYRFAWQMEGGEIPVTEMVGTFALSVGAAVGME  154

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWARWAHRALWHASLW MHESHHRPR+GPFELNDVFAI NAVPA++LL+YGFF++GLVPG
Sbjct  155   FWARWAHRALWHASLWDMHESHHRPRDGPFELNDVFAIVNAVPAMSLLAYGFFNRGLVPG  214

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPI +VPYFRRVAAAHQ+HH DKF GVPYG
Sbjct  215   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIENVPYFRRVAAAHQIHHMDKFQGVPYG  274

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  275   LFLGPK  280



>ref|XP_006652681.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like [Oryza 
brachyantha]
Length=310

 Score =   319 bits (818),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             K SER TYLVAAVMSSLG+TS  V AVYYRF WQ+EGG+VP TEMFGTFALSVGAAVGME
Sbjct  103   KLSERRTYLVAAVMSSLGVTSAGVAAVYYRFHWQLEGGDVPMTEMFGTFALSVGAAVGME  162

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWARWAHR+LWHASLWHMHESHHR REGPFELNDVFAITNAVPAI+LL+YGFFH+G+VPG
Sbjct  163   FWARWAHRSLWHASLWHMHESHHRAREGPFELNDVFAITNAVPAISLLAYGFFHRGIVPG  222

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HHTDKF GVPYG
Sbjct  223   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHTDKFEGVPYG  282

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  283   LFLGPK  288



>gb|ACX49496.1| beta-carotene hydroxylase 1 [Zea mays]
Length=319

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  456   RKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGM  635
             RKRSER TYLVAAVMSSLG+TSMAV  VYYRF+WQMEGGEVP  E  GTFALSVGAAVGM
Sbjct  82    RKRSERRTYLVAAVMSSLGVTSMAVTXVYYRFSWQMEGGEVPVIETLGTFALSVGAAVGM  141

Query  636   EFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVP  815
             EFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G+VP
Sbjct  142   EFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRGIVP  201

Query  816   GLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPY  995
             GLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRR  A+H++HH DKF GVPY
Sbjct  202   GLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRREGASHKIHHMDKFGGVPY  261

Query  996   GLFLGPK  1016
             GLFLGPK
Sbjct  262   GLFLGPK  268



>gb|AFD18927.1| carotenoid hydroxylase [Zea mays]
Length=307

 Score =   319 bits (817),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAAVGME  638
             KRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGG VP +EMFGT ALSVGAAVGME
Sbjct  100   KRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGAVPVSEMFGTLALSVGAAVGME  159

Query  639   FwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPG  818
             FWARWAHRA+WHASLWHMHESHHRPREGPFELNDVFA+ N+VPAI+ L+YGFFH GLVPG
Sbjct  160   FWARWAHRAVWHASLWHMHESHHRPREGPFELNDVFAMVNSVPAISFLAYGFFHCGLVPG  219

Query  819   LCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYG  998
             LCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIA+VPYFRRVAAAH++HH DKF GVPYG
Sbjct  220   LCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEGVPYG  279

Query  999   LFLGPK  1016
             LFLGPK
Sbjct  280   LFLGPK  285



>gb|AFX79621.1| beta-carotene hydroxylase A2 [Triticum aestivum]
Length=294

 Score =   318 bits (815),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = +3

Query  438   LAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSV  617
             ++E+ ARK SER TYLVAA+MSSLGITSMA  AVYYRFAWQMEGGE+P TEM GT ALSV
Sbjct  73    VSERAARKESERRTYLVAALMSSLGITSMAAAAVYYRFAWQMEGGEIPVTEMLGTLALSV  132

Query  618   GAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFF  797
             GAAVGMEFWARWAHRALWHASLW MHESHH PR+GPFELNDVFAI NAVPA+ALL++GFF
Sbjct  133   GAAVGMEFWARWAHRALWHASLWDMHESHHLPRDGPFELNDVFAIVNAVPAMALLAFGFF  192

Query  798   HKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDK  977
             ++GL+PGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPI +VPYFRRVAAAHQ+HH DK
Sbjct  193   NRGLLPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIENVPYFRRVAAAHQIHHMDK  252

Query  978   FNGVPYGLFLGPK  1016
             F+ VPYGLFLGPK
Sbjct  253   FDSVPYGLFLGPK  265



>ref|XP_002465958.1| hypothetical protein SORBIDRAFT_01g048860 [Sorghum bicolor]
 gb|EER92956.1| hypothetical protein SORBIDRAFT_01g048860 [Sorghum bicolor]
Length=271

