BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1961_g1_i1 len=1108 path=[3080:0-13 2006:14-1107]

Length=1108
                                                                      Score     E

ref|XP_009590900.1|  PREDICTED: pentatricopeptide repeat-containi...    544   0.0      
ref|XP_009804662.1|  PREDICTED: pentatricopeptide repeat-containi...    518   4e-178   
ref|XP_006344328.1|  PREDICTED: pentatricopeptide repeat-containi...    505   4e-173   
ref|XP_010319468.1|  PREDICTED: pentatricopeptide repeat-containi...    498   2e-170   
ref|XP_011075576.1|  PREDICTED: pentatricopeptide repeat-containi...    494   1e-168   
emb|CDP00406.1|  unnamed protein product                                487   6e-166   
ref|XP_002274352.1|  PREDICTED: pentatricopeptide repeat-containi...    478   3e-162   Vitis vinifera
gb|EYU28838.1|  hypothetical protein MIMGU_mgv1a003966mg                472   1e-159   
ref|XP_008221533.1|  PREDICTED: pentatricopeptide repeat-containi...    464   6e-157   
ref|XP_010259128.1|  PREDICTED: pentatricopeptide repeat-containi...    463   7e-157   
ref|XP_007222375.1|  hypothetical protein PRUPE_ppa004015mg             462   3e-156   
ref|XP_010035219.1|  PREDICTED: pentatricopeptide repeat-containi...    446   3e-150   
ref|XP_008389431.1|  PREDICTED: pentatricopeptide repeat-containi...    447   4e-150   
gb|KCW46505.1|  hypothetical protein EUGRSUZ_K00330                     445   5e-150   
ref|XP_009356368.1|  PREDICTED: pentatricopeptide repeat-containi...    446   1e-149   
ref|XP_003520106.1|  PREDICTED: pentatricopeptide repeat-containi...    442   1e-148   
ref|XP_010096577.1|  hypothetical protein L484_004253                   441   3e-148   
ref|XP_007045928.1|  Pentatricopeptide repeat-containing protein        434   2e-145   
ref|XP_007157581.1|  hypothetical protein PHAVU_002G081200g             431   5e-144   
gb|KHN02018.1|  Pentatricopeptide repeat-containing protein             431   5e-144   
ref|XP_003614017.1|  Pentatricopeptide repeat protein                   421   3e-140   
ref|XP_004490153.1|  PREDICTED: pentatricopeptide repeat-containi...    420   6e-140   
ref|XP_008465705.1|  PREDICTED: pentatricopeptide repeat-containi...    417   2e-138   
ref|XP_004143828.1|  PREDICTED: pentatricopeptide repeat-containi...    411   2e-136   
ref|XP_004157334.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    410   4e-136   
ref|XP_010259136.1|  PREDICTED: pentatricopeptide repeat-containi...    399   8e-133   
ref|XP_010939127.1|  PREDICTED: pentatricopeptide repeat-containi...    402   9e-133   
ref|XP_008777162.1|  PREDICTED: pentatricopeptide repeat-containi...    391   1e-128   
ref|XP_009398278.1|  PREDICTED: pentatricopeptide repeat-containi...    364   4e-118   
ref|XP_002512113.1|  pentatricopeptide repeat-containing protein,...    348   2e-114   Ricinus communis
emb|CBI27276.3|  unnamed protein product                                312   1e-101   
ref|XP_008465707.1|  PREDICTED: pentatricopeptide repeat-containi...    310   3e-98    
ref|XP_008361879.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    299   8e-95    
ref|XP_010557968.1|  PREDICTED: pentatricopeptide repeat-containi...    303   5e-93    
ref|XP_007029178.1|  Pentatricopeptide repeat (PPR) superfamily p...    295   2e-90    
ref|XP_002267596.1|  PREDICTED: pentatricopeptide repeat-containi...    294   8e-90    Vitis vinifera
ref|XP_003553630.1|  PREDICTED: pentatricopeptide repeat-containi...    290   2e-88    
ref|XP_010248175.1|  PREDICTED: pentatricopeptide repeat-containi...    283   1e-85    
ref|XP_007029177.1|  Pentatricopeptide repeat superfamily protein       282   2e-85    
ref|XP_004494285.1|  PREDICTED: pentatricopeptide repeat-containi...    283   2e-85    
ref|XP_008343155.1|  PREDICTED: pentatricopeptide repeat-containi...    278   7e-85    
ref|XP_002263755.1|  PREDICTED: pentatricopeptide repeat-containi...    280   1e-84    Vitis vinifera
ref|XP_009370591.1|  PREDICTED: pentatricopeptide repeat-containi...    277   2e-84    
ref|XP_006399126.1|  hypothetical protein EUTSA_v10015670mg             280   3e-84    
ref|XP_010423323.1|  PREDICTED: pentatricopeptide repeat-containi...    280   3e-84    
ref|XP_009117485.1|  PREDICTED: pentatricopeptide repeat-containi...    275   1e-83    
ref|XP_010243893.1|  PREDICTED: pentatricopeptide repeat-containi...    270   4e-83    
ref|XP_008242732.1|  PREDICTED: pentatricopeptide repeat-containi...    279   7e-83    
ref|XP_010263631.1|  PREDICTED: pentatricopeptide repeat-containi...    275   2e-82    
ref|XP_010275835.1|  PREDICTED: pentatricopeptide repeat-containi...    273   2e-82    
ref|XP_011042533.1|  PREDICTED: pentatricopeptide repeat-containi...    274   2e-82    
ref|XP_007163011.1|  hypothetical protein PHAVU_001G198600g             274   3e-82    
ref|XP_007046897.1|  Tetratricopeptide repeat (TPR)-like superfam...    272   3e-82    
ref|XP_010277322.1|  PREDICTED: pentatricopeptide repeat-containi...    272   4e-82    
ref|XP_010646933.1|  PREDICTED: pentatricopeptide repeat-containi...    271   4e-82    
ref|XP_002873264.1|  pentatricopeptide repeat-containing protein        274   4e-82    
ref|XP_010943863.1|  PREDICTED: pentatricopeptide repeat-containi...    274   5e-82    
ref|XP_006289319.1|  hypothetical protein CARUB_v10002804mg             273   6e-82    
ref|XP_009368815.1|  PREDICTED: pentatricopeptide repeat-containi...    276   7e-82    
ref|XP_010243892.1|  PREDICTED: pentatricopeptide repeat-containi...    270   1e-81    
emb|CBI31119.3|  unnamed protein product                                269   2e-81    
gb|KDP41276.1|  hypothetical protein JCGZ_15683                         265   2e-81    
ref|XP_002265420.1|  PREDICTED: pentatricopeptide repeat-containi...    270   2e-81    Vitis vinifera
ref|XP_007154464.1|  hypothetical protein PHAVU_003G121400g             271   3e-81    
ref|XP_004292867.1|  PREDICTED: pentatricopeptide repeat-containi...    270   3e-81    
ref|XP_010646822.1|  PREDICTED: pentatricopeptide repeat-containi...    267   3e-81    
ref|XP_002272744.1|  PREDICTED: pentatricopeptide repeat-containi...    271   5e-81    Vitis vinifera
emb|CAN66581.1|  hypothetical protein VITISV_030261                     271   5e-81    Vitis vinifera
ref|XP_008337322.1|  PREDICTED: pentatricopeptide repeat-containi...    273   9e-81    
gb|KDP23803.1|  hypothetical protein JCGZ_00135                         266   1e-80    
ref|XP_010646821.1|  PREDICTED: pentatricopeptide repeat-containi...    267   2e-80    
ref|XP_006425654.1|  hypothetical protein CICLE_v10025166mg             270   2e-80    
ref|XP_006299486.1|  hypothetical protein CARUB_v10015651mg             267   2e-80    
gb|KGN66073.1|  hypothetical protein Csa_1G569490                       268   6e-80    
ref|XP_002884209.1|  pentatricopeptide repeat-containing protein        265   9e-80    
ref|XP_002269269.2|  PREDICTED: pentatricopeptide repeat-containi...    270   1e-79    Vitis vinifera
ref|NP_196272.1|  pentatricopeptide repeat-containing protein           267   2e-79    Arabidopsis thaliana [mouse-ear cress]
emb|CAN70142.1|  hypothetical protein VITISV_032085                     269   2e-79    Vitis vinifera
ref|XP_002274432.2|  PREDICTED: pentatricopeptide repeat-containi...    269   3e-79    Vitis vinifera
ref|XP_007221475.1|  hypothetical protein PRUPE_ppa004164mg             264   4e-79    
ref|XP_008803539.1|  PREDICTED: pentatricopeptide repeat-containi...    264   4e-79    
ref|XP_010259704.1|  PREDICTED: pentatricopeptide repeat-containi...    263   5e-79    
ref|XP_010250091.1|  PREDICTED: pentatricopeptide repeat-containi...    263   5e-79    
ref|XP_008223786.1|  PREDICTED: pentatricopeptide repeat-containi...    263   6e-79    
ref|XP_003527818.1|  PREDICTED: pentatricopeptide repeat-containi...    263   6e-79    
ref|XP_006364895.1|  PREDICTED: pentatricopeptide repeat-containi...    268   7e-79    
gb|EYU20789.1|  hypothetical protein MIMGU_mgv1a002968mg                265   8e-79    
ref|XP_010662353.1|  PREDICTED: pentatricopeptide repeat-containi...    263   9e-79    
gb|KFK43124.1|  hypothetical protein AALP_AA1G083500                    268   9e-79    
ref|XP_004309259.1|  PREDICTED: pentatricopeptide repeat-containi...    262   1e-78    
ref|XP_006430418.1|  hypothetical protein CICLE_v10011492mg             262   1e-78    
ref|XP_009343520.1|  PREDICTED: pentatricopeptide repeat-containi...    260   1e-78    
ref|XP_009766197.1|  PREDICTED: pentatricopeptide repeat-containi...    263   1e-78    
gb|AEP33764.1|  organelle transcript processing 82                      266   1e-78    
emb|CBI30729.3|  unnamed protein product                                261   1e-78    
ref|XP_010942337.1|  PREDICTED: pentatricopeptide repeat-containi...    261   1e-78    
ref|XP_002519323.1|  pentatricopeptide repeat-containing protein,...    258   2e-78    Ricinus communis
ref|XP_009598291.1|  PREDICTED: pentatricopeptide repeat-containi...    262   3e-78    
ref|XP_007137157.1|  hypothetical protein PHAVU_009G104600g             261   3e-78    
ref|XP_010685827.1|  PREDICTED: pentatricopeptide repeat-containi...    264   3e-78    
ref|XP_007202004.1|  hypothetical protein PRUPE_ppa021060mg             262   3e-78    
ref|XP_006408981.1|  hypothetical protein EUTSA_v10001958mg             261   3e-78    
ref|XP_002282081.2|  PREDICTED: pentatricopeptide repeat-containi...    261   3e-78    Vitis vinifera
ref|XP_008790494.1|  PREDICTED: pentatricopeptide repeat-containi...    263   4e-78    
gb|EYU45574.1|  hypothetical protein MIMGU_mgv1a001941mg                266   5e-78    
ref|XP_010250014.1|  PREDICTED: pentatricopeptide repeat-containi...    266   5e-78    
ref|XP_009369706.1|  PREDICTED: pentatricopeptide repeat-containi...    263   6e-78    
ref|XP_010101131.1|  Serine/threonine-protein phosphatase PP2A-4 ...    266   6e-78    
ref|XP_006481967.1|  PREDICTED: pentatricopeptide repeat-containi...    261   6e-78    
ref|XP_009359788.1|  PREDICTED: pentatricopeptide repeat-containi...    263   7e-78    
ref|XP_010091291.1|  hypothetical protein L484_001646                   263   7e-78    
ref|XP_008227868.1|  PREDICTED: pentatricopeptide repeat-containi...    260   8e-78    
ref|XP_010039610.1|  PREDICTED: pentatricopeptide repeat-containi...    265   8e-78    
ref|XP_007226519.1|  hypothetical protein PRUPE_ppa025518mg             260   9e-78    
ref|XP_009349726.1|  PREDICTED: pentatricopeptide repeat-containi...    260   1e-77    
ref|XP_002282063.1|  PREDICTED: pentatricopeptide repeat-containi...    259   1e-77    Vitis vinifera
ref|XP_010489024.1|  PREDICTED: pentatricopeptide repeat-containi...    259   1e-77    
ref|XP_010927406.1|  PREDICTED: pentatricopeptide repeat-containi...    262   1e-77    
ref|XP_007154976.1|  hypothetical protein PHAVU_003G162300g             264   2e-77    
ref|XP_010491225.1|  PREDICTED: pentatricopeptide repeat-containi...    261   2e-77    
ref|NP_179644.1|  mitochondrial editing factor 21                       259   2e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002282128.1|  PREDICTED: pentatricopeptide repeat-containi...    259   3e-77    Vitis vinifera
ref|XP_006450982.1|  hypothetical protein CICLE_v10010823mg             263   3e-77    
emb|CDP14216.1|  unnamed protein product                                260   3e-77    
ref|XP_010049068.1|  PREDICTED: pentatricopeptide repeat-containi...    258   4e-77    
ref|XP_006475804.1|  PREDICTED: pentatricopeptide repeat-containi...    263   4e-77    
ref|XP_010546246.1|  PREDICTED: pentatricopeptide repeat-containi...    259   4e-77    
gb|KCW81521.1|  hypothetical protein EUGRSUZ_C02882                     258   4e-77    
ref|XP_006342693.1|  PREDICTED: pentatricopeptide repeat-containi...    261   4e-77    
ref|XP_007226779.1|  hypothetical protein PRUPE_ppa018015mg             261   5e-77    
ref|XP_006360941.1|  PREDICTED: pentatricopeptide repeat-containi...    258   6e-77    
ref|XP_007035985.1|  Tetratricopeptide repeat-like superfamily pr...    260   7e-77    
ref|XP_010047809.1|  PREDICTED: pentatricopeptide repeat-containi...    262   8e-77    
ref|XP_008390483.1|  PREDICTED: pentatricopeptide repeat-containi...    260   9e-77    
ref|XP_011071469.1|  PREDICTED: pentatricopeptide repeat-containi...    262   1e-76    
ref|XP_004247963.2|  PREDICTED: pentatricopeptide repeat-containi...    258   1e-76    
emb|CDX78334.1|  BnaA03g02460D                                          257   1e-76    
ref|XP_010467800.1|  PREDICTED: pentatricopeptide repeat-containi...    257   1e-76    
emb|CDP18487.1|  unnamed protein product                                257   1e-76    
ref|XP_008797556.1|  PREDICTED: pentatricopeptide repeat-containi...    263   1e-76    
ref|XP_010680017.1|  PREDICTED: pentatricopeptide repeat-containi...    254   2e-76    
gb|KHN44997.1|  Pentatricopeptide repeat-containing protein             258   2e-76    
ref|XP_006341456.1|  PREDICTED: pentatricopeptide repeat-containi...    257   2e-76    
ref|NP_172286.1|  chloroplast RNA editing factor                        261   2e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008223521.1|  PREDICTED: pentatricopeptide repeat-containi...    259   2e-76    
ref|XP_010688051.1|  PREDICTED: pentatricopeptide repeat-containi...    261   2e-76    
ref|XP_006476161.1|  PREDICTED: pentatricopeptide repeat-containi...    256   2e-76    
ref|XP_009338904.1|  PREDICTED: pentatricopeptide repeat-containi...    257   2e-76    
ref|XP_002524104.1|  transferase, transferring glycosyl groups, p...    262   3e-76    Ricinus communis
gb|KCW79820.1|  hypothetical protein EUGRSUZ_C01164                     255   3e-76    
ref|XP_003541335.1|  PREDICTED: pentatricopeptide repeat-containi...    258   3e-76    
ref|XP_010047826.1|  PREDICTED: pentatricopeptide repeat-containi...    256   5e-76    
ref|XP_006842814.1|  hypothetical protein AMTR_s00081p00056740          252   6e-76    
ref|XP_009381432.1|  PREDICTED: pentatricopeptide repeat-containi...    255   6e-76    
ref|XP_009402625.1|  PREDICTED: pentatricopeptide repeat-containi...    256   6e-76    
ref|XP_009795612.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    258   6e-76    
gb|AEP33772.1|  organelle transcript processing 82                      255   6e-76    
ref|XP_010318680.1|  PREDICTED: pentatricopeptide repeat-containi...    255   6e-76    
gb|AEP33769.1|  organelle transcript processing 82                      259   9e-76    
ref|XP_009131053.1|  PREDICTED: pentatricopeptide repeat-containi...    255   9e-76    
gb|KDP32370.1|  hypothetical protein JCGZ_13295                         259   1e-75    
ref|XP_006586001.1|  PREDICTED: putative pentatricopeptide repeat...    255   1e-75    
ref|XP_006450596.1|  hypothetical protein CICLE_v10010742mg             256   1e-75    
ref|XP_010940912.1|  PREDICTED: pentatricopeptide repeat-containi...    255   1e-75    
gb|ACP39950.1|  pentatricopeptide repeat protein                        254   1e-75    Gossypium hirsutum [American cotton]
ref|XP_008242855.1|  PREDICTED: pentatricopeptide repeat-containi...    249   1e-75    
ref|XP_011028546.1|  PREDICTED: pentatricopeptide repeat-containi...    257   1e-75    
ref|XP_004295922.1|  PREDICTED: pentatricopeptide repeat-containi...    254   2e-75    
ref|XP_010095598.1|  hypothetical protein L484_007437                   256   2e-75    
gb|KDO79692.1|  hypothetical protein CISIN_1g048358mg                   254   2e-75    
ref|XP_009367935.1|  PREDICTED: pentatricopeptide repeat-containi...    254   2e-75    
ref|XP_008392585.1|  PREDICTED: pentatricopeptide repeat-containi...    253   2e-75    
ref|XP_007013367.1|  Tetratricopeptide repeat (TPR)-like superfam...    260   3e-75    
ref|XP_010251341.1|  PREDICTED: putative pentatricopeptide repeat...    257   4e-75    
ref|XP_008803808.1|  PREDICTED: pentatricopeptide repeat-containi...    253   4e-75    
ref|XP_010277978.1|  PREDICTED: pentatricopeptide repeat-containi...    254   5e-75    
ref|XP_003530680.1|  PREDICTED: putative pentatricopeptide repeat...    255   5e-75    
gb|KHN13481.1|  Putative pentatricopeptide repeat-containing protein    254   5e-75    
ref|XP_007227273.1|  hypothetical protein PRUPE_ppa017736mg             253   5e-75    
ref|XP_010557591.1|  PREDICTED: pentatricopeptide repeat-containi...    258   5e-75    
ref|XP_009620111.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    257   6e-75    
ref|XP_010245284.1|  PREDICTED: pentatricopeptide repeat-containi...    253   7e-75    
ref|XP_002892433.1|  pentatricopeptide repeat-containing protein        257   7e-75    
ref|XP_009618113.1|  PREDICTED: pentatricopeptide repeat-containi...    255   7e-75    
ref|XP_011078947.1|  PREDICTED: pentatricopeptide repeat-containi...    255   7e-75    
ref|XP_008354505.1|  PREDICTED: pentatricopeptide repeat-containi...    252   8e-75    
ref|XP_008389944.1|  PREDICTED: pentatricopeptide repeat-containi...    252   9e-75    
ref|XP_010275968.1|  PREDICTED: pentatricopeptide repeat-containi...    253   1e-74    
ref|XP_006586000.1|  PREDICTED: putative pentatricopeptide repeat...    254   1e-74    
ref|XP_008797883.1|  PREDICTED: putative pentatricopeptide repeat...    254   1e-74    
ref|XP_010250474.1|  PREDICTED: pentatricopeptide repeat-containi...    251   1e-74    
ref|XP_010251726.1|  PREDICTED: pentatricopeptide repeat-containi...    254   1e-74    
gb|AEP33758.1|  organelle transcript processing 82                      256   1e-74    
ref|XP_006417732.1|  hypothetical protein EUTSA_v10006910mg             256   1e-74    
emb|CBI28140.3|  unnamed protein product                                253   2e-74    
ref|XP_010096333.1|  hypothetical protein L484_021080                   253   2e-74    
ref|XP_007014547.1|  Pentatricopeptide repeat protein isoform 2         251   2e-74    
ref|XP_011038349.1|  PREDICTED: pentatricopeptide repeat-containi...    251   3e-74    
ref|XP_009122264.1|  PREDICTED: pentatricopeptide repeat-containi...    253   3e-74    
ref|XP_002322762.2|  hypothetical protein POPTR_0016s06560g             251   3e-74    Populus trichocarpa [western balsam poplar]
ref|XP_011028518.1|  PREDICTED: pentatricopeptide repeat-containi...    253   3e-74    
ref|XP_006385170.1|  hypothetical protein POPTR_0004s24500g             253   3e-74    
ref|XP_004253185.1|  PREDICTED: pentatricopeptide repeat-containi...    253   4e-74    
ref|XP_010541645.1|  PREDICTED: pentatricopeptide repeat-containi...    251   4e-74    
ref|XP_010112156.1|  hypothetical protein L484_019895                   251   4e-74    
ref|XP_009394320.1|  PREDICTED: pentatricopeptide repeat-containi...    250   4e-74    
ref|XP_007014546.1|  Pentatricopeptide repeat protein isoform 1         251   4e-74    
emb|CDP13645.1|  unnamed protein product                                250   5e-74    
ref|XP_008234336.1|  PREDICTED: pentatricopeptide repeat-containi...    250   5e-74    
ref|XP_008465017.1|  PREDICTED: pentatricopeptide repeat-containi...    255   6e-74    
gb|KDP31652.1|  hypothetical protein JCGZ_14968                         251   6e-74    
ref|XP_008777202.1|  PREDICTED: pentatricopeptide repeat-containi...    249   7e-74    
ref|XP_006383156.1|  hypothetical protein POPTR_0005s12100g             253   7e-74    
ref|XP_010313693.1|  PREDICTED: pentatricopeptide repeat-containi...    254   8e-74    
emb|CBI38215.3|  unnamed protein product                                251   8e-74    
ref|XP_008389535.1|  PREDICTED: putative pentatricopeptide repeat...    252   8e-74    
ref|XP_008465018.1|  PREDICTED: pentatricopeptide repeat-containi...    254   9e-74    
ref|XP_010928067.1|  PREDICTED: pentatricopeptide repeat-containi...    252   9e-74    
ref|XP_006421782.1|  hypothetical protein CICLE_v10004643mg             251   9e-74    
ref|XP_009630094.1|  PREDICTED: pentatricopeptide repeat-containi...    254   1e-73    
ref|XP_010675197.1|  PREDICTED: pentatricopeptide repeat-containi...    249   1e-73    
ref|XP_011093233.1|  PREDICTED: pentatricopeptide repeat-containi...    252   1e-73    
ref|XP_009630093.1|  PREDICTED: pentatricopeptide repeat-containi...    254   1e-73    
gb|AEP33773.1|  organelle transcript processing 82                      253   1e-73    
ref|XP_004135465.1|  PREDICTED: putative pentatricopeptide repeat...    251   1e-73    
emb|CDP10401.1|  unnamed protein product                                249   2e-73    
gb|AEP33761.1|  organelle transcript processing 82                      253   2e-73    
ref|XP_008803598.1|  PREDICTED: pentatricopeptide repeat-containi...    249   2e-73    
gb|AEP33767.1|  organelle transcript processing 82                      253   2e-73    
ref|XP_002524455.1|  pentatricopeptide repeat-containing protein,...    248   2e-73    Ricinus communis
ref|XP_009394237.1|  PREDICTED: pentatricopeptide repeat-containi...    251   2e-73    
ref|XP_008393901.1|  PREDICTED: pentatricopeptide repeat-containi...    249   2e-73    
ref|XP_010243684.1|  PREDICTED: pentatricopeptide repeat-containi...    249   2e-73    
ref|XP_010092397.1|  hypothetical protein L484_023776                   248   2e-73    
ref|XP_010262425.1|  PREDICTED: putative pentatricopeptide repeat...    251   2e-73    
ref|XP_004961943.1|  PREDICTED: pentatricopeptide repeat-containi...    249   2e-73    
ref|XP_003631282.1|  PREDICTED: putative pentatricopeptide repeat...    251   2e-73    
ref|XP_004150015.1|  PREDICTED: pentatricopeptide repeat-containi...    253   2e-73    
ref|XP_009773356.1|  PREDICTED: pentatricopeptide repeat-containi...    253   3e-73    
ref|XP_008229311.1|  PREDICTED: pentatricopeptide repeat-containi...    249   3e-73    
ref|XP_003568364.1|  PREDICTED: pentatricopeptide repeat-containi...    249   3e-73    
ref|XP_010525501.1|  PREDICTED: pentatricopeptide repeat-containi...    248   3e-73    
ref|XP_010266378.1|  PREDICTED: pentatricopeptide repeat-containi...    251   4e-73    
ref|XP_010095259.1|  hypothetical protein L484_014600                   249   4e-73    
ref|XP_008220011.1|  PREDICTED: pentatricopeptide repeat-containi...    248   5e-73    
ref|XP_007043264.1|  Pentatricopeptide repeat superfamily protein       248   5e-73    
ref|XP_006306854.1|  hypothetical protein CARUB_v10008399mg             252   5e-73    
ref|XP_009383039.1|  PREDICTED: pentatricopeptide repeat-containi...    248   6e-73    
ref|XP_009336183.1|  PREDICTED: pentatricopeptide repeat-containi...    247   7e-73    
ref|XP_009604837.1|  PREDICTED: pentatricopeptide repeat-containi...    247   8e-73    
ref|XP_006372460.1|  hypothetical protein POPTR_0017s01850g             244   1e-72    
ref|XP_009360403.1|  PREDICTED: putative pentatricopeptide repeat...    249   1e-72    
emb|CDY35335.1|  BnaA04g15120D                                          249   1e-72    
ref|XP_009140698.1|  PREDICTED: putative pentatricopeptide repeat...    249   1e-72    
ref|XP_008791994.1|  PREDICTED: pentatricopeptide repeat-containi...    249   1e-72    
gb|AEP33760.1|  organelle transcript processing 82                      251   1e-72    
ref|XP_010252817.1|  PREDICTED: pentatricopeptide repeat-containi...    249   1e-72    
ref|XP_002510888.1|  pentatricopeptide repeat-containing protein,...    247   1e-72    Ricinus communis
ref|XP_008221687.1|  PREDICTED: putative pentatricopeptide repeat...    249   1e-72    
ref|XP_010025983.1|  PREDICTED: pentatricopeptide repeat-containi...    246   1e-72    
ref|XP_008446300.1|  PREDICTED: putative pentatricopeptide repeat...    248   2e-72    
ref|XP_009388055.1|  PREDICTED: pentatricopeptide repeat-containi...    245   2e-72    
ref|XP_007222052.1|  hypothetical protein PRUPE_ppa003120mg             248   2e-72    
ref|XP_006446854.1|  hypothetical protein CICLE_v10018065mg             243   2e-72    
emb|CDP01732.1|  unnamed protein product                                247   2e-72    
ref|XP_007156963.1|  hypothetical protein PHAVU_002G032000g             245   3e-72    
emb|CBI38358.3|  unnamed protein product                                246   3e-72    
gb|EPS62011.1|  hypothetical protein M569_12781                         244   5e-72    
ref|XP_010317464.1|  PREDICTED: pentatricopeptide repeat-containi...    245   6e-72    
ref|XP_002526196.1|  pentatricopeptide repeat-containing protein,...    244   6e-72    Ricinus communis
ref|XP_010918387.1|  PREDICTED: pentatricopeptide repeat-containi...    244   7e-72    
ref|XP_010024159.1|  PREDICTED: pentatricopeptide repeat-containi...    246   7e-72    
ref|XP_009798042.1|  PREDICTED: pentatricopeptide repeat-containi...    245   7e-72    
ref|XP_010911850.1|  PREDICTED: putative pentatricopeptide repeat...    247   8e-72    
ref|XP_009628544.1|  PREDICTED: pentatricopeptide repeat-containi...    245   8e-72    
ref|XP_009586648.1|  PREDICTED: pentatricopeptide repeat-containi...    244   8e-72    
ref|XP_007208480.1|  hypothetical protein PRUPE_ppa018503mg             244   9e-72    
ref|XP_010058731.1|  PREDICTED: pentatricopeptide repeat-containi...    246   9e-72    
gb|AES73838.2|  PPR containing plant-like protein                       244   1e-71    
ref|XP_011002251.1|  PREDICTED: pentatricopeptide repeat-containi...    244   1e-71    
ref|XP_010501370.1|  PREDICTED: pentatricopeptide repeat-containi...    247   1e-71    
ref|XP_004298455.1|  PREDICTED: putative pentatricopeptide repeat...    246   1e-71    
ref|XP_010557955.1|  PREDICTED: pentatricopeptide repeat-containi...    246   1e-71    
ref|XP_010066387.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    243   1e-71    
ref|XP_010272332.1|  PREDICTED: pentatricopeptide repeat-containi...    245   1e-71    
gb|KCW89721.1|  hypothetical protein EUGRSUZ_A01980                     243   2e-71    
gb|KDP34229.1|  hypothetical protein JCGZ_07800                         244   2e-71    
ref|XP_006468953.1|  PREDICTED: pentatricopeptide repeat-containi...    241   2e-71    
ref|XP_006484519.1|  PREDICTED: pentatricopeptide repeat-containi...    244   2e-71    
ref|XP_003525932.1|  PREDICTED: pentatricopeptide repeat-containi...    243   2e-71    
emb|CBI16398.3|  unnamed protein product                                245   2e-71    
ref|NP_001190262.1|  pentatricopeptide repeat (PPR) family protein      243   2e-71    
ref|XP_002277430.1|  PREDICTED: pentatricopeptide repeat-containi...    243   2e-71    
ref|XP_010267716.1|  PREDICTED: pentatricopeptide repeat-containi...    246   3e-71    
ref|XP_003603587.1|  Pentatricopeptide repeat-containing protein        244   3e-71    
ref|XP_004488535.1|  PREDICTED: pentatricopeptide repeat-containi...    244   3e-71    
ref|XP_003622275.1|  Pentatricopeptide repeat protein                   243   3e-71    
ref|XP_010047274.1|  PREDICTED: pentatricopeptide repeat-containi...    243   3e-71    
ref|XP_010041208.1|  PREDICTED: putative pentatricopeptide repeat...    245   3e-71    
gb|KDP31290.1|  hypothetical protein JCGZ_11666                         246   3e-71    
ref|XP_010112543.1|  hypothetical protein L484_007553                   241   3e-71    
ref|XP_009148065.1|  PREDICTED: pentatricopeptide repeat-containi...    247   3e-71    
ref|XP_010091451.1|  hypothetical protein L484_000760                   243   3e-71    
ref|XP_006475832.1|  PREDICTED: pentatricopeptide repeat-containi...    243   4e-71    
ref|XP_010061870.1|  PREDICTED: pentatricopeptide repeat-containi...    243   4e-71    
emb|CDP15415.1|  unnamed protein product                                245   4e-71    
ref|XP_007046822.1|  Pentatricopeptide repeat (PPR) superfamily p...    246   4e-71    
ref|XP_004236840.1|  PREDICTED: pentatricopeptide repeat-containi...    243   4e-71    
ref|XP_010053441.1|  PREDICTED: pentatricopeptide repeat-containi...    243   4e-71    
ref|XP_011019503.1|  PREDICTED: pentatricopeptide repeat-containi...    244   4e-71    
ref|XP_009600182.1|  PREDICTED: putative pentatricopeptide repeat...    245   4e-71    
ref|XP_003525660.2|  PREDICTED: pentatricopeptide repeat-containi...    247   4e-71    
emb|CDO96870.1|  unnamed protein product                                242   4e-71    
gb|AEP33763.1|  organelle transcript processing 82                      246   5e-71    
ref|XP_009781807.1|  PREDICTED: putative pentatricopeptide repeat...    244   5e-71    
ref|XP_004134932.1|  PREDICTED: pentatricopeptide repeat-containi...    245   6e-71    
ref|XP_004137589.1|  PREDICTED: pentatricopeptide repeat-containi...    243   6e-71    
ref|XP_006401000.1|  hypothetical protein EUTSA_v10015737mg             242   6e-71    
gb|KDO57336.1|  hypothetical protein CISIN_1g010881mg                   241   6e-71    
ref|XP_003612041.1|  Pentatricopeptide repeat-containing protein        242   6e-71    
ref|XP_010065411.1|  PREDICTED: putative pentatricopeptide repeat...    244   7e-71    
ref|XP_008241735.1|  PREDICTED: pentatricopeptide repeat-containi...    245   7e-71    
emb|CDP01970.1|  unnamed protein product                                245   7e-71    
ref|XP_008360231.1|  PREDICTED: pentatricopeptide repeat-containi...    244   7e-71    
ref|XP_010272376.1|  PREDICTED: pentatricopeptide repeat-containi...    241   7e-71    
ref|XP_010100941.1|  hypothetical protein L484_005950                   246   7e-71    
ref|XP_008439760.1|  PREDICTED: pentatricopeptide repeat-containi...    246   8e-71    
emb|CDX77010.1|  BnaC04g38050D                                          244   8e-71    
ref|XP_004236339.1|  PREDICTED: putative pentatricopeptide repeat...    244   9e-71    
ref|XP_004157498.1|  PREDICTED: pentatricopeptide repeat-containi...    242   9e-71    
ref|XP_011089593.1|  PREDICTED: putative pentatricopeptide repeat...    244   9e-71    
gb|AEP33757.1|  organelle transcript processing 82                      245   1e-70    
gb|KDP41900.1|  hypothetical protein JCGZ_26918                         240   1e-70    
emb|CDX93594.1|  BnaA06g04540D                                          245   1e-70    
ref|XP_002531775.1|  pentatricopeptide repeat-containing protein,...    240   1e-70    
emb|CDP19158.1|  unnamed protein product                                241   1e-70    
gb|AEP33766.1|  organelle transcript processing 82                      239   1e-70    
ref|XP_007203957.1|  hypothetical protein PRUPE_ppa022872mg             245   2e-70    
ref|XP_007138308.1|  hypothetical protein PHAVU_009G197700g             241   2e-70    
ref|XP_011093560.1|  PREDICTED: pentatricopeptide repeat-containi...    241   2e-70    
gb|KEH17497.1|  PPR containing plant-like protein                       241   2e-70    
ref|XP_009379143.1|  PREDICTED: pentatricopeptide repeat-containi...    241   2e-70    
ref|XP_004501200.1|  PREDICTED: pentatricopeptide repeat-containi...    241   3e-70    
ref|XP_004146494.1|  PREDICTED: pentatricopeptide repeat-containi...    243   3e-70    
gb|KFK40427.1|  hypothetical protein AALP_AA3G372200                    236   3e-70    
gb|EAY98197.1|  hypothetical protein OsI_20110                          241   3e-70    
ref|XP_007203772.1|  hypothetical protein PRUPE_ppa002597mg             243   3e-70    
ref|XP_007153854.1|  hypothetical protein PHAVU_003G070200g             242   3e-70    
gb|KCW90401.1|  hypothetical protein EUGRSUZ_A02542                     241   3e-70    
gb|EYU31178.1|  hypothetical protein MIMGU_mgv1a027138mg                243   3e-70    
ref|XP_010911952.1|  PREDICTED: pentatricopeptide repeat-containi...    240   4e-70    
ref|XP_004293084.1|  PREDICTED: pentatricopeptide repeat-containi...    240   4e-70    
emb|CDX95096.1|  BnaC05g05750D                                          244   4e-70    
ref|NP_001174447.1|  Os05g0439300                                       241   4e-70    
gb|KFK25192.1|  hypothetical protein AALP_AA8G079200                    239   4e-70    
ref|XP_011070702.1|  PREDICTED: pentatricopeptide repeat-containi...    240   4e-70    
emb|CAN65024.1|  hypothetical protein VITISV_026273                     245   4e-70    
ref|XP_002515972.1|  pentatricopeptide repeat-containing protein,...    240   4e-70    
gb|EEE63862.1|  hypothetical protein OsJ_18686                          240   4e-70    
ref|XP_009612360.1|  PREDICTED: pentatricopeptide repeat-containi...    240   5e-70    
ref|XP_010935476.1|  PREDICTED: pentatricopeptide repeat-containi...    240   5e-70    
gb|KFK40426.1|  hypothetical protein AALP_AA3G372200                    236   5e-70    
ref|XP_010458031.1|  PREDICTED: pentatricopeptide repeat-containi...    244   5e-70    
ref|XP_006425612.1|  hypothetical protein CICLE_v10025108mg             243   5e-70    
gb|EYU35572.1|  hypothetical protein MIMGU_mgv1a018815mg                239   5e-70    
ref|XP_010260649.1|  PREDICTED: pentatricopeptide repeat-containi...    242   5e-70    
ref|XP_006359300.1|  PREDICTED: pentatricopeptide repeat-containi...    240   5e-70    
ref|XP_008338038.1|  PREDICTED: pentatricopeptide repeat-containi...    243   5e-70    
ref|XP_002309169.1|  pentatricopeptide repeat-containing family p...    242   6e-70    
ref|XP_009132265.1|  PREDICTED: pentatricopeptide repeat-containi...    239   6e-70    
gb|KDP32395.1|  hypothetical protein JCGZ_13320                         239   6e-70    
ref|XP_004169636.1|  PREDICTED: pentatricopeptide repeat-containi...    242   7e-70    
ref|XP_010914156.1|  PREDICTED: pentatricopeptide repeat-containi...    240   7e-70    
ref|XP_008452110.1|  PREDICTED: pentatricopeptide repeat-containi...    242   7e-70    
ref|XP_007142776.1|  hypothetical protein PHAVU_007G016000g             240   7e-70    
ref|XP_006483247.1|  PREDICTED: putative pentatricopeptide repeat...    241   7e-70    
ref|XP_002308572.2|  hypothetical protein POPTR_0006s24730g             241   8e-70    
ref|XP_004289114.1|  PREDICTED: pentatricopeptide repeat-containi...    242   8e-70    
ref|XP_010062344.1|  PREDICTED: pentatricopeptide repeat-containi...    239   9e-70    
gb|AEP33759.1|  organelle transcript processing 82                      243   1e-69    
ref|XP_002446813.1|  hypothetical protein SORBIDRAFT_06g023080          239   1e-69    
ref|XP_010090943.1|  hypothetical protein L484_007578                   236   1e-69    
ref|XP_006844721.1|  hypothetical protein AMTR_s00016p00252780          236   1e-69    
ref|XP_009377373.1|  PREDICTED: pentatricopeptide repeat-containi...    244   1e-69    
ref|XP_006348045.1|  PREDICTED: pentatricopeptide repeat-containi...    239   1e-69    
ref|XP_009797557.1|  PREDICTED: pentatricopeptide repeat-containi...    239   1e-69    
ref|XP_010326776.1|  PREDICTED: pentatricopeptide repeat-containi...    239   1e-69    
ref|XP_003635033.1|  PREDICTED: putative pentatricopeptide repeat...    241   1e-69    
emb|CDX99419.1|  BnaC01g11330D                                          237   1e-69    
ref|XP_008667875.1|  PREDICTED: hypothetical protein isoform X1         239   1e-69    
ref|XP_006466854.1|  PREDICTED: pentatricopeptide repeat-containi...    241   1e-69    
gb|KHN06390.1|  Pentatricopeptide repeat-containing protein             240   2e-69    
ref|XP_008450539.1|  PREDICTED: pentatricopeptide repeat-containi...    241   2e-69    
ref|XP_006408800.1|  hypothetical protein EUTSA_v10001933mg             240   2e-69    
ref|XP_006438573.1|  hypothetical protein CICLE_v10030908mg             241   3e-69    
ref|XP_002270476.1|  PREDICTED: pentatricopeptide repeat-containi...    238   3e-69    
ref|XP_010257292.1|  PREDICTED: pentatricopeptide repeat-containi...    242   3e-69    
ref|XP_008447140.1|  PREDICTED: pentatricopeptide repeat-containi...    238   3e-69    
emb|CDO98289.1|  unnamed protein product                                238   4e-69    
ref|XP_004506294.1|  PREDICTED: pentatricopeptide repeat-containi...    238   4e-69    
ref|XP_002534070.1|  pentatricopeptide repeat-containing protein,...    238   4e-69    
ref|XP_008231210.1|  PREDICTED: pentatricopeptide repeat-containi...    235   4e-69    
emb|CAN78152.1|  hypothetical protein VITISV_040250                     239   4e-69    
gb|AFW62747.1|  hypothetical protein ZEAMMB73_141955                    231   4e-69    
ref|XP_003524199.1|  PREDICTED: pentatricopeptide repeat-containi...    239   4e-69    
ref|XP_008785897.1|  PREDICTED: pentatricopeptide repeat-containi...    238   4e-69    
ref|XP_006291116.1|  hypothetical protein CARUB_v10017228mg             235   4e-69    
ref|XP_006655361.1|  PREDICTED: pentatricopeptide repeat-containi...    238   5e-69    
ref|XP_006827330.1|  hypothetical protein AMTR_s00010p00267800          240   5e-69    
ref|XP_008803874.1|  PREDICTED: pentatricopeptide repeat-containi...    238   5e-69    
ref|XP_002324235.2|  pentatricopeptide repeat-containing family p...    241   6e-69    
ref|XP_010454688.1|  PREDICTED: putative pentatricopeptide repeat...    237   6e-69    
ref|XP_002310070.2|  hypothetical protein POPTR_0007s07610g             236   7e-69    
ref|XP_010929544.1|  PREDICTED: pentatricopeptide repeat-containi...    235   7e-69    
ref|XP_011003604.1|  PREDICTED: pentatricopeptide repeat-containi...    236   7e-69    
ref|XP_009120425.1|  PREDICTED: putative pentatricopeptide repeat...    237   7e-69    
ref|XP_003635064.1|  PREDICTED: putative pentatricopeptide repeat...    239   7e-69    
emb|CBI39619.3|  unnamed protein product                                239   8e-69    
ref|XP_008353912.1|  PREDICTED: pentatricopeptide repeat-containi...    237   8e-69    
ref|XP_010546497.1|  PREDICTED: putative pentatricopeptide repeat...    238   8e-69    
ref|XP_010250460.1|  PREDICTED: pentatricopeptide repeat-containi...    234   8e-69    
gb|EYU30350.1|  hypothetical protein MIMGU_mgv1a017701mg                234   8e-69    
ref|XP_010475598.1|  PREDICTED: pentatricopeptide repeat-containi...    241   9e-69    
ref|XP_003555200.1|  PREDICTED: pentatricopeptide repeat-containi...    237   1e-68    
ref|XP_002512787.1|  pentatricopeptide repeat-containing protein,...    235   1e-68    
ref|XP_010938127.1|  PREDICTED: pentatricopeptide repeat-containi...    237   1e-68    
ref|XP_010423113.1|  PREDICTED: pentatricopeptide repeat-containi...    236   1e-68    
ref|XP_004306129.1|  PREDICTED: pentatricopeptide repeat-containi...    235   1e-68    
gb|AEP33771.1|  organelle transcript processing 82                      239   1e-68    
ref|XP_008450020.1|  PREDICTED: pentatricopeptide repeat-containi...    233   1e-68    
ref|XP_008218684.1|  PREDICTED: pentatricopeptide repeat-containi...    238   1e-68    
gb|KHN36100.1|  Pentatricopeptide repeat-containing protein             236   1e-68    
ref|XP_010483530.1|  PREDICTED: putative pentatricopeptide repeat...    236   1e-68    
ref|XP_008787062.1|  PREDICTED: pentatricopeptide repeat-containi...    239   2e-68    
ref|XP_008793345.1|  PREDICTED: pentatricopeptide repeat-containi...    236   2e-68    
ref|XP_008444926.1|  PREDICTED: pentatricopeptide repeat-containi...    236   2e-68    
emb|CDP03984.1|  unnamed protein product                                238   2e-68    
ref|XP_010098972.1|  hypothetical protein L484_025631                   236   2e-68    
ref|XP_002267354.1|  PREDICTED: pentatricopeptide repeat-containi...    238   2e-68    
ref|XP_008376555.1|  PREDICTED: pentatricopeptide repeat-containi...    234   2e-68    
ref|XP_009778501.1|  PREDICTED: pentatricopeptide repeat-containi...    236   2e-68    
ref|XP_008219204.1|  PREDICTED: pentatricopeptide repeat-containi...    235   2e-68    
ref|XP_011026616.1|  PREDICTED: pentatricopeptide repeat-containi...    239   3e-68    
emb|CBI29077.3|  unnamed protein product                                238   3e-68    
ref|XP_010268183.1|  PREDICTED: putative pentatricopeptide repeat...    238   3e-68    
ref|XP_002279376.1|  PREDICTED: pentatricopeptide repeat-containi...    236   3e-68    
ref|XP_003629742.1|  Pentatricopeptide repeat-containing protein        237   3e-68    
ref|XP_007152720.1|  hypothetical protein PHAVU_004G153700g             235   3e-68    
gb|KDO52711.1|  hypothetical protein CISIN_1g039362mg                   233   3e-68    
ref|XP_003516564.2|  PREDICTED: pentatricopeptide repeat-containi...    236   4e-68    
ref|XP_011020171.1|  PREDICTED: pentatricopeptide repeat-containi...    236   4e-68    
gb|EAZ01552.1|  hypothetical protein OsI_23585                          234   4e-68    
ref|XP_006290148.1|  hypothetical protein CARUB_v10003816mg             234   5e-68    
ref|XP_010109685.1|  hypothetical protein L484_015170                   236   5e-68    
ref|XP_009417951.1|  PREDICTED: pentatricopeptide repeat-containi...    235   5e-68    
ref|XP_004163116.1|  PREDICTED: pentatricopeptide repeat-containi...    232   5e-68    
ref|XP_002268784.1|  PREDICTED: pentatricopeptide repeat-containi...    237   6e-68    
gb|AEP33762.1|  organelle transcript processing 82                      237   6e-68    
gb|KDP34237.1|  hypothetical protein JCGZ_07808                         240   6e-68    
gb|KDO60957.1|  hypothetical protein CISIN_1g046039mg                   233   6e-68    
ref|XP_006443657.1|  hypothetical protein CICLE_v10019256mg             237   6e-68    
ref|XP_010644678.1|  PREDICTED: pentatricopeptide repeat-containi...    234   6e-68    
ref|XP_011007048.1|  PREDICTED: pentatricopeptide repeat-containi...    234   6e-68    
gb|EYU35808.1|  hypothetical protein MIMGU_mgv1a021697mg                236   6e-68    
ref|XP_002280289.2|  PREDICTED: pentatricopeptide repeat-containi...    237   6e-68    
ref|XP_010439805.1|  PREDICTED: pentatricopeptide repeat-containi...    234   6e-68    
ref|XP_011039878.1|  PREDICTED: pentatricopeptide repeat-containi...    234   7e-68    
ref|XP_002311390.1|  hypothetical protein POPTR_0008s10600g             236   7e-68    
ref|XP_010109080.1|  hypothetical protein L484_012956                   234   7e-68    
ref|XP_009381711.1|  PREDICTED: pentatricopeptide repeat-containi...    233   7e-68    
ref|NP_200728.2|  protein ORGANELLE TRANSCRIPT PROCESSING 80            234   7e-68    
ref|XP_011081841.1|  PREDICTED: pentatricopeptide repeat-containi...    234   8e-68    
ref|XP_009387050.1|  PREDICTED: putative pentatricopeptide repeat...    236   9e-68    
ref|XP_006474838.1|  PREDICTED: pentatricopeptide repeat-containi...    236   9e-68    
ref|XP_010541412.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    234   9e-68    
ref|XP_006282116.1|  hypothetical protein CARUB_v10028364mg             234   9e-68    
gb|AEP33768.1|  organelle transcript processing 82                      237   9e-68    
ref|XP_010101867.1|  hypothetical protein L484_023657                   236   9e-68    
gb|EPS64702.1|  hypothetical protein M569_10080                         233   1e-67    
ref|XP_006382414.1|  hypothetical protein POPTR_0005s01930g             232   1e-67    
ref|XP_009142893.1|  PREDICTED: pentatricopeptide repeat-containi...    234   1e-67    
ref|XP_006437177.1|  hypothetical protein CICLE_v10031197mg             234   1e-67    
ref|XP_003617444.1|  Pentatricopeptide repeat-containing protein        234   1e-67    
ref|XP_010443660.1|  PREDICTED: putative pentatricopeptide repeat...    234   1e-67    
ref|XP_010931004.1|  PREDICTED: pentatricopeptide repeat-containi...    233   1e-67    
ref|XP_010035839.1|  PREDICTED: pentatricopeptide repeat-containi...    236   1e-67    
ref|XP_007025291.1|  Pentatricopeptide repeat (PPR-like) superfam...    233   1e-67    
ref|XP_006304931.1|  hypothetical protein CARUB_v10011411mg             234   2e-67    
ref|XP_002315764.2|  hypothetical protein POPTR_0010s09620g             237   2e-67    
ref|XP_010094224.1|  hypothetical protein L484_016768                   233   2e-67    
ref|XP_010272231.1|  PREDICTED: pentatricopeptide repeat-containi...    231   2e-67    
ref|XP_009383396.1|  PREDICTED: pentatricopeptide repeat-containi...    231   2e-67    
ref|XP_010502600.1|  PREDICTED: pentatricopeptide repeat-containi...    231   2e-67    
ref|XP_009404762.1|  PREDICTED: pentatricopeptide repeat-containi...    236   2e-67    
ref|XP_010522599.1|  PREDICTED: pentatricopeptide repeat-containi...    236   2e-67    
gb|AEP33765.1|  organelle transcript processing 82                      236   2e-67    
ref|XP_006399320.1|  hypothetical protein EUTSA_v10013204mg             233   2e-67    
ref|NP_001057989.1|  Os06g0597500                                       233   2e-67    
ref|XP_008386776.1|  PREDICTED: pentatricopeptide repeat-containi...    227   3e-67    
gb|KEH31953.1|  PPR containing plant-like protein                       233   3e-67    



>ref|XP_009590900.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Nicotiana tomentosiformis]
Length=528

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/362 (72%), Positives = 319/362 (88%), Gaps = 1/362 (0%)
 Frame = -2

Query  1104  LSTSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWR  925
             +S  T RCL LLE+C+N+KQL QAH QVITCGLG N+FALSRLLAFCS PNLG+PTYGW+
Sbjct  1     MSICTKRCLFLLERCRNMKQLKQAHAQVITCGLGQNSFALSRLLAFCSHPNLGSPTYGWK  60

Query  924   IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
             I+E+IQ+PTICI NTMIKAFLLKGEL+RT+E+YK+MLK GM PDNYTLPY+LKAC  M+ 
Sbjct  61    IFEQIQEPTICIFNTMIKAFLLKGELNRTIEIYKNMLKIGMYPDNYTLPYVLKACTRMKI  120

Query  744   CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
             CNLG  +HGQ LK GFL+D +VGN+LI MY+++D++E+A+ VF+E+P  CVV+WTVLIS 
Sbjct  121   CNLGELVHGQILKLGFLIDIFVGNTLIAMYTAIDNVEAARLVFNEIPCNCVVSWTVLISG  180

Query  564   YSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAIL  385
             Y+++GDV+EARL F+E PVKDR VWGSMISGYVQNNCFKEGL+LFR MQMTG+  DEAI 
Sbjct  181   YAKRGDVYEARLSFEECPVKDRGVWGSMISGYVQNNCFKEGLKLFRQMQMTGIDPDEAIF  240

Query  384   VSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPE  205
             VS+LSACAHLGSLDIG W+HRYVEKL M+++++LGTAL+DMYAKCGCL +A++LF E+P+
Sbjct  241   VSVLSACAHLGSLDIGIWIHRYVEKLRMSMSLKLGTALIDMYAKCGCLDIAEELFDEMPQ  300

Query  204   RDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLK  25
             RD+ICWNAMISGFAMNG+G  A++LF EMQ+ AG RPD VTFVS+FTACS +GMA+EGL 
Sbjct  301   RDLICWNAMISGFAMNGNGSKALQLFNEMQS-AGIRPDDVTFVSMFTACSYAGMANEGLN  359

Query  24    LL  19
             +L
Sbjct  360   ML  361



>ref|XP_009804662.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Nicotiana sylvestris]
Length=528

 Score =   518 bits (1334),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 248/362 (69%), Positives = 310/362 (86%), Gaps = 1/362 (0%)
 Frame = -2

Query  1104  LSTSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWR  925
             +S  T RCL LLE C+N+KQL Q+H QVITCGLG N+FALSRLLAFCS PNLG+PTYGW+
Sbjct  1     MSICTKRCLFLLESCRNMKQLKQSHAQVITCGLGQNSFALSRLLAFCSHPNLGSPTYGWK  60

Query  924   IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
             I+E+IQ+PTICI NTMIKAFLLKGEL++T+E+YK+M+K  M PDNYTLPY+LKAC  M++
Sbjct  61    IFEQIQEPTICIFNTMIKAFLLKGELNKTIEVYKYMVKIEMYPDNYTLPYVLKACARMKN  120

Query  744   CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
             CNLG  +H Q LK GFL+D +VGNSLI MY++ D++E+A+ VF E+P  CVV+WTVLIS 
Sbjct  121   CNLGELVHVQILKLGFLIDIFVGNSLIAMYTAFDNVEAARLVFYEIPCNCVVSWTVLISG  180

Query  564   YSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAIL  385
             Y+++GDV+EARL F+E PVKDR VWGSMISGYV NN FKEGL+LFR MQM G+  DEAI 
Sbjct  181   YAKRGDVYEARLTFEECPVKDRGVWGSMISGYVLNNNFKEGLKLFRQMQMAGIGPDEAIF  240

Query  384   VSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPE  205
             VS+LSACAHLGSLDIG W+H+YVEKL M+++++LGTAL+DMYAKCGC+ +A++LF E+P+
Sbjct  241   VSVLSACAHLGSLDIGIWIHKYVEKLRMSMSLKLGTALIDMYAKCGCVDIAEELFDEMPQ  300

Query  204   RDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLK  25
             RD+ICWNAMISG AMNG+G  A++LF EMQ+  G +PD VTFVS+FTACS +GMA+EGL 
Sbjct  301   RDLICWNAMISGIAMNGNGFKALKLFNEMQS-TGIKPDCVTFVSMFTACSYAGMANEGLN  359

Query  24    LL  19
             +L
Sbjct  360   ML  361



>ref|XP_006344328.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Solanum tuberosum]
Length=530

 Score =   505 bits (1300),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 250/364 (69%), Positives = 307/364 (84%), Gaps = 3/364 (1%)
 Frame = -2

Query  1104  LSTSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWR  925
             +S  T RCL LLEKCKN+ QL QAHGQVITCGLG N+FALSRLLAFCS PNLG+P YG++
Sbjct  1     MSICTRRCLFLLEKCKNMMQLKQAHGQVITCGLGENSFALSRLLAFCSHPNLGSPIYGFK  60

Query  924   IYERIQQPTICIVNTMIKAFLLKG--ELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNM  751
             I+E+IQ+PTICI NTMIK+FLLKG  EL+R  E+YK+MLK GM PDNYTLPY+LKACG M
Sbjct  61    IFEQIQEPTICIFNTMIKSFLLKGDNELNRITEIYKNMLKIGMYPDNYTLPYVLKACGRM  120

Query  750   ESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLI  571
             +S +LG  +HGQ LK GFL+D++VGNSLI  Y+  D++E+A+ VF E+P  CVV+WTVLI
Sbjct  121   KSFHLGELVHGQILKLGFLIDTFVGNSLIGFYTCFDNVEAARSVFYEIPCNCVVSWTVLI  180

Query  570   SRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEA  391
               Y++ GDV+EARL+FDE  VKDR VWG MIS YVQNNCFKEGLQLFR MQM+G++ DEA
Sbjct  181   CGYAKTGDVYEARLIFDECLVKDRGVWGCMISCYVQNNCFKEGLQLFRQMQMSGIEPDEA  240

Query  390   ILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
             ILVS+LSACAHLG +DIG W+H+YV+KL M  +++LGTAL+DMYAKCGCL +A+K+F E+
Sbjct  241   ILVSVLSACAHLGCVDIGIWIHKYVKKLKMGSSIKLGTALIDMYAKCGCLDIAEKVFDEM  300

Query  210   PERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             P RD+ICWNAMISGFA+NG+G  A++LF EMQ  + TRPD VTF+S+FTACS +GMA+EG
Sbjct  301   PIRDLICWNAMISGFAVNGNGLKALKLFNEMQK-SRTRPDDVTFISMFTACSYAGMANEG  359

Query  30    LKLL  19
             L LL
Sbjct  360   LNLL  363



>ref|XP_010319468.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Solanum lycopersicum]
Length=530

 Score =   498 bits (1282),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 248/360 (69%), Positives = 303/360 (84%), Gaps = 3/360 (1%)
 Frame = -2

Query  1092  TGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYER  913
             T RCL LLEKCKN+KQL QAHGQVITCGLG N+FALSRLLAFCS PNLG+P YG++I+E+
Sbjct  5     TRRCLFLLEKCKNMKQLKQAHGQVITCGLGENSFALSRLLAFCSHPNLGSPVYGFKIFEQ  64

Query  912   IQQPTICIVNTMIKAFLLKG--ELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCN  739
             IQ+PTICI NTMIK+FLLKG  E++R  E+Y++MLK GM PDNYTLPY+LKACG M+S +
Sbjct  65    IQEPTICIFNTMIKSFLLKGDDEVNRITEIYRNMLKIGMYPDNYTLPYVLKACGRMKSLH  124

Query  738   LGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYS  559
             LG  +HGQ LK GFL+D++VGNSLI  Y+  D++E+A+ VF E+P  CVV+WTVLI  Y+
Sbjct  125   LGELVHGQILKLGFLIDTFVGNSLIGFYTCFDNVEAARSVFYEIPCNCVVSWTVLICGYA  184

Query  558   RKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVS  379
             ++GDV+EARLVFDE  VKDR VWG MIS YVQNNCFKEGLQLFR MQM+G++ DEAILVS
Sbjct  185   KRGDVYEARLVFDECLVKDRGVWGCMISCYVQNNCFKEGLQLFRQMQMSGIEPDEAILVS  244

Query  378   ILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERD  199
             +LSACAHLG  DIG W+HRYV+KL M  +++LGTAL+DMY KCGCL +A+K+F E+P RD
Sbjct  245   VLSACAHLGCADIGVWIHRYVKKLKMGSSIKLGTALIDMYGKCGCLDIAEKVFDEMPIRD  304

Query  198   VICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLL  19
             +ICWNAMISGFA+NG+G  A++LF EMQ     RPD VTF+S+FTACS +GMA+EGL LL
Sbjct  305   LICWNAMISGFAVNGNGLKALKLFNEMQK-FRIRPDDVTFLSMFTACSYAGMANEGLNLL  363



>ref|XP_011075576.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Sesamum indicum]
Length=526

 Score =   494 bits (1271),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 243/358 (68%), Positives = 298/358 (83%), Gaps = 1/358 (0%)
 Frame = -2

Query  1092  TGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYER  913
             + RCL+LLEKCKN+KQL QAH  V+T GLG+N FALSR+LAFCSDP  G  +YG++I+  
Sbjct  2     SSRCLQLLEKCKNIKQLKQAHALVMTSGLGSNGFALSRILAFCSDPFHGGLSYGYKIFRN  61

Query  912   IQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLG  733
             I+ PTICI NTMIKAFLLK E  R ME+YK ML+ GMCPDNYTLPY+LKAC NM+S +LG
Sbjct  62    IENPTICICNTMIKAFLLKDENFRGMEVYKLMLRYGMCPDNYTLPYVLKACANMKSLDLG  121

Query  732   RSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRK  553
              S+HG  LK GF+ D++VGNSLIVMYS++ +M +A+CVF+E+  RCVV+WTVL+S Y++K
Sbjct  122   GSVHGHGLKLGFVSDNFVGNSLIVMYSAVGEMGAARCVFEEISCRCVVSWTVLVSGYAKK  181

Query  552   GDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSIL  373
             G+V  ARLVFDE PVKDR +WG+MISGYVQNNCFKEGL+LFRLMQ++G++ DEA  VS+L
Sbjct  182   GEVCSARLVFDEAPVKDRGIWGAMISGYVQNNCFKEGLRLFRLMQLSGIKPDEASFVSVL  241

Query  372   SACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVI  193
              ACAHLGSL+IGKW+HRYVEK  M + V+LGTAL+DMY+KCGCL LA+K+F ++P RDVI
Sbjct  242   CACAHLGSLEIGKWIHRYVEKHKMPVTVKLGTALIDMYSKCGCLDLAEKVFDKMPHRDVI  301

Query  192   CWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLL  19
             CWN MISG+AMNG+GE A+RLF EMQ  +  RPD VT +SL TACS S MAHEGL LL
Sbjct  302   CWNTMISGYAMNGNGEMALRLFDEMQK-SRVRPDNVTLISLLTACSYSDMAHEGLHLL  358



>emb|CDP00406.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   487 bits (1253),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 230/342 (67%), Positives = 282/342 (82%), Gaps = 1/342 (0%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              QAHGQ ITCGLG N++ALSRLLAFCSDP  G+  +G++I+E+I+QPTICI NTMIKA L
Sbjct  5     KQAHGQAITCGLGANSYALSRLLAFCSDPVQGSLFHGYKIFEQIEQPTICICNTMIKALL  64

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
             LK EL +T+ +YK ML+ GM PDNYTLPY+LKAC NME+ NLG  IHG C K GFL ++Y
Sbjct  65    LKKELEKTIAIYKDMLRNGMYPDNYTLPYMLKACANMENYNLGELIHGHCFKLGFLFNTY  124

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             V NSLI MYS   +ME+A+ VFDEMP  CVV+ T++I+ Y++KGDV+ ARLVFDE  +KD
Sbjct  125   VVNSLIFMYSGFLNMEAARLVFDEMPWPCVVSRTLVINGYAKKGDVYGARLVFDEAELKD  184

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
             R +WG+M+SGYVQNNCFKEGL LFRLMQ+ GV+ DEAILVS L ACAHLG LDIG WVHR
Sbjct  185   RGIWGAMLSGYVQNNCFKEGLLLFRLMQLDGVEPDEAILVSALCACAHLGCLDIGIWVHR  244

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             YV K  + ++V+LGTAL+DMYAKCG L +A+K+FYE+P RDVICWN MISGFAMNG+G+ 
Sbjct  245   YVGKGNLPLSVKLGTALMDMYAKCGYLDVAEKVFYEMPRRDVICWNTMISGFAMNGNGKG  304

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLE  16
             A++LFREM+ + G RPD +TF+SLFTACS S +AHEGL LL+
Sbjct  305   ALKLFREMEKN-GIRPDDITFISLFTACSYSCLAHEGLMLLD  345



>ref|XP_002274352.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 
[Vitis vinifera]
Length=536

 Score =   478 bits (1229),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 214/343 (62%), Positives = 280/343 (82%), Gaps = 1/343 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             +AH QV+TCGLG ++FALSRLLAFCS P  G+  + W+++++IQ PTICI NTMIKAF+L
Sbjct  23    EAHAQVLTCGLGTDSFALSRLLAFCSHPLHGSLPHAWKLFQQIQHPTICICNTMIKAFVL  82

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             KG+L  T+++Y  ML+ G+ PDNYTLPY+LKAC  ++SC+LG S HGQ +K GF  D +V
Sbjct  83    KGKLINTIQIYSQMLENGLYPDNYTLPYVLKACAGLQSCHLGESAHGQSVKLGFWFDIFV  142

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
             GN+LI MYSS  ++ +A+C+FDEMP    V+WTV+IS Y++ GDV  AR++FDE P+KDR
Sbjct  143   GNTLIAMYSSFGNVRAARCIFDEMPWHTAVSWTVMISGYAKVGDVETARMLFDEAPMKDR  202

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
              +WGS+ISGYVQNNCFKEGLQ+FRLMQ TG++ DEAILVSIL ACAHLG+++IG WVHRY
Sbjct  203   GIWGSIISGYVQNNCFKEGLQMFRLMQSTGLEPDEAILVSILCACAHLGAMEIGVWVHRY  262

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +++LG  ++VRL T L+DMYAKCG L +A+KLF  + +RD ICWNAMISG AMNGDG+NA
Sbjct  263   LDQLGHPLSVRLSTGLIDMYAKCGSLDIAKKLFDGMSQRDTICWNAMISGMAMNGDGDNA  322

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             +RLF EM+  AG +PD +TF+++FTACS SGMAHE ++LL  +
Sbjct  323   LRLFSEMEK-AGVKPDDITFIAIFTACSYSGMAHEAIRLLNSM  364



>gb|EYU28838.1| hypothetical protein MIMGU_mgv1a003966mg [Erythranthe guttata]
Length=552

 Score =   472 bits (1214),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 233/360 (65%), Positives = 292/360 (81%), Gaps = 2/360 (1%)
 Frame = -2

Query  1095  STGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYE  916
             S+ RCL+LLEKC+N+ QL+QAH   I CGLG+N+FALSR++AFCSDP  G+ +YG++I++
Sbjct  2     SSSRCLQLLEKCRNINQLNQAHALAIACGLGSNSFALSRIIAFCSDPFHGSLSYGYKIFQ  61

Query  915   RIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMC-PDNYTLPYLLKACGNMESCN  739
              I+ PTICI NTMIK FLLKGE    + +YK +L+     PDNYTLPY LKAC NM S N
Sbjct  62    HIENPTICICNTMIKGFLLKGESFEAIRIYKLLLRNSTRRPDNYTLPYALKACTNMGSSN  121

Query  738   LGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYS  559
             LG SIHG   K GFL D++VGNSLIVMYS   +M +A+  FDE+   CVV+WTVLIS Y+
Sbjct  122   LGESIHGHAAKLGFLSDNFVGNSLIVMYSDFGEMGAARIAFDEIYCHCVVSWTVLISGYA  181

Query  558   RKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVS  379
             +KGDV+ AR VFDE  +KDR +WG+MISGYVQN+CFKEGL+LFRLMQ++G++ DEA  VS
Sbjct  182   KKGDVYSARSVFDEARLKDRGIWGAMISGYVQNSCFKEGLKLFRLMQLSGIKPDEANFVS  241

Query  378   ILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERD  199
             +L ACAHLGSL+IGKW+H YV K+GM ++V+LGTAL+DMY+KCGCL LA+++F +LP RD
Sbjct  242   VLCACAHLGSLEIGKWIHIYVGKVGMRVSVKLGTALIDMYSKCGCLDLAEQVFDKLPHRD  301

Query  198   VICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLL  19
             VICWN MISG+AMNGDGE+A+RLF +M+   G RPD VTFVSLF+ACS SGMA EGL+LL
Sbjct  302   VICWNTMISGYAMNGDGESALRLFDKMEK-LGVRPDNVTFVSLFSACSYSGMAKEGLRLL  360



>ref|XP_008221533.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Prunus mume]
Length=526

 Score =   464 bits (1193),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 222/361 (61%), Positives = 290/361 (80%), Gaps = 1/361 (0%)
 Frame = -2

Query  1086  RClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQ  907
             RCL+LLEKCKN+K L QAH QV TCGLGN++FALSR+LAFCSDPN G+ ++ W++++ I 
Sbjct  12    RCLQLLEKCKNMKHLQQAHAQVFTCGLGNSSFALSRVLAFCSDPNHGSLSHAWKLFQHIP  71

Query  906   QPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRS  727
             QPTICI NTM+KA LL+ +L  T+ ++  ML+ GM PDNYTLPY+LKAC  ++S  LG  
Sbjct  72    QPTICIYNTMLKALLLRNDLILTINVFTKMLQNGMYPDNYTLPYVLKACARLQSSCLGEL  131

Query  726   IHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGD  547
             +HG  LK GF+ D +VGNSLIVMY + DDM++A+ +FDE+PS   V+WTV+IS +S+ GD
Sbjct  132   VHGCSLKLGFVSDIFVGNSLIVMYCAFDDMKAARHIFDEIPSLNAVSWTVMISGHSKAGD  191

Query  546   VFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSA  367
             +  ARL FDE PV+DR +WG+MISGYVQNNCFKEGL +FRLMQ+T ++ DEAI VS+L A
Sbjct  192   LDTARLFFDEAPVRDRGIWGAMISGYVQNNCFKEGLYMFRLMQLTEIEPDEAIFVSVLCA  251

Query  366   CAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICW  187
             CAHLG+LD G W+H Y+ +L + ++VRL T L+DMYAKCG L LA+ LFY++P+RD +CW
Sbjct  252   CAHLGALDTGIWIHSYLNRLRLPLSVRLSTGLIDMYAKCGKLDLARGLFYQMPKRDTVCW  311

Query  186   NAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIG  7
             NAMISG AM+GDGE A+ LFREM+  A  RPD +TF+++FTACS SGMAHEG+K+ +K+ 
Sbjct  312   NAMISGMAMHGDGEGALELFREMEA-AWVRPDDITFIAVFTACSYSGMAHEGMKVFDKMC  370

Query  6     R  4
             R
Sbjct  371   R  371



>ref|XP_010259128.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
isoform X1 [Nelumbo nucifera]
Length=520

 Score =   463 bits (1192),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 282/344 (82%), Gaps = 1/344 (0%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              QAH Q+IT GLGN+ FALSR+LAFCS+P+ G+  +  +I+ERI++PT+CI NTMIKAFL
Sbjct  21    KQAHAQIITNGLGNDNFALSRVLAFCSNPHYGSLNHALQIFERIEKPTMCICNTMIKAFL  80

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
             LKGEL + +++Y  ML+ G+ PDNYTLPY+LKAC N+++  LG  IH   LK GFL D +
Sbjct  81    LKGELIKIIKVYTRMLQEGLYPDNYTLPYMLKACKNLQNSVLGEQIHVHGLKLGFLFDIF  140

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             VGN++I+MYS+   ME+A  +FDE+P R  V+WT++IS Y+R+GD+  ARL+FDE P+KD
Sbjct  141   VGNTMILMYSACGMMEAAARIFDEIPHRTAVSWTIMISGYARQGDIDTARLIFDEAPMKD  200

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
             R +WGS+ISGYVQNNCFKEGLQ+FR+MQ+T ++ DEA+ VS+L ACAHLG+LDIG W+HR
Sbjct  201   RGIWGSIISGYVQNNCFKEGLQMFRMMQLTNLEPDEAVFVSVLCACAHLGALDIGIWIHR  260

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y++++G+ + +RLGTAL+DMYA+CG L +A+KLF  + +RD ICWNAMISG A++GDGEN
Sbjct  261   YLDRIGLPLTIRLGTALIDMYARCGNLDIAKKLFDGMQQRDTICWNAMISGVAVHGDGEN  320

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             A++LF EM+  +G RP+ +TF+++FTACS SGMA+EGL L +K+
Sbjct  321   ALKLFLEMEK-SGFRPNDITFIAVFTACSYSGMAYEGLHLFKKM  363



>ref|XP_007222375.1| hypothetical protein PRUPE_ppa004015mg [Prunus persica]
 gb|EMJ23574.1| hypothetical protein PRUPE_ppa004015mg [Prunus persica]
Length=535

 Score =   462 bits (1190),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 221/361 (61%), Positives = 289/361 (80%), Gaps = 1/361 (0%)
 Frame = -2

Query  1086  RClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQ  907
             RCL+LLEKCKN+K L QAH QV TCGLGN++FALSR+LAFCSDPN G+ ++ W++++ I 
Sbjct  11    RCLQLLEKCKNMKHLQQAHAQVFTCGLGNSSFALSRVLAFCSDPNHGSLSHAWKLFQHIP  70

Query  906   QPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRS  727
             QPTICI NTM+KA LL+ +L  T+ ++  ML+ GM PDNYTLPY+LKAC  ++S  LG  
Sbjct  71    QPTICIYNTMLKALLLRNDLILTINVFTKMLQNGMYPDNYTLPYVLKACARLQSSCLGEL  130

Query  726   IHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGD  547
             +HG  LK GF+ D +VGNSLIVMY + DDM++A+ +FDE+PS   V+WTV+IS +S+ GD
Sbjct  131   VHGCSLKLGFVSDIFVGNSLIVMYCAFDDMKAARHIFDEIPSLSAVSWTVMISGHSKAGD  190

Query  546   VFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSA  367
             +  ARL FDE PV+DR +WG+MISGYVQNNCFKEGL +FRLMQ+T ++ DEAI VS+L A
Sbjct  191   LDTARLFFDEAPVRDRGIWGAMISGYVQNNCFKEGLYMFRLMQLTEIEPDEAIFVSVLCA  250

Query  366   CAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICW  187
             CAHLG+LD G W+H Y+ +L + ++VRL T L+DMYAKCG L LA+ LFY++P+RD +CW
Sbjct  251   CAHLGALDTGIWIHSYLNRLRLPLSVRLSTGLIDMYAKCGKLDLARGLFYQMPKRDTVCW  310

Query  186   NAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIG  7
             NAMISG A +GDGE A+ LFREM+  A  RPD +TF+++FTACS SGMAHEG+K+ +K+ 
Sbjct  311   NAMISGMATHGDGEGALELFREMEA-AWVRPDDITFIAVFTACSYSGMAHEGMKVFDKMC  369

Query  6     R  4
             R
Sbjct  370   R  370



>ref|XP_010035219.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Eucalyptus grandis]
Length=518

 Score =   446 bits (1148),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 214/364 (59%), Positives = 277/364 (76%), Gaps = 1/364 (0%)
 Frame = -2

Query  1101  STSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRI  922
             S S  RCL LLEKCK ++ L +AHGQVITCGLG+N+FALSRLLAFC+DP  G+  Y W +
Sbjct  3     SASGRRCLLLLEKCKTMRHLREAHGQVITCGLGSNSFALSRLLAFCADPRHGSVHYAWEL  62

Query  921   YERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESC  742
             + RIQ PTICI NT+IKAFLL  E   T+ +Y  +L  G CPDNYT+PY+LKAC  +   
Sbjct  63    FRRIQMPTICIYNTIIKAFLLNNEFFSTVSLYNRLLMRGFCPDNYTIPYVLKACAKLHDH  122

Query  741   NLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRY  562
              LG S+HG  +K G L D +VGNSLI MY     M +A+  FDE+P RCV++WT++IS Y
Sbjct  123   YLGESVHGHGIKVGLLSDIFVGNSLISMYCEHKSMRAARKAFDEIPRRCVISWTIMISAY  182

Query  561   SRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILV  382
             ++ GDV  AR++FDE   KD+ +WG+MISGYVQN C KEGL +FRLMQ+ GV+ DE++LV
Sbjct  183   AKLGDVDSARVLFDEVTEKDKGIWGAMISGYVQNGCVKEGLYMFRLMQLNGVEPDESVLV  242

Query  381   SILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPER  202
             S LSACAHLG+LDIG W+HRYV +  + ++ RL T L+DMYAKCG + +A+KLF E+PE+
Sbjct  243   STLSACAHLGALDIGIWIHRYVNRWRLTLSSRLCTGLIDMYAKCGYIDIAKKLFDEMPEK  302

Query  201   DVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKL  22
             D ICWNAMISG+A NGDGE+A++LF EM+N    +PD +TF+S+FTAC+ SG+  EGL+L
Sbjct  303   DNICWNAMISGYAFNGDGESALKLFTEMEN-GSIQPDDITFISIFTACNHSGLPREGLRL  361

Query  21    LEKI  10
             L K+
Sbjct  362   LYKM  365


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/215 (27%), Positives = 94/215 (44%), Gaps = 30/215 (14%)
 Frame = -2

Query  558  RKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVS  379
            R G V  A  +F    +    ++ ++I  ++ NN F   + L+  + M G   D   +  
Sbjct  52   RHGSVHYAWELFRRIQMPTICIYNTIIKAFLLNNEFFSTVSLYNRLLMRGFCPDNYTIPY  111

Query  378  ILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERD  199
            +L ACA L    +G+ VH +  K+G+  ++ +G +L+ MY +   +  A+K F E+P R 
Sbjct  112  VLKACAKLHDHYLGESVHGHGIKVGLLSDIFVGNSLISMYCEHKSMRAARKAFDEIPRRC  171

Query  198  VICWNAMISGFAMNGDGENAMRLFREM----------------QNDA-------------  106
            VI W  MIS +A  GD ++A  LF E+                QN               
Sbjct  172  VISWTIMISAYAKLGDVDSARVLFDEVTEKDKGIWGAMISGYVQNGCVKEGLYMFRLMQL  231

Query  105  -GTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             G  PD    VS  +AC+  G    G+ +   + R
Sbjct  232  NGVEPDESVLVSTLSACAHLGALDIGIWIHRYVNR  266



>ref|XP_008389431.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Malus domestica]
 ref|XP_008350909.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Malus domestica]
Length=536

 Score =   447 bits (1149),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 226/368 (61%), Positives = 289/368 (79%), Gaps = 1/368 (0%)
 Frame = -2

Query  1107  SLSTSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGW  928
             S S++T RCL+LLEKCKN+K L QAH QV T GLG+N+FALSRLLAFCSDP  G+ ++ W
Sbjct  5     SSSSTTSRCLQLLEKCKNMKHLQQAHAQVFTSGLGSNSFALSRLLAFCSDPRHGSLSHAW  64

Query  927   RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
             ++++ I QPT+CI NTM+K+ LL+ EL  T+ ++  ML+ GMCPDNYTLPYL+KAC  M+
Sbjct  65    KLFQHIPQPTVCIYNTMLKSSLLRNELILTVHVFTKMLQNGMCPDNYTLPYLVKACARMQ  124

Query  747   SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
                LG  +HG CLK GF+ D +VGNSL+V Y + DDM+ A+ VFDEMPS  VV+WTV+IS
Sbjct  125   RSCLGELVHGLCLKLGFVSDIFVGNSLVVXYCASDDMKGARYVFDEMPSLSVVSWTVMIS  184

Query  567   RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
              +++ GD+  ARL FDE PV+DR +WG+MISGYVQN+CFKEGL LFRLMQ T ++ DEAI
Sbjct  185   GFAKVGDLNMARLFFDEAPVRDRGIWGAMISGYVQNSCFKEGLYLFRLMQFTDIEPDEAI  244

Query  387   LVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP  208
              VSIL ACAHLG+LD G W+H Y+ +L + ++VRL T L+DMYAKCG L LA+ LF E+ 
Sbjct  245   FVSILCACAHLGALDTGIWIHSYLNRLRLRLSVRLSTGLIDMYAKCGRLELARGLFDEML  304

Query  207   ERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGL  28
             +RD +CWNAMISG AM+GDGE A+ LFREM+  A  RPD VTF++LFTACS SGMA EG+
Sbjct  305   QRDTVCWNAMISGMAMHGDGEGALELFREMEA-ARVRPDDVTFIALFTACSYSGMADEGM  363

Query  27    KLLEKIGR  4
             K+ +K+ R
Sbjct  364   KVFDKMCR  371



>gb|KCW46505.1| hypothetical protein EUGRSUZ_K00330 [Eucalyptus grandis]
Length=500

 Score =   445 bits (1145),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 202/343 (59%), Positives = 263/343 (77%), Gaps = 1/343 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             +AHGQVITCGLG+N+FALSRLLAFC+DP  G+  Y W ++ RIQ PTICI NT+IKAFLL
Sbjct  6     EAHGQVITCGLGSNSFALSRLLAFCADPRHGSVHYAWELFRRIQMPTICIYNTIIKAFLL  65

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               E   T+ +Y  +L  G CPDNYT+PY+LKAC  +    LG S+HG  +K G L D +V
Sbjct  66    NNEFFSTVSLYNRLLMRGFCPDNYTIPYVLKACAKLHDHYLGESVHGHGIKVGLLSDIFV  125

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
             GNSLI MY     M +A+  FDE+P RCV++WT++IS Y++ GDV  AR++FDE   KD+
Sbjct  126   GNSLISMYCEHKSMRAARKAFDEIPRRCVISWTIMISAYAKLGDVDSARVLFDEVTEKDK  185

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
              +WG+MISGYVQN C KEGL +FRLMQ+ GV+ DE++LVS LSACAHLG+LDIG W+HRY
Sbjct  186   GIWGAMISGYVQNGCVKEGLYMFRLMQLNGVEPDESVLVSTLSACAHLGALDIGIWIHRY  245

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V +  + ++ RL T L+DMYAKCG + +A+KLF E+PE+D ICWNAMISG+A NGDGE+A
Sbjct  246   VNRWRLTLSSRLCTGLIDMYAKCGYIDIAKKLFDEMPEKDNICWNAMISGYAFNGDGESA  305

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             ++LF EM+N    +PD +TF+S+FTAC+ SG+  EGL+LL K+
Sbjct  306   LKLFTEMEN-GSIQPDDITFISIFTACNHSGLPREGLRLLYKM  347


 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/215 (27%), Positives = 94/215 (44%), Gaps = 30/215 (14%)
 Frame = -2

Query  558  RKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVS  379
            R G V  A  +F    +    ++ ++I  ++ NN F   + L+  + M G   D   +  
Sbjct  34   RHGSVHYAWELFRRIQMPTICIYNTIIKAFLLNNEFFSTVSLYNRLLMRGFCPDNYTIPY  93

Query  378  ILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERD  199
            +L ACA L    +G+ VH +  K+G+  ++ +G +L+ MY +   +  A+K F E+P R 
Sbjct  94   VLKACAKLHDHYLGESVHGHGIKVGLLSDIFVGNSLISMYCEHKSMRAARKAFDEIPRRC  153

Query  198  VICWNAMISGFAMNGDGENAMRLFREM----------------QNDA-------------  106
            VI W  MIS +A  GD ++A  LF E+                QN               
Sbjct  154  VISWTIMISAYAKLGDVDSARVLFDEVTEKDKGIWGAMISGYVQNGCVKEGLYMFRLMQL  213

Query  105  -GTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             G  PD    VS  +AC+  G    G+ +   + R
Sbjct  214  NGVEPDESVLVSTLSACAHLGALDIGIWIHRYVNR  248



>ref|XP_009356368.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Pyrus x bretschneideri]
Length=536

 Score =   446 bits (1146),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 224/366 (61%), Positives = 287/366 (78%), Gaps = 1/366 (0%)
 Frame = -2

Query  1101  STSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRI  922
             +++T RCL+LLEKCKN+K L QAH QV T GLG+N+FALSRLLAFCSDP  G+ ++ W++
Sbjct  7     NSTTSRCLQLLEKCKNMKHLQQAHAQVFTSGLGSNSFALSRLLAFCSDPRHGSLSHAWKL  66

Query  921   YERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESC  742
             ++ I QPT+CI NTM+K+ LL+ EL  T+ ++  ML+ GMCPDNYTLPYLLKAC  M+  
Sbjct  67    FQHIPQPTVCIYNTMLKSSLLRNELILTVNVFTKMLQNGMCPDNYTLPYLLKACARMQRS  126

Query  741   NLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRY  562
              LG  +HG CLK GF+ D +VGNSL+ MY + DDM+ A+ VFDEMPS  VV+WTV+IS +
Sbjct  127   CLGELVHGFCLKLGFVSDIFVGNSLVAMYCAFDDMKGARYVFDEMPSLSVVSWTVMISGF  186

Query  561   SRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILV  382
             ++ GD+  ARL FDE PV+DR +WG+MISGYVQN+CFKEGL LFRLMQ T ++ DEAI V
Sbjct  187   AKVGDLDMARLFFDEAPVRDRGIWGAMISGYVQNSCFKEGLYLFRLMQFTDIEPDEAIFV  246

Query  381   SILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPER  202
             S+L ACAHLG+LD G W+H Y+ +L + ++VRL T L DMYAKCG L LA+ LF E+ +R
Sbjct  247   SVLCACAHLGALDTGIWIHSYLNRLRLRLSVRLSTGLNDMYAKCGRLELARGLFDEMLQR  306

Query  201   DVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKL  22
             D +CWNAMISG AM+GDGE A+ LFREM+ DA  RPD VTF++LFTACS S MA EG+K+
Sbjct  307   DTVCWNAMISGMAMHGDGEGALELFREME-DAMVRPDDVTFIALFTACSYSSMADEGMKV  365

Query  21    LEKIGR  4
              +K+ R
Sbjct  366   FDKMHR  371



>ref|XP_003520106.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Glycine max]
Length=518

 Score =   442 bits (1137),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 213/365 (58%), Positives = 279/365 (76%), Gaps = 1/365 (0%)
 Frame = -2

Query  1104  LSTSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWR  925
             +S+ + RCL LLEKCKN+  L QAH QV T GL  NTFALSRLLAFCS P  G+ TY  R
Sbjct  1     MSSCSKRCLVLLEKCKNVNHLKQAHAQVFTTGLDTNTFALSRLLAFCSHPYQGSLTYACR  60

Query  924   IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
             ++ERI  PT+CI NT+IK FL+ G    T  ++  ML  G+ PDNYT+PY+LKAC  +  
Sbjct  61    VFERIHHPTLCICNTIIKTFLVNGNFYGTFHVFTKMLHNGLGPDNYTIPYVLKACAALRD  120

Query  744   CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
             C+LG+ +HG   K G + D +VGNSL+ MYS   D+ +A+ VFDEMP    V+W+V+IS 
Sbjct  121   CSLGKMVHGYSSKLGLVFDIFVGNSLMAMYSVCGDVIAARHVFDEMPRLSAVSWSVMISG  180

Query  564   YSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAIL  385
             Y++ GDV  ARL FDE P KDR +WG+MISGYVQN+CFKEGL LFRL+Q+T V  DE+I 
Sbjct  181   YAKVGDVDSARLFFDEAPEKDRGIWGAMISGYVQNSCFKEGLYLFRLLQLTHVVPDESIF  240

Query  384   VSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPE  205
             VSILSACAHLG+LDIG W+HRY+ +  +++++RL T+L+DMYAKCG L LA++LF  +PE
Sbjct  241   VSILSACAHLGALDIGIWIHRYLNRKTVSLSIRLSTSLLDMYAKCGNLELAKRLFDSMPE  300

Query  204   RDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLK  25
             RD++CWNAMISG AM+GDG +A+++F EM+   G +PD +TF+++FTACS SGMAHEGL+
Sbjct  301   RDIVCWNAMISGLAMHGDGASALKMFSEMEK-TGIKPDDITFIAVFTACSYSGMAHEGLQ  359

Query  24    LLEKI  10
             LL+K+
Sbjct  360   LLDKM  364


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/214 (27%), Positives = 93/214 (43%), Gaps = 30/214 (14%)
 Frame = -2

Query  555  KGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSI  376
            +G +  A  VF+        +  ++I  ++ N  F     +F  M   G+  D   +  +
Sbjct  52   QGSLTYACRVFERIHHPTLCICNTIIKTFLVNGNFYGTFHVFTKMLHNGLGPDNYTIPYV  111

Query  375  LSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDV  196
            L ACA L    +GK VH Y  KLG+  ++ +G +L+ MY+ CG +  A+ +F E+P    
Sbjct  112  LKACAALRDCSLGKMVHGYSSKLGLVFDIFVGNSLMAMYSVCGDVIAARHVFDEMPRLSA  171

Query  195  ICWNAMISGFAMNGDGENAMRLFREM-QNDAG----------------------------  103
            + W+ MISG+A  GD ++A   F E  + D G                            
Sbjct  172  VSWSVMISGYAKVGDVDSARLFFDEAPEKDRGIWGAMISGYVQNSCFKEGLYLFRLLQLT  231

Query  102  -TRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
               PD   FVS+ +AC+  G    G+ +   + R
Sbjct  232  HVVPDESIFVSILSACAHLGALDIGIWIHRYLNR  265



>ref|XP_010096577.1| hypothetical protein L484_004253 [Morus notabilis]
 gb|EXB65077.1| hypothetical protein L484_004253 [Morus notabilis]
Length=508

 Score =   441 bits (1133),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 203/346 (59%), Positives = 269/346 (78%), Gaps = 2/346 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             ++H  V+T GLG NTFALSRLLAFCSDP+ G+P + W+I++ IQQPTICI NT++KAFLL
Sbjct  6     KSHALVLTTGLGTNTFALSRLLAFCSDPHRGSPFHAWKIFQNIQQPTICIWNTVLKAFLL  65

Query  858   KGELSRTMEMYKHMLKTG-MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
               EL +T+ +YK ML +  + PDNYTLPY+LKAC  ++S  LG S+HG  LK G   D +
Sbjct  66    NDELIQTINIYKEMLHSSNIAPDNYTLPYVLKACSRLQSACLGVSVHGHGLKSGLAFDLF  125

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             VGNSLIVMYS   +ME+A+ VFDEMPS   V+W V+IS Y + G+V + RL FD  PV+D
Sbjct  126   VGNSLIVMYSEFRNMEAARQVFDEMPSLSTVSWMVMISGYGKVGEVDKERLFFDLAPVRD  185

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
             R +WG+MISGYVQN CFKEGL LFRLMQ   ++ DEAI VS+L  CAHLG+LD+G W+HR
Sbjct  186   RGIWGAMISGYVQNACFKEGLYLFRLMQCAEIEPDEAIFVSVLCGCAHLGALDVGVWIHR  245

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y+++LG+ ++VRLGT LVDMYAKCG L LA+ +F ++P++D +CWNAMIS  AM+GDG+ 
Sbjct  246   YLDRLGLPLSVRLGTGLVDMYAKCGNLDLARMVFEKMPQKDTVCWNAMISAMAMHGDGDT  305

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             A  LF EM+ +AG RPD +TF+++ TACS SG A+EG+++L+++ R
Sbjct  306   AFELFEEME-EAGVRPDDITFIAILTACSYSGRAYEGMRMLDRMCR  350



>ref|XP_007045928.1| Pentatricopeptide repeat-containing protein [Theobroma cacao]
 gb|EOY01760.1| Pentatricopeptide repeat-containing protein [Theobroma cacao]
Length=523

 Score =   434 bits (1117),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 210/365 (58%), Positives = 284/365 (78%), Gaps = 1/365 (0%)
 Frame = -2

Query  1104  LSTSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWR  925
             +S+S+ RCLKLLE+CKN+ QL QAH   ITCGLG N+FALSRLLAFC++PN G+ TY   
Sbjct  1     MSSSSRRCLKLLERCKNMNQLRQAHAHAITCGLGTNSFALSRLLAFCANPNRGSVTYACN  60

Query  924   IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
             +++RI+ PTICI NTMIKA  LKGE+ +T+E+Y +ML  GM PDNYTLPY+LKAC  ++ 
Sbjct  61    LFQRIENPTICICNTMIKALFLKGEIFKTIELYNNMLDKGMHPDNYTLPYVLKACAKLQY  120

Query  744   CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
                G  ++G CLK GF+ D +VGN+LI M+ + D+++ A+ +FDE+P    V+WTV+IS 
Sbjct  121   FYFGELVYGHCLKLGFVFDIFVGNALIAMFCAFDNVKVARYIFDEIPWPDFVSWTVMISG  180

Query  564   YSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAIL  385
             Y + GD+  ARL+FDE  VKD  +WG+MISGYV+NNCFKEGL +FRLMQM+ ++ DEAI 
Sbjct  181   YGKIGDIDTARLLFDEASVKDAGIWGAMISGYVKNNCFKEGLYMFRLMQMSDIEPDEAIY  240

Query  384   VSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPE  205
             VS+L ACAHLG+LD G W+H+Y+ K    +++RL T L+DMYAKCG L +A+KLF  + +
Sbjct  241   VSVLCACAHLGALDTGIWIHKYLGKQKFPLSLRLSTCLLDMYAKCGNLDIAKKLFDGMQQ  300

Query  204   RDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLK  25
             RDV+ WNAMISG AM+GDGE+A+ LF +M+ D G RPD +TF+++F+ACS SGMA EGL 
Sbjct  301   RDVVSWNAMISGMAMHGDGESALELFWQMEKD-GVRPDDITFIAVFSACSYSGMAFEGLT  359

Query  24    LLEKI  10
             +L+++
Sbjct  360   ILDRM  364


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 81/186 (44%), Gaps = 31/186 (17%)
 Frame = -2

Query  471  YVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAIN  292
            +++   FK  ++L+  M   G+  D   L  +L ACA L     G+ V+ +  KLG   +
Sbjct  81   FLKGEIFKT-IELYNNMLDKGMHPDNYTLPYVLKACAKLQYFYFGELVYGHCLKLGFVFD  139

Query  291  VRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQ-  115
            + +G AL+ M+     + +A+ +F E+P  D + W  MISG+   GD + A  LF E   
Sbjct  140  IFVGNALIAMFCAFDNVKVARYIFDEIPWPDFVSWTVMISGYGKIGDIDTARLLFDEASV  199

Query  114  NDAGT-----------------------------RPDGVTFVSLFTACSCSGMAHEGLKL  22
             DAG                               PD   +VS+  AC+  G    G+ +
Sbjct  200  KDAGIWGAMISGYVKNNCFKEGLYMFRLMQMSDIEPDEAIYVSVLCACAHLGALDTGIWI  259

Query  21   LEKIGR  4
             + +G+
Sbjct  260  HKYLGK  265


 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 56/276 (20%), Positives = 113/276 (41%), Gaps = 46/276 (17%)
 Frame = -2

Query  891  IVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQC  712
            I   MI  ++        + M++ M  + + PD      +L AC ++ + + G  IH   
Sbjct  204  IWGAMISGYVKNNCFKEGLYMFRLMQMSDIEPDEAIYVSVLCACAHLGALDTGIWIH---  260

Query  711  LKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEAR  532
                     Y+G     +   L                     T L+  Y++ G++  A+
Sbjct  261  --------KYLGKQKFPLSLRLS--------------------TCLLDMYAKCGNLDIAK  292

Query  531  LVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLG  352
             +FD    +D   W +MISG   +   +  L+LF  M+  GV+ D+   +++ SAC++ G
Sbjct  293  KLFDGMQQRDVVSWNAMISGMAMHGDGESALELFWQMEKDGVRPDDITFIAVFSACSYSG  352

Query  351  SLDIGKWVHRYVEKLGMAINVRLGTA----LVDMYAKCGCLGLAQKLFYELPER-----D  199
                G  +   ++++    N+   +     ++D+ ++ G    A K+   +P+      +
Sbjct  353  MAFEGLTI---LDRMCKVYNIEPKSEHFGCIIDLLSRGGLFEEANKIIQRMPDSSNPSDE  409

Query  198  VICWNAMISGFAMNGD---GENAMRLFREMQNDAGT  100
             I W A++S    NG     E A     ++++ +G 
Sbjct  410  AIAWRALLSSCCSNGQTKLAEVAAEKLMQLEDHSGV  445



>ref|XP_007157581.1| hypothetical protein PHAVU_002G081200g [Phaseolus vulgaris]
 gb|ESW29575.1| hypothetical protein PHAVU_002G081200g [Phaseolus vulgaris]
Length=517

 Score =   431 bits (1107),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 213/365 (58%), Positives = 280/365 (77%), Gaps = 1/365 (0%)
 Frame = -2

Query  1104  LSTSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWR  925
             +S+ + RCL LLEKCKN+K L QAH QV T GL  NT+ALSRLLAFCS PN G+ TY  R
Sbjct  1     MSSCSKRCLVLLEKCKNMKHLKQAHAQVFTTGLHINTYALSRLLAFCSYPNQGSLTYACR  60

Query  924   IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
             +++ I  PT+CI NT IK FLL  +   T+ ++  ML++G+ PDNYT PY+LKAC  + S
Sbjct  61    LFQHIHHPTLCICNTFIKTFLLNAKFYATLHVFTKMLQSGLYPDNYTTPYVLKACAALHS  120

Query  744   CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
              +LG+ +HG   K G + D +VGNSL+ MYS   D+ +A+ VFDE+P    V+W+V+IS 
Sbjct  121   RSLGQMVHGYSSKAGLVYDIFVGNSLMAMYSVCGDVVAARYVFDEIPRLSAVSWSVMISG  180

Query  564   YSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAIL  385
             Y++ GDV  ARL FDE P KDR +WG+MISGYVQN+CFKEGL LFRL+Q+T V  DE+I 
Sbjct  181   YAKVGDVDSARLFFDEAPEKDRGIWGAMISGYVQNSCFKEGLYLFRLLQLTEVVPDESIC  240

Query  384   VSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPE  205
             VSILSACAHLG+LDIG W+HRY+ +  + +++RL T+L+DMYAKCG L LA++LF  +PE
Sbjct  241   VSILSACAHLGALDIGIWIHRYLNRAAVPLSIRLSTSLLDMYAKCGNLDLAKRLFDLMPE  300

Query  204   RDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLK  25
             RD++CWNAMISG AM+GDG +A+++F +M+  AG RPD VTF+++FTACS SGMAHEGL+
Sbjct  301   RDIVCWNAMISGTAMHGDGASALKMFSDMEK-AGIRPDDVTFIAVFTACSYSGMAHEGLQ  359

Query  24    LLEKI  10
             LL K+
Sbjct  360   LLCKM  364



>gb|KHN02018.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=518

 Score =   431 bits (1107),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 209/365 (57%), Positives = 275/365 (75%), Gaps = 1/365 (0%)
 Frame = -2

Query  1104  LSTSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWR  925
             +S+   RCL LLEKCKN+  L QAH QV T GL  NTFALSRLLAFCS P  G+ TY  R
Sbjct  1     MSSCGKRCLVLLEKCKNVNHLKQAHAQVFTTGLDTNTFALSRLLAFCSHPYQGSLTYACR  60

Query  924   IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
             ++ERI  PT+CI NT+IK FLL G    T  ++  ML  G+ PDNYT+PY+LKAC  +  
Sbjct  61    VFERIHHPTLCICNTIIKTFLLNGNFYGTFHVFTKMLHNGLGPDNYTIPYVLKACAALRD  120

Query  744   CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
             C+LG+ +HG   K G + D +VGNSL+ MYS   D+ +A+ VFDEMP    V+W+V+IS 
Sbjct  121   CSLGKMVHGYSSKLGLVFDIFVGNSLMAMYSVCGDVIAARHVFDEMPRLSAVSWSVMISG  180

Query  564   YSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAIL  385
             Y++ GDV  ARL FDE P KDR +WG+MISGYVQN+CFKEGL LFRL+Q+T V  DE+I 
Sbjct  181   YAKVGDVDSARLFFDEAPEKDRGIWGAMISGYVQNSCFKEGLYLFRLLQLTHVVPDESIF  240