 Score =   317 bits (812),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 177/187 (95%), Gaps = 1/187 (1%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGG-EVPYTEMFGTFALSVGAAVGM  635
             K+SER TYLVAAVMSSLGITSMA  AVYYRFAWQMEGG E+P TEM GTFALSVGAAVGM
Sbjct  56    KQSERRTYLVAAVMSSLGITSMAAAAVYYRFAWQMEGGGEIPVTEMVGTFALSVGAAVGM  115

Query  636   EFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVP  815
             EFWARWAHRALWHASLWHMHESHHRPR+GPFELNDVFAI NAVPA++LL+YGFF++GLVP
Sbjct  116   EFWARWAHRALWHASLWHMHESHHRPRDGPFELNDVFAIVNAVPAMSLLAYGFFNRGLVP  175

Query  816   GLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPY  995
             GLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPI +VPYFRRVAAAHQ+HH DKF GVPY
Sbjct  176   GLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIENVPYFRRVAAAHQIHHMDKFQGVPY  235

Query  996   GLFLGPK  1016
             GLFLGPK
Sbjct  236   GLFLGPK  242



>gb|ACX49318.1| beta-carotene hydroxylase 1 [Zea mays]
Length=313

 Score =   318 bits (815),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  85    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  144

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  145   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  204

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+    DK  G
Sbjct  205   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXXXXDKXGG  264

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  265   VPYGLFLGPK  274



>gb|ACX49502.1| beta-carotene hydroxylase 1 [Zea mays]
Length=314

 Score =   318 bits (815),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  74    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  133

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  134   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  193

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRR      +HH DKF G
Sbjct  194   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRXXXXXXIHHMDKFGG  253

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  254   VPYGLFLGPK  263



>gb|ACX49485.1| beta-carotene hydroxylase 1 [Zea mays]
Length=299

 Score =   317 bits (813),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  85    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  144

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  145   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  204

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRR      +HH DKF G
Sbjct  205   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRXXXXXXIHHMDKFGG  264

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  265   VPYGLFLGPK  274



>gb|ACX49293.1| beta-carotene hydroxylase 1 [Zea mays]
Length=303

 Score =   317 bits (813),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  74    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  133

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  134   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  193

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+     KF G
Sbjct  194   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXXXXXKFGG  253

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  254   VPYGLFLGPK  263



>ref|XP_009363402.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
Length=305

 Score =   317 bits (813),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 176/199 (88%), Gaps = 0/199 (0%)
 Frame = +3

Query  420   QISASRLAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFG  599
              I   R +E+L RKRSER+TYLVAA+MSSLG+TS A +AVYYRF WQ E GE    EMFG
Sbjct  83    NIITLRASERLERKRSERYTYLVAAIMSSLGVTSAAAMAVYYRFYWQTEVGEYLLPEMFG  142

Query  600   TFALSVGAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIAL  779
             TFALSVG+AVGMEFWARWAHRALWHASLW MHESHHRPR+GPFELNDVFAITNAVPAIAL
Sbjct  143   TFALSVGSAVGMEFWARWAHRALWHASLWQMHESHHRPRDGPFELNDVFAITNAVPAIAL  202

Query  780   LSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQ  959
             LSYG F+KGL PGLCFGAGLGIT FGMAYMFVHDGLVH RFPVGPIADVPY R+VAAAHQ
Sbjct  203   LSYGLFNKGLFPGLCFGAGLGITTFGMAYMFVHDGLVHHRFPVGPIADVPYLRKVAAAHQ  262

Query  960   LHHTDKFNGVPYGLFLGPK  1016
             LHH+  FNGVPYGLFLGPK
Sbjct  263   LHHSCIFNGVPYGLFLGPK  281



>gb|ACX49531.1| beta-carotene hydroxylase 1 [Zea mays]
Length=319

 Score =   318 bits (814),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  79    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  138

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  139   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  198

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRR      +HH DKF G
Sbjct  199   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRXXXXXXIHHMDKFGG  258

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  259   VPYGLFLGPK  268



>gb|ACX49450.1| beta-carotene hydroxylase 1 [Zea mays]
Length=301

 Score =   317 bits (812),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  74    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  133

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  134   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  193

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+     KF G
Sbjct  194   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXXXXXKFGG  253

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  254   VPYGLFLGPK  263



>gb|ACX49504.1| beta-carotene hydroxylase 1 [Zea mays]
Length=302

 Score =   317 bits (812),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  74    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  133