Query  384   VSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPE  205
             VSILSACAHLG+LDIG W+HRY+ +  +++++RL T+L+D+YAKC  L L ++LF  +PE
Sbjct  241   VSILSACAHLGALDIGIWIHRYLNRKTVSLSIRLSTSLLDIYAKCRNLELTKRLFNSMPE  300

Query  204   RDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLK  25
             R+++ WNAMISG AM+GDG +A+++F EM+   G +PD +TF+++FTACS SGMAHEGL+
Sbjct  301   RNIVFWNAMISGLAMHGDGASALKMFSEMEK-TGIKPDDITFIAVFTACSYSGMAHEGLQ  359

Query  24    LLEKI  10
             LL+K+
Sbjct  360   LLDKM  364


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/214 (27%), Positives = 93/214 (43%), Gaps = 30/214 (14%)
 Frame = -2

Query  555  KGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSI  376
            +G +  A  VF+        +  ++I  ++ N  F     +F  M   G+  D   +  +
Sbjct  52   QGSLTYACRVFERIHHPTLCICNTIIKTFLLNGNFYGTFHVFTKMLHNGLGPDNYTIPYV  111

Query  375  LSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDV  196
            L ACA L    +GK VH Y  KLG+  ++ +G +L+ MY+ CG +  A+ +F E+P    
Sbjct  112  LKACAALRDCSLGKMVHGYSSKLGLVFDIFVGNSLMAMYSVCGDVIAARHVFDEMPRLSA  171

Query  195  ICWNAMISGFAMNGDGENAMRLFREM-QNDAG----------------------------  103
            + W+ MISG+A  GD ++A   F E  + D G                            
Sbjct  172  VSWSVMISGYAKVGDVDSARLFFDEAPEKDRGIWGAMISGYVQNSCFKEGLYLFRLLQLT  231

Query  102  -TRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
               PD   FVS+ +AC+  G    G+ +   + R
Sbjct  232  HVVPDESIFVSILSACAHLGALDIGIWIHRYLNR  265



>ref|XP_003614017.1| Pentatricopeptide repeat protein [Medicago truncatula]
 gb|AES96975.1| PPR containing plant-like protein [Medicago truncatula]
Length=525

 Score =   421 bits (1082),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 208/368 (57%), Positives = 280/368 (76%), Gaps = 4/368 (1%)
 Frame = -2

Query  1104  LSTSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNP--TYG  931
             +S+ST RCL LLEKCK++K L QAH QV T GL NNTFALSR+LAFCS     +   TY 
Sbjct  1     MSSSTKRCLVLLEKCKSMKHLKQAHAQVFTTGLENNTFALSRVLAFCSSHKHHHESLTYA  60

Query  930   WRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNM  751
              R++E+IQ PT+CI NT+IKAFL+  +    ++++  ML++ + PDNYT+PY+LKACG  
Sbjct  61    CRVFEQIQNPTVCIYNTLIKAFLVNNKFKSALQVFVKMLQSELKPDNYTIPYVLKACGTF  120

Query  750   ESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLI  571
               C+ G+ IHG   K G + D YVGNSL+ MY    D+ +A+ VFDE+PS  VV+W+V+I
Sbjct  121   HDCSFGKMIHGYSSKLGLVFDIYVGNSLMAMYCVFGDVVAARYVFDEIPSLNVVSWSVMI  180

Query  570   SRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEA  391
             S Y++ GDV  ARL FDE P KD+ +WG+MISGYVQN+CFKE L LFRLMQ+T +  DE+
Sbjct  181   SGYAKVGDVDSARLFFDEAPEKDKGIWGAMISGYVQNSCFKESLYLFRLMQLTDIVPDES  240

Query  390   ILVSILSACAHLGSLDIGKWVHRYVEKLGMA-INVRLGTALVDMYAKCGCLGLAQKLFYE  214
             I VSILSACAHLG+L+IG W+H+++ +L +  ++VRL T+L+DMYAKCG L LA++LF  
Sbjct  241   IFVSILSACAHLGALEIGVWIHQHLNQLKLVPLSVRLSTSLLDMYAKCGNLELAKRLFDS  300

Query  213   LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHE  34
             +  RDV+CWNAMISG AM+GDG+ A++LF +M+   G +PD +TF+++FTACS SGMA+E
Sbjct  301   MNMRDVVCWNAMISGMAMHGDGKGALKLFYDMEK-VGVKPDDITFIAVFTACSYSGMAYE  359

Query  33    GLKLLEKI  10
             GL LL+K+
Sbjct  360   GLMLLDKM  367



>ref|XP_004490153.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Cicer arietinum]
Length=523

 Score =   420 bits (1080),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 210/368 (57%), Positives = 282/368 (77%), Gaps = 4/368 (1%)
 Frame = -2

Query  1104  LSTSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNP--TYG  931
             +S+S+ RCL LLEKCKN+ QL QAH QV T GL NNTFALSR+LAFCS  +  +    Y 
Sbjct  1     MSSSSKRCLVLLEKCKNMNQLKQAHAQVFTTGLENNTFALSRVLAFCSSHSHHHGSLAYA  60

Query  930   WRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNM  751
             +R++ERI  PT+CI NT+IKAFLL G+ + T+ ++  ML+ G+ PDNYT+PY+LKAC  +
Sbjct  61    FRVFERIHDPTVCIYNTIIKAFLLNGKFNNTLHVFVKMLQKGLRPDNYTVPYVLKACAAL  120

Query  750   ESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLI  571
               C+LG+ +HG   K G + D +VGNSL+ MY    D+ +A+ VFDE+P   +V+W+V+I
Sbjct  121   HDCSLGKLVHGYGSKLGLVFDIFVGNSLMSMYVVFGDVVAARYVFDEIPCLSLVSWSVMI  180

Query  570   SRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEA  391
             S Y++ G+V  ARL FDE P KD+ +WG+MISGYVQN+CFKE L LFRLMQ+T +  DE+
Sbjct  181   SGYAKMGNVDSARLFFDEAPEKDKGIWGAMISGYVQNSCFKESLYLFRLMQLTDIVPDES  240

Query  390   ILVSILSACAHLGSLDIGKWVHRYVEKLGM-AINVRLGTALVDMYAKCGCLGLAQKLFYE  214
             I VSILSACAHLG+LDIG W+HRY+ +  M  ++VRL T+L+DMYAKCG L LA++LF  
Sbjct  241   IFVSILSACAHLGALDIGVWIHRYLNRSKMLPLSVRLSTSLLDMYAKCGNLELAKRLFDS  300

Query  213   LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHE  34
             + ERD++CWNAMISG AM+GDG+ A++LF +M+   G +PD +TF+++FTACS SGMA E
Sbjct  301   MQERDIVCWNAMISGMAMHGDGKGAVKLFYDMEK-VGMKPDDITFIAVFTACSYSGMAFE  359

Query  33    GLKLLEKI  10
             GLKLL+K+
Sbjct  360   GLKLLDKM  367


 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/196 (29%), Positives = 88/196 (45%), Gaps = 32/196 (16%)
 Frame = -2

Query  495  VWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYV  316
            ++ ++I  ++ N  F   L +F  M   G++ D   +  +L ACA L    +GK VH Y 
Sbjct  74   IYNTIIKAFLLNGKFNNTLHVFVKMLQKGLRPDNYTVPYVLKACAALHDCSLGKLVHGYG  133

Query  315  EKLGMAINVRLGTALVDMY-------------------------------AKCGCLGLAQ  229
             KLG+  ++ +G +L+ MY                               AK G +  A+
Sbjct  134  SKLGLVFDIFVGNSLMSMYVVFGDVVAARYVFDEIPCLSLVSWSVMISGYAKMGNVDSAR  193

Query  228  KLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCS  49
              F E PE+D   W AMISG+  N   + ++ LFR MQ      PD   FVS+ +AC+  
Sbjct  194  LFFDEAPEKDKGIWGAMISGYVQNSCFKESLYLFRLMQL-TDIVPDESIFVSILSACAHL  252

Query  48   GMAHEGLKLLEKIGRA  1
            G    G+ +   + R+
Sbjct  253  GALDIGVWIHRYLNRS  268



>ref|XP_008465705.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
isoform X1 [Cucumis melo]
 ref|XP_008465706.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
isoform X1 [Cucumis melo]
Length=532

 Score =   417 bits (1071),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 199/365 (55%), Positives = 271/365 (74%), Gaps = 1/365 (0%)
 Frame = -2

Query  1104  LSTSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWR  925
             +S+S+ RCL LL+KC N+  L QAH QV+T GL N+ F LS+LL FC++   G+ ++ ++
Sbjct  1     MSSSSKRCLLLLQKCINMNHLKQAHAQVLTSGLHNSNFVLSKLLNFCAESRNGSLSHAFK  60

Query  924   IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
             +++ IQ PTICI NTMIKA LL+GE    + ++  M + G+ PD YTLPY+LKA   M +
Sbjct  61    LFQHIQHPTICICNTMIKALLLRGEFLNAIVVFSAMFRNGIHPDTYTLPYVLKASARMTN  120

Query  744   CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
              +LG SIH   +K GF +D +VGNSL+VMY S D M SA+ VFDEMP    V+WTV+I  
Sbjct  121   IHLGESIHACTIKLGFAVDEFVGNSLLVMYRSFDKMTSARQVFDEMPELSAVSWTVMIYG  180

Query  564   YSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAIL  385
             Y+  GDV  AR +FD   VKD  +WG+MISGYVQNNCFKEGL +FRLMQ+T V+ DEAI+
Sbjct  181   YANMGDVDTARELFDMATVKDTGIWGAMISGYVQNNCFKEGLHMFRLMQLTEVEPDEAII  240

Query  384   VSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPE  205
             V+ILSACAH+G+LD G W+HRY+ +LG+++ +R+ T L+DMYAKCG L LA+ LF E+ +
Sbjct  241   VTILSACAHMGALDTGIWIHRYLGRLGLSLTLRVRTGLIDMYAKCGHLDLAKYLFNEMSQ  300

Query  204   RDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLK  25
             RD +CWNAMISG AM+GDGE A++LF EM+  AG +PD +TF+++  ACS SGM  EG++
Sbjct  301   RDNVCWNAMISGMAMDGDGEGAIKLFMEMEK-AGIKPDNITFIAVLAACSNSGMVDEGIR  359

Query  24    LLEKI  10
             +  ++
Sbjct  360   IWNRM  364



>ref|XP_004143828.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Cucumis sativus]
 gb|KGN51188.1| hypothetical protein Csa_5G485180 [Cucumis sativus]
Length=532

 Score =   411 bits (1057),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/365 (54%), Positives = 269/365 (74%), Gaps = 1/365 (0%)
 Frame = -2

Query  1104  LSTSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWR  925
             +S+S+ RCL LL KC N+ QL QAH QV+  GL N+ F LSRLL FC++   G+ ++ ++
Sbjct  1     MSSSSKRCLLLLHKCINMNQLKQAHAQVLKSGLHNSNFVLSRLLNFCAESRNGSLSHAFK  60

Query  924   IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
             +++ IQ PTICI NTMIKA LL+GE    + ++  + + G+ PD YTLPY+LKA   M +
Sbjct  61    LFQHIQHPTICIFNTMIKALLLRGEFLNAIAVFSAIFRNGIHPDTYTLPYVLKASARMTN  120

Query  744   CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
              +LG SIH   +K G  ++ +VGNSL+VMY S D+M SA+ VFDEMP    V+WTV+I  
Sbjct  121   IHLGESIHACTIKLGSAVNEFVGNSLLVMYRSFDNMRSARQVFDEMPELSAVSWTVMIYG  180

Query  564   YSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAIL  385
             Y+  GDV  AR +FD   VKD  +WG+MISGYVQNNCFKEGL +FRLMQ+T V+ DEAI+
Sbjct  181   YANMGDVDTARELFDMATVKDTGIWGAMISGYVQNNCFKEGLHMFRLMQLTEVEPDEAII  240

Query  384   VSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPE  205
             V+ILSACAH+G+LD G W+HRY+ +LG+ + +R+ T L+DMYAKCG L LA+ LF E+ +
Sbjct  241   VTILSACAHMGALDTGIWIHRYLGRLGLPLTLRVSTGLIDMYAKCGHLDLAKYLFNEMSQ  300

Query  204   RDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLK  25
             RD +CWNAMISG AM+GDGE A++LF EM+  AG +PD +TF+++  ACS SGM  EG++
Sbjct  301   RDNVCWNAMISGMAMDGDGEGAIKLFMEMEK-AGIKPDNITFIAVLAACSNSGMVDEGIR  359

Query  24    LLEKI  10
             +  ++
Sbjct  360   IWNRM  364


 Score = 71.2 bits (173),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 90/216 (42%), Gaps = 30/216 (14%)
 Frame = -2

Query  561  SRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILV  382
            SR G +  A  +F         ++ +MI   +    F   + +F  +   G+  D   L 
Sbjct  50   SRNGSLSHAFKLFQHIQHPTICIFNTMIKALLLRGEFLNAIAVFSAIFRNGIHPDTYTLP  109

Query  381  SILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPER  202
             +L A A + ++ +G+ +H    KLG A+N  +G +L+ MY     +  A+++F E+PE 
Sbjct  110  YVLKASARMTNIHLGESIHACTIKLGSAVNEFVGNSLLVMYRSFDNMRSARQVFDEMPEL  169

Query  201  DVICWNAMISGFAMNGDGENAMRLFR----------------EMQND-------------  109
              + W  MI G+A  GD + A  LF                  +QN+             
Sbjct  170  SAVSWTVMIYGYANMGDVDTARELFDMATVKDTGIWGAMISGYVQNNCFKEGLHMFRLMQ  229

Query  108  -AGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
                 PD    V++ +AC+  G    G+ +   +GR
Sbjct  230  LTEVEPDEAIIVTILSACAHMGALDTGIWIHRYLGR  265



>ref|XP_004157334.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At2g20540-like [Cucumis sativus]
Length=532

 Score =   410 bits (1055),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 197/365 (54%), Positives = 270/365 (74%), Gaps = 1/365 (0%)
 Frame = -2

Query  1104  LSTSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWR  925
             +S+S+ RCL LL KC N+ QL QAH QV+  GL N+ F LSRLL FC++   G+ ++ ++
Sbjct  1     MSSSSKRCLLLLHKCINMNQLKQAHAQVLKSGLHNSNFVLSRLLNFCAESRNGSLSHAFK  60

Query  924   IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
             +++ IQ PTICI NTMIKA LL+GE    + ++  + + G+ PD YTLPY+LKA   M +
Sbjct  61    LFQHIQHPTICIFNTMIKALLLRGEFLNAIAVFSAIFRNGIHPDTYTLPYVLKASARMTN  120

Query  744   CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
              +LG SIH   +K G  ++ +VGNSL+VMY S D+M SA+ VFDEMP    V+WTV+I  
Sbjct  121   IHLGESIHACTIKLGSAVNEFVGNSLLVMYRSFDNMRSARQVFDEMPELSAVSWTVMIYG  180

Query  564   YSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAIL  385
             Y+  GDV  AR +FD   VKD  +WG+MISGYVQNNCFKEGL +FRLMQ+T V+ DEAI+
Sbjct  181   YANMGDVDTARELFDMATVKDTGIWGAMISGYVQNNCFKEGLHMFRLMQLTEVEPDEAII  240

Query  384   VSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPE  205
             V+ILSACAH+G+LD G W+HRY+ +LG+ + +R+ T L+DMYAKCG L LA+ LF E+ +
Sbjct  241   VTILSACAHMGALDTGIWIHRYLGRLGLPLTLRVSTGLIDMYAKCGHLDLAKYLFNEMSQ  300

Query  204   RDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLK  25
             RD +CWNAMISG AM+GDGE A++LF EM+  AG +PD +TF++++ ACS SGM  EG++
Sbjct  301   RDNVCWNAMISGMAMDGDGEGAIKLFMEMEK-AGIKPDNITFIAVWXACSNSGMVDEGIR  359

Query  24    LLEKI  10
             +  ++
Sbjct  360   IWNRM  364


 Score = 71.2 bits (173),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 90/216 (42%), Gaps = 30/216 (14%)
 Frame = -2

Query  561  SRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILV  382
            SR G +  A  +F         ++ +MI   +    F   + +F  +   G+  D   L 
Sbjct  50   SRNGSLSHAFKLFQHIQHPTICIFNTMIKALLLRGEFLNAIAVFSAIFRNGIHPDTYTLP  109

Query  381  SILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPER  202
             +L A A + ++ +G+ +H    KLG A+N  +G +L+ MY     +  A+++F E+PE 
Sbjct  110  YVLKASARMTNIHLGESIHACTIKLGSAVNEFVGNSLLVMYRSFDNMRSARQVFDEMPEL  169

Query  201  DVICWNAMISGFAMNGDGENAMRLFR----------------EMQND-------------  109
              + W  MI G+A  GD + A  LF                  +QN+             
Sbjct  170  SAVSWTVMIYGYANMGDVDTARELFDMATVKDTGIWGAMISGYVQNNCFKEGLHMFRLMQ  229

Query  108  -AGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
                 PD    V++ +AC+  G    G+ +   +GR
Sbjct  230  LTEVEPDEAIIVTILSACAHMGALDTGIWIHRYLGR  265



>ref|XP_010259136.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial-like isoform X2 [Nelumbo nucifera]
Length=452

 Score =   399 bits (1026),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 243/296 (82%), Gaps = 1/296 (0%)
 Frame = -2

Query  897  ICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHG  718
            +CI NTMIKAFLLKGEL + +++Y  ML+ G+ PDNYTLPY+LKAC N+++  LG  IH 
Sbjct  1    MCICNTMIKAFLLKGELIKIIKVYTRMLQEGLYPDNYTLPYMLKACKNLQNSVLGEQIHV  60

Query  717  QCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFE  538
              LK GFL D +VGN++I+MYS+   ME+A  +FDE+P R  V+WT++IS Y+R+GD+  
Sbjct  61   HGLKLGFLFDIFVGNTMILMYSACGMMEAAARIFDEIPHRTAVSWTIMISGYARQGDIDT  120

Query  537  ARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAH  358
            ARL+FDE P+KDR +WGS+ISGYVQNNCFKEGLQ+FR+MQ+T ++ DEA+ VS+L ACAH
Sbjct  121  ARLIFDEAPMKDRGIWGSIISGYVQNNCFKEGLQMFRMMQLTNLEPDEAVFVSVLCACAH  180

Query  357  LGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAM  178
            LG+LDIG W+HRY++++G+ + +RLGTAL+DMYA+CG L +A+KLF  + +RD ICWNAM
Sbjct  181  LGALDIGIWIHRYLDRIGLPLTIRLGTALIDMYARCGNLDIAKKLFDGMQQRDTICWNAM  240

Query  177  ISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
            ISG A++GDGENA++LF EM+  +G RP+ +TF+++FTACS SGMA+EGL L +K+
Sbjct  241  ISGVAVHGDGENALKLFLEMEK-SGFRPNDITFIAVFTACSYSGMAYEGLHLFKKM  295



>ref|XP_010939127.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Elaeis guineensis]
Length=520

 Score =   402 bits (1032),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 197/363 (54%), Positives = 258/363 (71%), Gaps = 1/363 (0%)
 Frame = -2

Query  1098  TSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIY  919
             +S+ RCL LLE+CK +KQL Q H Q+I  GLG ++FALSRL+AFCS P  GN  Y   ++
Sbjct  2     SSSRRCLLLLEQCKTMKQLKQTHAQIIAGGLGQDSFALSRLMAFCSHPISGNLAYAQHLF  61

Query  918   ERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCN  739
             + IQ PT+CI NTMIKAFLLK   ++ +++Y  +L  G+CPD+YTLPY+LKAC N+    
Sbjct  62    QHIQNPTLCIRNTMIKAFLLKENCTKPLDIYHSLLHDGLCPDDYTLPYVLKACANLPDIR  121

Query  738   LGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYS  559
              G  +H   +K GFL D YV N+LI MY +  +  +A+ VFD  P R    WTV+IS YS
Sbjct  122   TGSVVHTHVVKLGFLADIYVSNTLISMYMACGNSRAAREVFDGSPQRNAATWTVMISGYS  181

Query  558   RKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVS  379
             + G+V  AR +FD+ P KDR +WGSMISGYVQNNCFKEGL +FRLMQ  G++ DE ++VS
Sbjct  182   KLGEVAAAREIFDDAPGKDRGIWGSMISGYVQNNCFKEGLVMFRLMQAEGLKPDEVVIVS  241

Query  378   ILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERD  199
              L ACA LG++D+G W+HRY+  +G+ ++VRLGTAL+DMY KCG L LA+KLF  + +RD
Sbjct  242   ALCACAQLGAMDLGSWIHRYLNLVGLQLSVRLGTALIDMYMKCGNLVLAKKLFDGMQKRD  301

Query  198   VICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLL  19
              ICWN MI G AM+GDGE AM  F  MQ + G RPD  TF+++  ACS +G+  EGLKL 
Sbjct  302   TICWNVMILGLAMHGDGEGAMEFFHRMQKE-GLRPDDATFIAVLAACSHAGLVEEGLKLF  360

Query  18    EKI  10
               +
Sbjct  361   NSM  363



>ref|XP_008777162.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Phoenix dactylifera]
Length=520

 Score =   391 bits (1005),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 239/343 (70%), Gaps = 1/343 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q+IT GLG  +FALSRLLAFCS P  GN +Y   +++ IQ PT+CI NTMIKAFL 
Sbjct  22    QTHAQIITGGLGQESFALSRLLAFCSHPIHGNLSYAQLLFQHIQNPTLCIRNTMIKAFLH  81

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             K   +R +E+Y  +L  G+ PDNYTLPY+LKAC N+     G  +H   +K GF  D +V
Sbjct  82    KENYTRPLEIYHSLLHDGLYPDNYTLPYVLKACANLWDIRTGSGVHTHVVKLGFCADIFV  141

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N+L+ MY S  +   A+ VFD  P R    WT++IS YS+ G+V  AR +F++ P KDR
Sbjct  142   SNTLVSMYMSCGNARVAREVFDGSPQRNAATWTIMISGYSKLGEVAAARQIFNDAPGKDR  201

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
              +WGSM+SGYVQNNCFKEGL +FRLMQ  G++ DE ++VS L ACA LG++D+G W+HRY
Sbjct  202   GIWGSMVSGYVQNNCFKEGLLMFRLMQAEGLEPDEGVIVSALCACAQLGAIDLGSWIHRY  261

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +  +G+ +++RLGTAL+DMY KCG L LA+KLF  + +RD ICWN MI G AM+GDGE A
Sbjct  262   LNLVGLPLSIRLGTALIDMYVKCGNLELAKKLFDRMQKRDTICWNVMILGLAMHGDGEGA  321

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             +  F  MQ + G RPD  TF+++  ACS +G+  EGL L  ++
Sbjct  322   VEFFHSMQKE-GLRPDDATFIAILAACSHAGLVEEGLNLFNRM  363



>ref|XP_009398278.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like 
[Musa acuminata subsp. malaccensis]
Length=518

 Score =   364 bits (935),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 168/343 (49%), Positives = 235/343 (69%), Gaps = 1/343 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q   Q+IT  L  + F LSRLLA CS P  G+ ++   ++  I  PT+C+ NTMIKAFLL
Sbjct  25    QTQAQIITTALAQDAFFLSRLLAICSHPTHGSLSHAHLLFRHIHSPTLCVRNTMIKAFLL  84

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             + + +   E+Y  +L+ G+ PDNYT PY+LK+C  +     G  +H   +K GF  D++V
Sbjct  85    REDYANPFEIYCGLLRDGLFPDNYTFPYVLKSCAGLRDLRAGAQVHSHVVKLGFCSDTFV  144

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
             GN+L +MY +  D+ +A+  FD +  R   +WTV+IS YS+ GDV  AR++FDE+PVKDR
Sbjct  145   GNTLALMYVACGDVSAAREAFDGILQRDAASWTVMISGYSQLGDVETARMMFDESPVKDR  204

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
              +WG++IS YV NNCFKEGL +FRL+Q  G++ DE +LVS L ACA  G+ DIG W+H Y
Sbjct  205   GIWGAVISAYVHNNCFKEGLSMFRLLQAEGLEPDEGVLVSALCACAQTGAEDIGSWIHHY  264

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V ++G A++VRLGTALVDMY KCG L  A+K+F  +  +D +CWN MI G AM+GDGE A
Sbjct  265   VNRVGFALSVRLGTALVDMYLKCGSLNSAKKVFDGMTCKDTVCWNVMILGLAMHGDGEGA  324

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             + LF  M+ + G +PD  TFV++ +ACS SGM  EGL++ + +
Sbjct  325   LELFTCMKKE-GLKPDDATFVAVLSACSHSGMVEEGLEVFKSM  366


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/248 (24%), Positives = 102/248 (41%), Gaps = 39/248 (16%)
 Frame = -2

Query  891  IVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQC  712
            I   +I A++        + M++ +   G+ PD   L   L AC    + ++G  IH   
Sbjct  206  IWGAVISAYVHNNCFKEGLSMFRLLQAEGLEPDEGVLVSALCACAQTGAEDIGSWIHHYV  265

Query  711  LKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEAR  532
             + GF +   +G +L+ MY         +C                       G +  A+
Sbjct  266  NRVGFALSVRLGTALVDMY--------LKC-----------------------GSLNSAK  294

Query  531  LVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLG  352
             VFD    KD   W  MI G   +   +  L+LF  M+  G++ D+A  V++LSAC+H G
Sbjct  295  KVFDGMTCKDTVCWNVMILGLAMHGDGEGALELFTCMKKEGLKPDDATFVAVLSACSHSG  354

Query  351  SLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLAQKLFYELP------ERDVI  193
             ++ G  V + +  L  +         +VD   + G    A+++   +P      ER  +
Sbjct  355  MVEEGLEVFKSMRSLYHVEPRSEHYVCVVDFLGRSGRFQEAKEVIEGMPCNSSPAER-AM  413

Query  192  CWNAMISG  169
             W A++S 
Sbjct  414  AWRALLSA  421



>ref|XP_002512113.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF50782.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=336

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 182/359 (51%), Positives = 241/359 (67%), Gaps = 52/359 (14%)
 Frame = -2

Query  1098  TSTGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIY  919
             +S+GRCL LLEKCK++KQL QAH Q ITCGLGNN+F LSR+LAFCSDPN  + ++ W+I+
Sbjct  6     SSSGRCLHLLEKCKSMKQLKQAHAQAITCGLGNNSFTLSRILAFCSDPNHASLSHAWKIF  65

Query  918   ERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCN  739
             + IQQPTICI NTMIKA LLK                                       
Sbjct  66    QHIQQPTICIYNTMIKALLLK---------------------------------------  86

Query  738   LGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYS  559
                         GF +++ VGNSLI+MY    +M +A+ VFDE+P  CVV+WT++IS ++
Sbjct  87    ------------GFSVNAVVGNSLILMYCGFCNMRAARYVFDEIPGPCVVSWTLMISGFA  134

Query  558   RKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVS  379
             + GD+  ARL FD  P KDR + G+MISGYVQNNCFKE L +F ++Q+T    DE I +S
Sbjct  135   KVGDIESARLFFDGAPRKDRGICGAMISGYVQNNCFKECLYMFSMIQLTDNVPDEGIFLS  194

Query  378   ILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERD  199
             IL ACA LG+LD G W+HRY+++LG+ + +RL T L+DMYAKCG + LA+ LF E+P+RD
Sbjct  195   ILCACAQLGALDTGIWIHRYMDRLGLPLTIRLSTGLIDMYAKCGNVDLAKSLFDEMPQRD  254

Query  198   VICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKL  22
              +CWN MISG AM+GDGE A+ LF +M+ +AG +PD VTF+++ +ACS SGMA+EG   
Sbjct  255   TVCWNVMISGLAMHGDGEGAINLFLKME-EAGFKPDDVTFIAILSACSYSGMAYEGFSF  312



>emb|CBI27276.3| unnamed protein product [Vitis vinifera]
Length=248

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/275 (55%), Positives = 193/275 (70%), Gaps = 32/275 (12%)
 Frame = -2

Query  879  MIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFG  700
            MIKAF+LKG+L  T+++Y  ML+ G+ PDNYTLPY+LKAC  ++SC+LG S HGQ +K G
Sbjct  1    MIKAFVLKGKLINTIQIYSQMLENGLYPDNYTLPYVLKACAGLQSCHLGESAHGQSVKLG  60

Query  699  FLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFD  520
            F  D +VGN+LI MYSS                                G+V  AR +FD
Sbjct  61   FWFDIFVGNTLIAMYSSF-------------------------------GNVRAARCIFD  89

Query  519  ETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDI  340
            E P      W  MISGY +NNCFKEGLQ+FRLMQ TG++ DEAILVSIL ACAHLG+++I
Sbjct  90   EMPWHTAVSWTVMISGYAKNNCFKEGLQMFRLMQSTGLEPDEAILVSILCACAHLGAMEI  149

Query  339  GKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAM  160
            G WVHRY+++LG  ++VRL T L+DMYAKCG L +A+KLF  + +RD ICWNAMISG AM
Sbjct  150  GVWVHRYLDQLGHPLSVRLSTGLIDMYAKCGSLDIAKKLFDGMSQRDTICWNAMISGMAM  209

Query  159  NGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACS  55
            NGDG+NA+RLF EM+  AG +PD +TF+++FTA +
Sbjct  210  NGDGDNALRLFSEMEK-AGVKPDDITFIAIFTASA  243


 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 81/163 (50%), Gaps = 4/163 (2%)
 Frame = -2

Query  483  MISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLG  304
            MI  +V        +Q++  M   G+  D   L  +L ACA L S  +G+  H    KLG
Sbjct  1    MIKAFVLKGKLINTIQIYSQMLENGLYPDNYTLPYVLKACAGLQSCHLGESAHGQSVKLG  60

Query  303  MAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFR  124
               ++ +G  L+ MY+  G +  A+ +F E+P    + W  MISG+A N   +  +++FR
Sbjct  61   FWFDIFVGNTLIAMYSSFGNVRAARCIFDEMPWHTAVSWTVMISGYAKNNCFKEGLQMFR  120

Query  123  EMQNDAGTRPDGVTFVSLFTACSCSGMAHEGL---KLLEKIGR  4
             MQ+  G  PD    VS+  AC+  G    G+   + L+++G 
Sbjct  121  LMQS-TGLEPDEAILVSILCACAHLGAMEIGVWVHRYLDQLGH  162


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/225 (24%), Positives = 91/225 (40%), Gaps = 33/225 (15%)
 Frame = -2

Query  1035  AHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLK  856
             AHGQ +  G   + F  + L+A  S  + GN      I++ +   T      MI  +   
Sbjct  52    AHGQSVKLGFWFDIFVGNTLIAMYS--SFGNVRAARCIFDEMPWHTAVSWTVMISGYAKN  109

Query  855   GELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVG  676
                   ++M++ M  TG+ PD   L  +L AC ++ +  +G  +H    + G  +   + 
Sbjct  110   NCFKEGLQMFRLMQSTGLEPDEAILVSILCACAHLGAMEIGVWVHRYLDQLGHPLSVRLS  169

Query  675   NSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRR  496
               LI MY+    ++ A+ +FD M  R  + W  +IS  +  GD   A             
Sbjct  170   TGLIDMYAKCGSLDIAKKLFDGMSQRDTICWNAMISGMAMNGDGDNA-------------  216

Query  495   VWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACA  361
                               L+LF  M+  GV+ D+   ++I +A A
Sbjct  217   ------------------LRLFSEMEKAGVKPDDITFIAIFTASA  243



>ref|XP_008465707.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, 
chloroplastic-like isoform X2 [Cucumis melo]
Length=415

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/248 (57%), Positives = 189/248 (76%), Gaps = 1/248 (0%)
 Frame = -2

Query  753  MESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVL  574
            M + +LG SIH   +K GF +D +VGNSL+VMY S D M SA+ VFDEMP    V+WTV+
Sbjct  1    MTNIHLGESIHACTIKLGFAVDEFVGNSLLVMYRSFDKMTSARQVFDEMPELSAVSWTVM  60

Query  573  ISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADE  394
            I  Y+  GDV  AR +FD   VKD  +WG+MISGYVQNNCFKEGL +FRLMQ+T V+ DE
Sbjct  61   IYGYANMGDVDTARELFDMATVKDTGIWGAMISGYVQNNCFKEGLHMFRLMQLTEVEPDE  120

Query  393  AILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYE  214
            AI+V+ILSACAH+G+LD G W+HRY+ +LG+++ +R+ T L+DMYAKCG L LA+ LF E
Sbjct  121  AIIVTILSACAHMGALDTGIWIHRYLGRLGLSLTLRVRTGLIDMYAKCGHLDLAKYLFNE  180

Query  213  LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHE  34
            + +RD +CWNAMISG AM+GDGE A++LF EM+  AG +PD +TF+++  ACS SGM  E
Sbjct  181  MSQRDNVCWNAMISGMAMDGDGEGAIKLFMEMEK-AGIKPDNITFIAVLAACSNSGMVDE  239

Query  33   GLKLLEKI  10
            G+++  ++
Sbjct  240  GIRIWNRM  247


 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 61/292 (21%), Positives = 117/292 (40%), Gaps = 49/292 (17%)
 Frame = -2

Query  957  PNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLP  778
             N+G+      +++        I   MI  ++        + M++ M  T + PD   + 
Sbjct  65   ANMGDVDTARELFDMATVKDTGIWGAMISGYVQNNCFKEGLHMFRLMQLTEVEPDEAIIV  124

Query  777  YLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSR  598
             +L AC +M + + G  IH    + G  +   V   LI MY+    ++ A+ +F+EM  R
Sbjct  125  TILSACAHMGALDTGIWIHRYLGRLGLSLTLRVRTGLIDMYAKCGHLDLAKYLFNEMSQR  184

Query  597  CVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEG-LQLFRLM  421
              V W  +IS  +  GD                                 EG ++LF  M
Sbjct  185  DNVCWNAMISGMAMDGD--------------------------------GEGAIKLFMEM  212

Query  420  QMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTA----LVDMYAK  253
            +  G++ D    +++L+AC++ G +D G    R   ++     +   +     ++D+ ++
Sbjct  213  EKAGIKPDNITFIAVLAACSNSGMVDEGI---RIWNRMSTIHKIEPKSEHYGCVIDLLSR  269

Query  252  CGCLGLAQKLFYELPE-----RDVICWNAMISGFAMNGDGEN----AMRLFR  124
             G    A+ +   LP+      + + W A +S    +G  +     A RLF+
Sbjct  270  VGRFEEAEAVILRLPKTANPSEEAVAWRAFLSACCKHGQTQQAEVAAERLFQ  321



>ref|XP_008361879.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g08070-like [Malus domestica]
Length=365

 Score =   299 bits (766),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 154/301 (51%), Positives = 202/301 (67%), Gaps = 26/301 (9%)
 Frame = -2

Query  906  QPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRS  727
            +PTIC  NTM+KA LL+ EL  T+ ++  ML+ GMCP NYTLPYLLKAC  M+ C LG  
Sbjct  74   EPTICFYNTMLKASLLRNELILTVGVFTEMLQNGMCPGNYTLPYLLKACARMQRCRLGEL  133

Query  726  IHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGD  547
            +HG CLK GF+ D +VGNSLIVMY + DD++ A  VFDEMPS   V+  V+IS +++ G+
Sbjct  134  VHGFCLKLGFVSDIFVGNSLIVMYCAFDDVKRALYVFDEMPSLSAVSRMVMISGFAKVGN  193

Query  546  VFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSA  367
            +  ARL FDE PV+DR + G+MISGYV N CF+EGL LF+LMQ+   + DEAI   +L A
Sbjct  194  LDMARLXFDEAPVRDRXIXGAMISGYVXNGCFREGLYLFQLMQLXDTEPDEAIFXXVLCA  253

Query  366  CAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICW  187
            CAHLG+LDIG W+H Y+ +L + ++VRL T L+DMYAKC  L LA+ L  E+ +RD +CW
Sbjct  254  CAHLGALDIGIWIHSYLNRLRLRLSVRLTTGLIDMYAKCRRLELARGLLAEMLQRDTVCW  313

Query  186  NAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIG  7
            NAM                            D VTF+++ TACS SGMA EG+K+ +K+ 
Sbjct  314  NAM--------------------------HGDDVTFIAVLTACSYSGMADEGMKVFDKMR  347

Query  6    R  4
            R
Sbjct  348  R  348



>ref|XP_010557968.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540 
[Tarenaya hassleriana]
Length=622

 Score =   303 bits (775),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/346 (42%), Positives = 217/346 (63%), Gaps = 4/346 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNPT---YGWRIYERIQQPTICIVNTMIKAFL  862
             HG +I   L ++ F  SRLLA C D  L +     Y +R++ +I+ P I I N +I+ F 
Sbjct  35    HGFLIRTRLISDVFVSSRLLALCVDSTLKSSDLLDYAYRVFTQIRHPNIFIFNALIRGFS  94

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                + SR    Y  ML++G+C DN T P+L+KAC  + S  LG  IH   ++FGF  D Y
Sbjct  95    SGEDPSRVFGFYTQMLESGICSDNITFPFLVKACAELGSVRLGGQIHAHVVQFGFENDVY  154

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             V NSL+ MY +   + SA  +F +M  R VV+WT +++ Y ++GD+  AR +FDE P ++
Sbjct  155   VENSLVHMYVNCGSVSSADRIFKQMQFRDVVSWTSMVAGYCKRGDIDTARKMFDEMPERN  214

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W  MI+GYV+NNCF + ++LF  M+  G+QA+E ++VS++S+CAHLG L++G+  H 
Sbjct  215   LVTWSVMINGYVKNNCFVKAIELFESMKRKGIQANETVMVSVISSCAHLGGLELGEKAHD  274

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             YV K  + +NV LGTALVDMYA+CG +  A ++F ELPE+D + W ++ISG AM G G  
Sbjct  275   YVVKNNLTVNVILGTALVDMYARCGNIEKAIRVFEELPEKDSLSWTSIISGLAMYGHGNE  334

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             A+  F EM    G  P  +TF ++ +ACS  G+   GL++ E + R
Sbjct  335   AIHYFSEMVR-LGFTPRDITFTAVLSACSHGGLVDRGLEIYESMKR  379



>ref|XP_007029178.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOY09680.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=626

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 223/345 (65%), Gaps = 3/345 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNP--TYGWRIYERIQQPTICIVNTMIKAFLL  859
             HG +I   +  + FA SRL++ C+DP+ G     Y ++I+ +I+ P + I N +IK F  
Sbjct  40    HGHMIRTHIIFDIFAASRLISLCTDPSFGTALLDYAFKIFSQIETPNLFIFNALIKGFSA  99

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                  ++   Y  +L+  + PDN + P+L++AC  +ES ++G   HGQ +K GF  + YV
Sbjct  100   CQNPHQSFHFYTQLLRANILPDNLSFPFLVRACAQLESLDMGIQAHGQIIKHGFESNVYV  159

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSL+ MYS+  D+++A  +F  M    VV+WT +I+  ++ GDV  AR +FD  P K+ 
Sbjct  160   QNSLVHMYSTCGDIKAANAIFQRMTFLNVVSWTSMIAGLNKVGDVEMARKLFDTMPEKNL  219

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W  MISGY +N+ F++ ++LF+++Q  GVQA+E ++VS++S+CAHLG++++G+  H Y
Sbjct  220   VTWSIMISGYAKNSYFEKAVELFQVLQEEGVQANETVMVSVISSCAHLGAIELGEKAHEY  279

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             + +  +++NV LGTALVDMYA+CG +  A  +F ELPERDV+ W A+I+G AM+G  E A
Sbjct  280   IFRNNLSLNVILGTALVDMYARCGSIEKAIGVFEELPERDVLSWTALIAGLAMHGYAERA  339

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             +  F EM   +G +P  ++F ++ +ACS  G+  +GL+L   + R
Sbjct  340   LWFFSEMVK-SGLKPRDISFTAVLSACSHGGLVGKGLELFGSMKR  383


 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 67/336 (20%), Positives = 136/336 (40%), Gaps = 66/336 (20%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTF---ALSRLLAFCSDPNLGNPTY---------GW-----------  928
             QAHGQ+I  G  +N +   +L  + + C D    N  +          W           
Sbjct  143   QAHGQIIKHGFESNVYVQNSLVHMYSTCGDIKAANAIFQRMTFLNVVSWTSMIAGLNKVG  202

Query  927   ------RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLK  766
                   ++++ + +  +   + MI  +       + +E+++ + + G+  +   +  ++ 
Sbjct  203   DVEMARKLFDTMPEKNLVTWSIMISGYAKNSYFEKAVELFQVLQEEGVQANETVMVSVIS  262

Query  765   ACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVA  586
             +C ++ +  LG   H                               + +F    S  V+ 
Sbjct  263   SCAHLGAIELGEKAH-------------------------------EYIFRNNLSLNVIL  291

Query  585   WTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGV  406
              T L+  Y+R G + +A  VF+E P +D   W ++I+G   +   +  L  F  M  +G+
Sbjct  292   GTALVDMYARCGSIEKAIGVFEELPERDVLSWTALIAGLAMHGYAERALWFFSEMVKSGL  351

Query  405   QADEAILVSILSACAHLGSLDIGKWVHRYVE-KLGMAINVRLGTA--LVDMYAKCGCLGL  235
             +  +    ++LSAC+H G   +GK +  +   K    I  RL     +VD+  + G L  
Sbjct  352   KPRDISFTAVLSACSHGGL--VGKGLELFGSMKRDFGIEPRLEHYGCVVDLLGRAGKLAE  409

Query  234   AQKLFYELPER-DVICWNAMISGFAMNGDGENAMRL  130
             A+K   E+P + +   W A++    ++ + E A R+
Sbjct  410   AEKFVLEMPVKPNAPIWGALLGACRIHRNAEIAERV  445



>ref|XP_002267596.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540 
[Vitis vinifera]
Length=623

 Score =   294 bits (753),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 141/345 (41%), Positives = 213/345 (62%), Gaps = 3/345 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNP--TYGWRIYERIQQPTICIVNTMIKAFLL  859
             H  +I   +  + FA SRL+AFC DP+ G     Y  RI+ +IQ P + I N MI+    
Sbjct  37    HAYMIRTHIICDVFAASRLIAFCVDPSSGTSLIDYASRIFSQIQNPNLFIFNAMIRGHSG  96

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                  +    Y    + G+ PDN T P+L+K+C  +   ++G   HG  +K GF  D YV
Sbjct  97    SKNPDQAFHFYVQSQRQGLLPDNLTFPFLVKSCTKLHCISMGSQAHGHIIKHGFEKDVYV  156

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSL+ MY++  D E+A  +F  M    VV+WT +I  +++ GDV  AR +FD+ P K+ 
Sbjct  157   QNSLVHMYATFGDTEAATLIFQRMYYVDVVSWTSMIRGFNKCGDVESARKLFDQMPEKNL  216

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MISGY QNN F + ++LF+++Q  GV+A+E ++VS++S+CAHLG+L++G+  H Y
Sbjct  217   VTWSTMISGYAQNNHFDKAVELFKVLQSQGVRANETVMVSVISSCAHLGALELGERAHDY  276

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V K GM +N+ LGTALVDMYA+CG +  A  +F +LPERD + W A+I+G AM+G  E +
Sbjct  277   VVKNGMTLNLILGTALVDMYARCGSIDKAVWVFEDLPERDTLSWTALIAGLAMHGYSERS  336

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             ++ F  M  +AG  P  +TF ++ +ACS  G+   G ++ E + R
Sbjct  337   LKYFATMV-EAGLTPRDITFTAVLSACSHGGLVERGFQIFESMKR  380



>ref|XP_003553630.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like 
[Glycine max]
 gb|KHN43589.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=622

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/343 (41%), Positives = 210/343 (61%), Gaps = 1/343 (0%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKG  853
             H  ++   L  + FA SRL+AFC D       Y  R+  +IQ P + I N +I+      
Sbjct  37    HAHMLRTHLFFDVFAASRLIAFCIDSTTNLLHYAIRVASQIQNPNLFIYNALIRGCSTSE  96

Query  852   ELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGN  673
                 +   Y   L+ G+ PDN T P+L+KAC  +E+  +G   HGQ +K GF  D YV N
Sbjct  97    NPENSFHYYIKALRFGLLPDNITHPFLVKACAQLENAPMGMQTHGQAIKHGFEQDFYVQN  156

Query  672   SLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRV  493
             SL+ MY+S+ D+ +A+ VF  M    VV+WT +I+ Y R GD   AR +FD  P ++   
Sbjct  157   SLVHMYASVGDINAARSVFQRMCRFDVVSWTCMIAGYHRCGDAKSARELFDRMPERNLVT  216

Query  492   WGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVE  313
             W +MISGY +NNCF++ ++ F  +Q  GV A+E ++V ++S+CAHLG+L +G+  H YV 
Sbjct  217   WSTMISGYARNNCFEKAVETFEALQAEGVVANETVMVGVISSCAHLGALAMGEKAHEYVM  276

Query  312   KLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMR  133
             +  +++N+ LGTA+VDMYA+CG +  A  +F +LPE+DV+CW A+I+G AM+G  E A+ 
Sbjct  277   RNKLSLNLILGTAVVDMYARCGNVEKAVMVFEQLPEKDVLCWTALIAGLAMHGYAEKALW  336

Query  132   LFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
              F EM    G  P  +TF ++ TACS +GM   GL++ E + R
Sbjct  337   YFSEMAKK-GFVPRDITFTAVLTACSHAGMVERGLEIFESMKR  378



>ref|XP_010248175.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540 
[Nelumbo nucifera]
Length=629

 Score =   283 bits (725),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 214/345 (62%), Gaps = 3/345 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNP--TYGWRIYERIQQPTICIVNTMIKAFLL  859
             H  +I   +  + FA SRL+AFC++P  G     Y  RI+ +IQ P + I N M++ +  
Sbjct  43    HAYMIRTHIITDLFAASRLIAFCTNPTYGTSFLDYAQRIFSQIQNPNLFIYNAMVRVYSG  102

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                  ++ + Y+ + + G+ PDN T PYL+K+C       +G    GQ +K GF  D YV
Sbjct  103   SKNPQQSFQFYRKLQQEGLLPDNLTFPYLVKSCAEFGCVGMGIQALGQIIKHGFESDVYV  162

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSL+ MY++  D+ +A  +F  +    VV+WT +I+ Y++ GDV  AR +FD+ P ++ 
Sbjct  163   QNSLVHMYATCGDIGTANRIFRGIYHLDVVSWTSMIAGYNKCGDVESARRLFDKMPERNL  222

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W  MI+GYV+N+ F + ++LF+++Q  GVQA+E ++VS+++ACAHLG+L+ G+  H Y
Sbjct  223   VTWSIMINGYVRNHHFNKAIELFQVLQSEGVQANETVMVSVIAACAHLGALEQGEKAHNY  282

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V +  + +N+ LGTALVDMYA+CG +  A ++F ELPERD + W A+I+G AM+G  + A
Sbjct  283   VLRHKLNVNLILGTALVDMYARCGSIQKAIRVFEELPERDTLSWTAVIAGLAMHGHADKA  342

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             +  F EM    G  P  +TF ++ +ACS  G+   G ++ E + R
Sbjct  343   LEYFSEMLK-TGITPRDITFTAVLSACSHGGLVDRGFQIFESMER  386



>ref|XP_007029177.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
 gb|EOY09679.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
Length=584

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/334 (40%), Positives = 214/334 (64%), Gaps = 3/334 (1%)
 Frame = -2

Query  999  NTFALSRLLAFCSDPNLGNP--TYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMY  826
            + FA SRL++ C+DP+ G     Y +++  +++ P   I N +IK F       ++   Y
Sbjct  9    DIFAASRLISLCTDPSFGTTLLDYAFKVLSQVETPNPFIYNALIKGFSACQNPHKSFHFY  68

Query  825  KHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSL  646
              + +  + PD  + P+L++AC  +ES ++G   HGQ +K GF  + YV NSL+ MYS+ 
Sbjct  69   TQLFRANILPDYISFPFLVRACAQLESLDMGVQAHGQIIKHGFENNVYVQNSLVHMYSTC  128

Query  645  DDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYV  466
             D+ +A  +F  M    VV+WT +I+  ++ GDV  AR +FD TP K+   W  MISGY 
Sbjct  129  GDVTAANAIFQRMTCLNVVSWTSMIAGLNKVGDVEMARKLFDTTPEKNLVTWSIMISGYA  188

Query  465  QNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVR  286
            +N+ F++ ++LF+++Q  GVQA+E ++VS++S+CAHLG++++G+  H Y+ +  +++NV 
Sbjct  189  KNSYFEKAVELFQVLQEEGVQANETVMVSVISSCAHLGAIELGEKAHEYIFRNNLSLNVI  248

Query  285  LGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDA  106
            LGTALVDMYA+CG +  A  +F ELPERDV+ W A+I+G AM+G  E A+  F EM   +
Sbjct  249  LGTALVDMYARCGNIEKAIGVFEELPERDVLSWTALIAGLAMHGYAERALWFFSEMVK-S  307