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  134   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  193

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+     KF G
Sbjct  194   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXXXXXKFGG  253

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  254   VPYGLFLGPK  263



>gb|ACX49295.1| beta-carotene hydroxylase 1 [Zea mays]
 gb|ACX49322.1| beta-carotene hydroxylase 1 [Zea mays]
Length=300

 Score =   317 bits (812),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  74    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  133

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  134   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  193

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+     KF G
Sbjct  194   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXXXXXKFGG  253

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  254   VPYGLFLGPK  263



>gb|ACX49524.1| beta-carotene hydroxylase 1 [Zea mays]
Length=325

 Score =   318 bits (814),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  85    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  144

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  145   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  204

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRR      +HH DKF G
Sbjct  205   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRXXXXXXIHHMDKFGG  264

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  265   VPYGLFLGPK  274



>gb|ACX49439.1| beta-carotene hydroxylase 1 [Zea mays]
Length=325

 Score =   317 bits (813),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  85    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  144

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  145   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  204

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+     KF G
Sbjct  205   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXXXXXKFGG  264

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  265   VPYGLFLGPK  274



>gb|ABK25382.1| unknown [Picea sitchensis]
Length=330

 Score =   317 bits (813),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +3

Query  444   EKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGA  623
             ++ AR+++ER  Y  AA+ SS+GITSMA  AVYYRF W M+G EVPYTEMFGTFAL+VGA
Sbjct  114   KRAARRKAERHVYFFAAIASSVGITSMAAAAVYYRFVWLMQGAEVPYTEMFGTFALAVGA  173

Query  624   AVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHK  803
              VGME+WARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NAVPAIALL+YGFF+K
Sbjct  174   TVGMEYWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLAYGFFNK  233

Query  804   GLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFN  983
             GLVPGLCFGAGLGITVFGMAYMFVHDGLVH+RFPVGPIADVPY  +VAAAHQLHH DKFN
Sbjct  234   GLVPGLCFGAGLGITVFGMAYMFVHDGLVHRRFPVGPIADVPYLLKVAAAHQLHHADKFN  293

Query  984   GVPYGLFLGPK  1016
             GVPYGLFLGPK
Sbjct  294   GVPYGLFLGPK  304



>gb|AFX79623.1| beta-carotene hydroxylase D2 [Triticum aestivum]
Length=297

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  438   LAEKLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSV  617
             ++E+ ARK SER TYLVAA+MSSLGITSMA  AVYYRFAWQMEGGE+P TEM GT ALSV
Sbjct  76    VSERAARKESERRTYLVAALMSSLGITSMAAAAVYYRFAWQMEGGEIPVTEMLGTLALSV  135

Query  618   GAAVGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFF  797
             GAAVGMEFWARWAHRALWHASLW MHESHH PR+GPFELNDVFAI NAVPA+ALL++GFF
Sbjct  136   GAAVGMEFWARWAHRALWHASLWDMHESHHLPRDGPFELNDVFAIVNAVPAMALLAFGFF  195

Query  798   HKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDK  977
             ++GL+PGLCFGAGLGIT+FGMAYMF HDGLVH+RFPVGPI +VPYFRRVAAAHQ+HH DK
Sbjct  196   NRGLLPGLCFGAGLGITLFGMAYMFFHDGLVHRRFPVGPIENVPYFRRVAAAHQIHHMDK  255

Query  978   FNGVPYGLFLGPK  1016
             F+ VPYGLFLGPK
Sbjct  256   FDSVPYGLFLGPK  268



>ref|XP_008650403.1| PREDICTED: beta-carotene 3-hydroxylase, chloroplastic-like [Zea 
mays]
 tpg|DAA43060.1| TPA: hypothetical protein ZEAMMB73_554819 [Zea mays]
Length=299

 Score =   316 bits (809),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 177/187 (95%), Gaps = 1/187 (1%)
 Frame = +3

Query  459   KRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGG-EVPYTEMFGTFALSVGAAVGM  635
             K+SER TYLVAAVMSSLGITSMA  AVYYRFAWQMEGG E+P TEM GTFALSVGAAVGM
Sbjct  84    KQSERRTYLVAAVMSSLGITSMAAAAVYYRFAWQMEGGGEIPVTEMVGTFALSVGAAVGM  143

Query  636   EFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVP  815
             EFWARWAHRALWHASLWHMH+SHHRPR+GPFELNDVFAI NAVPA++LL+YGFF++GLVP
Sbjct  144   EFWARWAHRALWHASLWHMHQSHHRPRDGPFELNDVFAIVNAVPAMSLLAYGFFNRGLVP  203