Query  105  GTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
            G +P  ++F ++ +ACS  G+  + L+L E + R
Sbjct  308  GLKPRDISFTAVLSACSHRGLVGKVLELFESMKR  341


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 68/336 (20%), Positives = 136/336 (40%), Gaps = 66/336 (20%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTF---ALSRLLAFCSDPNLGNPTY---------GW-----------  928
             QAHGQ+I  G  NN +   +L  + + C D    N  +          W           
Sbjct  101   QAHGQIIKHGFENNVYVQNSLVHMYSTCGDVTAANAIFQRMTCLNVVSWTSMIAGLNKVG  160

Query  927   ------RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLK  766
                   ++++   +  +   + MI  +       + +E+++ + + G+  +   +  ++ 
Sbjct  161   DVEMARKLFDTTPEKNLVTWSIMISGYAKNSYFEKAVELFQVLQEEGVQANETVMVSVIS  220

Query  765   ACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVA  586
             +C ++ +  LG   H                               + +F    S  V+ 
Sbjct  221   SCAHLGAIELGEKAH-------------------------------EYIFRNNLSLNVIL  249

Query  585   WTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGV  406
              T L+  Y+R G++ +A  VF+E P +D   W ++I+G   +   +  L  F  M  +G+
Sbjct  250   GTALVDMYARCGNIEKAIGVFEELPERDVLSWTALIAGLAMHGYAERALWFFSEMVKSGL  309

Query  405   QADEAILVSILSACAHLGSLDIGKWVHRYVE-KLGMAINVRLGTA--LVDMYAKCGCLGL  235
             +  +    ++LSAC+H G   +GK +  +   K    I  RL     +VD+  + G L  
Sbjct  310   KPRDISFTAVLSACSHRGL--VGKVLELFESMKRDFGIEPRLEHYGCVVDLLGRAGKLAE  367

Query  234   AQKLFYELPER-DVICWNAMISGFAMNGDGENAMRL  130
             A+K   E+P + +   W A++    ++ + E A R+
Sbjct  368   AEKFVLEMPVKPNAPIWGALLGARRIHRNAEIAERV  403



>ref|XP_004494285.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like 
[Cicer arietinum]
Length=618

 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/344 (40%), Positives = 214/344 (62%), Gaps = 4/344 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSD-PNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLK  856
             H  ++      +TFA SR++AFC D PN    TY  +++ +I  P I I N +I+     
Sbjct  35    HAHMLRTHFFFDTFASSRIIAFCIDKPNF--LTYAIKVFSQIYNPNIFIFNALIRGCSTS  92

Query  855   GELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVG  676
                  +   Y    + G+ PDN T P+L+KAC  +ES  +G  +HGQ +K GF +D YV 
Sbjct  93    ENPENSFHYYIQSQRIGLLPDNITHPFLVKACSKIESLKMGMQVHGQIIKHGFELDFYVQ  152

Query  675   NSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRR  496
             ++L+ MY+SL D+ +A  +F  M    V +WT +I+ Y + GDV  AR +FD+ P ++  
Sbjct  153   HALVYMYASLGDLMAAMFIFKRMGRFDVASWTCMIAGYHKFGDVESARELFDKMPDRNLV  212

Query  495   VWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYV  316
              W +MISGY +NN F + +++F ++Q  GV A+E ++V ++S+CAHLG+L +G+  H YV
Sbjct  213   TWSTMISGYARNNRFDKAVEMFGILQDEGVVANEVVMVGVISSCAHLGALAVGEKAHEYV  272

Query  315   EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAM  136
              + G+A+NV LGTA+VDMYA+CG +  A ++F  L E+DV+CW A+ISG AM+G    A+
Sbjct  273   MRNGLALNVILGTAIVDMYARCGDVEKAIRVFKGLEEKDVLCWTALISGLAMHGYAMKAL  332

Query  135   RLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
               F EM+ + G  P  +TF ++  ACS  G+  +GL++ E + R
Sbjct  333   EYFSEMEKN-GIFPRDITFTAVLKACSHGGLVEKGLEIFESMKR  375


 Score = 67.4 bits (163),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 66/315 (21%), Positives = 134/315 (43%), Gaps = 24/315 (8%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q HGQ+I  G   + +    L+   +  +LG+      I++R+ +  +     MI  +  
Sbjct  135   QVHGQIIKHGFELDFYVQHALVYMYA--SLGDLMAAMFIFKRMGRFDVASWTCMIAGYHK  192

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
              G++    E++  M      PD   + +     G   +    +++      FG L D  V
Sbjct  193   FGDVESARELFDKM------PDRNLVTWSTMISGYARNNRFDKAVE----MFGILQDEGV  242

Query  678   GNSLIVMYSSLDD----------MESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARL  529
               + +VM   +             ++ + V     +  V+  T ++  Y+R GDV +A  
Sbjct  243   VANEVVMVGVISSCAHLGALAVGEKAHEYVMRNGLALNVILGTAIVDMYARCGDVEKAIR  302

Query  528   VFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGS  349
             VF     KD   W ++ISG   +    + L+ F  M+  G+   +    ++L AC+H G 
Sbjct  303   VFKGLEEKDVLCWTALISGLAMHGYAMKALEYFSEMEKNGIFPRDITFTAVLKACSHGGL  362

Query  348   LDIGKWVHRYVEK-LGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPER-DVICWNAMI  175
             ++ G  +   +++  G+   +     +VD+  + G L  A+K  +E+P + +   W A++
Sbjct  363   VEKGLEIFESMKRDHGVEPRLEHFGCMVDLLGRAGKLEEAEKFIHEMPVKPNAPIWGALL  422

Query  174   SGFAMNGDGENAMRL  130
                 ++ + E   R+
Sbjct  423   GACRIHRNVEVGERV  437



>ref|XP_008343155.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Malus domestica]
Length=526

 Score =   278 bits (712),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 134/340 (39%), Positives = 211/340 (62%), Gaps = 1/340 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q    +   G   + +A ++++AFCS+ N G+  + +R++  +   T  I N MI+AF  
Sbjct  22    QTQSHLTVSGTLFDPYAAAKIIAFCSESNSGDLRHAFRLFRHMPHRTTYIWNVMIRAFAE  81

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             + E  R + +Y  M+++G+ P+NYT  +LL+AC ++   ++G  +H   ++ G+    +V
Sbjct  82    RNEXXRALSLYNDMIQSGLLPNNYTFSFLLRACADLSYLSMGLLLHCHAIRLGWESYDFV  141

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N LI +Y + D +  A+ +FD    + VV WT LI+ Y + G V  AR +FDE P K+ 
Sbjct  142   QNGLIHLYVTCDSINPARKLFDMSVYKDVVTWTALINGYVKSGQVEVARELFDEMPEKNA  201

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W ++I+GYVQ   F E L+LF  MQ++GV  + A +V  L+ACA LG+LD G+W+H Y
Sbjct  202   VSWSALINGYVQVGLFSEALELFVDMQVSGVLPNHAGIVGALTACAFLGALDQGRWIHAY  261

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V + GM ++  LGTALVDMY KCGC+  A  +F E+P RDV  + ++ISG A +G+ E+A
Sbjct  262   VSRKGMKLDRVLGTALVDMYTKCGCVETAHAVFNEMPSRDVFAFTSLISGLANSGESESA  321

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLL  19
             + LF  MQN+ G  P+ VTF+ + +ACS  G+  EGL++ 
Sbjct  322   ISLFARMQNE-GIAPNEVTFICVLSACSRMGLVDEGLRIF  360


 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/270 (24%), Positives = 120/270 (44%), Gaps = 33/270 (12%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            G       +++ + +      + +I  ++  G  S  +E++  M  +G+ P++  +   L
Sbjct  184  GQVEVARELFDEMPEKNAVSWSALINGYVQVGLFSEALELFVDMQVSGVLPNHAGIVGAL  243

Query  768  KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
             AC  + + + GR IH    + G  +D  +G +L+ MY+                 +C  
Sbjct  244  TACAFLGALDQGRWIHAYVSRKGMKLDRVLGTALVDMYT-----------------KC--  284

Query  588  AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
                        G V  A  VF+E P +D   + S+ISG   +   +  + LF  MQ  G
Sbjct  285  ------------GCVETAHAVFNEMPSRDVFAFTSLISGLANSGESESAISLFARMQNEG  332

Query  408  VQADEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLA  232
            +  +E   + +LSAC+ +G +D G  +   +  + G+   V+    LVD+  + G L  A
Sbjct  333  IAPNEVTFICVLSACSRMGLVDEGLRIFXSMSNIFGIQPGVQHYGCLVDLLGRAGMLEEA  392

Query  231  QKLFYELP-ERDVICWNAMISGFAMNGDGE  145
            +K+  E+P E D     A+++   ++GD E
Sbjct  393  KKVVREMPMEPDSYVLGALLNACRVHGDVE  422



>ref|XP_002263755.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Vitis vinifera]
Length=624

 Score =   280 bits (717),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/337 (41%), Positives = 209/337 (62%), Gaps = 3/337 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q+I  GL  +  A+ R++ FC+    G+  Y   ++++I  P   I NT+ + +L 
Sbjct  38    QYHSQIIRLGLSADNDAMGRVIKFCAISKSGDLNYALEVFDKIPHPDAYIYNTIFRGYL-  96

Query  858   KGELSRT-MEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
             + +L+R  + MY  ML   + P+ +T P L++AC    +   G+ IH   LKFGF  D +
Sbjct  97    RWQLARNCIFMYSRMLHKSVSPNKFTYPPLIRACCIDYAIEEGKQIHAHVLKFGFGADGF  156

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+LI MY +   +E A+ VFD MP R VV+WT LI+ YS+ G V +AR VF+  P ++
Sbjct  157   SLNNLIHMYVNFQSLEQARRVFDNMPQRDVVSWTSLITGYSQWGFVDKAREVFELMPERN  216

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MI+ YVQ+N   E   LF  M++  V  D+ +  S+LSAC  LG+L+ GKW+H 
Sbjct  217   SVSWNAMIAAYVQSNRLHEAFALFDRMRLENVVLDKFVAASMLSACTGLGALEQGKWIHG  276

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y+EK G+ ++ +L T ++DMY KCGCL  A ++F ELP++ +  WN MI G AM+G GE 
Sbjct  277   YIEKSGIELDSKLATTVIDMYCKCGCLEKASEVFNELPQKGISSWNCMIGGLAMHGKGEA  336

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             A+ LF+EM+ +    PDG+TFV++ +AC+ SG+  EG
Sbjct  337   AIELFKEMEREM-VAPDGITFVNVLSACAHSGLVEEG  372


 Score = 83.2 bits (204),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 78/329 (24%), Positives = 132/329 (40%), Gaps = 62/329 (19%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLL--------------AFCSDPN----------LGNPTYG  931
             Q H  V+  G G + F+L+ L+               F + P            G   +G
Sbjct  141   QIHAHVLKFGFGADGFSLNNLIHMYVNFQSLEQARRVFDNMPQRDVVSWTSLITGYSQWG  200

Query  930   W-----RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLK  766
             +      ++E + +      N MI A++    L     ++  M    +  D +    +L 
Sbjct  201   FVDKAREVFELMPERNSVSWNAMIAAYVQSNRLHEAFALFDRMRLENVVLDKFVAASMLS  260

Query  765   ACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVA  586
             AC  + +   G+ IHG   K G  +DS +  ++I MY                  +C   
Sbjct  261   ACTGLGALEQGKWIHGYIEKSGIELDSKLATTVIDMYC-----------------KC---  300

Query  585   WTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGV  406
                        G + +A  VF+E P K    W  MI G   +   +  ++LF+ M+   V
Sbjct  301   -----------GCLEKASEVFNELPQKGISSWNCMIGGLAMHGKGEAAIELFKEMEREMV  349

Query  405   QADEAILVSILSACAHLGSLDIGKWVHRYV-EKLGMAINVRLGTALVDMYAKCGCLGLAQ  229
               D    V++LSACAH G ++ GK   +Y+ E LG+   +     +VD+  + G L  A+
Sbjct  350   APDGITFVNVLSACAHSGLVEEGKHYFQYMTEVLGLKPGMEHFGCMVDLLGRAGLLEEAR  409

Query  228   KLFYELP-ERDVICWNAMISGFAMNGDGE  145
             KL  E+P   D     A++    ++G+ E
Sbjct  410   KLINEMPVNPDAGVLGALVGACRIHGNTE  438



>ref|XP_009370591.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Pyrus x bretschneideri]
Length=526

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/343 (39%), Positives = 212/343 (62%), Gaps = 1/343 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q    +   G   + +A ++++AFCS+ N G+  + +R++  +   T  I N MI+AF  
Sbjct  22    QTQSHLTVSGTLFDPYAAAKIIAFCSESNSGDLRHAFRLFRHMPHRTTYIWNVMIRAFAE  81

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             + E  R + +Y  M+++G+ P+NYT  +LL+AC ++   ++G  +H   ++ G+    +V
Sbjct  82    RNESMRALSLYNDMIQSGLLPNNYTFSFLLRACTDLSYLSMGLVLHCHAIRLGWESYDFV  141

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N LI +Y + D +  A+ +FD+   + VV WT LI+ Y + G V  AR +FDE P K+ 
Sbjct  142   QNGLIHLYVTCDSINPARKLFDKSVYKDVVTWTALINGYVKSGQVEVARELFDEMPEKNA  201

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W ++I+GYVQ   F E L+LF  MQ++GV  + A +V  L+ACA LG+LD G+W+H Y
Sbjct  202   VSWSALINGYVQVGLFSEALELFVDMQVSGVLPNHAGIVGALTACAFLGALDQGRWIHAY  261

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V + GM ++  LGTALVDMY KCGC+  A  +F E+P RDV  + ++ISG A  G+ E+A
Sbjct  262   VSQKGMKLDRVLGTALVDMYTKCGCVETAHAVFNEMPSRDVFAFTSLISGLANCGESESA  321

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             + LF  MQ D G  P+ VTF+ + +ACS  G+  EGL++ E +
Sbjct  322   ISLFVRMQ-DEGIAPNEVTFICVLSACSRMGLVDEGLRIFESM  363


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 122/282 (43%), Gaps = 43/282 (15%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            G       +++ + +      + +I  ++  G  S  +E++  M  +G+ P++  +   L
Sbjct  184  GQVEVARELFDEMPEKNAVSWSALINGYVQVGLFSEALELFVDMQVSGVLPNHAGIVGAL  243

Query  768  KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
             AC  + + + GR IH    + G  +D  +G +L+ MY+                 +C  
Sbjct  244  TACAFLGALDQGRWIHAYVSQKGMKLDRVLGTALVDMYT-----------------KC--  284

Query  588  AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
                        G V  A  VF+E P +D   + S+ISG       +  + LF  MQ  G
Sbjct  285  ------------GCVETAHAVFNEMPSRDVFAFTSLISGLANCGESESAISLFVRMQDEG  332

Query  408  VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTA----LVDMYAKCGCL  241
            +  +E   + +LSAC+ +G +D G    R  E +     ++ G      LVD+  + G L
Sbjct  333  IAPNEVTFICVLSACSRMGLVDEGL---RIFESMSNTFGIQPGVQHYGCLVDLLGRAGML  389

Query  240  GLAQKLFYELP-ERDVICWNAMISGFAMNGDGENAMRLFREM  118
              A+K+  E+P E D     A+++   ++GD E    L REM
Sbjct  390  EEAKKVVREIPMEPDSYVLGALLNACRVHGDVE----LGREM  427



>ref|XP_006399126.1| hypothetical protein EUTSA_v10015670mg [Eutrema salsugineum]
 gb|ESQ40579.1| hypothetical protein EUTSA_v10015670mg [Eutrema salsugineum]
Length=620

 Score =   280 bits (715),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/348 (40%), Positives = 213/348 (61%), Gaps = 6/348 (2%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNPT-----YGWRIYERIQQPTICIVNTMIKA  868
             HG +I   L ++ F  SRLLA C D    N +     Y + I+ +IQ P + + N +I+ 
Sbjct  32    HGFLIRSHLASDVFVASRLLALCIDDYTFNKSINFLGYAYGIFSQIQNPNLFVFNLLIRG  91

Query  867   FLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMD  688
             F +  E SR    Y  MLK+ + PDN T P+L+KA   ME   +G   H Q ++FGF  D
Sbjct  92    FSIGAEPSRAFGFYTQMLKSCIRPDNITFPFLVKASTEMECVTMGEQTHSQIVRFGFQND  151

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
              YV NSL+ MY++   + +A  +F +M  R VV+WT +++ Y + G   +AR +FDE P 
Sbjct  152   VYVENSLVHMYANCGLIGAAGRIFGQMKFRDVVSWTSMVAGYCKCGMADDAREMFDEMPH  211

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWV  328
             ++   W  MI+GY +NNCF + +QLF LM+  GV A+E ++VS++S+CAHLG+L +G+  
Sbjct  212   RNLVTWSIMINGYAKNNCFDKAIQLFELMKREGVVANETVMVSVISSCAHLGALGLGERA  271

Query  327   HRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDG  148
             H YV K  M +N+ LGTALVDMY +CG +  A ++F ELPE+D + W+++I G A++G  
Sbjct  272   HEYVVKNHMTLNLILGTALVDMYWRCGEIEKAVRVFEELPEKDSLSWSSIIKGLAVHGHA  331

Query  147   ENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
               A+  F +M    G  P  +TF ++ +ACS  G+  +GL++ E + R
Sbjct  332   HKAVHYFSQMVR-LGFIPSDITFTAVLSACSHGGLVDKGLEIYESMKR  378


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/242 (20%), Positives = 100/242 (41%), Gaps = 34/242 (14%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
             +++ +    +   + MI  +       + +++++ M + G+  +   +  ++ +C ++ 
Sbjct  204  EMFDEMPHRNLVTWSIMINGYAKNNCFDKAIQLFELMKREGVVANETVMVSVISSCAHLG  263

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            +  LG   H   +K    ++  +G +L+ MY                       W     
Sbjct  264  ALGLGERAHEYVVKNHMTLNLILGTALVDMY-----------------------W-----  295

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
               R G++ +A  VF+E P KD   W S+I G   +    + +  F  M   G    +  
Sbjct  296  ---RCGEIEKAVRVFEELPEKDSLSWSSIIKGLAVHGHAHKAVHYFSQMVRLGFIPSDIT  352

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGT--ALVDMYAKCGCLGLAQKLFYE  214
              ++LSAC+H G +D G  ++  +++    I  RL     +VDM  + G L  A+    E
Sbjct  353  FTAVLSACSHGGLVDKGLEIYESMKR-DYVIESRLEHYGCIVDMLGRAGKLAEAENFILE  411

Query  213  LP  208
            +P
Sbjct  412  MP  413



>ref|XP_010423323.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540 
[Camelina sativa]
Length=622

 Score =   280 bits (715),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 143/349 (41%), Positives = 214/349 (61%), Gaps = 6/349 (2%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGN-PT----YGWRIYERIQQPTICIVNTMIKA  868
             HG +I   L ++ F  SRLLA C D ++ N PT    Y + I+ +IQ P + + N +I+ 
Sbjct  32    HGFLIRTHLISDVFVASRLLALCVDDSIFNKPTNVSGYAYGIFSQIQYPNLFVFNLLIRC  91

Query  867   FLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMD  688
             F    E +R    Y HML + +CPDN T P+L+KA   M    +G   H Q ++FGF  D
Sbjct  92    FSTGAEPNRAFGFYTHMLNSRICPDNITFPFLIKASTEMGCVTIGEQTHSQIVRFGFQND  151

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
              YV NSL+ MY++   + SA  +F +MP R VV+WT +++ Y + G V +AR +FDE P 
Sbjct  152   VYVENSLVHMYANCGLISSAGRIFGQMPFRDVVSWTSMVAGYCKCGMVEDAREMFDEMPH  211

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWV  328
             ++   W  MI+GY +NNCF++ + LF LM+  GV A+E ++VS++S+CAHLG+ + G   
Sbjct  212   RNLFTWSIMINGYAKNNCFEKAIDLFELMKREGVVANETVMVSVVSSCAHLGAFEHGVRA  271

Query  327   HRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDG  148
             H YV K  M +N+ LGTALVDMY +CG +  A  +F ELP++D + W+++I G A++G  
Sbjct  272   HEYVVKHHMTVNLILGTALVDMYWRCGDIEKAICVFDELPDKDSLSWSSIIKGLAVHGHA  331

Query  147   ENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGRA  1
               A+R F  M    G  P  VTF ++ +ACS  G+  +GL++ E + R 
Sbjct  332   HKAIRYFSLMIR-LGFIPRDVTFTAVLSACSHGGLVEKGLEIYEDMKRV  379


 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/283 (21%), Positives = 119/283 (42%), Gaps = 11/283 (4%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H Q++  G  N+ +  + L+   +  N G  +   RI+ ++    +    +M+  + 
Sbjct  137   EQTHSQIVRFGFQNDVYVENSLVHMYA--NCGLISSAGRIFGQMPFRDVVSWTSMVAGYC  194

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
               G +    EM+  M    +    +T   ++              +     + G + +  
Sbjct  195   KCGMVEDAREMFDEMPHRNL----FTWSIMINGYAKNNCFEKAIDLFELMKREGVVANET  250

Query  681   VGNSLIVMYSSLDDME----SAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDET  514
             V  S++   + L   E    + + V     +  ++  T L+  Y R GD+ +A  VFDE 
Sbjct  251   VMVSVVSSCAHLGAFEHGVRAHEYVVKHHMTVNLILGTALVDMYWRCGDIEKAICVFDEL  310

Query  513   PVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
             P KD   W S+I G   +    + ++ F LM   G    +    ++LSAC+H G ++ G 
Sbjct  311   PDKDSLSWSSIIKGLAVHGHAHKAIRYFSLMIRLGFIPRDVTFTAVLSACSHGGLVEKGL  370

Query  333   WVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLAQKLFYELP  208
              ++  ++++ G+   +     +VDM  + G L  A+    E+P
Sbjct  371   EIYEDMKRVYGIEPRLEHYGCIVDMLGRAGKLAEAENFILEMP  413



>ref|XP_009117485.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Brassica rapa]
Length=538

 Score =   275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/339 (38%), Positives = 204/339 (60%), Gaps = 4/339 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  + T GL  ++F L++++  C    +G+  Y  R++  +  P + + N++I+A+  
Sbjct  30    QIHASITTHGLSQSSFILTKMVDLCD--KIGDMEYATRLFNHVSNPNVFLYNSIIRAYTH  87

Query  858   KGELSRTMEMYKHMLKTGM-CPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                    + +YK ML   +  PD +T P++ K+C ++ SC LG+ +HG   KFG      
Sbjct  88    NSLYPSAIRIYKQMLANSLEFPDRFTFPFVFKSCASLGSCYLGKQVHGHLFKFGPKAHVV  147

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+LI MY+  D ++ A  VFDEM  R V++W  LIS ++R G + EA+ +F+  P K 
Sbjct  148   TENALIDMYTKFDGLDDAHKVFDEMSERDVISWNSLISGHARLGRMKEAKALFESMPEKT  207

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MISGY    C+ E ++LFR MQ+  +  DE  L+S+L +CAHLGSL++GKW+H 
Sbjct  208   IVSWTAMISGYTGAGCYGEAMELFREMQLADIDPDEISLISVLPSCAHLGSLELGKWIHI  267

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y E+ G      +  AL++MY+KCG +G A +LF  +  +DVI W+ MISG+A +G+ E 
Sbjct  268   YAERKGFLRQTGVCNALIEMYSKCGMIGQAVQLFDRMKGKDVISWSTMISGYAHHGNAEG  327

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLK  25
             A+  F  MQ  A  +P+G+TF+ L +ACS  G+  +GLK
Sbjct  328   AIETFDGMQR-AKVKPNGITFLGLLSACSHVGLWKQGLK  365



>ref|XP_010243893.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305 
isoform X2 [Nelumbo nucifera]
Length=408

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/347 (38%), Positives = 211/347 (61%), Gaps = 3/347 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +I  GL       +R+L+F +  N G+  Y ++++  +  PTI   NT+I+ +  
Sbjct  32    QIHALIIALGLSEVESFTTRILSFSAISNSGDIDYSYQVFRHLSNPTIFNWNTVIRGYSR  91

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 +R++ ++  ML+ G+ PD+ T P+L KA   + S  LG +IH    K GF MD +V
Sbjct  92    SKNPNRSISVFTQMLRVGVSPDHLTFPFLAKASARLSSLRLGLAIHSCIFKAGFEMDRFV  151

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
             GNSLI MY+S +D+ SAQ +F+EMP R +V+W  +I  Y++ GD+  AR++F+  P +D 
Sbjct  152   GNSLIHMYASCNDIASAQKLFEEMPQRSLVSWNAIIDGYAKCGDLVAARVIFESMPERDV  211

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W S+I GYV+    +E L +F  M+  G +A+E  +VS+L ACAHLG+L+ G+ +H+Y
Sbjct  212   VSWSSLIDGYVKAGDHREALTIFNRMRFVGPEANEVTMVSVLCACAHLGALEQGRMMHQY  271

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLF--YELPERDVICWNAMISGFAMNGDGE  145
             V+   + +++ L T+LVDMYAKCG +  A  +F    + + DV+ WNAMI G A +G  +
Sbjct  272   VKDNALPLSLTLRTSLVDMYAKCGAIEEALLVFNGVSVHQTDVLIWNAMIGGLATHGLVK  331

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
              ++ LF +MQN  G  PD +T++ L +AC+  G+  +       +G+
Sbjct  332   ESLELFTDMQN-LGIAPDEITYLCLLSACAHGGLVEQAWYFFNSLGK  377


 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 97/233 (42%), Gaps = 33/233 (14%)
 Frame = -2

Query  924  IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
            I+E + +  +   +++I  ++  G+    + ++  M   G   +  T+  +L AC ++ +
Sbjct  202  IFESMPERDVVSWSSLIDGYVKAGDHREALTIFNRMRFVGPEANEVTMVSVLCACAHLGA  261

Query  744  CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
               GR +H                               Q V D      +   T L+  
Sbjct  262  LEQGRMMH-------------------------------QYVKDNALPLSLTLRTSLVDM  290

Query  564  YSRKGDVFEARLVFDETPVK--DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEA  391
            Y++ G + EA LVF+   V   D  +W +MI G   +   KE L+LF  MQ  G+  DE 
Sbjct  291  YAKCGAIEEALLVFNGVSVHQTDVLIWNAMIGGLATHGLVKESLELFTDMQNLGIAPDEI  350

Query  390  ILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLA  232
              + +LSACAH G ++   +    + K GM       + +VD+  + G L  A
Sbjct  351  TYLCLLSACAHGGLVEQAWYFFNSLGKHGMTPKSEHYSCMVDVLGRAGQLDEA  403



>ref|XP_008242732.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 
[Prunus mume]
Length=739

 Score =   279 bits (713),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 140/331 (42%), Positives = 204/331 (62%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +I  GL N  FALS+L+ FC+    G+ +Y   +++ I+ P   I NT+I+ F L
Sbjct  51    QVHAHIIKTGLHNTHFALSKLVEFCAVSPFGDLSYALLVFQSIENPNQIIWNTIIRGFSL  110

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               +  + +E Y  ML +G+ P++YT P+LLK+C   E+ +  + IHG  LK G   D++V
Sbjct  111   SSKPIQAVEFYVMMLLSGVEPNSYTFPFLLKSCAKFEASHEAKQIHGHVLKLGLDSDAFV  170

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   ++++A+ VFD+   R VV++T LI+ Y   G + +AR +FDE PV+D 
Sbjct  171   HTSLINMYAQNGELDNARLVFDKSSFRDVVSFTALITGYVSSGCMDDARHLFDEIPVRDV  230

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MISGY Q+  F+E L LF  M+   V  +E+ +V +LSACA  GSL++GKWV  +
Sbjct  231   VSWNAMISGYAQSGRFEEALALFSEMRKANVSPNESTMVVVLSACAQSGSLELGKWVGSW  290

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E  G+  N+RL  AL+DMYAKCG L  A+ LF  L +RDVI WN MI G+      + A
Sbjct  291   IENRGLGSNLRLVNALIDMYAKCGALDTARSLFDGLQQRDVISWNVMIGGYTHKSHYKEA  350

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + LFR M   + T P+ VTF+ +  ACS  G
Sbjct  351   LALFRLMLR-SNTDPNDVTFLGILPACSHLG  380


 Score =   166 bits (421),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/300 (32%), Positives = 149/300 (50%), Gaps = 33/300 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
             +++ I    +   N MI  +   G     + ++  M K  + P+  T+  +L AC    
Sbjct  220  HLFDEIPVRDVVSWNAMISGYAQSGRFEEALALFSEMRKANVSPNESTMVVVLSACAQSG  279

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LG+ +       G   +  + N+LI MY        A+C                  
Sbjct  280  SLELGKWVGSWIENRGLGSNLRLVNALIDMY--------AKC------------------  313

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 G +  AR +FD    +D   W  MI GY   + +KE L LFRLM  +    ++  
Sbjct  314  -----GALDTARSLFDGLQQRDVISWNVMIGGYTHKSHYKEALALFRLMLRSNTDPNDVT  368

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKLGMAI-NVRLGTALVDMYAKCGCLGLAQKLFYEL  211
             + IL AC+HLG+LD+GKW+H Y++K   ++ N  L T+L+DMYAKCG +  A+++F  +
Sbjct  369  FLGILPACSHLGALDLGKWIHAYIDKNFQSLTNTSLWTSLIDMYAKCGNIEAAKQVFNGM  428

Query  210  PERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
              + +  WNAMISG AM+G    A+ LF +M N+ G +PD +TFV + +AC+  G+   G
Sbjct  429  EAKSLASWNAMISGLAMHGHAHTALELFSKMANE-GFKPDEITFVGVLSACNHGGLVDLG  487


 Score = 82.8 bits (203),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 57/252 (23%), Positives = 112/252 (44%), Gaps = 32/252 (13%)
 Frame = -2

Query  924  IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
            +++ +QQ  +   N MI  +  K      + +++ ML++   P++ T   +L AC ++ +
Sbjct  322  LFDGLQQRDVISWNVMIGGYTHKSHYKEALALFRLMLRSNTDPNDVTFLGILPACSHLGA  381

Query  744  CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
             +LG+ IH           +Y+  +    + SL +                  WT LI  
Sbjct  382  LDLGKWIH-----------AYIDKN----FQSLTNTS---------------LWTSLIDM  411

Query  564  YSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAIL  385
            Y++ G++  A+ VF+    K    W +MISG   +      L+LF  M   G + DE   
Sbjct  412  YAKCGNIEAAKQVFNGMEAKSLASWNAMISGLAMHGHAHTALELFSKMANEGFKPDEITF  471

Query  384  VSILSACAHLGSLDIGK-WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP  208
            V +LSAC H G +D+G+ +    +    ++  ++    ++D+  + G    A+ L   + 
Sbjct  472  VGVLSACNHGGLVDLGRQYFSSMITDYHISAQLQHYGCMIDLLGRAGLFDEAEALMSSME  531

Query  207  ER-DVICWNAMI  175
             + D   W +++
Sbjct  532  MKPDGAVWGSLL  543



>ref|XP_010263631.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 
[Nelumbo nucifera]
Length=626

 Score =   275 bits (703),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 205/345 (59%), Gaps = 1/345 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q+   GL  ++  +++LL F +    GN  Y   +++ IQQP I + N MI+ +  
Sbjct  42    QIHAQLFKTGLVLDSTPVTKLLTFSATSVSGNLAYAQLVFDSIQQPNIFMWNIMIRGYSN  101

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               E  R + +Y  ML+    P++YT P+LLKAC  + +    R IHGQ LK GF +D Y 
Sbjct  102   SKEPERALLLYHQMLRDSALPNHYTFPFLLKACATLSALEETRQIHGQVLKTGFAIDIYA  161

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSLI  Y+    + SA  +FD +  R +V+W  +I  Y++ G+  +A  +F + P K+ 
Sbjct  162   ANSLIHAYAKSGSLTSAHRLFDRVQERDIVSWNSMIDGYAKCGEREKAHELFTKMPRKNI  221

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W SMI+  V++  FKE L  F  +Q  G++ D   LVS LSACAHLG+LD G+W+H Y
Sbjct  222   ISWTSMITACVRDGFFKEALSFFYDLQNEGIKPDGVALVSTLSACAHLGALDQGRWIHAY  281

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             ++K+G+ I+  LG ALVDMY+KCG +  A ++F    E  V  W AMI+GFA++G G  A
Sbjct  282   IDKIGIQIDPILGCALVDMYSKCGDVEEALQVFKNTKEMGVPVWTAMIAGFAIHGRGREA  341

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             + LF  MQ  AG +P+ +TF  + TACS +G+  EG  L + + +
Sbjct  342   LDLFDNMQK-AGIKPNAITFTGVLTACSHAGLVDEGKFLFQSMWK  385


 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 86/350 (25%), Positives = 147/350 (42%), Gaps = 69/350 (20%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q HGQV+  G   + +A + L+   +    G+ T   R+++R+Q+  I   N+MI  +  
Sbjct  145   QIHGQVLKTGFAIDIYAANSLIHAYAKS--GSLTSAHRLFDRVQERDIVSWNSMIDGYAK  202

Query  858   KGELSRTMEMYKHMLKT-------------------------------GMCPDNYTLPYL  772
              GE  +  E++  M +                                G+ PD   L   
Sbjct  203   CGEREKAHELFTKMPRKNIISWTSMITACVRDGFFKEALSFFYDLQNEGIKPDGVALVST  262

Query  771   LKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCV  592
             L AC ++ + + GR IH    K G  +D  +G +L+ MYS                 +C 
Sbjct  263   LSACAHLGALDQGRWIHAYIDKIGIQIDPILGCALVDMYS-----------------KC-  304

Query  591   VAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMT  412
                          GDV EA  VF  T      VW +MI+G+  +   +E L LF  MQ  
Sbjct  305   -------------GDVEEALQVFKNTKEMGVPVWTAMIAGFAIHGRGREALDLFDNMQKA  351

Query  411   GVQADEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGL  235
             G++ +      +L+AC+H G +D GK++ + + K+     ++     +V++  + G L  
Sbjct  352   GIKPNAITFTGVLTACSHAGLVDEGKFLFQSMWKVYNETPSIEHYGCMVNLLGRAGQLKE  411

Query  234   AQKLFYELPERDVIC-WNAMISGFAMNGD---GENAMRLFREMQNDAGTR  97
             A+KL   +P +     W A+++   ++GD   G+    +  EM    G R
Sbjct  412   AKKLIETMPMKPTAAIWGALLNACNIHGDFNLGKQLGEILIEMDPSHGGR  461



>ref|XP_010275835.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Nelumbo nucifera]
Length=548

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/348 (39%), Positives = 220/348 (63%), Gaps = 5/348 (1%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             ++ H Q+I  GL   T+  SR+LA  +    G+  Y   I+++IQ PTI   NTMIK + 
Sbjct  56    NEIHSQMIIVGLVRYTYITSRILASYAVSQNGDLNYAQCIFDQIQMPTIFNWNTMIKGYC  115

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                E  +++ +Y  M    M P+ +T P L+KAC ++ S +    +HGQ +KFGF +D Y
Sbjct  116   RSSEPQKSLSIYAQMRTAQMEPNMHTFPVLIKACIDLNSLS---QVHGQLVKFGFSVDFY  172

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             V +SLI+ YS    ME A+ +F+E P+R +V WT LIS Y   G V EAR++FD+ P ++
Sbjct  173   VLSSLIMAYSKCGIMELARQIFEEAPNRNIVCWTSLISGYCSHGLVDEARILFDKMPDRN  232

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQ-MTGVQADEAILVSILSACAHLGSLDIGKWVH  325
                W ++ISGYVQN+CF E ++LF+ ++  +  + + ++LVS+L+ACA +G+ + GKWVH
Sbjct  233   DVSWSAIISGYVQNDCFNEAIELFQELKCSSNEKPNHSLLVSVLNACASVGAFEEGKWVH  292

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
              Y+++  +   + LGTAL++ YAKCG + +A+++F  +P +DV  W+AMI GFA+NG  +
Sbjct  293   SYMDQNRIEYGLELGTALINFYAKCGFIEIAEEIFRSMPCKDVTAWSAMIMGFAINGCDD  352

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGRA  1
               +  F +M+ +  T+P+ VTF+ + TAC+  G+  EG    E + + 
Sbjct  353   LVLEYFIKME-ETKTKPNAVTFIGILTACNHRGLVDEGWNFFESMSKV  399



>ref|XP_011042533.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540 
[Populus euphratica]
Length=617

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/343 (39%), Positives = 211/343 (62%), Gaps = 3/343 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKG  853
             H  +I      + FA S L++   D NL +  Y  +++ +IQ P + I N+ I+ F    
Sbjct  35    HAHLIRAHTIFDVFAASCLISISIDKNLLD--YAAQVFYQIQNPNLFIYNSFIRGFSGSK  92

Query  852   ELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGN  673
             +  ++   Y    + G+ PDN T P+L+KAC    S ++G   HGQ ++ G   D YV N
Sbjct  93    DPDKSFHFYVQSKRNGLVPDNLTYPFLVKACTQKGSLDMGIQAHGQIIRHGLDNDVYVQN  152

Query  672   SLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRV  493
             SL+ MYS+L D++SA  VF  +    VV+WT +++ Y + GDV  AR +FD+ P K+   
Sbjct  153   SLVTMYSTLGDIKSASYVFRRISCLDVVSWTSMVTGYIKSGDVTSARKLFDKMPEKNLVT  212

Query  492   WGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVE  313
             W  MISGY +N+ F++ ++L+ L+Q  GV+A+E ++VS++++CAHLG+L++G+  H Y+ 
Sbjct  213   WSVMISGYAKNSFFEKAIELYFLLQSEGVRANETVMVSVIASCAHLGALELGERAHDYIL  272

Query  312   KLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMR  133
             +  M +N+ LGTALVDMYA+CG +  A  +F +LP RD + W  +I+GFAM+G  E A+ 
Sbjct  273   RNKMTVNLILGTALVDMYARCGSIDKAIWVFDQLPGRDALSWTTLIAGFAMHGYAEKALE  332

Query  132   LFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
              F  M+  AG  P  +TF ++ +ACS  G+   GL+L E + R
Sbjct  333   YFLRMEK-AGLTPREITFTAVLSACSHGGLVERGLELFESMKR  374


 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 144/312 (46%), Gaps = 20/312 (6%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             QAHGQ+I  GL N+ +  + L+   S   LG+      ++ RI    +    +M+  ++ 
Sbjct  134   QAHGQIIRHGLDNDVYVQNSLVTMYS--TLGDIKSASYVFRRISCLDVVSWTSMVTGYIK  191

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCL--KFGFLMDS  685
              G+++   +++  M      P+   + + +   G  ++    ++I    L    G   + 
Sbjct  192   SGDVTSARKLFDKM------PEKNLVTWSVMISGYAKNSFFEKAIELYFLLQSEGVRANE  245

Query  684   YVGNSLIVMYSSLDDMESAQCVFD-----EMPSRCVVAWTVLISRYSRKGDVFEARLVFD  520
              V  S+I   + L  +E  +   D     +M    ++  T L+  Y+R G + +A  VFD
Sbjct  246   TVMVSVIASCAHLGALELGERAHDYILRNKMTVNLILG-TALVDMYARCGSIDKAIWVFD  304

Query  519   ETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDI  340
             + P +D   W ++I+G+  +   ++ L+ F  M+  G+   E    ++LSAC+H G ++ 
Sbjct  305   QLPGRDALSWTTLIAGFAMHGYAEKALEYFLRMEKAGLTPREITFTAVLSACSHGGLVER  364

Query  339   GKWVHRYVEKLGMAINVRLGTA--LVDMYAKCGCLGLAQKLFYELPER-DVICWNAMISG  169
             G  +   +++    I  RL     +VD+  + G L  A+K   E+P + +   W A++  
Sbjct  365   GLELFESMKR-DYRIEPRLEHYGCMVDLLGRAGKLAEAEKFVNEMPMKPNAPIWGALLGA  423

Query  168   FAMNGDGENAMR  133
               ++ + E A R
Sbjct  424   CRIHKNSEIAER  435



>ref|XP_007163011.1| hypothetical protein PHAVU_001G198600g [Phaseolus vulgaris]
 gb|ESW35005.1| hypothetical protein PHAVU_001G198600g [Phaseolus vulgaris]
Length=622

 Score =   274 bits (701),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/341 (39%), Positives = 206/341 (60%), Gaps = 1/341 (0%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKG  853
             H   +   L  + F  SRL+AFC +       Y  R+  +I+ P + I N +I+      
Sbjct  37    HAHFLRTHLFFDVFVASRLVAFCIESTTNLLHYALRVVSQIKNPNLFIYNALIRGCSTSQ  96

Query  852   ELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGN  673
                 +   Y   L+ G+ PDN T P+L+KAC  +ES  +G   HGQ +K GF +D +  N
Sbjct  97    NPQNSFHYYIKALRFGVVPDNITHPFLVKACTQLESAPMGMQAHGQIIKHGFELDFFARN  156

Query  672   SLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRV  493
             SL+ MY+++ D+++A+ +F  +    VV+WT +I  Y R GDV  AR +FD  P ++   
Sbjct  157   SLLHMYATVGDIKAARSIFQRIGRFDVVSWTSMIGGYHRCGDVESARQLFDRMPERNLVT  216

Query  492   WGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVE  313
             W +MISGY +NN F + +++F  +Q  GV A+E ++V ++S+CAHLG+L +G+  H YV 
Sbjct  217   WSTMISGYARNNYFDKAVEMFGALQAEGVVANETVMVGVISSCAHLGALAMGEKAHDYVM  276

Query  312   KLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMR  133
             +  + +N+ LGTA+VDMYA+CG LG A ++F  LPE+DV+CW A+I+G AM+G  E  + 
Sbjct  277   RNNLRLNLILGTAVVDMYARCGDLGKAVQVFELLPEKDVLCWTALIAGLAMHGYAEKVLW  336

Query  132   LFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
              F EM    G  P  +TF ++ +ACS +GM   GL++ E +
Sbjct  337   YFSEMLK-TGVVPRDITFTAVLSACSHAGMVERGLEIFESM  376


 Score = 77.4 bits (189),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 71/344 (21%), Positives = 141/344 (41%), Gaps = 65/344 (19%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLL---AFCSDPNLGNPTY---------GW-----------  928
             QAHGQ+I  G   + FA + LL   A   D       +          W           
Sbjct  138   QAHGQIIKHGFELDFFARNSLLHMYATVGDIKAARSIFQRIGRFDVVSWTSMIGGYHRCG  197

Query  927   ------RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLK  766
                   ++++R+ +  +   +TMI  +       + +EM+  +   G+  +   +  ++ 
Sbjct  198   DVESARQLFDRMPERNLVTWSTMISGYARNNYFDKAVEMFGALQAEGVVANETVMVGVIS  257

Query  765   ACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVA  586
             +C ++ +  +G   H   ++    ++  +G +++ MY+                 RC   
Sbjct  258   SCAHLGALAMGEKAHDYVMRNNLRLNLILGTAVVDMYA-----------------RC---  297

Query  585   WTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGV  406
                        GD+ +A  VF+  P KD   W ++I+G   +   ++ L  F  M  TGV
Sbjct  298   -----------GDLGKAVQVFELLPEKDVLCWTALIAGLAMHGYAEKVLWYFSEMLKTGV  346

Query  405   QADEAILVSILSACAHLGSLDIGKWVHRYV-EKLGMAINVRLGTALVDMYAKCGCLGLAQ  229
                +    ++LSAC+H G ++ G  +   + E  G+   +     +VD+  + G LG A+
Sbjct  347   VPRDITFTAVLSACSHAGMVERGLEIFESMKEDHGVEPRLEHYGCMVDLLGRAGKLGEAE  406

Query  228   KLFYELPER-DVICWNAMISGFAMNGD---GENAMRLFREMQND  109
             K   E+P + +   W A++    ++ +   GE   ++  EMQ +
Sbjct  407   KFVLEMPVKPNAPIWRALLGACRIHKNVQVGERVGKILLEMQPE  450



>ref|XP_007046897.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOX91054.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=529

 Score =   272 bits (695),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/345 (38%), Positives = 210/345 (61%), Gaps = 1/345 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q+   GL  +T  +SR+L FC  P  GN  Y   +++R+ +P   + NTMI+ +  
Sbjct  36    QIHAQMFKTGLVADTITVSRILTFCVSPKYGNLEYAQMVFDRVSRPNTFMYNTMIRGYSN  95

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               E  +   +Y+ ML   +  ++YT P+LLKAC ++ +    + IH   +K GF  + + 
Sbjct  96    NKEPEKAFLLYQQMLCHSVPHNSYTFPFLLKACSSLLAIEETKQIHAHVIKLGFGSEVFA  155

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSL+ +Y++   +++A+ +FD +P R +V+W  +I  Y++ G +  A   F + P K+ 
Sbjct  156   TNSLLHVYATSGSIKAARLLFDLVPERDIVSWNSMIGCYTKCGKMEIAYEFFKDMPTKNV  215

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MISGYV    +KE L LF  MQ+ GV+ D   L S LSAC+HLG+LD G+W+H Y
Sbjct  216   ISWTTMISGYVGAGMYKEALNLFHEMQIEGVKPDNVALASTLSACSHLGALDQGRWIHAY  275

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             ++++G+ I+  LG  L+DM+AKCG +  A ++F ++ +++V  W A+ISGFA++G G+ A
Sbjct  276   IDRIGVEIDPILGCVLIDMFAKCGDMEEALEVFRKVKKKEVSLWTAVISGFAIHGRGKEA  335

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             +  F  MQ   G RP+ +TF ++ TACS SG+  EG  L + + R
Sbjct  336   LVWFDIMQK-VGIRPNHITFTAILTACSHSGLVEEGKSLYKSMDR  379


 Score = 95.1 bits (235),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 76/348 (22%), Positives = 146/348 (42%), Gaps = 65/348 (19%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLL-AFCSDPNL----------------------------G  946
             Q H  VI  G G+  FA + LL  + +  ++                            G
Sbjct  139   QIHAHVIKLGFGSEVFATNSLLHVYATSGSIKAARLLFDLVPERDIVSWNSMIGCYTKCG  198

Query  945   NPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLK  766
                  +  ++ +    +    TMI  ++  G     + ++  M   G+ PDN  L   L 
Sbjct  199   KMEIAYEFFKDMPTKNVISWTTMISGYVGAGMYKEALNLFHEMQIEGVKPDNVALASTLS  258

Query  765   ACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVA  586
             AC ++ + + GR IH    + G  +D  +G                 CV  +M ++C   
Sbjct  259   ACSHLGALDQGRWIHAYIDRIGVEIDPILG-----------------CVLIDMFAKC---  298

Query  585   WTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGV  406
                        GD+ EA  VF +   K+  +W ++ISG+  +   KE L  F +MQ  G+
Sbjct  299   -----------GDMEEALEVFRKVKKKEVSLWTAVISGFAIHGRGKEALVWFDIMQKVGI  347

Query  405   QADEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLAQ  229
             + +     +IL+AC+H G ++ GK +++ ++++  ++  +     +VD+  + G L  A 
Sbjct  348   RPNHITFTAILTACSHSGLVEEGKSLYKSMDRVHKLSPTIEHYGCMVDLLGRAGFLREAM  407

Query  228   KLFYELPER-DVICWNAMISGFAMNGD---GENAMRLFREMQNDAGTR  97
              L  ++P + + + W A+++   M+ +   G+   ++  E   D G R
Sbjct  408   GLIEKMPVKPNAVVWGALLNACRMHKNVELGKKIGKILIEEDPDHGGR  455



>ref|XP_010277322.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Nelumbo nucifera]
 ref|XP_010277323.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Nelumbo nucifera]
 ref|XP_010277324.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Nelumbo nucifera]
 ref|XP_010277325.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Nelumbo nucifera]
 ref|XP_010277326.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Nelumbo nucifera]
Length=539

 Score =   272 bits (695),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/343 (39%), Positives = 216/343 (63%), Gaps = 1/343 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q    +I  G   + +A  +++AFC+  +LG+  + + ++  +   T  I NTMI+AF  
Sbjct  29    QIQSHLIVSGTICDPYAAGKIIAFCAISDLGDLNHAYLLFRHLPHRTTFIWNTMIRAFAE  88

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             + E ++ + +YK ML++G+ P+NYT  +LLKA  ++ S  LG   H Q ++ G+    +V
Sbjct  89    RKEPAKAILLYKQMLQSGLLPNNYTFSFLLKASVDLSSIWLGLKFHSQVVRLGWECYDFV  148

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N LI +Y++ D + +A+ +FD   +  V++WT +IS Y + G +  AR +F++ P ++ 
Sbjct  149   QNGLIHLYANCDCIANARKLFDRSLNPDVISWTAVISGYCKSGQLEIARQLFEKMPERNA  208

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY Q   F+E L+LF  MQ  G Q + A +V  LSACA LG+LD G+W+H Y
Sbjct  209   VSWSAMITGYAQVGKFRESLELFNEMQHAGFQPNHAGIVGALSACAFLGALDQGRWIHAY  268

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V++  M ++  LGTALVDMY+KCGC+  A+++F E+PERDV  + +MISG + +G   +A
Sbjct  269   VDRNKMELDRILGTALVDMYSKCGCIDTARQVFNEMPERDVYTFTSMISGLSNHGQSASA  328

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             + LF EMQ + G +P+ VTF+ + +ACS  G+  EGL+    +
Sbjct  329   IELFVEMQKE-GVKPNEVTFICVLSACSRMGLVEEGLRFFNSM  370


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 119/263 (45%), Gaps = 33/263 (13%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            +++E++ +      + MI  +   G+   ++E++  M   G  P++  +   L AC  + 
Sbjct  198  QLFEKMPERNAVSWSAMITGYAQVGKFRESLELFNEMQHAGFQPNHAGIVGALSACAFLG  257

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            + + GR IH    +    +D  +G +L+ MYS                 +C         
Sbjct  258  ALDQGRWIHAYVDRNKMELDRILGTALVDMYS-----------------KC---------  291

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 G +  AR VF+E P +D   + SMISG   +      ++LF  MQ  GV+ +E  
Sbjct  292  -----GCIDTARQVFNEMPERDVYTFTSMISGLSNHGQSASAIELFVEMQKEGVKPNEVT  346

Query  387  LVSILSACAHLGSLDIG-KWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
             + +LSAC+ +G ++ G ++ +   E   +   V     LVD+  + G L  A+K+  E+
Sbjct  347  FICVLSACSRMGLVEEGLRFFNSMTEVYAINPGVEHYGCLVDLLGRAGMLEEAKKVVTEM  406

Query  210  P-ERDVICWNAMISGFAMNGDGE  145
            P E D     A+++   ++G+ E
Sbjct  407  PMEPDSYVLGALLNACRVHGNVE  429



>ref|XP_010646933.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Vitis vinifera]
Length=528

 Score =   271 bits (694),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/346 (40%), Positives = 215/346 (62%), Gaps = 5/346 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q +  VIT GL   T+  SR+L+FC+    G+ +Y   ++ +I  PTI   N+MI  FL 
Sbjct  29    QIYAHVITLGLARFTYITSRVLSFCAVSETGDLSYAETVFNKIAAPTIFDFNSMITGFLN  88

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             + E  + + +Y  M   G+ P+  TL  ++KA   + S N    +H Q +KFG   D Y 
Sbjct  89    RSEFEKGLSVYAQMRTLGVEPNARTLTVMIKAFLRLSSIN---QVHCQIMKFGHGSDLYA  145

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              + LI  YS+   ME A+ VF+E  +R +V WT LIS Y   G V EAR VFD  P ++ 
Sbjct  146   ISLLITRYSTCGAMELARQVFNESSNRNIVCWTGLISGYCSNGFVDEARCVFDAMPERND  205

Query  498   RVWGSMISGYVQNNCFKEGLQLFR-LMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
               + +M SGYV+N+CF E ++LFR L     V+ + ++LVS+L ACA +G+ + GKW+H 
Sbjct  206   VSYSAMASGYVRNDCFNEAIELFRELNSCAAVKPNVSLLVSVLDACAAVGAFEEGKWIHS  265

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y+++ G+  ++++GTAL+D YAKCGC+  A+++F ++P +DV  W++MI G A+NG+ E 
Sbjct  266   YIDENGLDYDLKMGTALIDFYAKCGCIKTAEEIFDKMPLKDVTAWSSMILGLAINGNNEM  325

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
              + LF EM+   G RP+ +TF+ +FTAC+   + +E L+LL ++ +
Sbjct  326   GLELFHEMET-RGPRPNAITFIGVFTACNHKTLVNEALRLLGRMSK  370



>ref|XP_002873264.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH49523.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=624

 Score =   274 bits (700),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 212/350 (61%), Gaps = 8/350 (2%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFC---SDPNLGNPT----YGWRIYERIQQPTICIVNTMI  874
             HG ++   L ++ F  SRLLA      D     PT    Y + I+ +IQ P + + N +I
Sbjct  32    HGFLLRTHLISDVFVASRLLALALCVDDSTFHKPTNLLGYAYGIFSQIQNPNLFVFNVLI  91

Query  873   KAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFL  694
             + F    E S+    Y  MLK+ + PDN T P+L+KA   ME   +G   H Q ++FGF 
Sbjct  92    RCFSTGAEPSKAFGFYTQMLKSRIWPDNITFPFLIKASTEMECVVVGEQTHSQIVRFGFQ  151

Query  693   MDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDET  514
              D YV NSL+ MY++   + +A  +F +MP R VV+WT +++ Y + G V +AR +FDE 
Sbjct  152   NDVYVENSLVHMYANCGLIAAAGRIFGQMPFRDVVSWTSMVAGYCKCGMVEDAREMFDEM  211

Query  513   PVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
             P ++   W  MI+GY +NNCF++ + LF LM+  GV A+E ++VS++S+CAHLG+L+ G+
Sbjct  212   PHRNLFTWSIMINGYAKNNCFEKAIDLFELMKREGVVANETVMVSVISSCAHLGALEFGE  271

Query  333   WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNG  154
               H YV K  M +N+ LGTALVDMY +CG +  A ++F ELP++D + W+++I G A++G
Sbjct  272   RAHEYVVKSHMTVNLILGTALVDMYWRCGEIEKAIRVFEELPDKDSLSWSSIIKGLAVHG  331

Query  153   DGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
                 A+  F +M    G  P  +T  ++ +ACS  G+  +GL++ E + R
Sbjct  332   HAHKAIHYFSQMVR-LGFSPRDITLTAVLSACSHGGLVDKGLEIYENMKR  380


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/230 (22%), Positives = 98/230 (43%), Gaps = 43/230 (19%)
 Frame = -2

Query  774  LLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDD---------MESAQC  622
            LL++C +     +   IHG  L+   + D +V + L+ +   +DD         +  A  
Sbjct  18   LLQSCSSFSDLKI---IHGFLLRTHLISDVFVASRLLALALCVDDSTFHKPTNLLGYAYG  74

Query  621  VFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEG  442
            +F ++ +  +  + VLI  +S   +  +A   +  T +   R+W                
Sbjct  75   IFSQIQNPNLFVFNVLIRCFSTGAEPSKAFGFY--TQMLKSRIW----------------  116

Query  441  LQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDM  262
                          D      ++ A   +  + +G+  H  + + G   +V +  +LV M
Sbjct  117  -------------PDNITFPFLIKASTEMECVVVGEQTHSQIVRFGFQNDVYVENSLVHM  163

Query  261  YAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQN  112
            YA CG +  A ++F ++P RDV+ W +M++G+   G  E+A  +F EM +
Sbjct  164  YANCGLIAAAGRIFGQMPFRDVVSWTSMVAGYCKCGMVEDAREMFDEMPH  213



>ref|XP_010943863.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Elaeis guineensis]
Length=630

 Score =   274 bits (700),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/346 (39%), Positives = 206/346 (60%), Gaps = 3/346 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q++  GL  +  A+ RLL FC+    G+  Y  R++  + +P   + NT+ +A   
Sbjct  46    QYHSQIVRLGLAADNDAVGRLLKFCALSPSGDLAYALRLFSHLPRPDPFVFNTLFRA--Q  103

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                  R+  +Y  ML+  + P+ +T P LL++        LGR +H   LK GF  D Y 
Sbjct  104   PASAPRSALLYSDMLQRPVHPNEFTFPSLLQSIAADRELGLGRQVHAHVLKLGFGADGYS  163

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
             GN+L+ MY S   +  A  + D MP R VV+WT +IS  S+ G + +AR +FDE P ++ 
Sbjct  164   GNNLLHMYLSCGLLAEAHSLLDAMPHRDVVSWTTMISGLSQSGLLDDARKLFDEMPERNS  223

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GYVQ   FKE  +LF  MQ  GV+ D  +  S+LSAC  LG+L+ G+W+HRY
Sbjct  224   VSWNAMIAGYVQGGRFKEASKLFDQMQAEGVELDRYVAASMLSACTGLGALEQGQWIHRY  283

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E+ G+ ++ +L T ++DMY KCGCL  A ++F  L  + +  WN MI GFAM+G GE A
Sbjct  284   IERSGIELDSKLATTIIDMYCKCGCLEKAYEVFSGLSRKGLSSWNCMIGGFAMHGRGEEA  343

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGRA  1
             ++LF+EM+ + G  PD +T +++ +AC+ + + HEG    E + +A
Sbjct  344   IKLFKEMEKE-GVMPDDITLLNVLSACAHARLVHEGRHYFEYMVQA  388


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/263 (24%), Positives = 112/263 (43%), Gaps = 33/263 (13%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ + +      N MI  ++  G      +++  M   G+  D Y    +L AC  + 
Sbjct  213  KLFDEMPERNSVSWNAMIAGYVQGGRFKEASKLFDQMQAEGVELDRYVAASMLSACTGLG  272

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            +   G+ IH    + G  +DS +  ++I MY     +E A  VF               S
Sbjct  273  ALEQGQWIHRYIERSGIELDSKLATTIIDMYCKCGCLEKAYEVF---------------S  317

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
              SRKG                   W  MI G+  +   +E ++LF+ M+  GV  D+  
Sbjct  318  GLSRKG----------------LSSWNCMIGGFAMHGRGEEAIKLFKEMEKEGVMPDDIT  361

Query  387  LVSILSACAHLGSLDIGKWVHRY-VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
            L+++LSACAH   +  G+    Y V+   +   +     +VD+  + G L  A+K+  E+
Sbjct  362  LLNVLSACAHARLVHEGRHYFEYMVQAYHIEPRMEHFGCMVDLLGRAGLLEEAKKIIDEM  421

Query  210  P-ERDVICWNAMISGFAMNGDGE  145
            P E D     A++    ++G+ E
Sbjct  422  PMEPDAGVLGALLGACKIHGNVE  444



>ref|XP_006289319.1| hypothetical protein CARUB_v10002804mg [Capsella rubella]
 gb|EOA22217.1| hypothetical protein CARUB_v10002804mg [Capsella rubella]
Length=622

 Score =   273 bits (699),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 138/348 (40%), Positives = 216/348 (62%), Gaps = 6/348 (2%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGN-PT----YGWRIYERIQQPTICIVNTMIKA  868
             HG +I   L ++ F  SR+LA C D ++ N PT    Y + I+ +IQ P + + N +I+ 
Sbjct  32    HGFLIRTHLISDVFVASRVLALCVDDSIFNKPTNLLGYAYGIFSQIQYPNLFVFNLLIRC  91

Query  867   FLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMD  688
             F +  E SR    Y  MLK+ + PDN T P+L+KA   ME   +G   H Q ++FGF  D
Sbjct  92    FSIGAEPSRAFGFYTQMLKSRIWPDNITFPFLIKASTEMECVTIGEQTHSQIVRFGFQND  151

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
              YV NSL+ MY++   + +A  +F +MP R VV+WT +++ Y + G + +AR +FDE P 
Sbjct  152   VYVENSLVHMYANCGLIAAAGRIFGQMPFRDVVSWTSMVAGYCKCGMIEDAREMFDEMPH  211

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWV  328
             ++   W  MI+GY +NNCF++ + LF L++  GV A+E ++VS++S+CAHLG+L+ G   
Sbjct  212   RNLFTWSIMINGYAKNNCFEKAIDLFELLKREGVVANETVMVSVISSCAHLGALEHGVRA  271

Query  327   HRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDG  148
             H YV +  + +N+ LGTALVDMY +CG +  A  +F ELP++D + W+++I G A++G  
Sbjct  272   HEYVVENHITVNLILGTALVDMYWRCGDIEKAICVFDELPDKDSLSWSSIIKGLAVHGHA  331

Query  147   ENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
               A+  F +M    G  P  VTF ++ +ACS  G+  +GL++ E + R
Sbjct  332   HEAVHYFSQMIR-LGFIPRDVTFTAVLSACSHGGLVEKGLEIYENMKR  378



>ref|XP_009368815.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 
[Pyrus x bretschneideri]
Length=736

 Score =   276 bits (705),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 136/331 (41%), Positives = 204/331 (62%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +I  GL N  FALS+L+ FC+    G+ +Y   ++E I+ P   + NT+I+   L
Sbjct  48    QVHTHIIKTGLHNTHFALSKLVEFCAVSPFGDLSYALSVFESIENPNQIVWNTIIRGHSL  107

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    +E Y  M+ +G+ P++YT P+LLK+C    + + G+ +HG  +K G   D++V
Sbjct  108   SSRPIEAVEFYVRMILSGVEPNSYTFPFLLKSCAKTAATHEGKQVHGHVVKLGLESDAFV  167

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   +++SA+ VFD+   R  V++T LIS Y  +G + +AR++FDE PV+D 
Sbjct  168   HTSLINMYAQNGELDSARLVFDKSLLRDAVSFTALISGYVSRGCMDDARVLFDEIPVRDV  227

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MISGY Q   F+E L LF  M+   V  +E+ +V++LSACA  GSL++GKWV  +
Sbjct  228   VSWNAMISGYAQRERFEEALALFGEMRKANVSPNESTMVTVLSACAQSGSLELGKWVASW  287

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E  G+  N+RL +AL+DMY+KCG L +A+ LF  L ERDVI WN MI G+      + A
Sbjct  288   IEDHGLGSNLRLISALIDMYSKCGALDIARGLFDGLQERDVISWNVMIGGYTHKSHYKEA  347

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + LFR M   + T P+ VTF+ +  AC+  G
Sbjct  348   LMLFRLMLR-SNTEPNDVTFLGILPACAHLG  377


 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 103/230 (45%), Gaps = 32/230 (14%)
 Frame = -2

Query  1011  GLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTME  832
             GLG+N   +S L+   S     +   G  +++ +Q+  +   N MI  +  K      + 
Sbjct  292   GLGSNLRLISALIDMYSKCGALDIARG--LFDGLQERDVISWNVMIGGYTHKSHYKEALM  349

Query  831   MYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYS  652
             +++ ML++   P++ T   +L AC ++ + +LG+ IH           +Y+  +      
Sbjct  350   LFRLMLRSNTEPNDVTFLGILPACAHLGALDLGKWIH-----------AYIDKN------  392

Query  651   SLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISG  472
                        F +  + C+  WT LI  Y++ G++  A+ VF+    K    W +MISG
Sbjct  393   -----------FQKFTNTCL--WTSLIDMYAKCGNIEAAKQVFNGMETKSLASWNAMISG  439

Query  471   YVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                +      L+LF  M+  G   D    V +LSAC H G +D+G+   R
Sbjct  440   LAMHGDALAALELFSKMEDEGFNPDAITFVGVLSACNHGGLVDLGRQYFR  489



>ref|XP_010243892.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305 
isoform X1 [Nelumbo nucifera]
Length=531

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/347 (38%), Positives = 211/347 (61%), Gaps = 3/347 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +I  GL       +R+L+F +  N G+  Y ++++  +  PTI   NT+I+ +  
Sbjct  32    QIHALIIALGLSEVESFTTRILSFSAISNSGDIDYSYQVFRHLSNPTIFNWNTVIRGYSR  91

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 +R++ ++  ML+ G+ PD+ T P+L KA   + S  LG +IH    K GF MD +V
Sbjct  92    SKNPNRSISVFTQMLRVGVSPDHLTFPFLAKASARLSSLRLGLAIHSCIFKAGFEMDRFV  151

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
             GNSLI MY+S +D+ SAQ +F+EMP R +V+W  +I  Y++ GD+  AR++F+  P +D 
Sbjct  152   GNSLIHMYASCNDIASAQKLFEEMPQRSLVSWNAIIDGYAKCGDLVAARVIFESMPERDV  211

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W S+I GYV+    +E L +F  M+  G +A+E  +VS+L ACAHLG+L+ G+ +H+Y
Sbjct  212   VSWSSLIDGYVKAGDHREALTIFNRMRFVGPEANEVTMVSVLCACAHLGALEQGRMMHQY  271

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLF--YELPERDVICWNAMISGFAMNGDGE  145
             V+   + +++ L T+LVDMYAKCG +  A  +F    + + DV+ WNAMI G A +G  +
Sbjct  272   VKDNALPLSLTLRTSLVDMYAKCGAIEEALLVFNGVSVHQTDVLIWNAMIGGLATHGLVK  331

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
              ++ LF +MQN  G  PD +T++ L +AC+  G+  +       +G+
Sbjct  332   ESLELFTDMQN-LGIAPDEITYLCLLSACAHGGLVEQAWYFFNSLGK  377


 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 68/287 (24%), Positives = 119/287 (41%), Gaps = 37/287 (13%)
 Frame = -2

Query  924  IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
            I+E + +  +   +++I  ++  G+    + ++  M   G   +  T+  +L AC ++ +
Sbjct  202  IFESMPERDVVSWSSLIDGYVKAGDHREALTIFNRMRFVGPEANEVTMVSVLCACAHLGA  261

Query  744  CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
               GR +H                               Q V D      +   T L+  
Sbjct  262  LEQGRMMH-------------------------------QYVKDNALPLSLTLRTSLVDM  290

Query  564  YSRKGDVFEARLVFDETPVK--DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEA  391
            Y++ G + EA LVF+   V   D  +W +MI G   +   KE L+LF  MQ  G+  DE 
Sbjct  291  YAKCGAIEEALLVFNGVSVHQTDVLIWNAMIGGLATHGLVKESLELFTDMQNLGIAPDEI  350

Query  390  ILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
              + +LSACAH G ++   +    + K GM       + +VD+  + G L  A +   ++
Sbjct  351  TYLCLLSACAHGGLVEQAWYFFNSLGKHGMTPKSEHYSCMVDVLGRAGQLDEAFQFVSKM  410

Query  210  P-ERDVICWNAMISGFAMNGD---GENAMRLFREMQNDAGTRPDGVT  82
            P E       A++SG   +G     E   R   E++ D   R  G++
Sbjct  411  PVEPSSSTLGALLSGCITHGKFDLAEEVGRGLIELEPDHDGRYVGLS  457



>emb|CBI31119.3| unnamed protein product [Vitis vinifera]
Length=512

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/343 (38%), Positives = 213/343 (62%), Gaps = 1/343 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q    +   G   + FA  R+++FC+    G+ ++ + ++  + + T  I NTM++AF  
Sbjct  6     QIQSHLTVSGTLFDPFAAGRIISFCAVSAQGDISHAYLLFLSLPRRTSFIWNTMLRAFTD  65

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             K E +  + +YK+ML TG  P+NYT  +LL+AC  +   + G  +H Q ++ G+    +V
Sbjct  66    KKEPATVLSLYKYMLSTGFLPNNYTFSFLLQACAQLSDLSFGILLHAQAVRLGWEAYDFV  125

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N L+ +Y+S + M+SA+ +FD   +R VV WT +I+ Y++ G V  AR +FDE P K+ 
Sbjct  126   QNGLLHLYASCNCMDSARRLFDGSVNRDVVTWTAVINGYAKSGQVVVARQLFDEMPEKNA  185

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY Q   F+E L+LF  MQ+ G + +   +V  L+ACA LG+LD G+W+H Y
Sbjct  186   VSWSAMITGYAQIGLFREALELFNDMQIAGFRPNHGAIVGALTACAFLGALDQGRWIHAY  245

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V++  M ++  LGTAL+DMYAKCGC+  A ++F E+ +RDV  + ++ISG A +G    A
Sbjct  246   VDRNRMVLDRILGTALIDMYAKCGCVETACRVFDEMLDRDVFAFTSLISGLANHGHSATA  305

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             + +F  MQN+ G  P+ VTF+ L +ACS  G+  EGL++ + +
Sbjct  306   IEMFTRMQNE-GVCPNEVTFICLLSACSRVGLVEEGLRIFKSM  347



>gb|KDP41276.1| hypothetical protein JCGZ_15683 [Jatropha curcas]
Length=373

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 163/210 (78%), Gaps = 1/210 (0%)
 Frame = -2

Query  639  MESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQN  460
            M SA  +FDE+ S C V+WT++IS Y++ GD+  ARL FD    KD  +WG+MISGYVQN
Sbjct  1    MRSASYMFDEIRSPCSVSWTLMISGYAKVGDIESARLSFDRASDKDIGIWGAMISGYVQN  60

Query  459  NCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLG  280
            NCFKE L +FRLMQ   +  DE I +S L ACA LG+LD G W+HRY+++LG+ +++RL 
Sbjct  61   NCFKECLYMFRLMQSADIIPDEVIFLSTLCACAQLGALDTGIWIHRYLDRLGLPLSIRLK  120

Query  279  TALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGT  100
            T+L+DMYAKCG L LA+K+F E+P+RD +CWNAMISG AM+GDG+ A++LF EM+  AG 
Sbjct  121  TSLIDMYAKCGNLDLAKKMFDEMPQRDTVCWNAMISGLAMHGDGDGALKLFMEMEK-AGC  179

Query  99   RPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
            RPD VTF+++ +ACS SGMA EGL+LL+++
Sbjct  180  RPDDVTFIAILSACSYSGMAEEGLRLLDRM  209


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 107/267 (40%), Gaps = 37/267 (14%)
 Frame = -2

Query  921  YERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESC  742
            ++R     I I   MI  ++        + M++ M    + PD       L AC  + + 
Sbjct  39   FDRASDKDIGIWGAMISGYVQNNCFKECLYMFRLMQSADIIPDEVIFLSTLCACAQLGAL  98

Query  741  NLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRY  562
            + G  IH    + G  +   +  SLI MY+   +++ A+ +FDEMP R  V W  +IS  
Sbjct  99   DTGIWIHRYLDRLGLPLSIRLKTSLIDMYAKCGNLDLAKKMFDEMPQRDTVCWNAMISGL  158

Query  561  SRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILV  382
            +  GD   A                               L+LF  M+  G + D+   +
Sbjct  159  AMHGDGDGA-------------------------------LKLFMEMEKAGCRPDDVTFI  187

Query  381  SILSACAHLGSLDIG-KWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP-  208
            +ILSAC++ G  + G + + R      +         +VD+ ++ G L  A+ +   +P 
Sbjct  188  AILSACSYSGMAEEGLRLLDRMCNVYNIGPKSEHYACIVDVVSRAGLLQEAKDIIQRMPT  247

Query  207  ----ERDVICWNAMISGFAMNGDGENA  139
                 ++ + W A++S     G  + A
Sbjct  248  SSSSSQEAVAWRALLSACCDQGQAQLA  274



>ref|XP_002265420.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Vitis vinifera]
 ref|XP_010646695.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Vitis vinifera]
 ref|XP_010646696.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Vitis vinifera]
 ref|XP_010646697.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Vitis vinifera]
 ref|XP_010646698.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Vitis vinifera]
 ref|XP_010646699.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Vitis vinifera]
 ref|XP_010646700.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Vitis vinifera]
Length=537

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/343 (38%), Positives = 213/343 (62%), Gaps = 1/343 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q    +   G   + FA  R+++FC+    G+ ++ + ++  + + T  I NTM++AF  
Sbjct  31    QIQSHLTVSGTLFDPFAAGRIISFCAVSAQGDISHAYLLFLSLPRRTSFIWNTMLRAFTD  90

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             K E +  + +YK+ML TG  P+NYT  +LL+AC  +   + G  +H Q ++ G+    +V
Sbjct  91    KKEPATVLSLYKYMLSTGFLPNNYTFSFLLQACAQLSDLSFGILLHAQAVRLGWEAYDFV  150

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N L+ +Y+S + M+SA+ +FD   +R VV WT +I+ Y++ G V  AR +FDE P K+ 
Sbjct  151   QNGLLHLYASCNCMDSARRLFDGSVNRDVVTWTAVINGYAKSGQVVVARQLFDEMPEKNA  210

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY Q   F+E L+LF  MQ+ G + +   +V  L+ACA LG+LD G+W+H Y
Sbjct  211   VSWSAMITGYAQIGLFREALELFNDMQIAGFRPNHGAIVGALTACAFLGALDQGRWIHAY  270

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V++  M ++  LGTAL+DMYAKCGC+  A ++F E+ +RDV  + ++ISG A +G    A
Sbjct  271   VDRNRMVLDRILGTALIDMYAKCGCVETACRVFDEMLDRDVFAFTSLISGLANHGHSATA  330

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             + +F  MQN+ G  P+ VTF+ L +ACS  G+  EGL++ + +
Sbjct  331   IEMFTRMQNE-GVCPNEVTFICLLSACSRVGLVEEGLRIFKSM  372



>ref|XP_007154464.1| hypothetical protein PHAVU_003G121400g [Phaseolus vulgaris]
 gb|ESW26458.1| hypothetical protein PHAVU_003G121400g [Phaseolus vulgaris]
Length=604

 Score =   271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/337 (39%), Positives = 207/337 (61%), Gaps = 3/337 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  ++  GL  +  A+S +L+FCS  N G+  Y  +++  +  P   + NT+ KAF +
Sbjct  20    QHHSLLLRLGLSTDNHAMSGILSFCSLSNHGDINYALKLFTTLPNPDTFLYNTLFKAFFI  79

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 S ++  Y HML+  + P+++T P L++ C   +     + +H   LKFGF  D++ 
Sbjct  80    SHNPSLSLPFYSHMLQRSITPNSFTFPSLIRTCKLQQQV---KQLHAHVLKFGFGADTFA  136

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N+LI +Y +   ++ A+ VF  MP   VV+WT L+S YS  G V EA  VF+  P K+ 
Sbjct  137   LNNLIHVYFAFGSLDDARRVFYTMPHPNVVSWTTLVSGYSYWGLVDEAFRVFELMPSKNG  196

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+ +V++N F+E   LFR M++  V+ D  +  ++LSAC  +G+L+ GKW+H  
Sbjct  197   VSWNAMIACFVKSNRFREAFDLFRRMRVEEVEVDRFVAATMLSACTGVGALEQGKWIHGC  256

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             VE+ G+ ++ +LGT LVDMY KCGCL  A ++F EL  + V  WN MI GFAM+G GE+A
Sbjct  257   VERSGILLDSKLGTTLVDMYCKCGCLDKAFRVFCELEVKGVSSWNCMIGGFAMHGKGEDA  316

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGL  28
             +R+FR+M+ +    PD +TFV++ TAC+ SG+  EG 
Sbjct  317   IRIFRKMEEEGTVVPDDITFVNVLTACAHSGLIEEGF  353


 Score = 83.6 bits (205),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 87/362 (24%), Positives = 152/362 (42%), Gaps = 68/362 (19%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLL----AFCS------------DPNL--------GNPTYG  931
             Q H  V+  G G +TFAL+ L+    AF S             PN+        G   +G
Sbjct  120   QLHAHVLKFGFGADTFALNNLIHVYFAFGSLDDARRVFYTMPHPNVVSWTTLVSGYSYWG  179

Query  930   -----WRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLK  766
                  +R++E +        N MI  F+         ++++ M    +  D +    +L 
Sbjct  180   LVDEAFRVFELMPSKNGVSWNAMIACFVKSNRFREAFDLFRRMRVEEVEVDRFVAATMLS  239

Query  765   ACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVA  586
             AC  + +   G+ IHG   + G L+DS +G +L+ MY                  +C   
Sbjct  240   ACTGVGALEQGKWIHGCVERSGILLDSKLGTTLVDMYC-----------------KC---  279

Query  585   WTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG-  409
                        G + +A  VF E  VK    W  MI G+  +   ++ +++FR M+  G 
Sbjct  280   -----------GCLDKAFRVFCELEVKGVSSWNCMIGGFAMHGKGEDAIRIFRKMEEEGT  328

Query  408   VQADEAILVSILSACAHLGSLDIGKWVHRY-VEKLGMAINVRLGTALVDMYAKCGCLGLA  232
             V  D+   V++L+ACAH G ++ G +   Y ++  G+         +VD+ A+ G L  A
Sbjct  329   VVPDDITFVNVLTACAHSGLIEEGFYYFCYMIDVHGIQPTKEHYGCMVDLLARAGRLEEA  388

Query  231   QKLFYELP-ERDVICWNAMISGFAMNGD---GENAMRLFREMQNDAGTRPDGVTFVSLFT  64
             +K+  E+P   D     A++    ++G+   GE   +  R ++ D G     V   +++ 
Sbjct  389   KKVIDEMPMSPDAAVLGALLGACRIHGNLELGEEVGK--RLIELDPGNSGRYVILGNIYA  446

Query  63    AC  58
             +C
Sbjct  447   SC  448



>ref|XP_004292867.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Fragaria vesca subsp. vesca]
Length=544

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/348 (37%), Positives = 210/348 (60%), Gaps = 8/348 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H Q++   L  + F +++++  C     GN  Y   +++++ +P + + N MI+A+  
Sbjct  32    KIHAQIVKLSLSQSNFLVTKMVDVCDYS--GNVNYASLLFKQVLEPNVFLFNAMIRAYTH  89

Query  858   KGELSRTMEMYKHMLK-----TGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFL  694
                    + +YK ML+     T + PD +T P+++K C  +   +LGR +HGQ  KFG  
Sbjct  90    NYVYDSAIALYKQMLRHPESETLIFPDKFTFPFVIKCCAGLGCEDLGRQVHGQVWKFGPG  149

Query  693   MDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDET  514
                 + N+L+  Y+  D++  A  VFDEM  R V++W  L+S Y R G + +AR VF+E 
Sbjct  150   SHLLIENALMAFYTKCDNLRDAHKVFDEMTERDVISWNSLLSGYVRLGQMTKARAVFEEM  209

Query  513   PVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
               K    W +M+SGY +  C+ + L++FR MQM G++ DE  +VS+L AC+ LG+L++GK
Sbjct  210   SDKSIVSWTAMVSGYTRIGCYGDALEIFRRMQMLGIEPDEISVVSVLPACSQLGALEVGK  269

Query  333   WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNG  154
             W+HRY +K  +  +V +  AL++MY KCGC+  A +LF ++  RDVI W+ MI+G A NG
Sbjct  270   WIHRYSDKKRLLQSVSVCNALIEMYVKCGCIDQAWQLFDQMSGRDVISWSTMIAGLANNG  329

Query  153   DGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
                 A+ LF+EMQ    T P+G+TF+ + +ACS +G+  EGLK  + +
Sbjct  330   KAHEAVELFQEMQR-VKTEPNGITFLGVLSACSHAGLWKEGLKYFDSM  376



>ref|XP_010646822.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
isoform X2 [Vitis vinifera]
Length=474

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/346 (39%), Positives = 214/346 (62%), Gaps = 5/346 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q +  VIT GL   T+  SR+L+FC+    G+ +Y   ++ +I  PTI   N+MI  FL 
Sbjct  29    QIYAHVITLGLARFTYITSRVLSFCAVSETGDLSYAETVFNKIVAPTIFDFNSMITGFLN  88

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             + E  + + +Y  M   G+ P+  TL  ++KA   + S N    +H Q +KFG   D Y 
Sbjct  89    RSEFEKGLSVYAQMRTLGVEPNARTLTVMIKAFLRLSSIN---QVHCQIMKFGHGSDLYA  145

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              + LI  YS+   ME A+ VF+E  +R +V WT LIS Y   G V EAR VFD  P ++ 
Sbjct  146   ISLLITRYSTCGAMELARQVFNESSNRNIVCWTGLISGYCSNGFVDEARCVFDAMPERND  205

Query  498   RVWGSMISGYVQNNCFKEGLQLFR-LMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
               + +M SGYV+N+ F E ++LFR L     V+ + ++LVS+L ACA +G+ + GKW+H 
Sbjct  206   VSYSAMASGYVRNDRFNEAIELFRELKSCAAVKPNISLLVSVLDACAAVGAFEEGKWIHS  265

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y+++ G+  ++++GTAL+D YAKCGC+  A+++F ++P +DV  W++MI G A+NG+ E 
Sbjct  266   YIDENGLDYDLKMGTALIDFYAKCGCIKTAEEIFNKMPLKDVTAWSSMILGLAINGNNEM  325

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
              + LF EM+   G RP+ +TF+ +FTAC+   + +E L+LL ++ +
Sbjct  326   GLELFHEMETR-GPRPNAITFIGVFTACNHKTLVNEALRLLGRMSK  370



>ref|XP_002272744.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 
[Vitis vinifera]
Length=622

 Score =   271 bits (693),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/345 (40%), Positives = 204/345 (59%), Gaps = 1/345 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q HGQ++  GL  +    S+LLAFC+ PN G+  Y   +++RI +P   + NTMI+ +  
Sbjct  36    QIHGQMLKTGLILDEIPASKLLAFCASPNSGSLAYARTVFDRIFRPNTFMWNTMIRGYSN  95

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               E    + +Y HML   +  + YT P+LLKAC +M +    + IH   +K GF  + Y 
Sbjct  96    SKEPEEALLLYHHMLYHSVPHNAYTFPFLLKACSSMSALEETQQIHAHIIKMGFGSEIYT  155

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSL+ +YS   D++SA+ +FD++  R  V+W  +I  Y++ G++  A  +F+  P ++ 
Sbjct  156   TNSLLNVYSKSGDIKSARLLFDQVDQRDTVSWNSMIDGYTKCGEIEMAYEIFNHMPERNI  215

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W SMISG V     KE L LF  MQ  G++ D   LVS L ACA LG LD GKW+H Y
Sbjct  216   ISWTSMISGCVGAGKPKEALNLFHRMQTAGIKLDNVALVSTLQACADLGVLDQGKWIHAY  275

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             ++K  + I+  LG  L+DMYAKCG L  A ++F ++ E+ V  W AMISG+A++G G  A
Sbjct  276   IKKHEIEIDPILGCVLIDMYAKCGDLEEAIEVFRKMEEKGVSVWTAMISGYAIHGRGREA  335

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             +  F +MQ  AG  P+ +TF  + TACS +G+ HE   L E + R
Sbjct  336   LEWFMKMQT-AGVEPNQMTFTGILTACSHAGLVHEAKLLFESMER  379


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 78/331 (24%), Positives = 135/331 (41%), Gaps = 66/331 (20%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +I  G G+  +  + LL   S    G+      +++++ Q      N+MI  +  
Sbjct  139   QIHAHIIKMGFGSEIYTTNSLLNVYSKS--GDIKSARLLFDQVDQRDTVSWNSMIDGYTK  196

Query  858   KGELSRTMEMYKHMLK-------------------------------TGMCPDNYTLPYL  772
              GE+    E++ HM +                                G+  DN  L   
Sbjct  197   CGEIEMAYEIFNHMPERNIISWTSMISGCVGAGKPKEALNLFHRMQTAGIKLDNVALVST  256

Query  771   LKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCV  592
             L+AC ++   + G+ IH    K    +D  +G  LI MY        A+C          
Sbjct  257   LQACADLGVLDQGKWIHAYIKKHEIEIDPILGCVLIDMY--------AKC----------  298

Query  591   VAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMT  412
                          GD+ EA  VF +   K   VW +MISGY  +   +E L+ F  MQ  
Sbjct  299   -------------GDLEEAIEVFRKMEEKGVSVWTAMISGYAIHGRGREALEWFMKMQTA  345

Query  411   GVQADEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGL  235
             GV+ ++     IL+AC+H G +   K +   +E++ G   ++     +VD+  + G L  
Sbjct  346   GVEPNQMTFTGILTACSHAGLVHEAKLLFESMERIHGFKPSIEHYGCMVDLLGRAGLLKE  405

Query  234   AQKLFYELPER-DVICWNAMISGFAMNGDGE  145
             A++L   +P + +   W A+++   ++G+ E
Sbjct  406   AEELIENMPVKPNAAIWGALLNACHIHGNLE  436



>emb|CAN66581.1| hypothetical protein VITISV_030261 [Vitis vinifera]
Length=622

 Score =   271 bits (693),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/345 (40%), Positives = 204/345 (59%), Gaps = 1/345 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q HGQ++  GL  +    S+LLAFC+ PN G+  Y   +++RI +P   + NTMI+ +  
Sbjct  36    QIHGQMLKTGLILDEIPASKLLAFCASPNSGSLAYARTVFDRIFRPNTFMWNTMIRGYSN  95

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               E    + +Y HML   +  + YT P+LLKAC +M +    + IH   +K GF  + Y 
Sbjct  96    SKEPEEALLLYHHMLYHSVPHNAYTFPFLLKACSSMSASEETQQIHAHIIKMGFGSEIYT  155

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSL+ +YS   D++SA+ +FD++  R  V+W  +I  Y++ G++  A  +F+  P ++ 
Sbjct  156   TNSLLNVYSKSGDIKSARLLFDQVDQRDTVSWNSMIDGYTKCGEIEMAYEIFNHMPERNI  215

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W SMISG V     KE L LF  MQ  G++ D   LVS L ACA LG LD GKW+H Y
Sbjct  216   ISWTSMISGCVGAGKPKEALNLFHRMQTAGIKLDNVALVSTLQACADLGVLDQGKWIHAY  275

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             ++K  + I+  LG  L+DMYAKCG L  A ++F ++ E+ V  W AMISG+A++G G  A
Sbjct  276   IKKHEIEIDPILGCVLIDMYAKCGDLEEAIEVFRKMEEKGVSVWTAMISGYAIHGRGREA  335

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             +  F +MQ  AG  P+ +TF  + TACS +G+ HE   L E + R
Sbjct  336   LEWFMKMQT-AGVEPNQMTFTGILTACSHAGLVHEAKLLFESMER  379


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 78/331 (24%), Positives = 135/331 (41%), Gaps = 66/331 (20%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +I  G G+  +  + LL   S    G+      +++++ Q      N+MI  +  
Sbjct  139   QIHAHIIKMGFGSEIYTTNSLLNVYSKS--GDIKSARLLFDQVDQRDTVSWNSMIDGYTK  196

Query  858   KGELSRTMEMYKHMLK-------------------------------TGMCPDNYTLPYL  772
              GE+    E++ HM +                                G+  DN  L   
Sbjct  197   CGEIEMAYEIFNHMPERNIISWTSMISGCVGAGKPKEALNLFHRMQTAGIKLDNVALVST  256

Query  771   LKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCV  592
             L+AC ++   + G+ IH    K    +D  +G  LI MY        A+C          
Sbjct  257   LQACADLGVLDQGKWIHAYIKKHEIEIDPILGCVLIDMY--------AKC----------  298

Query  591   VAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMT  412
                          GD+ EA  VF +   K   VW +MISGY  +   +E L+ F  MQ  
Sbjct  299   -------------GDLEEAIEVFRKMEEKGVSVWTAMISGYAIHGRGREALEWFMKMQTA  345

Query  411   GVQADEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGL  235
             GV+ ++     IL+AC+H G +   K +   +E++ G   ++     +VD+  + G L  
Sbjct  346   GVEPNQMTFTGILTACSHAGLVHEAKLLFESMERIHGFKPSIEHYGCMVDLLGRAGLLKE  405

Query  234   AQKLFYELPER-DVICWNAMISGFAMNGDGE  145
             A++L   +P + +   W A+++   ++G+ E
Sbjct  406   AEELIENMPVKPNAAIWGALLNACHIHGNLE  436



>ref|XP_008337322.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 
[Malus domestica]
Length=736

 Score =   273 bits (698),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 133/331 (40%), Positives = 206/331 (62%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  ++  GL N  FALS+L+ FC+    G+ +Y   ++E I+ P   + NT+I+ + L
Sbjct  48    QVHTHIVKTGLHNXHFALSKLIEFCAVSPFGDLSYALSVFESIENPNQIVWNTIIRGYSL  107

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    +E Y  M+ +G+ P++YT P+LLK+C    + + G+ +HG  +K G   D++V
Sbjct  108   SSRPLEAVEFYVRMILSGVEPNSYTFPFLLKSCTKTAATHEGKQVHGHVVKLGLESDAFV  167

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   ++ SA+ VFD+   R  V++T LIS Y  +G + +AR++FDE PV+D 
Sbjct  168   HTSLINMYAQNGELVSARXVFDKSHLRDAVSFTALISGYVSRGCMDDARVLFDEIPVRDV  227

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MISGY Q + F+E L LF  M+   V  +E+ +V++LSACA  GSL++GKWV  +
Sbjct  228   VSWNAMISGYAQRDRFEEALALFGEMRKANVSPNESTMVTVLSACAQSGSLELGKWVASW  287

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E  G+  N+RL +AL+DMY+KCG L +A+ LF  L +RDVI WN MI G+      + A
Sbjct  288   IEDHGLGSNLRLVSALIDMYSKCGALDIARGLFDGLQQRDVISWNVMIGGYTHKSHYKEA  347

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             +  FR M   + T+P+ VTF+++  AC+  G
Sbjct  348   LMQFRLMLR-SNTQPNDVTFLAILPACAHLG  377


 Score =   166 bits (421),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 151/299 (51%), Gaps = 33/299 (11%)
 Frame = -2

Query  924  IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
            +++ I    +   N MI  +  +      + ++  M K  + P+  T+  +L AC    S
Sbjct  218  LFDEIPVRDVVSWNAMISGYAQRDRFEEALALFGEMRKANVSPNESTMVTVLSACAQSGS  277

Query  744  CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
              LG+ +        ++ D  +G++L                      R V A   LI  
Sbjct  278  LELGKWV------ASWIEDHGLGSNL----------------------RLVSA---LIDM  306

Query  564  YSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAIL  385
            YS+ G +  AR +FD    +D   W  MI GY   + +KE L  FRLM  +  Q ++   
Sbjct  307  YSKCGALDIARGLFDGLQQRDVISWNVMIGGYTHKSHYKEALMQFRLMLRSNTQPNDVTF  366

Query  384  VSILSACAHLGSLDIGKWVHRYVEK-LGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP  208
            ++IL ACAHLG+LD+GKW+H Y++K      N  L T+L+DMY KCG +  A+++F  + 
Sbjct  367  LAILPACAHLGALDLGKWIHAYIDKNFQKFTNTSLWTSLIDMYXKCGNIEAAKQVFNGME  426

Query  207  ERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             + +  WNAMISG AM+GD   A+ LF +M+ D G  PD +TFV + +AC+  G+   G
Sbjct  427  TKSLASWNAMISGLAMHGDAHAALELFSKME-DEGFNPDAITFVGVLSACNHGGLVDLG  484


 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 58/227 (26%), Positives = 101/227 (44%), Gaps = 34/227 (15%)
 Frame = -2

Query  1011  GLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTME  832
             GLG+N   +S L+   S     +   G  +++ +QQ  +   N MI  +  K      + 
Sbjct  292   GLGSNLRLVSALIDMYSKCGALDIARG--LFDGLQQRDVISWNVMIGGYTHKSHYKEALM  349

Query  831   MYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLK-FGFLMDSYVGNSLIVMY  655
              ++ ML++   P++ T   +L AC ++ + +LG+ IH    K F    ++ +  SLI MY
Sbjct  350   QFRLMLRSNTQPNDVTFLAILPACAHLGALDLGKWIHAYIDKNFQKFTNTSLWTSLIDMY  409

Query  654   SSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMIS  475
                 ++E+A+ VF+ M ++ + +W  +IS  +  GD   A                    
Sbjct  410   XKCGNIEAAKQVFNGMETKSLASWNAMISGLAMHGDAHAA--------------------  449

Query  474   GYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
                        L+LF  M+  G   D    V +LSAC H G +D+G+
Sbjct  450   -----------LELFSKMEDEGFNPDAITFVGVLSACNHGGLVDLGR  485



>gb|KDP23803.1| hypothetical protein JCGZ_00135 [Jatropha curcas]
Length=494

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 212/345 (61%), Gaps = 1/345 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q    +   G   + +A +++++FC+    GN ++ ++++ R+Q  +  I NTMI+AF  
Sbjct  32    QIQSHLTVSGTLKDPYAAAKIISFCAVSRAGNLSHAYQLFLRLQFRSTFIWNTMIRAFAE  91

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               E SR + +YKHML++   P+NYT  +L KAC ++    L  + HGQ +K G+    +V
Sbjct  92    ATEPSRAIALYKHMLRSNFLPNNYTFSFLFKACTDLNDFFLALACHGQAIKLGWESYDFV  151

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N LI ++++   M+ A+ +FD   +R V+ WT LI+ + + G V  AR +FD+ P K+ 
Sbjct  152   QNGLIHLFATFGFMDHARQLFDVSSNRDVITWTALINGFLKSGQVTVARGLFDKMPEKNS  211

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GYV+   FKE L LF  MQ++G + + A +V  ++ACA LG L  G+W+H Y
Sbjct  212   VSWSAMITGYVRVGLFKEALALFNAMQISGFRPNHAGIVGAITACAFLGDLYEGRWIHAY  271

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             + K  + ++  LG+AL+DMYAK G + LA  +F +LP+RDV  +  +ISG A +G+   A
Sbjct  272   ITKNRIELDRILGSALIDMYAKSGRIDLAFCIFDQLPKRDVYVYTCLISGLANHGESAAA  331

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             + LF  MQN+ G  P+ VTFVS+  ACS  G+  EGL++ E + +
Sbjct  332   IELFERMQNE-GVVPNDVTFVSVLNACSRMGLMDEGLRIFENMSK  375


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/270 (24%), Positives = 118/270 (44%), Gaps = 33/270 (12%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            G  T    +++++ +      + MI  ++  G     + ++  M  +G  P++  +   +
Sbjct  194  GQVTVARGLFDKMPEKNSVSWSAMITGYVRVGLFKEALALFNAMQISGFRPNHAGIVGAI  253

Query  768  KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
             AC  +     GR IH    K    +D  +G++LI MY+    ++ A C+          
Sbjct  254  TACAFLGDLYEGRWIHAYITKNRIELDRILGSALIDMYAKSGRIDLAFCI----------  303

Query  588  AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
                                 FD+ P +D  V+  +ISG   +      ++LF  MQ  G
Sbjct  304  ---------------------FDQLPKRDVYVYTCLISGLANHGESAAAIELFERMQNEG  342

Query  408  VQADEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLA  232
            V  ++   VS+L+AC+ +G +D G  +   + K+ G+   V+    LVD+  K G L  A
Sbjct  343  VVPNDVTFVSVLNACSRMGLMDEGLRIFENMSKIYGIEPQVQHYGCLVDILGKAGKLEEA  402

Query  231  QKLFYELP-ERDVICWNAMISGFAMNGDGE  145
            +K+  E+P E D     A+++   ++GD E
Sbjct  403  KKVVREMPMEPDSYVLGALLNACRVHGDVE  432


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 85/213 (40%), Gaps = 5/213 (2%)
 Frame = -2

Query  657  YSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMI  478
            +S +  ++S   V   +      A  +     SR G++  A  +F     +   +W +MI
Sbjct  27   FSQIKQIQSHLTVSGTLKDPYAAAKIISFCAVSRAGNLSHAYQLFLRLQFRSTFIWNTMI  86

Query  477  SGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMA  298
              + +       + L++ M  +    +      +  AC  L    +    H    KLG  
Sbjct  87   RAFAEATEPSRAIALYKHMLRSNFLPNNYTFSFLFKACTDLNDFFLALACHGQAIKLGWE  146

Query  297  INVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREM  118
                +   L+ ++A  G +  A++LF     RDVI W A+I+GF  +G    A  LF +M
Sbjct  147  SYDFVQNGLIHLFATFGFMDHARQLFDVSSNRDVITWTALINGFLKSGQVTVARGLFDKM  206

Query  117  QNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLL  19
                    + V++ ++ T     G+  E L L 
Sbjct  207  -----PEKNSVSWSAMITGYVRVGLFKEALALF  234



>ref|XP_010646821.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
isoform X1 [Vitis vinifera]
Length=528

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/346 (39%), Positives = 214/346 (62%), Gaps = 5/346 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q +  VIT GL   T+  SR+L+FC+    G+ +Y   ++ +I  PTI   N+MI  FL 
Sbjct  29    QIYAHVITLGLARFTYITSRVLSFCAVSETGDLSYAETVFNKIVAPTIFDFNSMITGFLN  88

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             + E  + + +Y  M   G+ P+  TL  ++KA   + S N    +H Q +KFG   D Y 
Sbjct  89    RSEFEKGLSVYAQMRTLGVEPNARTLTVMIKAFLRLSSIN---QVHCQIMKFGHGSDLYA  145

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              + LI  YS+   ME A+ VF+E  +R +V WT LIS Y   G V EAR VFD  P ++ 
Sbjct  146   ISLLITRYSTCGAMELARQVFNESSNRNIVCWTGLISGYCSNGFVDEARCVFDAMPERND  205

Query  498   RVWGSMISGYVQNNCFKEGLQLFR-LMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
               + +M SGYV+N+ F E ++LFR L     V+ + ++LVS+L ACA +G+ + GKW+H 
Sbjct  206   VSYSAMASGYVRNDRFNEAIELFRELKSCAAVKPNISLLVSVLDACAAVGAFEEGKWIHS  265

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y+++ G+  ++++GTAL+D YAKCGC+  A+++F ++P +DV  W++MI G A+NG+ E 
Sbjct  266   YIDENGLDYDLKMGTALIDFYAKCGCIKTAEEIFNKMPLKDVTAWSSMILGLAINGNNEM  325

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
              + LF EM+   G RP+ +TF+ +FTAC+   + +E L+LL ++ +
Sbjct  326   GLELFHEMETR-GPRPNAITFIGVFTACNHKTLVNEALRLLGRMSK  370