Query  816   GLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPY  995
             GLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPI +VPYFRRVAAAHQ+HH DKF GVPY
Sbjct  204   GLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIENVPYFRRVAAAHQIHHMDKFQGVPY  263

Query  996   GLFLGPK  1016
             GLFLGPK
Sbjct  264   GLFLGPK  270



>gb|ACX49340.1| beta-carotene hydroxylase 1 [Zea mays]
Length=299

 Score =   316 bits (809),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  79    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  138

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  139   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  198

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             LVPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+      F G
Sbjct  199   LVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXXXXXXFGG  258

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  259   VPYGLFLGPK  268



>ref|XP_004976573.1| PREDICTED: beta-carotene hydroxylase 2, chloroplastic-like isoform 
X1 [Setaria italica]
Length=346

 Score =   317 bits (813),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 171/223 (77%), Positives = 181/223 (81%), Gaps = 35/223 (16%)
 Frame = +3

Query  453   ARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQME----------------------  566
             ARK+SER TYLVAAVMSSLG+TSMAV AVYYRF+WQME                      
Sbjct  102   ARKQSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEVTRSIALFFSICLVAAMALLVE  161

Query  567   -------------GGEVPYTEMFGTFALSVGAAVGMEFwarwahralwhaSLWHMHESHH  707
                          GGEVP TEMFGTFALSVGAAVGMEFWARWAHRALWHASLWHMHESHH
Sbjct  162   QCRKSDARVRALQGGEVPVTEMFGTFALSVGAAVGMEFWARWAHRALWHASLWHMHESHH  221

Query  708   RPREGPFELNDVFAITNAVPAIALLSYGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGL  887
             RPREGPFELNDVFAI NAVPAI+LLSYGFFH+G VPGLCFGAGLGIT+FGMAYMFVHDGL
Sbjct  222   RPREGPFELNDVFAIINAVPAISLLSYGFFHRGFVPGLCFGAGLGITLFGMAYMFVHDGL  281

Query  888   VHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNGVPYGLFLGPK  1016
             VH+RFPVGPIA+VPYFRRVAAAH++HH DKF GVPYGLFLGPK
Sbjct  282   VHRRFPVGPIANVPYFRRVAAAHKIHHMDKFEGVPYGLFLGPK  324



>gb|ACX49296.1| beta-carotene hydroxylase 1 [Zea mays]
Length=305

 Score =   315 bits (807),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  85    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  144

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  145   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  204

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+      F G
Sbjct  205   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXXXXXXFGG  264

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  265   VPYGLFLGPK  274



>gb|ACX49323.1| beta-carotene hydroxylase 1 [Zea mays]
Length=295

 Score =   315 bits (806),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  74    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  133

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  134   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  193

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+      F G
Sbjct  194   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXXXXXXFGG  253

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  254   VPYGLFLGPK  263



>gb|ACX49373.1| beta-carotene hydroxylase 1 [Zea mays]
Length=303

 Score =   315 bits (806),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  79    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  138

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  139   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  198

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+      F G
Sbjct  199   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXXXXXXFGG  258

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  259   VPYGLFLGPK  268



>gb|ACX49374.1| beta-carotene hydroxylase 1 [Zea mays]
Length=305

 Score =   315 bits (807),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  447   KLARKRSERFTYLVAAVMSSLGITSMAVLAVYYRFAWQMEGGEVPYTEMFGTFALSVGAA  626
             K ARKRSER TYLVAAVMSSLG+TSMAV AVYYRF+WQMEGGEVP  E  GTFALSVGAA
Sbjct  79    KEARKRSERRTYLVAAVMSSLGVTSMAVAAVYYRFSWQMEGGEVPVIETLGTFALSVGAA  138

Query  627   VGMEFwarwahralwhaSLWHMHESHHRPREGPFELNDVFAITNAVPAIALLSYGFFHKG  806
             VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAI NA PAI+LL+YGFFH+G
Sbjct  139   VGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIVNAAPAISLLAYGFFHRG  198

Query  807   LVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHTDKFNG  986
             +VPGLCFGAGLGIT+FGMAYMFVHDGLVH+RFPVGPIADVPYFRRVAA+H+      F G
Sbjct  199   IVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIADVPYFRRVAASHKXXXXXXFGG  258

Query  987   VPYGLFLGPK  1016
             VPYGLFLGPK
Sbjct  259   VPYGLFLGPK  268



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5015338356684