>ref|XP_006425654.1| hypothetical protein CICLE_v10025166mg [Citrus clementina]
 ref|XP_006466814.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Citrus sinensis]
 gb|ESR38894.1| hypothetical protein CICLE_v10025166mg [Citrus clementina]
Length=622

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 205/345 (59%), Gaps = 1/345 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q+   GL  NT  +SRLLAFC+  N G+  Y   +++RI +P   + NTM++ +  
Sbjct  36    QIHAQMFKKGLTVNTILVSRLLAFCTFSNSGSLAYAQMVFDRIIKPNTFMWNTMVRGYAD  95

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               E  + + +Y+ ML   +  + YT P+LLKAC  + +    + IH Q +KFGF  + + 
Sbjct  96    SSEPEQALLLYRQMLSHSVSHNAYTFPFLLKACSRLSALEETQQIHAQIIKFGFSSEVFA  155

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSL+  Y+    ++SA+ +FD MP R  V+W  +I  Y++ G++  A   F +   K+ 
Sbjct  156   TNSLLHAYAISGSIKSARLIFDHMPQRDTVSWNSMIDGYTKCGEMELACEFFKDMKEKNV  215

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W ++ISGYV     KE L LF  MQ  GV+ D   LVS +SACAHLG+LD G+W+  Y
Sbjct  216   ISWTTLISGYVGAGMDKEALHLFHEMQTAGVKPDNVALVSAVSACAHLGALDQGRWIDEY  275

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             ++ LG+ I+  LG AL+DMYAKCG L  A +LF  + ++ V  W A+I G A++G G  A
Sbjct  276   IKHLGIKIDPILGCALIDMYAKCGDLEEALELFKRMEKKGVSAWTAIIFGLAIHGHGREA  335

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             +  F +MQ  A T+P+ VTF ++ TACS +G+  EG  L E + R
Sbjct  336   LNWFSKMQV-ARTKPNLVTFTAILTACSYAGLVDEGKSLFESMER  379



>ref|XP_006299486.1| hypothetical protein CARUB_v10015651mg [Capsella rubella]
 gb|EOA32384.1| hypothetical protein CARUB_v10015651mg [Capsella rubella]
Length=534

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/342 (37%), Positives = 205/342 (60%), Gaps = 4/342 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H  +I  GL  ++F +++++  C    +G+  Y  R++ ++  P + + N++I+A+  
Sbjct  28    KIHASIIIHGLSQSSFMVTKMVDSCD--KIGDMEYATRLFNQVSYPNVFLYNSIIRAYTH  85

Query  858   KGELSRTMEMYKHM-LKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                    + +Y+ + +K+   PD +T P++ K+C ++ SC LG+ +HG   KFG      
Sbjct  86    HSLYCEVIRIYRQLFMKSIELPDRFTFPFMFKSCASLGSCYLGKQVHGHLCKFGPKFHVV  145

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+LI MY   DD+  A  VFDEM  R V++W  L+S Y+R G + +A+ +F   P K 
Sbjct  146   TENALIDMYMKFDDLADADRVFDEMSDRDVISWNSLLSGYARLGQMKKAKALFRLMPDKT  205

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MISGY    C+ E +  FR MQ+ G++ DE  L+S+L +CAHLGSL++GKW+H 
Sbjct  206   IVSWTAMISGYSGIGCYVEAMDFFREMQLAGIEPDEISLISVLPSCAHLGSLELGKWIHM  265

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y E+        +  AL++MY+KCG +  A +LF ++  +DVI W+ MISG+A +G+   
Sbjct  266   YAERRRFLKQTGVCNALIEMYSKCGVISQAIQLFDQMKRKDVISWSTMISGYAHHGNAHR  325

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLE  16
             A+ +F EMQ  A  +P+G+TF+ L +ACS  G+  EGLK  +
Sbjct  326   AIEIFNEMQR-AKVKPNGITFLGLLSACSHVGLWQEGLKYFD  366



>gb|KGN66073.1| hypothetical protein Csa_1G569490 [Cucumis sativus]
Length=611

 Score =   268 bits (685),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 132/339 (39%), Positives = 204/339 (60%), Gaps = 5/339 (1%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H Q+I  GL  +  A+ RL+ FC+    G+  Y   ++  I  P   I NT+I+A+L
Sbjct  38    KQFHSQIIRLGLSTDNNAIGRLIKFCAVSKYGDLHYALLLFNSIPYPDAFIYNTLIRAYL  97

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                    ++ +Y  ML   + P+ +T P +++AC    S   G+ IH   +KFGF  D +
Sbjct  98    HFNSPKSSLLLYLQMLHNSVFPNKFTFPSVIRACCIDNSVEEGKQIHTHVVKFGFSKDRF  157

Query  681   VGNSLIVMYSSLDDMESAQCVFD--EMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
               N+LI MY++   +E A+ VFD  E+P   VVAWT L++ Y++ G V E+  VF+  P 
Sbjct  158   CQNNLIHMYANFQSLEDARRVFDCIELPD--VVAWTTLLTGYAQLGYVDESLRVFESMPE  215

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWV  328
             ++   W +MIS +VQNN F E   LF  M++  V  ++ +  S+LSAC  LG+L+ GKW+
Sbjct  216   RNSASWNAMISCFVQNNRFHEAFGLFNRMRIEKVVLEKYVAASMLSACTGLGALEQGKWI  275

Query  327   HRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDG  148
             HRY+E+ G+  + +L T L+DMY KCGCL  A ++F  LPE+ +  WN MI G AM+G G
Sbjct  276   HRYIERNGIEFDSKLATTLIDMYCKCGCLDCAYEVFVHLPEKGISSWNCMIGGMAMHGKG  335

Query  147   ENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             E A+ LF++M+     +PD +TF+++ +AC+ SG+  +G
Sbjct  336   EAAIELFKDMETKM-VKPDNITFLNVLSACAHSGLVEKG  373


 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/271 (22%), Positives = 109/271 (40%), Gaps = 33/271 (12%)
 Frame = -2

Query  951  LGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYL  772
            LG      R++E + +      N MI  F+          ++  M    +  + Y    +
Sbjct  200  LGYVDESLRVFESMPERNSASWNAMISCFVQNNRFHEAFGLFNRMRIEKVVLEKYVAASM  259

Query  771  LKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCV  592
            L AC  + +   G+ IH    + G   DS +  +LI MY     ++ A  VF  +P + +
Sbjct  260  LSACTGLGALEQGKWIHRYIERNGIEFDSKLATTLIDMYCKCGCLDCAYEVFVHLPEKGI  319

Query  591  VAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMT  412
             +                               W  MI G   +   +  ++LF+ M+  
Sbjct  320  SS-------------------------------WNCMIGGMAMHGKGEAAIELFKDMETK  348

Query  411  GVQADEAILVSILSACAHLGSLDIGK-WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGL  235
             V+ D    +++LSACAH G ++ G+ + +R+ +  G+         +VD+Y + G L  
Sbjct  349  MVKPDNITFLNVLSACAHSGLVEKGQHYFYRFTQVYGIEPRTEHYGCMVDLYGRAGLLEE  408

Query  234  AQKLFYELP-ERDVICWNAMISGFAMNGDGE  145
            A K+  E+P   DV    A +    ++G+ E
Sbjct  409  AMKVIDEMPMSPDVGVLGAFVGACKIHGNIE  439



>ref|XP_002884209.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH60468.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=534

 Score =   265 bits (678),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 129/343 (38%), Positives = 203/343 (59%), Gaps = 4/343 (1%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              + H  +I  GL  ++F +++++  C    LG+  Y  R++ ++  P + + N++I+A+ 
Sbjct  27    KKIHACIIVHGLSQSSFMVTKMVDLCD--KLGDMDYATRLFNQVSNPNVFLYNSIIRAYT  84

Query  861   LKGELSRTMEMYKHML-KTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDS  685
                     + +YK +L KT   PD +T P++ K+C ++ SC LG+ +HG   KFG     
Sbjct  85    HNSLYCDVIRIYKQLLRKTIEFPDRFTFPFMFKSCASLGSCYLGKQVHGHLYKFGPRFHV  144

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
                N+LI MY   DD+  A  VFDEM  R V++W  L+S Y+R G + +A+ +F     K
Sbjct  145   VTENALIDMYMKFDDLVDAHKVFDEMSERDVISWNSLLSGYARLGQMKKAKGLFHLMIDK  204

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
                 W +MISGY    C+ E +  FR MQ+ G++ DE  L+S+L +CAHLGSL++GKW+H
Sbjct  205   TIVSWTAMISGYTGIGCYVEAMDFFREMQLAGIEPDEISLISVLPSCAHLGSLELGKWIH  264

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
              Y E+ G+     +  AL++MY+KCG L  A +LF +   +DVI W+ MISG+A +G+  
Sbjct  265   MYAERRGLLKQTGVCNALIEMYSKCGMLSQAIQLFEQTKGKDVISWSTMISGYAYHGNAH  324

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLE  16
              A   F EMQ  A  +P+G+TF+ L +ACS  G+  +GLK  +
Sbjct  325   RAFETFIEMQR-AKVKPNGITFLGLLSACSHVGLWQQGLKYFD  366



>ref|XP_002269269.2| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Vitis vinifera]
Length=725

 Score =   270 bits (689),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/338 (40%), Positives = 210/338 (62%), Gaps = 2/338 (1%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             +Q H Q IT G+ ++ F  SR+L+F +    G+  Y   ++ RI++P I I NT+I+A+ 
Sbjct  52    TQIHAQTITTGIFSDNFVASRILSFAALSPHGSIPYARFLFYRIRKPDIFIANTLIRAYA  111

Query  861   LKGELSRTMEMYKHMLKTGMC-PDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDS  685
                     +  Y  M ++ +  PD +T P LLKAC  + S  LG +IH    K G+  + 
Sbjct  112   FSPNPIDAVVFYSEMTESSVVFPDVHTFPLLLKACSEIPSLRLGEAIHSHVFKLGWSSEV  171

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
              V N L+ MY+S   +ESA  VFD  P     +W ++I  Y + G    AR +F+  P +
Sbjct  172   SVSNFLVQMYASCGLIESAGLVFDRTPECDGASWNIMIGGYLKCGVFKSARRMFEAMPDR  231

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             D   W  MI+GYVQ + FKEGL LF+ M    ++ +E++LV+ LSACAHLG+++ G+W+ 
Sbjct  232   DVVSWSVMINGYVQESRFKEGLGLFQDMMGEKIEPNESVLVNALSACAHLGAMEQGQWIE  291

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
             RY+E+  + + VRLGTAL+DMY+KCG +  A ++F+++ E++V+ W+AMI+G A+NG G+
Sbjct  292   RYMERKNVRLTVRLGTALIDMYSKCGSVERALEVFHKMKEKNVLAWSAMINGLAINGQGK  351

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             +A+ LF +M+   G +P+ VTF+ +  ACS S +  EG
Sbjct  352   DALNLFSQMEMQ-GVKPNEVTFIGILNACSHSKLVDEG  388



>ref|NP_196272.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9FG16.1|PP367_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g06540 
[Arabidopsis thaliana]
 dbj|BAB11403.1| selenium-binding protein-like [Arabidopsis thaliana]
 gb|AED91032.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=622

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/348 (39%), Positives = 211/348 (61%), Gaps = 6/348 (2%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGN-PT----YGWRIYERIQQPTICIVNTMIKA  868
             HG ++   L ++ F  SRLLA C D +  N PT    Y + I+ +IQ P + + N +I+ 
Sbjct  32    HGFLLRTHLISDVFVASRLLALCVDDSTFNKPTNLLGYAYGIFSQIQNPNLFVFNLLIRC  91

Query  867   FLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMD  688
             F    E S+    Y  MLK+ + PDN T P+L+KA   ME   +G   H Q ++FGF  D
Sbjct  92    FSTGAEPSKAFGFYTQMLKSRIWPDNITFPFLIKASSEMECVLVGEQTHSQIVRFGFQND  151

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
              YV NSL+ MY++   + +A  +F +M  R VV+WT +++ Y + G V  AR +FDE P 
Sbjct  152   VYVENSLVHMYANCGFIAAAGRIFGQMGFRDVVSWTSMVAGYCKCGMVENAREMFDEMPH  211

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWV  328
             ++   W  MI+GY +NNCF++ + LF  M+  GV A+E ++VS++S+CAHLG+L+ G+  
Sbjct  212   RNLFTWSIMINGYAKNNCFEKAIDLFEFMKREGVVANETVMVSVISSCAHLGALEFGERA  271

Query  327   HRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDG  148
             + YV K  M +N+ LGTALVDM+ +CG +  A  +F  LPE D + W+++I G A++G  
Sbjct  272   YEYVVKSHMTVNLILGTALVDMFWRCGDIEKAIHVFEGLPETDSLSWSSIIKGLAVHGHA  331

Query  147   ENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
               AM  F +M +  G  P  VTF ++ +ACS  G+  +GL++ E + +
Sbjct  332   HKAMHYFSQMIS-LGFIPRDVTFTAVLSACSHGGLVEKGLEIYENMKK  378


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/282 (19%), Positives = 113/282 (40%), Gaps = 11/282 (4%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H Q++  G  N+ +  + L+   +  N G      RI+ ++    +    +M+  + 
Sbjct  137   EQTHSQIVRFGFQNDVYVENSLVHMYA--NCGFIAAAGRIFGQMGFRDVVSWTSMVAGYC  194

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
               G +    EM+  M    +    +T   ++              +     + G + +  
Sbjct  195   KCGMVENAREMFDEMPHRNL----FTWSIMINGYAKNNCFEKAIDLFEFMKREGVVANET  250

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRC----VVAWTVLISRYSRKGDVFEARLVFDET  514
             V  S+I   + L  +E  +  ++ +        ++  T L+  + R GD+ +A  VF+  
Sbjct  251   VMVSVISSCAHLGALEFGERAYEYVVKSHMTVNLILGTALVDMFWRCGDIEKAIHVFEGL  310

Query  513   PVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
             P  D   W S+I G   +    + +  F  M   G    +    ++LSAC+H G ++ G 
Sbjct  311   PETDSLSWSSIIKGLAVHGHAHKAMHYFSQMISLGFIPRDVTFTAVLSACSHGGLVEKGL  370

Query  333   WVHRYVEK-LGMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
              ++  ++K  G+   +     +VDM  + G L  A+    ++
Sbjct  371   EIYENMKKDHGIEPRLEHYGCIVDMLGRAGKLAEAENFILKM  412



>emb|CAN70142.1| hypothetical protein VITISV_032085 [Vitis vinifera]
Length=748

 Score =   269 bits (688),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/331 (41%), Positives = 202/331 (61%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q+I  GL N  FALS+L+ FC+    GN +Y   ++E I+QP   I NTMI+   L
Sbjct  50    QIHSQIIKTGLHNTQFALSKLIEFCAISPFGNLSYALLLFESIEQPNQFIWNTMIRGNSL  109

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    ++ Y  ML  G+ P++YT P+LLK+C  + +   G+ IHG  LK G   D +V
Sbjct  110   SSSPVGAIDFYVRMLLCGVEPNSYTFPFLLKSCAKVGATQEGKQIHGHVLKLGLESDPFV  169

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   ++  A+ VF +   R  V++T LI+ Y+ +G + +AR +F+E PV+D 
Sbjct  170   HTSLINMYAQNGELGYAELVFSKSSLRDAVSFTALITGYTLRGCLDDARRLFEEIPVRDA  229

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY Q+  F+E L  F+ M+   V  +E+ +V++LSACA  GSL++G WV  +
Sbjct  230   VSWNAMIAGYAQSGRFEEALAFFQEMKRANVAPNESTMVTVLSACAQSGSLELGNWVRSW  289

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E  G+  N+RL  AL+DMY+KCG L  A+ LF  + E+D+I WN MI G++     + A
Sbjct  290   IEDHGLGSNLRLVNALIDMYSKCGDLDKARDLFEGICEKDIISWNVMIGGYSHMNSYKEA  349

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + LFR+MQ  +   P+ VTFVS+  AC+  G
Sbjct  350   LALFRKMQQ-SNVEPNDVTFVSILPACAYLG  379


 Score =   180 bits (456),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 107/301 (36%), Positives = 159/301 (53%), Gaps = 35/301 (12%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            R++E I        N MI  +   G     +  ++ M +  + P+  T+  +L AC    
Sbjct  219  RLFEEIPVRDAVSWNAMIAGYAQSGRFEEALAFFQEMKRANVAPNESTMVTVLSACAQSG  278

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LG  +        ++ D  +G++L                      R V A   LI 
Sbjct  279  SLELGNWVRS------WIEDHGLGSNL----------------------RLVNA---LID  307

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
             YS+ GD+ +AR +F+    KD   W  MI GY   N +KE L LFR MQ + V+ ++  
Sbjct  308  MYSKCGDLDKARDLFEGICEKDIISWNVMIGGYSHMNSYKEALALFRKMQQSNVEPNDVT  367

Query  387  LVSILSACAHLGSLDIGKWVHRYVEK--LGMAINVRLGTALVDMYAKCGCLGLAQKLFYE  214
             VSIL ACA+LG+LD+GKW+H Y++K  LG+  N  L T+L+DMYAKCG +  A+++F  
Sbjct  368  FVSILPACAYLGALDLGKWIHAYIDKKFLGLT-NTSLWTSLIDMYAKCGNIEAAKQVFAG  426

Query  213  LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHE  34
            +  + +  WNAMISG AM+G    A+ LFR+M+ D G  PD +TFV + +ACS +G+   
Sbjct  427  MKPKSLGSWNAMISGLAMHGHANMALELFRQMR-DEGFEPDDITFVGVLSACSHAGLVEL  485

Query  33   G  31
            G
Sbjct  486  G  486


 Score = 80.5 bits (197),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 67/306 (22%), Positives = 134/306 (44%), Gaps = 37/306 (12%)
 Frame = -2

Query  1011  GLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTME  832
             GLG+N   ++ L+   S    G+      ++E I +  I   N MI  +         + 
Sbjct  294   GLGSNLRLVNALIDMYS--KCGDLDKARDLFEGICEKDIISWNVMIGGYSHMNSYKEALA  351

Query  831   MYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYS  652
             +++ M ++ + P++ T   +L AC  + + +LG+ IH           +Y+    + + +
Sbjct  352   LFRKMQQSNVEPNDVTFVSILPACAYLGALDLGKWIH-----------AYIDKKFLGLTN  400

Query  651   SLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISG  472
             +                     WT LI  Y++ G++  A+ VF     K    W +MISG
Sbjct  401   T-------------------SLWTSLIDMYAKCGNIEAAKQVFAGMKPKSLGSWNAMISG  441

Query  471   YVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKW-VHRYVEKLGMAI  295
                +      L+LFR M+  G + D+   V +LSAC+H G +++G+      VE   ++ 
Sbjct  442   LAMHGHANMALELFRQMRDEGFEPDDITFVGVLSACSHAGLVELGRQCFSSMVEDYDISP  501

Query  294   NVRLGTALVDMYAKCGCLGLAQKLFYELPER-DVICWNAMISGFAMNGD---GENAMRLF  127
              ++    ++D+  + G    A+ L   +  + D   W +++    ++G+   GE A +  
Sbjct  502   KLQHYGCMIDLLGRAGLFDEAEALMKNMEMKPDGAIWGSLLGACRVHGNVELGEFAAKHL  561

Query  126   REMQND  109
              E++ +
Sbjct  562   FELEPE  567



>ref|XP_002274432.2| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 
[Vitis vinifera]
Length=743

 Score =   269 bits (687),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/331 (41%), Positives = 202/331 (61%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q+I  GL N  FALS+L+ FC+    GN +Y   ++E I+QP   I NTMI+   L
Sbjct  55    QIHSQIIKTGLHNTQFALSKLIEFCAISPFGNLSYALLLFESIEQPNQFIWNTMIRGNSL  114

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    ++ Y  ML  G+ P++YT P+LLK+C  + +   G+ IHG  LK G   D +V
Sbjct  115   SSSPVGAIDFYVRMLLCGVEPNSYTFPFLLKSCAKVGATQEGKQIHGHVLKLGLESDPFV  174

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   ++  A+ VF +   R  V++T LI+ Y+ +G + +AR +F+E PV+D 
Sbjct  175   HTSLINMYAQNGELGYAELVFSKSSLRDAVSFTALITGYTLRGCLDDARRLFEEIPVRDA  234

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY Q+  F+E L  F+ M+   V  +E+ +V++LSACA  GSL++G WV  +
Sbjct  235   VSWNAMIAGYAQSGRFEEALAFFQEMKRANVAPNESTMVTVLSACAQSGSLELGNWVRSW  294

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E  G+  N+RL  AL+DMY+KCG L  A+ LF  + E+D+I WN MI G++     + A
Sbjct  295   IEDHGLGSNLRLVNALIDMYSKCGDLDKARDLFEGICEKDIISWNVMIGGYSHMNSYKEA  354

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + LFR+MQ  +   P+ VTFVS+  AC+  G
Sbjct  355   LALFRKMQQ-SNVEPNDVTFVSILPACAYLG  384


 Score =   180 bits (456),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 107/301 (36%), Positives = 159/301 (53%), Gaps = 35/301 (12%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            R++E I        N MI  +   G     +  ++ M +  + P+  T+  +L AC    
Sbjct  224  RLFEEIPVRDAVSWNAMIAGYAQSGRFEEALAFFQEMKRANVAPNESTMVTVLSACAQSG  283

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LG  +        ++ D  +G++L                      R V A   LI 
Sbjct  284  SLELGNWVRS------WIEDHGLGSNL----------------------RLVNA---LID  312

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
             YS+ GD+ +AR +F+    KD   W  MI GY   N +KE L LFR MQ + V+ ++  
Sbjct  313  MYSKCGDLDKARDLFEGICEKDIISWNVMIGGYSHMNSYKEALALFRKMQQSNVEPNDVT  372

Query  387  LVSILSACAHLGSLDIGKWVHRYVEK--LGMAINVRLGTALVDMYAKCGCLGLAQKLFYE  214
             VSIL ACA+LG+LD+GKW+H Y++K  LG+  N  L T+L+DMYAKCG +  A+++F  
Sbjct  373  FVSILPACAYLGALDLGKWIHAYIDKKFLGLT-NTSLWTSLIDMYAKCGNIEAAKQVFAG  431

Query  213  LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHE  34
            +  + +  WNAMISG AM+G    A+ LFR+M+ D G  PD +TFV + +ACS +G+   
Sbjct  432  MKPKSLGSWNAMISGLAMHGHANMALELFRQMR-DEGFEPDDITFVGVLSACSHAGLVEL  490

Query  33   G  31
            G
Sbjct  491  G  491


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 67/306 (22%), Positives = 134/306 (44%), Gaps = 37/306 (12%)
 Frame = -2

Query  1011  GLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTME  832
             GLG+N   ++ L+   S    G+      ++E I +  I   N MI  +         + 
Sbjct  299   GLGSNLRLVNALIDMYS--KCGDLDKARDLFEGICEKDIISWNVMIGGYSHMNSYKEALA  356

Query  831   MYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYS  652
             +++ M ++ + P++ T   +L AC  + + +LG+ IH           +Y+    + + +
Sbjct  357   LFRKMQQSNVEPNDVTFVSILPACAYLGALDLGKWIH-----------AYIDKKFLGLTN  405

Query  651   SLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISG  472
             +                     WT LI  Y++ G++  A+ VF     K    W +MISG
Sbjct  406   T-------------------SLWTSLIDMYAKCGNIEAAKQVFAGMKPKSLGSWNAMISG  446

Query  471   YVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKW-VHRYVEKLGMAI  295
                +      L+LFR M+  G + D+   V +LSAC+H G +++G+      VE   ++ 
Sbjct  447   LAMHGHANMALELFRQMRDEGFEPDDITFVGVLSACSHAGLVELGRQCFSSMVEDYDISP  506

Query  294   NVRLGTALVDMYAKCGCLGLAQKLFYELPER-DVICWNAMISGFAMNGD---GENAMRLF  127
              ++    ++D+  + G    A+ L   +  + D   W +++    ++G+   GE A +  
Sbjct  507   KLQHYGCMIDLLGRAGLFDEAEALMKNMEMKPDGAIWGSLLGACRVHGNVELGEFAAKHL  566

Query  126   REMQND  109
              E++ +
Sbjct  567   FELEPE  572



>ref|XP_007221475.1| hypothetical protein PRUPE_ppa004164mg [Prunus persica]
 gb|EMJ22674.1| hypothetical protein PRUPE_ppa004164mg [Prunus persica]
Length=526

 Score =   264 bits (674),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/340 (38%), Positives = 204/340 (60%), Gaps = 1/340 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q    +   G   + +A ++++ FC+  N G+  + ++++  +   T  I N +I+A   
Sbjct  22    QIQSHLTVSGTLFDPYAAAKIITFCTVSNSGDLRHAFQLFRHMPYRTTYIWNVVIRALAE  81

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               E  R + +Y  M+++G+ P+NYT  +LL+AC ++   + G  +H   ++ G+    +V
Sbjct  82    NNESMRAVSLYSDMIQSGLLPNNYTFSFLLRACADLSYLSFGLVLHCHAIRLGWESHDFV  141

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N LI +Y + D +  A+ +FD    + VV WT LI+ Y + G V  AR +FD+ P K+ 
Sbjct  142   QNGLIHLYVTCDFINPARKLFDMSVYKDVVTWTALINGYVKSGQVVIARELFDQMPQKNA  201

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GYVQ   F+E L+LF  MQ++G   + A +V  L+ACA LG+LD G+W+H Y
Sbjct  202   VSWSAMINGYVQVGLFREALELFVDMQVSGFLPNHAGIVGSLTACAFLGALDQGRWIHAY  261

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V + GM ++  LGTALVDMY KCGC+  A+ +F E+P RDV  + ++ISG A NGD   A
Sbjct  262   VNRKGMQLDRVLGTALVDMYTKCGCIETARAVFNEMPSRDVFAFTSLISGLANNGDSAGA  321

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLL  19
             + LF  MQ D G  P+ VTF+ + +ACS  G+  EGL++ 
Sbjct  322   ISLFARMQ-DEGIAPNEVTFICMLSACSRMGLVDEGLRIF  360


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/273 (24%), Positives = 116/273 (42%), Gaps = 39/273 (14%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            G       +++++ Q      + MI  ++  G     +E++  M  +G  P++  +   L
Sbjct  184  GQVVIARELFDQMPQKNAVSWSAMINGYVQVGLFREALELFVDMQVSGFLPNHAGIVGSL  243

Query  768  KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
             AC  + + + GR IH    + G  +D  +G +L+ MY+                 +C  
Sbjct  244  TACAFLGALDQGRWIHAYVNRKGMQLDRVLGTALVDMYT-----------------KC--  284

Query  588  AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
                        G +  AR VF+E P +D   + S+ISG   N      + LF  MQ  G
Sbjct  285  ------------GCIETARAVFNEMPSRDVFAFTSLISGLANNGDSAGAISLFARMQDEG  332

Query  408  VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTA----LVDMYAKCGCL  241
            +  +E   + +LSAC+ +G +D G    R    +     ++ G      LVD+  + G L
Sbjct  333  IAPNEVTFICMLSACSRMGLVDEGL---RIFGSMTSTFRIQPGIQHYGCLVDLLGRAGML  389

Query  240  GLAQKLFYELP-ERDVICWNAMISGFAMNGDGE  145
              A K+  E+P E D     A+++   ++GD E
Sbjct  390  EEANKVVREMPMEPDSYVLGALLNACRVHGDVE  422



>ref|XP_008803539.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305 
[Phoenix dactylifera]
 ref|XP_008803540.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305 
[Phoenix dactylifera]
 ref|XP_008803541.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305 
[Phoenix dactylifera]
 ref|XP_008803542.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305 
[Phoenix dactylifera]
 ref|XP_008803543.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305 
[Phoenix dactylifera]
Length=537

 Score =   264 bits (674),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/338 (39%), Positives = 208/338 (62%), Gaps = 6/338 (2%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKG  853
             H Q+ T GL  + F +S+LL F +  + G+  Y  R++  +  PT  I NT+I+ F    
Sbjct  33    HAQITTHGLSADNFLISKLL-FSAVFDYGDIDYSCRVFRTLPAPTTFIYNTLIRGFSKSK  91

Query  852   ELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGN  673
               + ++ +Y  ML+ G+ PD+ T P+L K+C  + S  LG S+H    K G   D +V N
Sbjct  92    NPNSSISLYTQMLRAGVSPDHLTFPFLAKSCARLSSLRLGLSVHAHIAKSGLEFDLFVQN  151

Query  672   SLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRV  493
             SLI +Y+S DD+ SA+ VFD +    VV+W  L+  Y++ G++  AR  FD  P +D   
Sbjct  152   SLIHLYASCDDILSARRVFDGISQPNVVSWNALVDGYAKCGNIAAAREAFDRMPERDVVS  211

Query  492   WGSMISGYVQNNCFKEGLQLFRLMQMT--GVQADEAILVSILSACAHLGSLDIGKWVHRY  319
             W ++I GYV+   ++E L LF +MQ    G +A+E  +VS+L ACAHLG+LD G+ +HR+
Sbjct  212   WSALIDGYVKGGEYREALALFEMMQAQAGGPKANEVTMVSVLCACAHLGALDKGREMHRH  271

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPER--DVICWNAMISGFAMNGDGE  145
             +E+ G+ ++  L T+L+DMYAKCG +    ++F+ +P +  DV+ WNAMI G AM+G G+
Sbjct  272   LEENGLRLSPELLTSLIDMYAKCGSIHEGLEVFHAVPTQKTDVLMWNAMIGGLAMHGLGK  331

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
              ++ +FREMQ   G  PD +T++ L ++C+  G+  + 
Sbjct  332   ESVEMFREMQR-VGMVPDEITYLGLLSSCAHGGLVEDA  368


 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 63/270 (23%), Positives = 114/270 (42%), Gaps = 36/270 (13%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCP--DNYTLPY  775
            GN       ++R+ +  +   + +I  ++  GE    + +++ M      P  +  T+  
Sbjct  192  GNIAAAREAFDRMPERDVVSWSALIDGYVKGGEYREALALFEMMQAQAGGPKANEVTMVS  251

Query  774  LLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRC  595
            +L AC ++ + + GR +H    + G  +   +  SLI MY        A+C         
Sbjct  252  VLCACAHLGALDKGREMHRHLEENGLRLSPELLTSLIDMY--------AKC---------  294

Query  594  VVAWTVLISRYSRKGDVFEARLVFDETPVK--DRRVWGSMISGYVQNNCFKEGLQLFRLM  421
                          G + E   VF   P +  D  +W +MI G   +   KE +++FR M
Sbjct  295  --------------GSIHEGLEVFHAVPTQKTDVLMWNAMIGGLAMHGLGKESVEMFREM  340

Query  420  QMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCL  241
            Q  G+  DE   + +LS+CAH G ++      R ++  GM  +V     +VD+  + GC+
Sbjct  341  QRVGMVPDEITYLGLLSSCAHGGLVEDAWAFFRSLKAQGMTPHVEHYACMVDVLCRAGCM  400

Query  240  GLAQKLFYELP-ERDVICWNAMISGFAMNG  154
              A +    +P E       A++SG   +G
Sbjct  401  EEAYEFVSTMPIEPSASVLGALLSGCQTHG  430



>ref|XP_010259704.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Nelumbo nucifera]
Length=505

 Score =   263 bits (671),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/344 (37%), Positives = 208/344 (60%), Gaps = 2/344 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +I  GL      L +L+ F +  N  + +Y   ++  I+ P+  + NTMI+A+  
Sbjct  6     QLHAHIIIAGLQQQELYLRKLITFFAISNPSSLSYARLVFSNIETPSTFVYNTMIRAYAT  65

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               + S+ + +Y  M + G  PD YT P+LLKAC  +   + G+  H   +K GFL D +V
Sbjct  66    SSDPSQALHLYNQMRRQGTQPDRYTFPFLLKACSVLSDLHKGQETHCHVIKQGFLSDIFV  125

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSLI +Y S   ++ A  +FDEMP R +  WT L++  +    +  AR +FD  P +  
Sbjct  126   RNSLIHLYGSNSKIKIAHRIFDEMPHRDIATWTTLVACCANFASIELARKLFDRMPERSN  185

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               + +MI+GY+++  FKE LQLFR MQ+ G+  + + L S+L ACA+LG+LD+G+W+H +
Sbjct  186   VSFSAMIAGYIRHGWFKEALQLFRRMQIEGLVPNNSTLSSVLCACANLGALDLGRWIHSF  245

Query  318   V-EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             + E+ G   + R+ TAL+DMY KCG +  A ++F    ++ V  W AMISG AM+G G+ 
Sbjct  246   ICEREGNKFDCRIITALIDMYFKCGSIKDALQVFAGAKKKFVGEWTAMISGMAMHGFGQT  305

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             ++ LF +M + +G +P+ VTFV+L + C+ +G+  EGL+  +++
Sbjct  306   SIELFEDMVS-SGIKPNAVTFVALLSGCTHAGLVDEGLRYFQRM  348



>ref|XP_010250091.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like 
[Nelumbo nucifera]
Length=527

 Score =   263 bits (672),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 138/348 (40%), Positives = 215/348 (62%), Gaps = 5/348 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             + H  ++   L  N  ++S LL+F +   ++    +   I+  +   +  + NT+I+  +
Sbjct  25    EIHAHLLKSHLTENPLSISPLLSFAAVSGDIALFGHACSIFRSLCYRSTFMYNTVIRGHV  84

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME---SCNLGRSIHGQCLKFGFLM  691
                  +  +  Y  ML  G+  +NYT P L+KAC  +    S  +GR +HG  +KFGF  
Sbjct  85    QTHSPASAILCYLQMLNYGLASNNYTFPPLIKACTLLNCPPSKLVGRLVHGHAVKFGFSD  144

Query  690   DSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETP  511
             D ++ +SLI  YSS+ D E+A+ +FD  P+R VV WT ++  Y + GDV  AR +FDE P
Sbjct  145   DPFILSSLIEFYSSVLDTEAARRLFDGSPNRDVVLWTAMVDAYGKTGDVKNARALFDEMP  204

Query  510   VKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKW  331
             V++   W +M++GY + + FKE L+LF  MQ  G + +E++LVS+L+ACAHLG+L  G W
Sbjct  205   VRNAISWSAMMAGYSRVSDFKEVLRLFGQMQDLGTKPNESVLVSVLTACAHLGALTQGMW  264

Query  330   VHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGD  151
             VH YV +  +  N  L TA+VDMY+KCGC+G A  +F  +  +DV  WNA+ISG AMNGD
Sbjct  265   VHSYVRRNNLESNPILATAVVDMYSKCGCIGSALSVFEGILNKDVRSWNAIISGVAMNGD  324

Query  150   GENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIG  7
              + ++ LF +M    GT+P  VTFV++ TAC+ +G+  +G++L E++G
Sbjct  325   AKKSLELFDKMILH-GTQPTEVTFVAILTACTHAGLVDKGIELFEQMG  371



>ref|XP_008223786.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Prunus mume]
Length=528

 Score =   263 bits (672),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 141/345 (41%), Positives = 212/345 (61%), Gaps = 5/345 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q++T GL   TF  S+LLAF +    GN  Y   +  +I +P I   N+MI  FL 
Sbjct  30    QIHAQIVTTGLARFTFIASKLLAFSALSEYGNLHYAETLLYQITRPNIFDCNSMITGFLK  89

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               E  + + +Y  M + G  P+  T  +L KAC ++ S  LG+ +HGQ +KFG   D YV
Sbjct  90    CSESEKGLSIYTKMRRMGTEPNARTFTFLAKACVDVSS--LGQ-LHGQIMKFGHGCDVYV  146

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              +SLI MY   + +E A+ VF+E   + V  WT LIS Y   G V EAR +FD  P ++ 
Sbjct  147   ISSLISMYCKCEAVEFARRVFEESLDKNVACWTSLISGYCSNGLVHEARDLFDAMPERND  206

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               + +M+SGYV N CF E + LFR  + + V+  E++LVS+L+ACA +G+L+ GKW++ +
Sbjct  207   VSYSAMVSGYVWNACFNEAIDLFRESK-SHVKPKESLLVSVLNACASMGALEEGKWINLF  265

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             + + G+   + LGTAL+D YAKCGC+  AQ++F  +P +DV  W+AMI GFA+NG+ +  
Sbjct  266   LNENGIEYGLELGTALIDFYAKCGCIEDAQEVFSVMPSKDVTTWSAMIMGFAINGENDMG  325

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             + LF EM+   G +P+ VTFV + TAC+   + +E  +LL ++ +
Sbjct  326   LALFAEMEKK-GPKPNAVTFVGVLTACNHKTLVNEAWRLLGRMSK  369



>ref|XP_003527818.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Glycine max]
 gb|KHN18214.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=535

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 127/342 (37%), Positives = 203/342 (59%), Gaps = 4/342 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H  ++   L  + F ++++L  C   NL +  Y   I+++++ P +   N +I+ +  
Sbjct  25    KIHAHIVKLSLSQSNFLVTKMLDLCD--NLSHVDYATMIFQQLENPNVFSYNAIIRTYTH  82

Query  858   KGELSRTMEMYKHMLKT-GMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
               +    + ++  ML T    PD +T P+++K+C  +    LG+ +H    KFG    + 
Sbjct  83    NHKHPLAITVFNQMLTTKSASPDKFTFPFVIKSCAGLLCRRLGQQVHAHVCKFGPKTHAI  142

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+LI MY+   DM  A  V++EM  R  V+W  LIS + R G +  AR VFDE P + 
Sbjct  143   TENALIDMYTKCGDMSGAYQVYEEMTERDAVSWNSLISGHVRLGQMKSAREVFDEMPCRT  202

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MI+GY +  C+ + L +FR MQ+ G++ DE  ++S+L ACA LG+L++GKW+H+
Sbjct  203   IVSWTTMINGYARGGCYADALGIFREMQVVGIEPDEISVISVLPACAQLGALEVGKWIHK  262

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y EK G   N  +  ALV+MYAKCGC+  A  LF ++ E+DVI W+ MI G A +G G  
Sbjct  263   YSEKSGFLKNAGVFNALVEMYAKCGCIDEAWGLFNQMIEKDVISWSTMIGGLANHGKGYA  322

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLE  16
             A+R+F +MQ  AG  P+GVTFV + +AC+ +G+ +EGL+  +
Sbjct  323   AIRVFEDMQK-AGVTPNGVTFVGVLSACAHAGLWNEGLRYFD  363



>ref|XP_006364895.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Solanum tuberosum]
Length=731

 Score =   268 bits (685),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 132/331 (40%), Positives = 197/331 (60%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H   I  GL N  FALS+LL FC+    G+ +Y   I+    +P   + N +I+ + L
Sbjct  43    KVHSHFIKFGLHNTQFALSKLLEFCATKPYGDFSYALSIFNTTDEPNHVMYNMIIRGYSL  102

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 S  ++ Y+ ML +G  P++YT P+LLK+C  +    +G+ IHG   K G + D YV
Sbjct  103   SSSPSFAIDFYEKMLFSGNRPNSYTFPFLLKSCAKIMDTQMGKMIHGHVFKLGLMTDVYV  162

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   +M+ A+ VFD+   R  V++T LI+ Y+ KG V +AR +FDE PV+D 
Sbjct  163   HASLINMYAQNGEMDDARLVFDKSSKRDAVSFTALINGYALKGRVGDARELFDEMPVRDV  222

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MISGY Q   F+E L LF  M+   V+   + L+S+LSACA +G L +G WV  +
Sbjct  223   VSWNAMISGYAQVGRFEEALVLFEEMRNVNVEPSVSTLLSVLSACARVGELKLGNWVRSW  282

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E  G+ +N+RL  AL+DMYAKCG +  A+ LF  L E+D++ WN MI G+   G  ++A
Sbjct  283   IEDHGLGLNIRLVNALIDMYAKCGDVKTARMLFEGLEEKDLVSWNVMIGGYTHTGYYKDA  342

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + +F  MQ +    P+ VT +S+  AC+  G
Sbjct  343   LSVFHRMQQEV-IDPNDVTLLSILPACAHLG  372


 Score = 76.6 bits (187),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 72/304 (24%), Positives = 124/304 (41%), Gaps = 70/304 (23%)
 Frame = -2

Query  924  IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
            ++E +++  +   N MI  +   G     + ++  M +  + P++ TL  +L AC ++ +
Sbjct  314  LFEGLEEKDLVSWNVMIGGYTHTGYYKDALSVFHRMQQEVIDPNDVTLLSILPACAHLGA  373

Query  744  CNLGRSIHGQCLK-FGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
             +LG+ IH    K +  L ++ +  SLI MY+    + +A+ VF  M  + + ++ V+IS
Sbjct  374  LDLGKWIHVYIDKHYQHLQNTSLWTSLINMYAKCGAIAAAKQVFQGMKMKTLASYNVMIS  433

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
              +  GD +EA                               L+LFR M    ++ D+  
Sbjct  434  GLAMHGDAYEA-------------------------------LELFRKMTEESMKPDDIT  462

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP  208
             VS+LSAC H G +D+G+      E     I     T  +  Y   GC            
Sbjct  463  FVSVLSACNHAGLVDLGR------EYFNTMIQSYKYTPKLQHY---GC------------  501

Query  207  ERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGL  28
                     MI      G  + AM +   M+     +PDG  + SL  +C      H+ L
Sbjct  502  ---------MIDLLGRAGKFDEAMTMIESME----IKPDGAIWGSLLGSCRI----HKNL  544

Query  27   KLLE  16
            +L E
Sbjct  545  ELGE  548



>gb|EYU20789.1| hypothetical protein MIMGU_mgv1a002968mg [Erythranthe guttata]
Length=621

 Score =   265 bits (678),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 126/337 (37%), Positives = 204/337 (61%), Gaps = 2/337 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q+I  GL ++  A+ R++ FCS    G+  Y  ++++ +  P   I NTM + +L 
Sbjct  37    QHHAQIIKLGLSSDNDAVGRVIKFCSLSQSGDLNYAHQLFDYLPHPDAFIYNTMFRGYL-  95

Query  858   KGELSRT-MEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
             + +L R  + +Y HML+  + P+ ++LP +++AC +  +    + +H   +K GF  DSY
Sbjct  96    QAQLHRNCIILYAHMLERFVTPNKFSLPPVIRACCSDGAIEEAKQVHAHVVKLGFARDSY  155

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+LI MY + + +E A+ VFD+M  +  V+WT LIS YS+ G V EA  VF+  PVK+
Sbjct  156   CQNNLIHMYVNFNSLEEARRVFDKMDKKDDVSWTTLISGYSQYGSVDEALSVFESMPVKN  215

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W ++I+ +VQNN F E   LF  M+   V  D  +  S+L+AC  LG+LD G+W+H 
Sbjct  216   SAAWNAVIAAHVQNNRFHEAFSLFSRMRNENVAMDNFVAASMLAACTRLGALDQGEWIHN  275

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y++   + ++ +L T ++DMY KCG +  A ++F  L  + V  WN MI G AM+G G++
Sbjct  276   YIKTRSIEVDPKLATTIIDMYCKCGRIDKAYEVFDSLSSKKVSSWNCMIGGLAMHGKGKD  335

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             A+ L ++M+ +    PD VTFV++ +AC+ SG+  EG
Sbjct  336   AIALLKKMEAEKTVTPDYVTFVNVLSACAHSGLVQEG  372


 Score = 73.6 bits (179),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 64/303 (21%), Positives = 131/303 (43%), Gaps = 13/303 (4%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  V+  G   +++  + L+      N  +     R+++++ +       T+I  +  
Sbjct  140   QVHAHVVKLGFARDSYCQNNLIHMYV--NFNSLEEARRVFDKMDKKDDVSWTTLISGYSQ  197

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
              G +   + +++ M        N  +   ++     E+ +L   +  +       MD++V
Sbjct  198   YGSVDEALSVFESMPVKNSAAWNAVIAAHVQNNRFHEAFSLFSRMRNE----NVAMDNFV  253

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVA----WTVLISRYSRKGDVFEARLVFDETP  511
               S++   + L  ++  + + + + +R +       T +I  Y + G + +A  VFD   
Sbjct  254   AASMLAACTRLGALDQGEWIHNYIKTRSIEVDPKLATTIIDMYCKCGRIDKAYEVFDSLS  313

Query  510   VKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG-VQADEAILVSILSACAHLGSLDIGK  334
              K    W  MI G   +   K+ + L + M+    V  D    V++LSACAH G +  G+
Sbjct  314   SKKVSSWNCMIGGLAMHGKGKDAIALLKKMEAEKTVTPDYVTFVNVLSACAHSGLVQEGR  373

Query  333   WVHRYV-EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPER-DVICWNAMISGFAM  160
             +   Y+ E   +A  +     LVD+  + G L  A+K+  E+P R DV    A++    +
Sbjct  374   YYFSYMTEVYSIAPRMEHYGCLVDLLGRAGLLEEAKKVINEMPMRADVGVLGALLGACRI  433

Query  159   NGD  151
             +G+
Sbjct  434   HGN  436



>ref|XP_010662353.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Vitis vinifera]
Length=537

 Score =   263 bits (672),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 138/349 (40%), Positives = 213/349 (61%), Gaps = 13/349 (4%)
 Frame = -2

Query  1041  SQAHGQVITCG---LGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIK  871
              Q H Q+IT       +N F ++RLL  C+  + G+ +Y   ++  IQ P++ + N MI+
Sbjct  23    KQIHSQIITSPHLPKAHNHFLITRLLFVCAISDWGSLSYATDVFRLIQNPSLSVYNIMIR  82

Query  870   AFLLKGE------LSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCL  709
             A+  K        L + + +YK ML +G+ P+  T P+L+K C   +   LG S+HGQ +
Sbjct  83    AYACKDNGVDEIGLWQPIILYKQMLCSGIAPNYLTFPFLVKECTKRDGGGLGLSVHGQII  142

Query  708   KFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARL  529
             KFGF  D +V NSLI  YS+   + +A+ +FDEM +R VV+W  LI+ Y R G++  A  
Sbjct  143   KFGFHGDLFVQNSLISFYSACGFLSTARILFDEMSNRDVVSWNALITGYLRSGEIDSALG  202

Query  528   VFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG---VQADEAILVSILSACAH  358
             +F +   ++   W S I+G VQ    KE ++ F  MQ+     V+ D+  + S+LSACA 
Sbjct  203   LFRKMEERNVITWNSTITGLVQGGRPKEAVEYFFEMQVMSNDTVRPDKITIASVLSACAS  262

Query  357   LGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAM  178
             LG++D GKWVH Y+++ G+  ++ +GTALVDMY KCGC+  A ++F ++P++D++ W AM
Sbjct  263   LGAIDHGKWVHSYLKRSGLECDMVIGTALVDMYGKCGCVESAIEVFRKMPKKDILAWTAM  322

Query  177   ISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             IS FA++G G+ A  L  EM+   G RP+ VTFV L  AC+ SG+  +G
Sbjct  323   ISAFALHGLGKEAFDLLEEMET-LGVRPNHVTFVGLLLACAHSGLVEKG  370


 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 73/333 (22%), Positives = 131/333 (39%), Gaps = 69/333 (21%)
 Frame = -2

Query  1035  AHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLK  856
              HGQ+I  G   + F  + L++F S    G  +    +++ +    +   N +I  +L  
Sbjct  137   VHGQIIKFGFHGDLFVQNSLISFYS--ACGFLSTARILFDEMSNRDVVSWNALITGYLRS  194

Query  855   GELSRTMEMYKHMLK----------TGMC------------------------PDNYTLP  778
             GE+   + +++ M +          TG+                         PD  T+ 
Sbjct  195   GEIDSALGLFRKMEERNVITWNSTITGLVQGGRPKEAVEYFFEMQVMSNDTVRPDKITIA  254

Query  777   YLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSR  598
              +L AC ++ + + G+ +H    + G   D  +G +L+ MY     +ESA          
Sbjct  255   SVLSACASLGAIDHGKWVHSYLKRSGLECDMVIGTALVDMYGKCGCVESAI---------  305

Query  597   CVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQ  418
                                    VF + P KD   W +MIS +  +   KE   L   M+
Sbjct  306   ----------------------EVFRKMPKKDILAWTAMISAFALHGLGKEAFDLLEEME  343

Query  417   MTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGM-AINVRLGTALVDMYAKCGCL  241
               GV+ +    V +L ACAH G ++ G+     +  + +    V     +VD+ ++ G  
Sbjct  344   TLGVRPNHVTFVGLLLACAHSGLVEKGRLCFDLMRCVYLIEPQVHHYACMVDLLSRAGLF  403

Query  240   GLAQKLFYELP-ERDVICWNAMISGFAMNGDGE  145
               A+ L   +P + DV  W A++ G  M+G+ E
Sbjct  404   EEAEGLIRCMPMQPDVFVWGALLGGCQMHGNVE  436



>gb|KFK43124.1| hypothetical protein AALP_AA1G083500 [Arabis alpina]
Length=737

 Score =   268 bits (684),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 138/332 (42%), Positives = 200/332 (60%), Gaps = 2/332 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             Q H Q+I  GL N  +ALS+L+  C   P+     Y   ++E IQ+P + I NTM +   
Sbjct  46    QIHSQIIKTGLHNTNYALSKLIELCVVSPHFDGFLYAISVFETIQEPNLLIWNTMFRGHA  105

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
             L  +    +++Y  M+  G+ P++YT P+LLKAC   ++   G  IHGQ LK GF +  Y
Sbjct  106   LSSDSVSALKLYVDMVSLGLLPNSYTFPFLLKACAKSKALMEGEQIHGQVLKLGFDVYLY  165

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             V  SLI MY     +E A  VFD    R VV++T LI+ Y+ +GD+  AR +FDE PVKD
Sbjct  166   VHASLISMYVQNGRLEDAHKVFDGSSERNVVSYTALITGYASRGDMESARKLFDEIPVKD  225

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MISGYV+N  FKE L+LF+ M M  V+ DE+ +V+++SACA  GS+++G+ VH 
Sbjct  226   VVSWNAMISGYVENGNFKEALELFKEMMMMNVRLDESTMVTVVSACAQSGSIELGRHVHS  285

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
              ++  G   +V++  AL+ +Y+KCG L  A  LF  L ++DVI WN +I G+      + 
Sbjct  286   LIDDYGFGSSVKIVNALIGLYSKCGELETACGLFEGLSKKDVISWNTLIGGYTHMNLYKE  345

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             A+ LFREM   +G  PD VT +S+  AC+  G
Sbjct  346   ALSLFREMLR-SGECPDDVTMLSVLPACAHLG  376


 Score =   175 bits (443),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 98/316 (31%), Positives = 161/316 (51%), Gaps = 35/316 (11%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            G+     ++++ I    +   N MI  ++  G     +E++K M+   +  D  T+  ++
Sbjct  209  GDMESARKLFDEIPVKDVVSWNAMISGYVENGNFKEALELFKEMMMMNVRLDESTMVTVV  268

Query  768  KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
             AC    S  LGR +H     +GF     + N+LI +YS   ++E+A  +F+ +  + V+
Sbjct  269  SACAQSGSIELGRHVHSLIDDYGFGSSVKIVNALIGLYSKCGELETACGLFEGLSKKDVI  328

Query  588  AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
            +                               W ++I GY   N +KE L LFR M  +G
Sbjct  329  S-------------------------------WNTLIGGYTHMNLYKEALSLFREMLRSG  357

Query  408  VQADEAILVSILSACAHLGSLDIGKWVHRYVEK--LGMAIN-VRLGTALVDMYAKCGCLG  238
               D+  ++S+L ACAHLG++DIG+W+H Y++K   G+  N   L T+L+DMYAKCG + 
Sbjct  358  ECPDDVTMLSVLPACAHLGAIDIGRWIHVYIDKKLKGVVTNDSSLRTSLIDMYAKCGDIE  417

Query  237  LAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTAC  58
             + ++F  +  R +  WNAMI GFAM+G    A  LF  M+ + G  PD +TF+ L +AC
Sbjct  418  ASHQVFNSMINRSLSSWNAMIFGFAMHGRANAAFDLFSRMKKN-GIEPDDITFIGLLSAC  476

Query  57   SCSGMAHEGLKLLEKI  10
            S SG+   G  + + +
Sbjct  477  SHSGLLDLGRHIFKSM  492



>ref|XP_004309259.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Fragaria vesca subsp. vesca]
Length=511

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/348 (41%), Positives = 206/348 (59%), Gaps = 12/348 (3%)
 Frame = -2

Query  1041  SQAHGQVITCGL---GNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIK  871
              Q H  +I        + +F  +RLL FC+  + G+ TY   ++  I+ P + + N MI+
Sbjct  23    KQIHTHIIKSPFLLEQDQSFLNTRLLFFCALSDSGSQTYAAGVFRVIKNPNLYLYNIMIR  82

Query  870   AFL-LKGELS------RTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQC  712
             A+  +K          R++E+YK M+  G+ PD  T P+L+K C        GRS+HGQ 
Sbjct  83    AYTSIKANAFDEPASFRSLELYKQMVGDGIRPDCLTFPFLVKECAARIDGGNGRSVHGQV  142

Query  711   LKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEAR  532
             +K+GF  D +V NSL+ MYS    +  A+ VFDE+  R VV+W  +I  Y R GD+ EA 
Sbjct  143   VKYGFRKDLFVQNSLMNMYSVFGSLICARKVFDEITERDVVSWNSMIKGYLRSGDLDEAI  202

Query  531   LVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMT-GVQADEAILVSILSACAHL  355
              VF E   +    W S+I+G VQ    +E L  F  MQ+  GV+ D+  + S+L+ACAHL
Sbjct  203   EVFREMKKRSVFSWNSIITGCVQGGRAREALDFFHEMQVVEGVRPDKITIASVLAACAHL  262

Query  354   GSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMI  175
             G +D G WVH Y+ + G+  +V +GTALVDMY KCGC+  A ++F E+P++D + W AMI
Sbjct  263   GEVDNGTWVHGYLRRSGVESDVVIGTALVDMYGKCGCVEKAYEVFMEMPKKDTLAWTAMI  322

Query  174   SGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             S FA++G G  A  LF +M+  AG  P+ VTFV L +AC+ SG+  +G
Sbjct  323   SVFALHGFGNEAFDLFEKMEA-AGVEPNHVTFVGLLSACAHSGLVEKG  369


 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 140/331 (42%), Gaps = 69/331 (21%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKG  853
             HGQV+  G   + F  + L+   S    G+     ++++ I +  +   N+MIK +L  G
Sbjct  139   HGQVVKYGFRKDLFVQNSLMNMYS--VFGSLICARKVFDEITERDVVSWNSMIKGYLRSG  196

Query  852   ELSRTMEMYKHMLK--------------------------------TGMCPDNYTLPYLL  769
             +L   +E+++ M K                                 G+ PD  T+  +L
Sbjct  197   DLDEAIEVFREMKKRSVFSWNSIITGCVQGGRAREALDFFHEMQVVEGVRPDKITIASVL  256

Query  768   KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
              AC ++   + G  +HG   + G   D  +G +L+ MY                  +C  
Sbjct  257   AACAHLGEVDNGTWVHGYLRRSGVESDVVIGTALVDMYG-----------------KC--  297

Query  588   AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
                         G V +A  VF E P KD   W +MIS +  +    E   LF  M+  G
Sbjct  298   ------------GCVEKAYEVFMEMPKKDTLAWTAMISVFALHGFGNEAFDLFEKMEAAG  345

Query  408   VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRL--GTALVDMYAKCGCLGL  235
             V+ +    V +LSACAH G ++ G+W    + ++ + I  +L     +VD+ ++ G +  
Sbjct  346   VEPNHVTFVGLLSACAHSGLVEKGRWCFDVMRRVYL-IEPQLYHYACMVDILSRAGLIEE  404

Query  234   AQKLFYELPER-DVICWNAMISGFAMNGDGE  145
             A++L   +P + DV  W A++ G  ++G  E
Sbjct  405   AERLIRSMPMKPDVYVWGALLGGCQIHGQVE  435



>ref|XP_006430418.1| hypothetical protein CICLE_v10011492mg [Citrus clementina]
 gb|ESR43658.1| hypothetical protein CICLE_v10011492mg [Citrus clementina]
Length=519

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/343 (37%), Positives = 212/343 (62%), Gaps = 1/343 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q    +   G   + FA+ +++ FCS  ++G+ ++G+R++  +Q  T  I NTMI+ F  
Sbjct  6     QIQSHLTVSGTLWDPFAVGKIIGFCSASDIGDLSHGYRLFVCLQYRTTFIWNTMIRGFAE  65

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             K E  +   +YK ML++   P+NYT  ++L+AC +     LG   H Q ++ G+    +V
Sbjct  66    KNEPIKAFALYKQMLRSDFLPNNYTFSFILRACADTSCLFLGLICHAQVIRLGWESYDFV  125

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N L+ +Y++ + M+ A+ +FD   +R V++WT LI+ Y++ G +  AR +FD+ P K+ 
Sbjct  126   LNGLLHLYATCNCMDPARKLFDMSVNRGVISWTSLINGYAKSGQISIARQMFDKMPEKNA  185

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GYVQ   FKE L+ F  MQ+ G + + A +V  L+ACA LG+LD G+W+H Y
Sbjct  186   VSWSAMINGYVQVELFKEALEHFNFMQLCGFRPNHAGIVGALTACAFLGALDQGRWIHAY  245

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V++ G+ +++ LGTA++DMYAKCGC+  A  +F  +P RDV  + ++ISG A +    +A
Sbjct  246   VDRNGIELDIILGTAIIDMYAKCGCIETACSVFDSMPNRDVFAYTSLISGLANHDQSASA  305

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             + LF  MQ + G  P+ VTF+ +  ACS  G+  +GL++ + +
Sbjct  306   IELFMRMQLE-GVVPNEVTFICVLNACSRMGLVDQGLRIFKSM  347


 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 72/325 (22%), Positives = 133/325 (41%), Gaps = 62/325 (19%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAF-----CSDP------------------------NLGNP  940
             H QVI  G  +  F L+ LL       C DP                          G  
Sbjct  111   HAQVIRLGWESYDFVLNGLLHLYATCNCMDPARKLFDMSVNRGVISWTSLINGYAKSGQI  170

Query  939   TYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKAC  760
             +   ++++++ +      + MI  ++        +E +  M   G  P++  +   L AC
Sbjct  171   SIARQMFDKMPEKNAVSWSAMINGYVQVELFKEALEHFNFMQLCGFRPNHAGIVGALTAC  230

Query  759   GNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWT  580
               + + + GR IH    + G  +D  +G ++I MY+    +E+A  V             
Sbjct  231   AFLGALDQGRWIHAYVDRNGIELDIILGTAIIDMYAKCGCIETACSV-------------  277

Query  579   VLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQA  400
                               FD  P +D   + S+ISG   ++     ++LF  MQ+ GV  
Sbjct  278   ------------------FDSMPNRDVFAYTSLISGLANHDQSASAIELFMRMQLEGVVP  319

Query  399   DEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLAQKL  223
             +E   + +L+AC+ +G +D G  + + + ++ G+   V+    LVD+  + G L  A+K+
Sbjct  320   NEVTFICVLNACSRMGLVDQGLRIFKSMSEIYGIEPGVQHYGCLVDLLGRAGMLEAAKKV  379

Query  222   FYELP-ERDVICWNAMISGFAMNGD  151
               E+P E D     A+++   ++GD
Sbjct  380   VREMPIEPDNYVLGALLNACRVHGD  404



>ref|XP_009343520.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like, 
partial [Pyrus x bretschneideri]
Length=448

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/349 (39%), Positives = 211/349 (60%), Gaps = 14/349 (4%)
 Frame = -2

Query  1038  QAHGQVITCGL---GNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKA  868
             Q H Q+I   L    +  F ++RLL F +  + G+  Y   ++  I+ P + + N MI+A
Sbjct  28    QIHTQIIKSPLLSKDDQNFLVTRLLFFSAISDSGSHGYAIDVFRAIENPNLYVYNVMIRA  87

Query  867   FLLKGELSR-------TMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCL  709
             +  +    R       ++ +YK ML  G+ P+  + P+L+K C +     +GRSIHGQ +
Sbjct  88    YACRKIGGRDEALSFGSLLLYKQMLCDGISPNCLSFPFLVKECTSRVDGGVGRSIHGQAV  147

Query  708   KFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARL  529
             K+G   D +V NSL+ MYS+   + SA+ +FDE P R VV+W  +I  Y +   + EA  
Sbjct  148   KYGLDSDVFVQNSLMSMYSACGFLSSARKLFDETPGRDVVSWNSMIKGYLKSRSLDEALK  207

Query  528   VFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG---VQADEAILVSILSACAH  358
             +F +   +    W S+I+G+VQ    KE L+LF  MQ+TG   V+ D+  + S+L+ACAH
Sbjct  208   LFRKMKKRSIFTWNSVITGFVQGGRPKEALELFHEMQITGGDIVRPDKITVASVLAACAH  267

Query  357   LGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAM  178
             LG++D G WVH Y+ + G+  +V +GTALVDMY KCGC+  A ++F E+P +D + W AM
Sbjct  268   LGAIDHGIWVHGYLRRSGLDSDVVIGTALVDMYGKCGCVDKAYEVFQEMPRKDTLAWTAM  327

Query  177   ISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             IS  A++G G  A  LF++M+  AG +P+ VTFV+LF+AC+ SG   +G
Sbjct  328   ISVMALHGFGNEAFGLFKQMET-AGVKPNHVTFVALFSACAHSGFVEKG  375


 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 78/336 (23%), Positives = 142/336 (42%), Gaps = 67/336 (20%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCS------------DPNLGNPTYGW-------------  928
             HGQ +  GL ++ F  + L++  S            D   G     W             
Sbjct  143   HGQAVKYGLDSDVFVQNSLMSMYSACGFLSSARKLFDETPGRDVVSWNSMIKGYLKSRSL  202

Query  927   ----RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTG---MCPDNYTLPYLL  769
                 +++ ++++ +I   N++I  F+  G     +E++  M  TG   + PD  T+  +L
Sbjct  203   DEALKLFRKMKKRSIFTWNSVITGFVQGGRPKEALELFHEMQITGGDIVRPDKITVASVL  262

Query  768   KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
              AC ++ + + G  +HG   + G   D  +G +L+ MY                  +C  
Sbjct  263   AACAHLGAIDHGIWVHGYLRRSGLDSDVVIGTALVDMYG-----------------KC--  303

Query  588   AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
                         G V +A  VF E P KD   W +MIS    +    E   LF+ M+  G
Sbjct  304   ------------GCVDKAYEVFQEMPRKDTLAWTAMISVMALHGFGNEAFGLFKQMETAG  351

Query  408   VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRL--GTALVDMYAKCGCLGL  235
             V+ +    V++ SACAH G ++ G+W    ++ + + I  +L     +VD+ ++ G +  
Sbjct  352   VKPNHVTFVALFSACAHSGFVEKGRWCFDAMKHVYL-IEPQLYHYACMVDILSRAGLIEE  410

Query  234   AQKLFYELPER-DVICWNAMISGFAMNGDGENAMRL  130
             A++    +P + D   W A++ G  ++G  E   R+
Sbjct  411   AEQCIRSMPMKPDTFVWGALLGGCQIHGKVELGARV  446


 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 123/303 (41%), Gaps = 67/303 (22%)
 Frame = -2

Query  819  MLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLM--DSYVGNSLIVMYSSL  646
            M++T M     TL +LL  C N+      + IH Q +K   L   D     + ++ +S++
Sbjct  1    MIETQMASARSTLLHLLHECKNIREL---KQIHTQIIKSPLLSKDDQNFLVTRLLFFSAI  57

Query  645  DDMES---AQCVFDEMPSRCVVAWTVLISRYS-RKGDVFEARLVFDETPVKDRRVWGSMI  478
             D  S   A  VF  + +  +  + V+I  Y+ RK    +  L F           GS++
Sbjct  58   SDSGSHGYAIDVFRAIENPNLYVYNVMIRAYACRKIGGRDEALSF-----------GSLL  106

Query  477  SGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMA  298
                          L++ M   G+  +      ++  C       +G+ +H    K G+ 
Sbjct  107  --------------LYKQMLCDGISPNCLSFPFLVKECTSRVDGGVGRSIHGQAVKYGLD  152

Query  297  INVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMI-------------------  175
             +V +  +L+ MY+ CG L  A+KLF E P RDV+ WN+MI                   
Sbjct  153  SDVFVQNSLMSMYSACGFLSSARKLFDETPGRDVVSWNSMIKGYLKSRSLDEALKLFRKM  212

Query  174  ------------SGFAMNGDGENAMRLFREMQNDAG--TRPDGVTFVSLFTACSCSGMAH  37
                        +GF   G  + A+ LF EMQ   G   RPD +T  S+  AC+  G   
Sbjct  213  KKRSIFTWNSVITGFVQGGRPKEALELFHEMQITGGDIVRPDKITVASVLAACAHLGAID  272

Query  36   EGL  28
             G+
Sbjct  273  HGI  275



>ref|XP_009766197.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Nicotiana sylvestris]
 ref|XP_009766198.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Nicotiana sylvestris]
 ref|XP_009766199.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Nicotiana sylvestris]
 ref|XP_009766200.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Nicotiana sylvestris]
Length=541

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/343 (38%), Positives = 203/343 (59%), Gaps = 8/343 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H Q++   L  + + +++++  C    LG   Y   +++++++P   + N MI+A+  
Sbjct  32    KIHAQMVKFSLSQSNYLVTKMVEICD--KLGEVDYASLLFKQVEEPNNYLYNCMIRAYTN  89

Query  858   KGELSRTMEMYKHMLKTG-----MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFL  694
             +      + +YK M++         PD YT P+++++CG +   NLG+  HGQ  KFGF 
Sbjct  90    RQRYVPCINIYKQMMEQTESEETTSPDEYTYPFVIRSCGGLLCVNLGKQFHGQVSKFGFK  149

Query  693   MDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDET  514
               S + NSL+ MY   D M  A  +F+EM  R V++W  LIS + +   V +AR +F+E 
Sbjct  150   SSSMIENSLLDMYVKCDQMSYAHKLFEEMSERDVISWNSLISGHIKLRQVRKARALFEEM  209

Query  513   PVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
             P K    W +MISGY +  C+ + L +FR MQM G++ D   LV++L ACA LG+L++GK
Sbjct  210   PNKTVVSWTAMISGYTKTGCYGDALDVFRRMQMIGMKPDWISLVAVLPACAQLGALELGK  269

Query  333   WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNG  154
             W+H Y EK G      +  AL++MYAKCG +  A +LF E+ ERDVI W+ MI G A +G
Sbjct  270   WIHFYAEKYGYLRKTSVCNALMEMYAKCGSVNQAWQLFNEMSERDVISWSTMIGGLANHG  329

Query  153   DGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLK  25
                 A++LF EMQ  A   P+ +TFV L  AC+ +G+ ++GL+
Sbjct  330   RAHEALKLFNEMQRSA-VEPNEITFVGLLCACAHAGLVNDGLR  371


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 106/255 (42%), Gaps = 38/255 (15%)
 Frame = -2

Query  756  NMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTV  577
            N +S    + IH Q +KF     +Y+   ++ +   L                       
Sbjct  23   NCKSTGFMKKIHAQMVKFSLSQSNYLVTKMVEICDKL-----------------------  59

Query  576  LISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFR-LMQMTGVQ-  403
                    G+V  A L+F +    +  ++  MI  Y     +   + +++ +M+ T  + 
Sbjct  60   --------GEVDYASLLFKQVEEPNNYLYNCMIRAYTNRQRYVPCINIYKQMMEQTESEE  111

Query  402  ---ADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLA  232
                DE     ++ +C  L  +++GK  H  V K G   +  +  +L+DMY KC  +  A
Sbjct  112  TTSPDEYTYPFVIRSCGGLLCVNLGKQFHGQVSKFGFKSSSMIENSLLDMYVKCDQMSYA  171

Query  231  QKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSC  52
             KLF E+ ERDVI WN++ISG         A  LF EM N   T       +S +T   C
Sbjct  172  HKLFEEMSERDVISWNSLISGHIKLRQVRKARALFEEMPNK--TVVSWTAMISGYTKTGC  229

Query  51   SGMAHEGLKLLEKIG  7
             G A +  + ++ IG
Sbjct  230  YGDALDVFRRMQMIG  244



>gb|AEP33764.1| organelle transcript processing 82, partial [Iberis amara]
Length=666

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/330 (40%), Positives = 200/330 (61%), Gaps = 2/330 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLK  856
             H Q+I  GL N  +ALS+L+ FC   P+     Y   ++E IQ+P + I NTM +   L 
Sbjct  10    HAQMIKTGLHNTNYALSKLIEFCILSPHFDGLPYAISVFETIQEPNLLIWNTMFRGHALS  69

Query  855   GELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVG  676
              +    +++Y  M+  G+ P++YT P+LLK+C   ++   G+ IHG  LK G  +D YV 
Sbjct  70    SDPVSALKLYVCMISLGLLPNSYTFPFLLKSCAKSKAFKEGQQIHGHVLKLGCDLDLYVH  129

Query  675   NSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRR  496
              SLI MY     +E A  VFDE P R VV++T LI  Y+ +G +  A+ +FDE PVKD  
Sbjct  130   TSLISMYVQNGRLEDAHKVFDESPHRDVVSYTALIKGYASRGYIENAQKMFDEIPVKDVV  189

Query  495   VWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYV  316
              W +MISGY +   +KE L+LF+ M  T V+ DE+ +V+++SACA  GS+++G+ VH ++
Sbjct  190   SWNAMISGYAETGNYKEALELFKDMMKTNVRPDESTMVTVVSACAQSGSIELGRQVHSWI  249

Query  315   EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAM  136
             +  G   N+++  AL+D+Y+KCG L  A  LF  LP +DVI WN +I G+      + A+
Sbjct  250   DDHGFGSNLKIVNALIDLYSKCGELETACGLFEGLPYKDVISWNTLIGGYTHMNLYKEAL  309

Query  135   RLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
              LF+EM   +G  P+ VT +S+  AC+  G
Sbjct  310   LLFQEMLR-SGETPNDVTMLSILPACAHLG  338


 Score =   182 bits (463),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/297 (34%), Positives = 157/297 (53%), Gaps = 34/297 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ I    +   N MI  +   G     +E++K M+KT + PD  T+  ++ AC    
Sbjct  178  KMFDEIPVKDVVSWNAMISGYAETGNYKEALELFKDMMKTNVRPDESTMVTVVSACAQSG  237

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LGR +H      GF  +  + N+LI +YS   ++E+A  +F+ +             
Sbjct  238  SIELGRQVHSWIDDHGFGSNLKIVNALIDLYSKCGELETACGLFEGL-------------  284

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                              P KD   W ++I GY   N +KE L LF+ M  +G   ++  
Sbjct  285  ------------------PYKDVISWNTLIGGYTHMNLYKEALLLFQEMLRSGETPNDVT  326

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKL--GMAINVRLGTALVDMYAKCGCLGLAQKLFYE  214
            ++SIL ACAHLG++DIG+W+H Y++K   G+A    L T+L+DMYAKCG +  A ++F  
Sbjct  327  MLSILPACAHLGAIDIGRWIHVYIDKRLKGVANASSLRTSLIDMYAKCGDIEAAHQVFNS  386

Query  213  LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGM  43
            +  + +  WNAMI GFAM+G  + +  +F  M+ + G  PD +TFV L +ACS SGM
Sbjct  387  ILHKSLSSWNAMIFGFAMHGRADASFDIFSRMRKN-GIEPDDITFVGLLSACSHSGM  442


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/241 (28%), Positives = 112/241 (46%), Gaps = 22/241 (9%)
 Frame = -2

Query  732  RSIHGQCLKFGFLMDSYVGNSLI---VMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRY  562
            R IH Q +K G    +Y  + LI   ++    D +  A  VF+ +    ++ W  +   +
Sbjct  7    RMIHAQMIKTGLHNTNYALSKLIEFCILSPHFDGLPYAISVFETIQEPNLLIWNTMFRGH  66

Query  561  SRKGDVFEARLVF----DETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADE  394
            +   D   A  ++        + +   +  ++    ++  FKEG Q+   +   G   D 
Sbjct  67   ALSSDPVSALKLYVCMISLGLLPNSYTFPFLLKSCAKSKAFKEGQQIHGHVLKLGCDLDL  126

Query  393  AILVSILSACAHLGSLDIGKWV-----HRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQ  229
             +  S++S     G L+    V     HR         +V   TAL+  YA  G +  AQ
Sbjct  127  YVHTSLISMYVQNGRLEDAHKVFDESPHR---------DVVSYTALIKGYASRGYIENAQ  177

Query  228  KLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCS  49
            K+F E+P +DV+ WNAMISG+A  G+ + A+ LF++M      RPD  T V++ +AC+ S
Sbjct  178  KMFDEIPVKDVVSWNAMISGYAETGNYKEALELFKDMMK-TNVRPDESTMVTVVSACAQS  236

Query  48   G  46
            G
Sbjct  237  G  237


 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 69/303 (23%), Positives = 133/303 (44%), Gaps = 39/303 (13%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +   G G+N   ++ L+   S    G       ++E +    +   NT+I  +  
Sbjct  244   QVHSWIDDHGFGSNLKIVNALIDLYS--KCGELETACGLFEGLPYKDVISWNTLIGGYTH  301

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIH---GQCLKFGFLMD  688
                    + +++ ML++G  P++ T+  +L AC ++ + ++GR IH    + LK G    
Sbjct  302   MNLYKEALLLFQEMLRSGETPNDVTMLSILPACAHLGAIDIGRWIHVYIDKRLK-GVANA  360

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
             S +  SLI MY+   D+E+A  VF+ +  + + +W  +I  ++  G    A   FD    
Sbjct  361   SSLRTSLIDMYAKCGDIEAAHQVFNSILHKSLSSWNAMIFGFAMHG---RADASFD----  413

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWV  328
                                     +F  M+  G++ D+   V +LSAC+H G LD+G+ +
Sbjct  414   ------------------------IFSRMRKNGIEPDDITFVGLLSACSHSGMLDLGRHI  449

Query  327   HR-YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP-ERDVICWNAMISGFAMNG  154
              R   +   M   +     ++D+    G    A+++   +  E D + W +++    M+G
Sbjct  450   FRSMTQDYKMTPKLEHYGCMIDLLGHSGLFKEAEEMINTMEMEPDGVIWCSLLKACKMHG  509

Query  153   DGE  145
             + E
Sbjct  510   NVE  512



>emb|CBI30729.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/342 (40%), Positives = 206/342 (60%), Gaps = 3/342 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNP-TYGWRIYERIQQPTICIVNTMIKAFL  862
             QAH  ++  GL ++TFA SRL+A  S  +      Y   I+ RI  P   + NT+I+A+ 
Sbjct  25    QAHAHILKSGLIHSTFAASRLIASVSTNSHAQAIPYAHSIFSRIPNPNSYMWNTIIRAYA  84

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                     + ++  ML   + PD YT  + LK+CG+      GR IHG  LK G   D +
Sbjct  85    NSPTPEAALTIFHQMLHASVLPDKYTFTFALKSCGSFSGVEEGRQIHGHVLKTGLGDDLF  144

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDV-FEARLVFDETPVK  505
             + N+LI +Y+S   +E A+ + D M  R VV+W  L+S Y+ +G +   +R VF ETPVK
Sbjct  145   IQNTLIHLYASCGCIEDARHLLDRMLERDVVSWNALLSAYAERGLMELASRRVFGETPVK  204

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             +   W +MI+GY     F E L LF  MQ  GV+ D   LVS+LSACAH+G+L  G+WVH
Sbjct  205   NVVSWNAMITGYSHAGRFSEVLVLFEDMQHAGVKPDNCTLVSVLSACAHVGALSQGEWVH  264

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
              Y++K G++I+  + TALVDMY+KCG +  A ++F     +D+  WN++ISG + +G G+
Sbjct  265   AYIDKNGISIDGFVATALVDMYSKCGSIEKALEVFNSCLRKDISTWNSIISGLSTHGSGQ  324

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLL  19
             +A+++F EM  + G +P+ VTFV + +ACS +G+  EG ++ 
Sbjct  325   HALQIFSEMLVE-GFKPNEVTFVCVLSACSRAGLLDEGREMF  365



>ref|XP_010942337.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800 
[Elaeis guineensis]
Length=505

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/316 (41%), Positives = 190/316 (60%), Gaps = 1/316 (0%)
 Frame = -2

Query  957  PNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLP  778
            P   +  Y   ++ RI  P+    N +I+A  L     + + ++  M +  + PD ++ P
Sbjct  66   PPTHSIDYALSLFHRIPSPSTFAYNLLIRARTLLSSPFQALILFARMRRLSIPPDYHSFP  125

Query  777  YLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSR  598
            + LKAC  + S  LGR++H Q LK GF  D +V N+LI MY+S D M  A+ +FDE+ S 
Sbjct  126  FALKACARLRSLPLGRALHSQALKLGFATDLFVHNTLISMYASSDSMLDARSLFDEISSC  185

Query  597  CVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQ  418
             VV +  LI  Y + GD+  AR +FDE P +D   WG++++GY Q   FKE LQLF  M 
Sbjct  186  DVVTYNTLIDGYVKAGDMILARKLFDEMPHRDTVSWGTLLAGYSQIRQFKEALQLFDQML  245

Query  417  MTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLG  238
             TG + D+  LVS LS CA LG+LD GK +H+Y+++   A+NV L T LVDMYAKCGC+ 
Sbjct  246  PTGSRPDDVALVSALSCCAQLGALDQGKVIHQYIKENRAALNVYLLTGLVDMYAKCGCID  305

Query  237  LAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTAC  58
             A ++F     R++  WNA++ G AM+G GE ++R F  M    G RPDGV+F+ +  AC
Sbjct  306  AATEMFDSTTHRNLFTWNAIVVGLAMHGHGERSLRYFERMIG-VGVRPDGVSFLGVLVAC  364

Query  57   SCSGMAHEGLKLLEKI  10
            S +G+     KL +++
Sbjct  365  SHAGLTDTARKLFDEM  380


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 56/289 (19%), Positives = 114/289 (39%), Gaps = 37/289 (13%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            G+     ++++ +         T++  +    +    ++++  ML TG  PD+  L   L
Sbjct  201  GDMILARKLFDEMPHRDTVSWGTLLAGYSQIRQFKEALQLFDQMLPTGSRPDDVALVSAL  260

Query  768  KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
              C  + + + G+ IH                               Q + +   +  V 
Sbjct  261  SCCAQLGALDQGKVIH-------------------------------QYIKENRAALNVY  289

Query  588  AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
              T L+  Y++ G +  A  +FD T  ++   W +++ G   +   +  L+ F  M   G
Sbjct  290  LLTGLVDMYAKCGCIDAATEMFDSTTHRNLFTWNAIVVGLAMHGHGERSLRYFERMIGVG  349

Query  408  VQADEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLA  232
            V+ D    + +L AC+H G  D  + +   +E + G+A  ++    + D+  + G +  A
Sbjct  350  VRPDGVSFLGVLVACSHAGLTDTARKLFDEMESIFGVARELKHYGCMADLLGRAGLMEKA  409

Query  231  QKLFYELP-ERDVICWNAMISGFAMNGDGENA----MRLFREMQNDAGT  100
              +   +P E D   W  ++ G  ++G+ E A      L R    D+G 
Sbjct  410  MDMIKAMPMEADAYVWGGVLGGCRIHGNVEIAEIATEHLLRLNPEDSGV  458



>ref|XP_002519323.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF43187.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=396

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/330 (39%), Positives = 194/330 (59%), Gaps = 1/330 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q+I  GL  +   +++L+ F +  N  +  Y  ++++ I  P     NT+IKA+L 
Sbjct  62    QYHSQIIRLGLSADKHVMTQLINFSALSNNRDLAYAIKLFDSIPNPDAFFYNTIIKAYLQ  121

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 + ++ +Y HML+  + P+++T P +++AC   +   LG+ IH   LK GF      
Sbjct  122   HLSPTNSILLYSHMLQHSVFPNDFTFPSVIRACCIHDDIQLGKQIHAHVLKLGFGAHVIS  181

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N+LI MY+     E A+CV   MP +  ++WT LIS YS+ G V EA  VF   P ++ 
Sbjct  182   LNNLIHMYARFQAFEEARCVLYSMPEQNFISWTTLISGYSQWGLVDEAFRVFQSMPERNS  241

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+ YVQ N F E   LF  M+  GV  D+ +  ++LSAC  LG+L+ GKW+H Y
Sbjct  242   ASWNAMIAAYVQGNRFHESFALFDRMRAEGVVLDKFVAATMLSACTGLGALEQGKWIHGY  301

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +EK G+  + +L TA++DMY KCG L  A ++F  LP + +  WN MI G AM+G GE A
Sbjct  302   IEKKGIEKDSKLATAIIDMYCKCGSLEKALEVFKGLPHKGISSWNCMIGGLAMHGKGEAA  361

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCS  49
             + LF+EM+ +    PD +TFV+L +AC+ S
Sbjct  362   IELFKEMEKEM-LAPDRITFVNLLSACAHS  390



>ref|XP_009598291.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Nicotiana tomentosiformis]
 ref|XP_009598292.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Nicotiana tomentosiformis]
Length=542

 Score =   262 bits (669),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/349 (36%), Positives = 204/349 (58%), Gaps = 9/349 (3%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H Q++   L  + + +++++  C    LG   Y   +++++++P   + N MI+A+  
Sbjct  32    KIHAQIVKFSLSQSNYLVTKMIEICD--KLGEVDYASLLFKQVEEPNNYLYNCMIRAYTN  89

Query  858   KGELSRTMEMYKHMLK------TGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGF  697
             +      + +YK M++      T + PD YT P+++++CG +   NLG+  HGQ  KFG 
Sbjct  90    RQRYVPCINIYKQMMEQTQSDETTISPDEYTYPFVIRSCGGLLCVNLGKQFHGQVCKFGL  149

Query  696   LMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDE  517
                S + NSL+ MY   D M  A  +F+EM  R V++W  LIS + +   V +AR +F+E
Sbjct  150   KSSSVIENSLLDMYVKCDQMSYAHKLFEEMSERDVISWNSLISGHIKLRQVRKARALFEE  209

Query  516   TPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIG  337
              P K    W +MI+GY +  C+ + L +FR MQM G++ D   LV++L ACA LG+L++G
Sbjct  210   MPNKTVVSWTAMIAGYTKTGCYGDALDVFRRMQMVGMKPDWISLVAVLPACAQLGALELG  269

Query  336   KWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMN  157
             KW+H Y EK G      +  AL++MYAKCG +  A +LF E+ ERDVI W+ MI G A +
Sbjct  270   KWIHFYAEKYGYLRKTSVCNALMEMYAKCGSVNQAWQLFNEMSERDVISWSTMIGGLANH  329

Query  156   GDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             G    A++LF EMQ      P+ +TFV L  AC+ +G+  +GL+  + +
Sbjct  330   GRAHEALKLFHEMQRSV-VEPNEITFVGLLCACAHAGLVKDGLRYFDSM  377


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/256 (25%), Positives = 105/256 (41%), Gaps = 39/256 (15%)
 Frame = -2

Query  756  NMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTV  577
            N +S    + IH Q +KF     +Y+   +I +   L                       
Sbjct  23   NCKSTGFMKKIHAQIVKFSLSQSNYLVTKMIEICDKL-----------------------  59

Query  576  LISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLM------QM  415
                    G+V  A L+F +    +  ++  MI  Y     +   + +++ M        
Sbjct  60   --------GEVDYASLLFKQVEEPNNYLYNCMIRAYTNRQRYVPCINIYKQMMEQTQSDE  111

Query  414  TGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGL  235
            T +  DE     ++ +C  L  +++GK  H  V K G+  +  +  +L+DMY KC  +  
Sbjct  112  TTISPDEYTYPFVIRSCGGLLCVNLGKQFHGQVCKFGLKSSSVIENSLLDMYVKCDQMSY  171

Query  234  AQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACS  55
            A KLF E+ ERDVI WN++ISG         A  LF EM N   T       ++ +T   
Sbjct  172  AHKLFEEMSERDVISWNSLISGHIKLRQVRKARALFEEMPNK--TVVSWTAMIAGYTKTG  229

Query  54   CSGMAHEGLKLLEKIG  7
            C G A +  + ++ +G
Sbjct  230  CYGDALDVFRRMQMVG  245



>ref|XP_007137157.1| hypothetical protein PHAVU_009G104600g [Phaseolus vulgaris]
 gb|ESW09151.1| hypothetical protein PHAVU_009G104600g [Phaseolus vulgaris]
Length=527

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/342 (37%), Positives = 201/342 (59%), Gaps = 6/342 (2%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKG  853
             H  ++   L  + F  +++L  C   NLG+  Y   I++ ++ P +   N +I+      
Sbjct  27    HAHIVKLSLSQSNFLATKMLDLCD--NLGHVDYATLIFQNLEDPNVFSYNAIIRTCTHNH  84

Query  852   ELSRTMEMYKHMLKTGM---CPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
             + S  + ++  ML+  M    PD +T P ++K+C  +    LG+ +H Q  KFG    + 
Sbjct  85    KHSLAITVFNEMLRHAMKSALPDKFTFPSVIKSCAGILCHRLGQQVHAQVCKFGPKSHAI  144

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+LI MY+   D+  A  VF+EM  R  V+W  LIS ++R G +  AR  FDE P + 
Sbjct  145   TDNALIDMYTKCGDLSGAYQVFEEMADRDSVSWNSLISGHARLGQMKSAREAFDEMPCRT  204

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MI+GY +  C  E L++FR MQ+ G++ DE  ++S+L ACA LG+L++GKW+H+
Sbjct  205   IVSWTTMINGYARAGCSVEALEIFREMQVVGIEPDEISVISVLPACAQLGALEVGKWIHK  264

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y EK G      +  AL++MY+KCGC+  +  LF ++ E+DVICW+ MI G A +G G  
Sbjct  265   YSEKSGFLKKTAVCNALIEMYSKCGCIDESLGLFDQMVEKDVICWSTMIGGLANHGKGYA  324

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLE  16
             A+R+F +MQN AG  P+GVTFV + +AC  +G+  EGL+  +
Sbjct  325   AIRVFEDMQN-AGVAPNGVTFVGVLSACVHAGLWKEGLRYFD  365



>ref|XP_010685827.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Beta vulgaris subsp. vulgaris]
Length=624

 Score =   264 bits (674),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/337 (38%), Positives = 201/337 (60%), Gaps = 1/337 (0%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H Q+I  GL ++   + R + FC+     +  Y  ++++++  P   I NT+I+ +L
Sbjct  36    KQLHSQIIRLGLSSDNDIMGRAIKFCAFSKCSDLVYAHQMFDKMPHPDAFIYNTLIRGYL  95

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                 +     +Y  ML+  + P+N+T P L++AC        GR IH   +K GFL D +
Sbjct  96    QCQLVRECFILYLQMLQDSVMPNNFTFPSLIRACCIDNWVEKGRQIHAHVVKMGFLDDKF  155

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+L+ MY S   +E A+ VFD+MP R VV+WT LIS YS+ G V +A  VF   P ++
Sbjct  156   SQNNLLYMYVSFGCLEEARRVFDKMPQRDVVSWTTLISGYSQLGLVNDAYEVFKSMPNRN  215

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MI+ YVQN+ F E   LF  M+M  V+ D  ++ S+LSAC  LG+LD G+W+H 
Sbjct  216   SAAWNAMIAAYVQNDRFHEAFALFNEMRMGNVELDRYVVASMLSACTKLGALDQGEWIHG  275

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y+ K G+ ++ +L T ++DMY KCGCL  A ++F  LP + +  WN MI G A++G G+ 
Sbjct  276   YIRKNGIEMDTKLATTVIDMYCKCGCLEKAFEVFNGLPSKGISTWNCMIGGLAIHGRGKA  335

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             A+ LF++M+ +    PD +TF+++ +AC+ +G+   G
Sbjct  336   AIELFKDMERET-VAPDNITFLNVLSACAHAGLVETG  371


 Score = 76.3 bits (186),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 120/290 (41%), Gaps = 38/290 (13%)
 Frame = -2

Query  951  LGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYL  772
            LG     + +++ +        N MI A++          ++  M    +  D Y +  +
Sbjct  198  LGLVNDAYEVFKSMPNRNSAAWNAMIAAYVQNDRFHEAFALFNEMRMGNVELDRYVVASM  257

Query  771  LKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCV  592
            L AC  + + + G  IHG   K G  MD+ +  ++I MY     +E A            
Sbjct  258  LSACTKLGALDQGEWIHGYIRKNGIEMDTKLATTVIDMYCKCGCLEKA------------  305

Query  591  VAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMT  412
                            FE   VF+  P K    W  MI G   +   K  ++LF+ M+  
Sbjct  306  ----------------FE---VFNGLPSKGISTWNCMIGGLAIHGRGKAAIELFKDMERE  346

Query  411  GVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLG-MAINVRLGTALVDMYAKCGCLGL  235
             V  D    +++LSACAH G ++ G+   +++ ++  +   +     +VD+  + G L  
Sbjct  347  TVAPDNITFLNVLSACAHAGLVETGRHYFKHMTEVHRLEPRMEHYGCMVDLLGRAGLLEE  406

Query  234  AQKLF-YELP-ERDVICWNAMISGFAMNGD---GEN-AMRLFREMQNDAG  103
            A+KL   E+P E D     A++    ++GD   GEN   RL     N++G
Sbjct  407  ARKLVEEEMPMEADAGVLGALVGACKIHGDINLGENFGKRLIELDPNNSG  456



>ref|XP_007202004.1| hypothetical protein PRUPE_ppa021060mg, partial [Prunus persica]
 gb|EMJ03203.1| hypothetical protein PRUPE_ppa021060mg, partial [Prunus persica]
Length=554

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/348 (39%), Positives = 206/348 (59%), Gaps = 4/348 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLL-AFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             Q +  ++TC L  N ++++ LL A  +  +     Y   I++        + NTMI+ ++
Sbjct  52    QIYAHLLTCRLPENPYSIAPLLSASATSKDASLFCYACSIFKHHHHRNTFMYNTMIRGYV  111

Query  861   LKGELSRTMEM-YKHMLKTGMCPDNYTLPYLLKACGNM--ESCNLGRSIHGQCLKFGFLM  691
             L+        + Y  ML  G  P+NYT P L+KAC  +   S   GR +HG  +KFG+  
Sbjct  112   LQSHTPIPAILCYLDMLNYGFVPNNYTFPPLIKACTVLIPNSKLSGRLVHGHVVKFGYRD  171

Query  690   DSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETP  511
             D +V +SLI  YS + DME+A+ VFD+ P R VV WT +I  Y + GDV  AR +FDE P
Sbjct  172   DPFVLSSLIEFYSVIHDMETAKLVFDKSPKRDVVVWTAMIDGYGKAGDVENARALFDEMP  231

Query  510   VKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKW  331
              ++   W +M++ Y + + F+E L LFR MQ  G + +E++LVS+L+A AHLG++  G W
Sbjct  232   ERNAISWSAMMAAYSRVSHFREVLSLFRQMQEVGTKPNESVLVSVLTASAHLGAVTQGLW  291

Query  330   VHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGD  151
             VH + ++  +  N  L TALVDMY+KCG +  A  +F  +  +D   WNAMI+G AMNGD
Sbjct  292   VHSFAKRYNLESNTILATALVDMYSKCGYVEAALWVFEGISNKDARAWNAMIAGVAMNGD  351

Query  150   GENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIG  7
                ++ LF +M    G +P   TFV++ TAC+ + M  +GL+L +++G
Sbjct  352   ARKSLELFNKMVEYGGVQPTETTFVAVLTACTHAKMVDKGLELFDQMG  399



>ref|XP_006408981.1| hypothetical protein EUTSA_v10001958mg [Eutrema salsugineum]
 gb|ESQ50434.1| hypothetical protein EUTSA_v10001958mg [Eutrema salsugineum]
Length=531

 Score =   261 bits (667),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/342 (36%), Positives = 203/342 (59%), Gaps = 4/342 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H  +I  GL  ++F +++++  C    +G+     R+++++  P + + N++I+A+  
Sbjct  28    KIHASIIVHGLSQSSFMVTKMVDVCD--KIGDMECATRLFKQVANPNVFLYNSIIRAYAH  85

Query  858   KGELSRTMEMYKHMLKTGM-CPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                    + +Y+ +L+  +  PD +T P++ K+C ++ S  LG+  HG   KFG      
Sbjct  86    NSLYRDVIRIYRQLLRKSLDLPDRFTFPFMFKSCASIGSYYLGKQAHGHLCKFGPKFHLV  145

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+LI MY   DD+  A  VFDEM  R V++W  L+S Y+R G + +A+ +F   P K 
Sbjct  146   TENALIDMYMKFDDLADAHKVFDEMSVRDVISWNSLLSGYARLGQMKKAKALFHSMPDKT  205

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MISGY    C+ E ++ FR MQ+ G++ DE  L+S+L +CAHLGSL++GKW+H 
Sbjct  206   IVSWTAMISGYTGIGCYVEAMEFFRGMQLAGIEPDEISLISVLPSCAHLGSLELGKWIHM  265

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y ++ G      +  AL++MY+KCG +  A +LF  +  +DVI W+ MISG+A +G+   
Sbjct  266   YADRKGFLKQTGVCNALIEMYSKCGLISQAIELFSRMKRKDVISWSTMISGYAHHGNAHQ  325

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLE  16
             A+  F EMQ  A  +P+G+TF+ L +ACS  G+  +GLK  +
Sbjct  326   AIETFNEMQR-AKVKPNGITFLGLLSACSHVGLWQQGLKYFD  366


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 63/131 (48%), Gaps = 3/131 (2%)
 Frame = -2

Query  423  MQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGC  244
            M   G++  E   V  L     LG     K +H  +   G++ +  + T +VD+  K G 
Sbjct  1    MAFHGIRELENYFVPFLQRFKSLGEW---KKIHASIIVHGLSQSSFMVTKMVDVCDKIGD  57

Query  243  LGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFT  64
            +  A +LF ++   +V  +N++I  +A N    + +R++R++   +   PD  TF  +F 
Sbjct  58   MECATRLFKQVANPNVFLYNSIIRAYAHNSLYRDVIRIYRQLLRKSLDLPDRFTFPFMFK  117

Query  63   ACSCSGMAHEG  31
            +C+  G  + G
Sbjct  118  SCASIGSYYLG  128



>ref|XP_002282081.2| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Vitis vinifera]
Length=541

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/351 (36%), Positives = 206/351 (59%), Gaps = 8/351 (2%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              + H  ++   L  ++F +++++  C+  +     Y   +++R+  P   + N MI+A+ 
Sbjct  31    KKIHAHIVKFSLSQSSFLVTKMVDVCN--HHAETEYANLLFKRVADPNAFLYNAMIRAYK  88

Query  861   LKGELSRTMEMYKHML-----KTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGF  697
                     + +YK ML     +  + PD +T P+++K+C  +   +LG+ +HG   KFG 
Sbjct  89    HNKVYVLAITVYKQMLGHSHGENPIFPDKFTFPFVVKSCAGLMCYDLGKQVHGHVFKFGQ  148

Query  696   LMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDE  517
               ++ V NSL+ MY   D ++ A  VF+EM  R  V+W  LIS + R G +  AR +F+E
Sbjct  149   KSNTVVENSLVEMYVKCDSLDDAHKVFEEMTERDAVSWNTLISGHVRLGQMRRARAIFEE  208

Query  516   TPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIG  337
                K    W +++SGY +  C+ + L+ FR MQM G++ DE  LVS+L ACA LG+L++G
Sbjct  209   MQDKTIFSWTAIVSGYARIGCYADALEFFRRMQMVGIEPDEISLVSVLPACAQLGALELG  268

Query  336   KWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMN  157
             KW+H Y +K G   N+ +  AL++MYAKCG +   ++LF ++ ERDVI W+ MI G A +
Sbjct  269   KWIHFYADKAGFLRNICVCNALIEMYAKCGSIDEGRRLFDQMNERDVISWSTMIVGLANH  328

Query  156   GDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             G    A+ LF+EMQ  A   P+ +TFV L +AC+ +G+ +EGL+  E + R
Sbjct  329   GRAHEAIELFQEMQK-AKIEPNIITFVGLLSACAHAGLLNEGLRYFESMKR  378


 Score = 83.2 bits (204),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 109/280 (39%), Gaps = 73/280 (26%)
 Frame = -2

Query  774  LLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRC  595
            +LK C N+      + IH   +KF     S++   ++ + +   + E A           
Sbjct  20   ILKNCPNIVEL---KKIHAHIVKFSLSQSSFLVTKMVDVCNHHAETEYAN----------  66

Query  594  VVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQM  415
                                 L+F      +  ++ +MI  Y  N  +   + +++  QM
Sbjct  67   ---------------------LLFKRVADPNAFLYNAMIRAYKHNKVYVLAITVYK--QM  103

Query  414  TG-------VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYA  256
             G       +  D+     ++ +CA L   D+GK VH +V K G   N  +  +LV+MY 
Sbjct  104  LGHSHGENPIFPDKFTFPFVVKSCAGLMCYDLGKQVHGHVFKFGQKSNTVVENSLVEMYV  163

Query  255  KCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQN------------  112
            KC  L  A K+F E+ ERD + WN +ISG    G    A  +F EMQ+            
Sbjct  164  KCDSLDDAHKVFEEMTERDAVSWNTLISGHVRLGQMRRARAIFEEMQDKTIFSWTAIVSG  223

Query  111  --------DA----------GTRPDGVTFVSLFTACSCSG  46
                    DA          G  PD ++ VS+  AC+  G
Sbjct  224  YARIGCYADALEFFRRMQMVGIEPDEISLVSVLPACAQLG  263



>ref|XP_008790494.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Phoenix dactylifera]
Length=632

 Score =   263 bits (673),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/346 (38%), Positives = 205/346 (59%), Gaps = 3/346 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q++  GL  +  A+ RLL FC+    G+  Y  R++  + +P   + NT+ +A   
Sbjct  48    QYHSQIVRLGLAADNDAVGRLLKFCALSPSGDLAYSLRLFSHLPRPDPFVFNTLFRA--Q  105

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 +R+  +Y  ML+  + P+ +T P LL++        LGR +H   LK GF  D Y 
Sbjct  106   PPSAARSALLYSDMLRRPVHPNEFTFPSLLQSIAADRELGLGRQVHAHVLKLGFGTDGYS  165

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
             GN+L+ MY S   +  +  +F  MP R VV+WT +IS  S  G + +AR +FDE P ++ 
Sbjct  166   GNNLLHMYLSCGLLAESLGLFHAMPHRDVVSWTTMISGLSELGFLDDARKLFDEMPERNS  225

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GYV+   FKE   LF  M+  GV+ D  +  S+L+AC  LG+L+ G+W+H Y
Sbjct  226   VSWNAMIAGYVRGGRFKEASGLFEQMRADGVELDRYVAASMLAACTGLGALEQGQWIHTY  285

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +++ G+ ++ +L T +VDMY KCGCL  A ++F ELP + +  WN MI GFAM+G GE A
Sbjct  286   IKRRGIELDSKLATTVVDMYCKCGCLEKAYEVFSELPCKGLSSWNCMIGGFAMHGRGEAA  345

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGRA  1
             + LF+EM+ + G  PD +T +++ +AC+ +G+  EG    E I +A
Sbjct  346   IELFKEMEKE-GVMPDDITLLNVLSACAHAGLVREGRHYFEYIVQA  390


 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 122/295 (41%), Gaps = 38/295 (13%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ + +      N MI  ++  G       +++ M   G+  D Y    +L AC  + 
Sbjct  215  KLFDEMPERNSVSWNAMIAGYVRGGRFKEASGLFEQMRADGVELDRYVAASMLAACTGLG  274

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            +   G+ IH    + G  +DS +  +++ MY     +E A  VF E+             
Sbjct  275  ALEQGQWIHTYIKRRGIELDSKLATTVVDMYCKCGCLEKAYEVFSEL-------------  321

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                              P K    W  MI G+  +   +  ++LF+ M+  GV  D+  
Sbjct  322  ------------------PCKGLSSWNCMIGGFAMHGRGEAAIELFKEMEKEGVMPDDIT  363

Query  387  LVSILSACAHLGSLDIGKWVHRY-VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
            L+++LSACAH G +  G+    Y V+   +   +     +VD+  + G L  A+K+  E+
Sbjct  364  LLNVLSACAHAGLVREGRHYFEYIVQAYHIEPKMEHFGCMVDLLGRAGLLEEAKKIIDEM  423

Query  210  P-ERDVICWNAMISGFAMNGD---GENAMRLFREMQNDAGTRPDGVTFVSLFTAC  58
            P E D     A++    ++G+   GE   RL  E+      R   V   +LF + 
Sbjct  424  PMEADAGVLGALLGACKIHGNVELGEQIGRLVIELDPQNSGRY--VLLANLFASA  476



>gb|EYU45574.1| hypothetical protein MIMGU_mgv1a001941mg [Erythranthe guttata]
Length=736

 Score =   266 bits (679),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/331 (40%), Positives = 195/331 (59%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H   I  GL N  FA+S+L+ FC+    GN +Y   I++ I  P   I N MI+ + L
Sbjct  47    QIHSHFIKFGLHNTQFAVSKLIDFCAVSPYGNLSYAVSIFDSIHNPNHVIYNMMIRGYSL  106

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    +  Y  ML  G+ P++YT P+LLK+C    +   G+ +HG   KFG   D YV
Sbjct  107   GSVPKSALNCYVKMLFLGLEPNSYTFPFLLKSCTKFPTAQTGKQVHGHVFKFGLDSDVYV  166

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   D+E A+ VFD+ P R  V++T LI+ Y  +G V  AR +FDE PV+D 
Sbjct  167   HTSLINMYAHHGDLEDARMVFDKSPLRDAVSFTALITGYLPRGYVDRARELFDEIPVRDV  226

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MISGY Q   F E L LFR M+   V  D + L+S+LSACA +G ++ G W+  +
Sbjct  227   VSWNAMISGYAQIGKFDEALSLFREMRNAEVAPDVSTLLSVLSACARVGDIETGDWIKLW  286

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E+  +  N++L  A++DMYAKCG L  A+KLF  + E+D++ WN MI G+    + +NA
Sbjct  287   IEENRLDSNLQLVNAMIDMYAKCGNLHTARKLFDGIKEKDIVSWNVMIGGYTHMSEYKNA  346

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + +FR +Q +    P+ VTF+++  AC+  G
Sbjct  347   LEMFRLLQLNK-VEPNDVTFLNIIPACAQLG  376


 Score =   167 bits (422),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/307 (31%), Positives = 156/307 (51%), Gaps = 32/307 (10%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
             +++ I    +   N MI  +   G+    + +++ M    + PD  TL  +L AC  + 
Sbjct  216  ELFDEIPVRDVVSWNAMISGYAQIGKFDEALSLFREMRNAEVAPDVSTLLSVLSACARVG  275

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
                G  I                  L +  + LD   + Q V              +I 
Sbjct  276  DIETGDWI-----------------KLWIEENRLD--SNLQLV------------NAMID  304

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
             Y++ G++  AR +FD    KD   W  MI GY   + +K  L++FRL+Q+  V+ ++  
Sbjct  305  MYAKCGNLHTARKLFDGIKEKDIVSWNVMIGGYTHMSEYKNALEMFRLLQLNKVEPNDVT  364

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKLGMAI-NVRLGTALVDMYAKCGCLGLAQKLFYEL  211
             ++I+ ACA LG+LD+GKW+H Y+EK      N  L T+L++MYAKCG +  A+++FY  
Sbjct  365  FLNIIPACAQLGALDLGKWMHTYIEKHYHDFPNETLWTSLINMYAKCGNIEAAKQIFYGT  424

Query  210  PERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
              + +  WNAMISG AM+GD  NA+ LF +M  +   +PD +TFVS+ +AC  +G+   G
Sbjct  425  KTKSLASWNAMISGLAMHGDASNAIELFSKMAKEGLFKPDEITFVSVLSACCHAGLVDLG  484

Query  30   LKLLEKI  10
             ++ + +
Sbjct  485  RQIFKSM  491


 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/290 (22%), Positives = 129/290 (44%), Gaps = 37/290 (13%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            GN     ++++ I++  I   N MI  +    E    +EM++ +    + P++ T   ++
Sbjct  310  GNLHTARKLFDGIKEKDIVSWNVMIGGYTHMSEYKNALEMFRLLQLNKVEPNDVTFLNII  369

Query  768  KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
             AC  + + +LG+ +H    K                             + + P+  + 
Sbjct  370  PACAQLGALDLGKWMHTYIEKH----------------------------YHDFPNETL-  400

Query  588  AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
             WT LI+ Y++ G++  A+ +F  T  K    W +MISG   +      ++LF  M   G
Sbjct  401  -WTSLINMYAKCGNIEAAKQIFYGTKTKSLASWNAMISGLAMHGDASNAIELFSKMAKEG  459

Query  408  V-QADEAILVSILSACAHLGSLDIGKWVHR-YVEKLGMAINVRLGTALVDMYAKCGCLGL  235
            + + DE   VS+LSAC H G +D+G+ + +  V+   ++  ++    ++D+  + G    
Sbjct  460  LFKPDEITFVSVLSACCHAGLVDLGRQIFKSMVQDYNISPQLQHYGCMIDLLGRAGLFEE  519

Query  234  AQKLFYELP-ERDVICWNAMISGFAMNGDGE----NAMRLFREMQNDAGT  100
            A +L   +  E D   W +++    ++ + E     A +LF+   N+ G+
Sbjct  520  AMELVEGMEIEPDGAIWGSILGACRIHKNLELGEFAAEKLFKIEPNNPGS  569



>ref|XP_010250014.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Nelumbo nucifera]
Length=737

 Score =   266 bits (679),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/331 (40%), Positives = 197/331 (60%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q+I  GL N  FALS+L+ FC+    G+ +Y   I+  I++P + I NT+I+   L
Sbjct  49    QIHSQIIKTGLHNTQFALSKLIEFCAISPFGDLSYALLIFACIEEPNVFIWNTIIRGHSL  108

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    +  Y  ML  G+ P++YT P+LLK+C    +   GR +H   LK G   D++V
Sbjct  109   SSSPILAVAFYVRMLLAGVEPNSYTFPFLLKSCAQATATQQGRQVHAHILKLGLETDAFV  168

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   ++E A  VFD+   R  V++T LI+ Y+  G + +AR +FD+ PV+D 
Sbjct  169   HTSLISMYARNGELEDAHLVFDKGSLRNAVSFTALITGYASAGYLEDARKLFDDIPVRDV  228

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W ++I+GY Q+  +KE L  F  M  + VQ +E+ LVS+LSACA  GSL++G W   +
Sbjct  229   ISWNAIIAGYAQSGRYKEALDFFHDMLNSNVQPNESTLVSVLSACAQSGSLELGHWARIW  288

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E  G+  N+ L  +L+DMYAKCG L  A+ LF  + +RD + WN MI G+   G  + A
Sbjct  289   IEDHGLGSNLHLVNSLIDMYAKCGDLETARGLFDGIHQRDRVSWNVMIGGYTHKGHYKEA  348

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + LFR+MQ  +   P+ VTF+S+  AC+  G
Sbjct  349   LTLFRQMQQ-SNEEPNDVTFLSILPACAHLG  378


 Score =   177 bits (449),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 158/309 (51%), Gaps = 33/309 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ I    +   N +I  +   G     ++ +  ML + + P+  TL  +L AC    
Sbjct  218  KLFDDIPVRDVISWNAIIAGYAQSGRYKEALDFFHDMLNSNVQPNESTLVSVLSACAQSG  277

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LG          G   + ++ NSLI MY        A+C                  
Sbjct  278  SLELGHWARIWIEDHGLGSNLHLVNSLIDMY--------AKC------------------  311

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 GD+  AR +FD    +DR  W  MI GY     +KE L LFR MQ +  + ++  
Sbjct  312  -----GDLETARGLFDGIHQRDRVSWNVMIGGYTHKGHYKEALTLFRQMQQSNEEPNDVT  366

Query  387  LVSILSACAHLGSLDIGKWVHRYVEK-LGMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
             +SIL ACAHLG+LD+GKW+H Y+++      N  L T+L+DMYAKCG +  A+++F  +
Sbjct  367  FLSILPACAHLGALDLGKWIHAYIDRNFSNLSNDALSTSLIDMYAKCGNIDAAKQVFDAM  426

Query  210  PERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
              + +  WNAMISG A++G  + ++ LF +M  D G +PD +TFVS+ +ACS +G+   G
Sbjct  427  RPKTLASWNAMISGLAIHGHADMSLGLFLKMA-DEGFKPDDITFVSVLSACSHAGLVEVG  485

Query  30   LKLLEKIGR  4
             +L E + R
Sbjct  486  CQLFESMTR  494


 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 66/292 (23%), Positives = 124/292 (42%), Gaps = 36/292 (12%)
 Frame = -2

Query  1011  GLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTME  832
             GLG+N   ++ L+   +    G+      +++ I Q      N MI  +  KG     + 
Sbjct  293   GLGSNLHLVNSLIDMYA--KCGDLETARGLFDGIHQRDRVSWNVMIGGYTHKGHYKEALT  350

Query  831   MYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLK-FGFLMDSYVGNSLIVMY  655
             +++ M ++   P++ T   +L AC ++ + +LG+ IH    + F  L +  +  SLI MY
Sbjct  351   LFRQMQQSNEEPNDVTFLSILPACAHLGALDLGKWIHAYIDRNFSNLSNDALSTSLIDMY  410

Query  654   SSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMIS  475
                     A+C                       G++  A+ VFD    K    W +MIS
Sbjct  411   --------AKC-----------------------GNIDAAKQVFDAMRPKTLASWNAMIS  439

Query  474   GYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIG-KWVHRYVEKLGMA  298
             G   +      L LF  M   G + D+   VS+LSAC+H G +++G +          ++
Sbjct  440   GLAIHGHADMSLGLFLKMADEGFKPDDITFVSVLSACSHAGLVEVGCQLFESMTRDYKIS  499

Query  297   INVRLGTALVDMYAKCGCLGLAQKLFYELPER-DVICWNAMISGFAMNGDGE  145
               ++    ++D+  + G    A+ L   +  + D   W +++    ++G+ E
Sbjct  500   PKLQHYGCMIDLLGRAGLFEEAEALIKSMEMKPDGAIWGSLLGACRVHGNVE  551



>ref|XP_009369706.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Pyrus x bretschneideri]
Length=627

 Score =   263 bits (672),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 132/338 (39%), Positives = 207/338 (61%), Gaps = 3/338 (1%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H QVI  GL  +  A+ R++ FC+    G+  Y  ++++ + QP   I NT+++ +L
Sbjct  40    KQLHSQVIRLGLATDNDAMGRVIKFCALSKNGDLGYALQVFDAMPQPDAFIYNTVMRGYL  99

Query  861   LKGELSRT-MEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDS  685
              + +L R  + +Y  ML+  + P+ +T P +++AC    +   G+ +H   +K GF  D 
Sbjct  100   -QCQLPRDCIVLYSQMLQDFVTPNRFTFPSVVRACCADGAVVEGKQVHAHVIKLGFGDDG  158

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
             +  N+LI MY     +E A+ VFD+MP   VV+WT LI+ YS++G V EA  +F+  P K
Sbjct  159   FCQNNLIHMYVKFQSLEEARRVFDKMPRVDVVSWTTLITGYSQRGFVDEAFEMFELMPEK  218

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             +   W +MIS YVQ+  F E   LF+ M++  V+ D+ +  S+LSAC  LG+L+ GKW+H
Sbjct  219   NSVSWNAMISSYVQSGRFHEAFALFQRMRVENVELDKFMAASMLSACTGLGALEQGKWIH  278

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
              Y+EK G+ ++ +L T ++DMY KCGCL  A ++F  LP + +  WN MI G AM+G GE
Sbjct  279   GYIEKSGIELDSKLATTIIDMYCKCGCLEKAFEVFNGLPRKGISSWNCMIGGLAMHGKGE  338

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
              A+ LF +MQ D    PD +TFV++ +AC+ SG+  +G
Sbjct  339   AAVELFEQMQRDM-VAPDNITFVNVLSACAHSGLVEKG  375


 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/243 (24%), Positives = 100/243 (41%), Gaps = 32/243 (13%)
 Frame = -2

Query  933  GWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGN  754
             + ++E + +      N MI +++  G       +++ M    +  D +    +L AC  
Sbjct  208  AFEMFELMPEKNSVSWNAMISSYVQSGRFHEAFALFQRMRVENVELDKFMAASMLSACTG  267

Query  753  MESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVL  574
            + +   G+ IHG   K G  +DS +  ++I MY     +E A  VF+ +P + + +    
Sbjct  268  LGALEQGKWIHGYIEKSGIELDSKLATTIIDMYCKCGCLEKAFEVFNGLPRKGISS----  323

Query  573  ISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADE  394
                                       W  MI G   +   +  ++LF  MQ   V  D 
Sbjct  324  ---------------------------WNCMIGGLAMHGKGEAAVELFEQMQRDMVAPDN  356

Query  393  AILVSILSACAHLGSLDIGKWVHR-YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFY  217
               V++LSACAH G ++ G+   R  VE  G+         +VD+  + G L  A+KL  
Sbjct  357  ITFVNVLSACAHSGLVEKGQQYFRSMVEVHGIEPRTEHFGCMVDLLGRAGRLEEARKLIN  416

Query  216  ELP  208
            E+P
Sbjct  417  EMP  419



>ref|XP_010101131.1| Serine/threonine-protein phosphatase PP2A-4 catalytic subunit 
[Morus notabilis]
 gb|EXB87349.1| Serine/threonine-protein phosphatase PP2A-4 catalytic subunit 
[Morus notabilis]
Length=783

 Score =   266 bits (681),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 136/343 (40%), Positives = 209/343 (61%), Gaps = 1/343 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q    +   G   + +A ++++AFCS  +     + +R++  +   T  I NTMI+AF  
Sbjct  22    QIQSHLAVSGTLFDPYAAAKIIAFCSTSDASYVCHAYRLFHCMPYRTTYIWNTMIRAFAE  81

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               E  R + +YK+ML+ G  P+NYT  +LL+AC  +   +LG +IHGQ ++ G+    +V
Sbjct  82    GNEAIRALSLYKNMLENGFLPNNYTFSFLLRACTELSDLSLGFTIHGQTIRLGWESYDFV  141

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N LI +Y++   M+ A+ +FD   +R V+ WT LI+ Y++   +  AR +FD+ P K+ 
Sbjct  142   QNGLIHLYATCFCMDPARKLFDVNVNRDVITWTSLINGYAKSEQLLIARELFDKMPEKNT  201

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY Q   FKE L+LF  MQ +G     A +V  L+ACA LG+LD G+W+H Y
Sbjct  202   VSWSAMINGYCQVGLFKEALELFSDMQASGFAPSHAAIVGALTACAFLGALDQGRWIHAY  261

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V + GM I+  +GTAL+DMYAKCGC+  A  +F  L ERDV  + ++ISG A +G    A
Sbjct  262   VGRKGMQIDRVVGTALIDMYAKCGCIQTACVVFDGLSERDVFAFTSLISGLANHGQSTRA  321

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             + LF  MQ + G +P+ VTF+S+ +ACS  G+  EGL++ E +
Sbjct  322   IELFMRMQRE-GVQPNEVTFISVLSACSRMGLVDEGLRIFESM  363


 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/212 (25%), Positives = 88/212 (42%), Gaps = 32/212 (15%)
 Frame = -2

Query  546  VFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSA  367
            V  A  +F   P +   +W +MI  + + N     L L++ M   G   +      +L A
Sbjct  54   VCHAYRLFHCMPYRTTYIWNTMIRAFAEGNEAIRALSLYKNMLENGFLPNNYTFSFLLRA  113

Query  366  CAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLG-----------------  238
            C  L  L +G  +H    +LG      +   L+ +YA C C+                  
Sbjct  114  CTELSDLSLGFTIHGQTIRLGWESYDFVQNGLIHLYATCFCMDPARKLFDVNVNRDVITW  173

Query  237  --------------LAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGT  100
                          +A++LF ++PE++ + W+AMI+G+   G  + A+ LF +MQ  +G 
Sbjct  174  TSLINGYAKSEQLLIARELFDKMPEKNTVSWSAMINGYCQVGLFKEALELFSDMQA-SGF  232

Query  99   RPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             P     V   TAC+  G   +G  +   +GR
Sbjct  233  APSHAAIVGALTACAFLGALDQGRWIHAYVGR  264



>ref|XP_006481967.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Citrus sinensis]
Length=546

 Score =   261 bits (667),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/343 (37%), Positives = 213/343 (62%), Gaps = 1/343 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q    +   G   + FA+ +++ FCS  ++G+ ++G+R++  +Q  T  I NTMI+ F  
Sbjct  30    QIQSHLTVSGTLWDPFAVGKIIGFCSASDIGDLSHGYRLFVCLQYRTTFIWNTMIRGFAE  89

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             K E  +   +YK ML++   P+NYT  ++L+AC +     +G   H Q ++ G+    +V
Sbjct  90    KNEPIKAFALYKQMLRSDFLPNNYTFSFILRACADTSCLFVGLICHAQVIRLGWESYDFV  149

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N L+ +Y++ + M+ A+ +FD   +R V++WT LI+ Y++ G +  AR +FD+ P K+ 
Sbjct  150   LNGLLHLYATCNCMDPARKLFDMSVNRDVISWTSLINGYAKSGQISIARQMFDKMPEKNA  209

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GYVQ + FKE L+ F  MQ+ G + + A +V  L+ACA LG+LD G+W+H Y
Sbjct  210   ISWSAMINGYVQVDLFKEALEHFNYMQLCGFRPNHAGIVGALTACAFLGALDQGRWIHAY  269

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V++ G+ +++ LGTA++DMYAKCGC+  A  +F  +P RDV  + ++ISG A +    +A
Sbjct  270   VDRNGIELDIILGTAIIDMYAKCGCIETACSVFDSMPNRDVFAYTSLISGLANHDQSASA  329

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             + LF  MQ + G  P+ VTF+ +  ACS  G+  +GL++ + +
Sbjct  330   IELFMRMQLE-GVVPNEVTFICVLNACSRMGLVDQGLRIFKSM  371


 Score = 80.5 bits (197),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 73/325 (22%), Positives = 136/325 (42%), Gaps = 62/325 (19%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAF-----CSDP-------NLGNPTYGW-------------  928
             H QVI  G  +  F L+ LL       C DP       ++      W             
Sbjct  135   HAQVIRLGWESYDFVLNGLLHLYATCNCMDPARKLFDMSVNRDVISWTSLINGYAKSGQI  194

Query  927   ----RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKAC  760
                 ++++++ +      + MI  ++        +E + +M   G  P++  +   L AC
Sbjct  195   SIARQMFDKMPEKNAISWSAMINGYVQVDLFKEALEHFNYMQLCGFRPNHAGIVGALTAC  254

Query  759   GNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWT  580
               + + + GR IH    + G  +D  +G ++I MY+    +E+A          C V   
Sbjct  255   AFLGALDQGRWIHAYVDRNGIELDIILGTAIIDMYAKCGCIETA----------CSV---  301

Query  579   VLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQA  400
                               FD  P +D   + S+ISG   ++     ++LF  MQ+ GV  
Sbjct  302   ------------------FDSMPNRDVFAYTSLISGLANHDQSASAIELFMRMQLEGVVP  343

Query  399   DEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLAQKL  223
             +E   + +L+AC+ +G +D G  + + + ++ G+   V+    LVD+  + G L  A+K+
Sbjct  344   NEVTFICVLNACSRMGLVDQGLRIFKSMSEIYGIEPGVQHYGCLVDLLGRAGMLEAAKKV  403

Query  222   FYELP-ERDVICWNAMISGFAMNGD  151
               E+P E D     A+++   ++GD
Sbjct  404   VREMPIEPDNYVLGALLNACRVHGD  428



>ref|XP_009359788.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Pyrus x bretschneideri]
Length=627

 Score =   263 bits (672),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 132/338 (39%), Positives = 207/338 (61%), Gaps = 3/338 (1%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H QVI  GL  +  A+ R++ FC+    G+  Y  ++++ + QP   I NT+++ +L
Sbjct  40    KQLHSQVIRLGLATDNDAMGRVIKFCALSKNGDLGYALQVFDAMPQPDAFIYNTVMRGYL  99

Query  861   LKGELSRT-MEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDS  685
              + +L R  + +Y  ML+  + P+ +T P +++AC    +   G+ +H   +K GF  D 
Sbjct  100   -QCQLPRDCIVLYSQMLQDFVTPNRFTFPSVVRACCADGAVVEGKQVHAHVIKLGFGDDG  158

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
             +  N+LI MY     +E A+ VFD+MP   VV+WT LI+ YS++G V EA  +F+  P K
Sbjct  159   FCQNNLIHMYVKFQSLEEARRVFDKMPRVDVVSWTTLITGYSQRGFVDEAFEMFELMPEK  218

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             +   W +MIS YVQ+  F E   LF+ M++  V+ D+ +  S+LSAC  LG+L+ GKW+H
Sbjct  219   NSVSWNAMISSYVQSGRFHEAFALFQRMRVENVELDKFMAASMLSACTGLGALEQGKWIH  278

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
              Y+EK G+ ++ +L T ++DMY KCGCL  A ++F  LP + +  WN MI G AM+G GE
Sbjct  279   GYIEKSGIELDSKLATTIIDMYCKCGCLEKAFEVFNGLPRKGISSWNCMIGGLAMHGKGE  338

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
              A+ LF +MQ D    PD +TFV++ +AC+ SG+  +G
Sbjct  339   AAVELFEQMQRDM-VAPDNITFVNVLSACAHSGLVEKG  375


 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/243 (24%), Positives = 100/243 (41%), Gaps = 32/243 (13%)
 Frame = -2

Query  933  GWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGN  754
             + ++E + +      N MI +++  G       +++ M    +  D +    +L AC  
Sbjct  208  AFEMFELMPEKNSVSWNAMISSYVQSGRFHEAFALFQRMRVENVELDKFMAASMLSACTG  267

Query  753  MESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVL  574
            + +   G+ IHG   K G  +DS +  ++I MY     +E A  VF+ +P + + +    
Sbjct  268  LGALEQGKWIHGYIEKSGIELDSKLATTIIDMYCKCGCLEKAFEVFNGLPRKGISS----  323

Query  573  ISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADE  394
                                       W  MI G   +   +  ++LF  MQ   V  D 
Sbjct  324  ---------------------------WNCMIGGLAMHGKGEAAVELFEQMQRDMVAPDN  356

Query  393  AILVSILSACAHLGSLDIGKWVHR-YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFY  217
               V++LSACAH G ++ G+   R  VE  G+         +VD+  + G L  A+KL  
Sbjct  357  ITFVNVLSACAHSGLVEKGQQYFRSMVEVHGIEPRTEHFGCMVDLLGRAGRLEEARKLIN  416

Query  216  ELP  208
            E+P
Sbjct  417  EMP  419



>ref|XP_010091291.1| hypothetical protein L484_001646 [Morus notabilis]
 gb|EXB44248.1| hypothetical protein L484_001646 [Morus notabilis]
Length=633

 Score =   263 bits (672),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 135/352 (38%), Positives = 206/352 (59%), Gaps = 6/352 (2%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H + I  GL ++  A+ RL+ FC+    G+ +Y  ++++++ QP   I NT+++   
Sbjct  41    KQLHSRAIRLGLSSDNDAMGRLIKFCAVSEHGDLSYALQLFDQMPQPDAFIYNTIMRGLC  100

Query  861   LKGELSRT-MEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDS  685
              K       +  Y  ML+  + P+ +T P ++ AC    +   GR +H   LKFGF  D 
Sbjct  101   RKSHFPMDCLLFYLRMLRRSVSPNRFTFPSVIGACCLANAVEEGRQVHAHVLKFGFGEDG  160

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
             +  NSLI MY     ++ A+ VFD MP+  VV+WT LI+ YSR G V EA  +F+  P  
Sbjct  161   FCQNSLIHMYVGCGALDDARKVFDGMPAPDVVSWTTLIAGYSRCGSVDEAFRLFESMPEG  220

Query  504   DRRV--WGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKW  331
             +R    W +MI+ YVQ+N F E   LF+ M+   V+ D+ +  S+LSAC  LG+L+ GKW
Sbjct  221   ERSSVSWNAMIASYVQSNRFHEAFALFQRMRDEKVELDKYLAASMLSACTGLGALNQGKW  280

Query  330   VHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERD--VICWNAMISGFAMN  157
             +HRY+++ G+ ++ +L T ++DMY KCGCL  A ++F ELP +D  +  WN MI G AM+
Sbjct  281   IHRYIDESGIELDSKLATTIIDMYCKCGCLEKAYQVFKELPRKDKGISSWNCMIGGLAMH  340

Query  156   GDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGRA  1
             G G+ A+ LF EM       PD +TFV+L +AC+ SG+  EG     ++  A
Sbjct  341   GKGKAAIELFEEMHGQR-VAPDNITFVNLLSACAHSGLVEEGRHYFRRMTEA  391



>ref|XP_008227868.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Prunus mume]
Length=526

 Score =   260 bits (665),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 129/340 (38%), Positives = 201/340 (59%), Gaps = 1/340 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q    +   G   + +A ++++ FC+  N G+  + ++++  +   T  I N +I+A   
Sbjct  22    QIQSHLTVSGTLFDPYAAAKIITFCTVSNSGDLRHAFQLFRHMPYRTTYIWNVVIRALAE  81

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               E  R + +Y  M+++G  P+NYT  +LL+AC ++   + G  +H   ++ G+    +V
Sbjct  82    NNESMRAVSLYSDMIQSGFLPNNYTFSFLLRACADLSYLSFGLVLHCHAIRLGWESHDFV  141

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N LI +Y + D +  A+ +FD    R VV WT LI+ Y + G V  AR +FD+ P K+ 
Sbjct  142   QNGLIHLYVTCDFINPARKLFDMSVYRDVVTWTALINGYVKSGQVVIARELFDQMPQKNA  201

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GYVQ   F+E L+LF  MQ +G   + A +V  L+ACA LG+LD G+W+H Y
Sbjct  202   VSWSAMINGYVQVGLFREALELFVDMQASGFLPNHAGIVGSLTACAFLGALDQGRWIHAY  261

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V +  M ++  LGTALVDMY KCGC+  A+ +F E+P RDV  + ++ISG A NGD   A
Sbjct  262   VNRKRMQLDRVLGTALVDMYTKCGCIETARAVFNEMPSRDVFAFTSLISGLANNGDSAGA  321

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLL  19
             + LF  MQ D G  P+ VTF+ + +ACS  G+  EGL++ 
Sbjct  322   ISLFARMQ-DEGIAPNEVTFICVLSACSRMGLVDEGLRIF  360


 Score = 80.5 bits (197),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/273 (24%), Positives = 116/273 (42%), Gaps = 39/273 (14%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            G       +++++ Q      + MI  ++  G     +E++  M  +G  P++  +   L
Sbjct  184  GQVVIARELFDQMPQKNAVSWSAMINGYVQVGLFREALELFVDMQASGFLPNHAGIVGSL  243

Query  768  KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
             AC  + + + GR IH    +    +D  +G +L+ MY+                 +C  
Sbjct  244  TACAFLGALDQGRWIHAYVNRKRMQLDRVLGTALVDMYT-----------------KC--  284

Query  588  AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
                        G +  AR VF+E P +D   + S+ISG   N      + LF  MQ  G
Sbjct  285  ------------GCIETARAVFNEMPSRDVFAFTSLISGLANNGDSAGAISLFARMQDEG  332

Query  408  VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTA----LVDMYAKCGCL  241
            +  +E   + +LSAC+ +G +D G    R    +     ++ G      LVD+  + G L
Sbjct  333  IAPNEVTFICVLSACSRMGLVDEGL---RIFGSMTSTFRIQPGIQHYGCLVDLLGRAGML  389

Query  240  GLAQKLFYELP-ERDVICWNAMISGFAMNGDGE  145
              A+K+  E+P E D     A+++   ++GD E
Sbjct  390  EEAKKVVREMPMEPDSYVLGALLNACRVHGDVE  422



>ref|XP_010039610.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Eucalyptus grandis]
Length=736

 Score =   265 bits (677),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/329 (38%), Positives = 206/329 (63%), Gaps = 1/329 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q++  GL N  FALS+L+ FC+    G+ +Y   ++E I++P   I NT+I+   L
Sbjct  48    QIHCQIVKSGLHNTQFALSKLIEFCAVSPSGDLSYAVSLFESIEEPNQLIWNTIIRGHCL  107

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    +++Y  ML  G  P++YT P+LLK+C      + G+ IH   LK G   D++V
Sbjct  108   SAAPGLAIDIYVQMLLRGAMPNSYTFPFLLKSCAKAGLTHEGKQIHSHVLKLGLESDAFV  167

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   +++SA+ VF++   R VV++T L++ Y+  G + EA+ +F++ PV+D 
Sbjct  168   HTSLISMYAQSGELDSARLVFEKSSYRDVVSYTALLTGYASSGQMNEAKQLFEDIPVRDA  227

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY +   F+E ++ FR MQ   V  +E+ +V++LSACA  GS+++GKW+HR+
Sbjct  228   VSWNAMIAGYSECGQFEEAIETFRGMQKVNVMPNESTMVTVLSACAQSGSVELGKWMHRW  287

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E  G+  N RL  AL+DMY+KCG + +A+ LF  + ++DV+ WN MI G++     + A
Sbjct  288   IEDHGVGSNTRLVNALIDMYSKCGDVEIARGLFDGMSQKDVVSWNVMIGGYSHMNCYKEA  347

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSC  52
             + LFREM   +   P+ VTF+++  +C+C
Sbjct  348   LVLFREMLK-SNVEPNDVTFLNVLPSCAC  375


 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 97/295 (33%), Positives = 151/295 (51%), Gaps = 33/295 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            +++E I        N MI  +   G+    +E ++ M K  + P+  T+  +L AC    
Sbjct  217  QLFEDIPVRDAVSWNAMIAGYSECGQFEEAIETFRGMQKVNVMPNESTMVTVLSACAQSG  276

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LG+ +H      G   ++ + N+LI MYS                 +C         
Sbjct  277  SVELGKWMHRWIEDHGVGSNTRLVNALIDMYS-----------------KC---------  310

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 GDV  AR +FD    KD   W  MI GY   NC+KE L LFR M  + V+ ++  
Sbjct  311  -----GDVEIARGLFDGMSQKDVVSWNVMIGGYSHMNCYKEALVLFREMLKSNVEPNDVT  365

Query  387  LVSILSACAHLGSLDIGKWVHRYVEK-LGMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
             +++L +CA L +LD+GKW+H Y+ +    + N  L T+L+DMYAKCG +  A+++F  +
Sbjct  366  FLNVLPSCACLCALDLGKWIHTYINRNFKSSTNTALYTSLIDMYAKCGNVEAAEQVFNGM  425

Query  210  PERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
              + +  WNAMISG A++G+ E A+  F  M N+ G  PD +TFV + +AC+ +G
Sbjct  426  KCKSLSSWNAMISGLAVHGEVEKALGFFSRMVNE-GLEPDDITFVGVLSACNHAG  479


 Score = 76.6 bits (187),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 67/313 (21%), Positives = 136/313 (43%), Gaps = 37/313 (12%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKG  853
             H  +   G+G+NT  ++ L+   S    G+      +++ + Q  +   N MI  +    
Sbjct  285   HRWIEDHGVGSNTRLVNALIDMYS--KCGDVEIARGLFDGMSQKDVVSWNVMIGGYSHMN  342

Query  852   ELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGN  673
                  + +++ MLK+ + P++ T   +L +C  + + +LG+ IH       ++  ++  +
Sbjct  343   CYKEALVLFREMLKSNVEPNDVTFLNVLPSCACLCALDLGKWIHT------YINRNFKSS  396

Query  672   SLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRV  493
             +   +Y+SL DM                        Y++ G+V  A  VF+    K    
Sbjct  397   TNTALYTSLIDM------------------------YAKCGNVEAAEQVFNGMKCKSLSS  432

Query  492   WGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK-WVHRYV  316
             W +MISG   +   ++ L  F  M   G++ D+   V +LSAC H GSL++ + +    +
Sbjct  433   WNAMISGLAVHGEVEKALGFFSRMVNEGLEPDDITFVGVLSACNHAGSLELARSYFSSMI  492

Query  315   EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPER-DVICWNAMISGFAMNGD---G  148
             +   ++  ++    ++D+  K G    A+ L   +  + D   W +++     +G    G
Sbjct  493   QDYRISPKLQHYGCVIDLMGKNGLFDEAEALIESMNVKPDGAIWGSLLEACRAHGKVELG  552

Query  147   ENAMRLFREMQND  109
             E   R   E++ D
Sbjct  553   ETFARHLFELEPD  565



>ref|XP_007226519.1| hypothetical protein PRUPE_ppa025518mg [Prunus persica]
 gb|EMJ27718.1| hypothetical protein PRUPE_ppa025518mg [Prunus persica]
Length=528

 Score =   260 bits (664),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 137/345 (40%), Positives = 210/345 (61%), Gaps = 5/345 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q++T GL   TF  S+LLAF +    GN  Y   +  +I +P I   N+MI  FL 
Sbjct  30    QIHAQIVTTGLARFTFIASKLLAFSALSEYGNLHYAETLLYQITRPNIFDCNSMIMGFLK  89

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             + E  + + +Y  M + G  P+  T  +L+KAC  +   +L   +HGQ +KFG   D YV
Sbjct  90    RSESEKGLSIYTKMRRMGTEPNARTFTFLVKACVGV---SLLGQLHGQIMKFGHGCDVYV  146

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              +SLI MY   + +E A+ VF+E   + +  WT LIS Y   G V EAR +FD  P ++ 
Sbjct  147   ISSLISMYCKCEAVEFARRVFEESLDKNLACWTSLISGYCSNGLVHEARDLFDAMPERNN  206

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               + +M+SGYV N CF E + LFR  + + V+  E++LVS+L+ACA +G+ + GKW++ +
Sbjct  207   VSYSAMVSGYVWNACFNEAIDLFRESK-SHVRLKESLLVSVLNACASVGAFEEGKWINLF  265

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             + + G+   + LGTAL+D YAKCGC+  AQ++F  +P +DV  W+AMI GFA+NG+ +  
Sbjct  266   LNENGIEYGLELGTALIDFYAKCGCIEDAQEVFSMMPSKDVTTWSAMIMGFAINGENDMG  325

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             + LF EM+   G +P+ VTFV + TAC+   + +E  +LL ++ +
Sbjct  326   LALFAEMEKK-GPKPNAVTFVGVLTACNHKTLVNEAWRLLGRMSK  369



>ref|XP_009349726.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Pyrus x bretschneideri]
Length=544

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/349 (39%), Positives = 211/349 (60%), Gaps = 14/349 (4%)
 Frame = -2

Query  1038  QAHGQVITCGL---GNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKA  868
             Q H Q+I   L    +  F ++RLL F +  + G+  Y   ++  I+ P + + N MI+A
Sbjct  28    QIHTQIIKSPLLPKDDQNFLITRLLFFSAISDSGSHGYAIDVFRAIENPNLYVYNVMIRA  87

Query  867   FLLKGELSR-------TMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCL  709
             +  +    R       ++ +YK ML  G+ P+  + P+L+K C +      GRSIHGQ +
Sbjct  88    YACRKIGCRDEALSFGSLLLYKQMLCDGISPNCLSFPFLVKECTSRVDGGAGRSIHGQAV  147

Query  708   KFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARL  529
             K+G   D +V NSL+ MYS+   + SA+ +FDE P R VV+W  +I  Y + G + EA  
Sbjct  148   KYGLDSDVFVQNSLMSMYSACGFLSSARKLFDETPGRDVVSWNSMIKGYLKSGSLDEALK  207

Query  528   VFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG---VQADEAILVSILSACAH  358
             +F +   +    W S+I+G+VQ    KE L+LF  MQ+TG   V+ D+  + S+L+ACAH
Sbjct  208   LFRKMKKRSIFTWNSVITGFVQGGRPKEALELFHEMQITGGDIVRPDKITVASVLAACAH  267

Query  357   LGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAM  178
             LG++D G WVH Y+ + G+  +V +GTALVDMY KCGC+  A ++F E+P++D + W AM
Sbjct  268   LGAIDHGIWVHGYLRRSGLDSDVVIGTALVDMYGKCGCVDKAYEVFQEMPKKDTLAWTAM  327

Query  177   ISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             IS  A++G G  A  LF++M+   G +P+ VTFV+LF+AC+ SG   +G
Sbjct  328   ISVMALHGFGNEAFGLFKQMET-TGVKPNHVTFVALFSACAHSGFVEKG  375


 Score = 97.8 bits (242),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 79/336 (24%), Positives = 143/336 (43%), Gaps = 67/336 (20%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCS------------DPNLGNPTYGW-------------  928
             HGQ +  GL ++ F  + L++  S            D   G     W             
Sbjct  143   HGQAVKYGLDSDVFVQNSLMSMYSACGFLSSARKLFDETPGRDVVSWNSMIKGYLKSGSL  202

Query  927   ----RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTG---MCPDNYTLPYLL  769
                 +++ ++++ +I   N++I  F+  G     +E++  M  TG   + PD  T+  +L
Sbjct  203   DEALKLFRKMKKRSIFTWNSVITGFVQGGRPKEALELFHEMQITGGDIVRPDKITVASVL  262

Query  768   KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
              AC ++ + + G  +HG   + G   D  +G +L+ MY                  +C  
Sbjct  263   AACAHLGAIDHGIWVHGYLRRSGLDSDVVIGTALVDMYG-----------------KC--  303

Query  588   AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
                         G V +A  VF E P KD   W +MIS    +    E   LF+ M+ TG
Sbjct  304   ------------GCVDKAYEVFQEMPKKDTLAWTAMISVMALHGFGNEAFGLFKQMETTG  351

Query  408   VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRL--GTALVDMYAKCGCLGL  235
             V+ +    V++ SACAH G ++ G+W    ++ + + I  +L     +VD+ ++ G +  
Sbjct  352   VKPNHVTFVALFSACAHSGFVEKGRWCFDAMKHVYL-IEPQLYHYACMVDILSRAGLVEE  410

Query  234   AQKLFYELPER-DVICWNAMISGFAMNGDGENAMRL  130
             A++    +P + D   W A++ G  ++G  E   R+
Sbjct  411   AEQCIRSMPMKPDTFVWGALLGGCQIHGKVELGARV  446


 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 78/303 (26%), Positives = 124/303 (41%), Gaps = 67/303 (22%)
 Frame = -2

Query  819  MLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLM--DSYVGNSLIVMYSSL  646
            M++T M     TL +LL  C NM      + IH Q +K   L   D     + ++ +S++
Sbjct  1    MIETQMASARSTLLHLLHECKNMREL---KQIHTQIIKSPLLPKDDQNFLITRLLFFSAI  57

Query  645  DDMES---AQCVFDEMPSRCVVAWTVLISRYS-RKGDVFEARLVFDETPVKDRRVWGSMI  478
             D  S   A  VF  + +  +  + V+I  Y+ RK    +  L F           GS++
Sbjct  58   SDSGSHGYAIDVFRAIENPNLYVYNVMIRAYACRKIGCRDEALSF-----------GSLL  106

Query  477  SGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMA  298
                          L++ M   G+  +      ++  C        G+ +H    K G+ 
Sbjct  107  --------------LYKQMLCDGISPNCLSFPFLVKECTSRVDGGAGRSIHGQAVKYGLD  152

Query  297  INVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFR--  124
             +V +  +L+ MY+ CG L  A+KLF E P RDV+ WN+MI G+  +G  + A++LFR  
Sbjct  153  SDVFVQNSLMSMYSACGFLSSARKLFDETPGRDVVSWNSMIKGYLKSGSLDEALKLFRKM  212

Query  123  -----------------------------EMQNDAG--TRPDGVTFVSLFTACSCSGMAH  37
                                         EMQ   G   RPD +T  S+  AC+  G   
Sbjct  213  KKRSIFTWNSVITGFVQGGRPKEALELFHEMQITGGDIVRPDKITVASVLAACAHLGAID  272

Query  36   EGL  28
             G+
Sbjct  273  HGI  275



>ref|XP_002282063.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Vitis vinifera]
Length=533

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/348 (39%), Positives = 210/348 (60%), Gaps = 8/348 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTY---GWRIYERIQQPTICIVNTMIKA  868
             Q H  ++   L  + FA+ +LL+  +  N  NP++      I++ +    I + N+MI+ 
Sbjct  29    QIHANLLQSHLPESPFAIGQLLSLAATSN--NPSFFSHACLIFQNLSLRNIFMYNSMIRG  86

Query  867   FLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCN--LGRSIHGQCLKFGFL  694
             ++L    +R +  Y  ML  G+  +NYT P L+KAC  + S +  +G  +H   + FGF 
Sbjct  87    YVLSHSPTRAILCYLDMLNYGLLANNYTFPPLIKACTTLGSSSKLIGCLVHAHVVTFGFD  146

Query  693   MDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDET  514
              D +V ++LI  YS   DM +A+ +FD +P+R VV WT +I  Y + GDV  AR++F++ 
Sbjct  147   EDPFVVSALIEFYSLNFDMGTARTLFDRIPNRDVVLWTAMIDGYGKMGDVEHARILFEDM  206

Query  513   PVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
             P ++   W ++++ Y +   FKE L LFR MQ  G   +E++LVS+L+ACAHLG+L  G 
Sbjct  207   PERNAISWSAVMAAYSRVGDFKEVLCLFRRMQEAGTMPNESVLVSVLTACAHLGALAQGL  266

Query  333   WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNG  154
             WVH Y ++     N  L TALVDMY+KCGC+  A   F  +P +D   WNAMISG AMNG
Sbjct  267   WVHSYAKQCNFDSNPILATALVDMYSKCGCVESALSTFQGIPNKDAGAWNAMISGVAMNG  326

Query  153   DGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             D   ++ LF +M ++ GT+P   TFV++ TAC+ + +  EGLKL E++
Sbjct  327   DAWKSLELFNKMISN-GTQPTETTFVAVLTACTHARLVKEGLKLFEQM  373



>ref|XP_010489024.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Camelina sativa]
Length=534

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/342 (36%), Positives = 202/342 (59%), Gaps = 4/342 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H  +I  GL  ++F +++++  C    +G+  Y  R++ ++  P + + N++I+A+  
Sbjct  28    KIHACIIIHGLSQSSFMVTKMVDSCD--KIGDMEYATRLFNQVSSPNVFLYNSIIRAYTH  85

Query  858   KGELSRTMEMYKHMLKTGM-CPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                    +  Y+ +L+  +  PD +T P++ K+C ++ SC LG+ +HG   KFG      
Sbjct  86    HSLYCEVIRTYRQLLRKCIELPDRFTFPFMFKSCASLGSCYLGKQVHGHLCKFGPKFHVV  145

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+LI MY   DD+  A  VFD+M  R V++W  L+S Y+R G + +A+ +F   P K 
Sbjct  146   TENALIDMYMKFDDLADAHKVFDDMSERDVISWNSLLSGYARLGQMKKAKGLFHCMPDKT  205

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MISGY    C+ E +  FR MQ+ G++ DE  LVS+L +CAHLGSL++GKW+H 
Sbjct  206   IVSWTAMISGYTGIGCYVEAMAFFREMQLAGIEPDEISLVSVLPSCAHLGSLELGKWIHM  265

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y E+ G      +  AL++MY+KCG +  A +LF ++  +DVI W+ MISG+A +G+   
Sbjct  266   YAERRGFLKQTGVCNALIEMYSKCGMISQAIQLFDQMKMKDVISWSTMISGYAHHGNAHG  325

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLE  16
             A+  F  MQ  A  +P+G+TF+ L +ACS  G+  EGL   +
Sbjct  326   AIETFNGMQR-AKVKPNGITFIGLLSACSHVGLWQEGLTYFD  366



>ref|XP_010927406.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 
[Elaeis guineensis]
Length=623

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/347 (39%), Positives = 208/347 (60%), Gaps = 3/347 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLA-FCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             Q H ++I  GL  +    SRLLA  C+D N G+ TY   ++ERIQ P   + NTMI+A  
Sbjct  35    QVHARMIKTGLILDAIPASRLLAALCADSNAGSMTYALMVFERIQNPNTFMWNTMIRALS  94

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNL-GRSIHGQCLKFGFLMDS  685
                     + +Y  ML   +  ++YT P+LLKAC N+ S     + IH   +K G+ ++ 
Sbjct  95    SGNNPEEAILLYCQMLYNAVPHNSYTFPFLLKACANLPSATEETQQIHCHIIKTGYALEV  154

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
                NSL+ +Y+    + SA  +FD +P R +V+W  +I  Y++ G +  AR +FD+   K
Sbjct  155   CTTNSLLHVYAKSGGILSASQLFDSIPCRDIVSWNSMIDGYAKGGKIEMARELFDQMENK  214

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             +   W SMI+GYV+N  FKE L+LFR MQ+  ++ D   L S+L+ACAH+G+LD G+W+H
Sbjct  215   NIISWTSMITGYVENCLFKEALELFRKMQVMDIEPDTIALASVLTACAHVGALDEGRWIH  274

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
              Y++K  + +++ L   LVDMYAKCG L  A  +F    E++V    AMI+GFA++G G 
Sbjct  275   TYIKKKQIRLDLVLRCVLVDMYAKCGELDEALAVFKTTKEKNVCMCTAMITGFAVHGRGR  334

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
              A+ LF +M+   G +P+ +TF  + TACS +GM  EG  + E+I +
Sbjct  335   EALDLFTDMER-TGIKPNNITFTGVLTACSYAGMVEEGKSIFERIEK  380


 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 120/255 (47%), Gaps = 33/255 (13%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
             ++++++   I    +MI  ++        +E+++ M    + PD   L  +L AC ++ 
Sbjct  206  ELFDQMENKNIISWTSMITGYVENCLFKEALELFRKMQVMDIEPDTIALASVLTACAHVG  265

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            + + GR IH           +Y+    I +               ++  RCV     L+ 
Sbjct  266  ALDEGRWIH-----------TYIKKKQIRL---------------DLVLRCV-----LVD  294

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
             Y++ G++ EA  VF  T  K+  +  +MI+G+  +   +E L LF  M+ TG++ +   
Sbjct  295  MYAKCGELDEALAVFKTTKEKNVCMCTAMITGFAVHGRGREALDLFTDMERTGIKPNNIT  354

Query  387  LVSILSACAHLGSLDIGKWVHRYVEK-LGMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
               +L+AC++ G ++ GK +   +EK   M+ +V     +VD+  + G L  A+++  ++
Sbjct  355  FTGVLTACSYAGMVEEGKSIFERIEKDYDMSPSVEHYGCMVDLLGRAGLLKEAEEMIRKM  414

Query  210  PER-DVICWNAMISG  169
            P + +   W A+++ 
Sbjct  415  PVKPNAAVWGALLNA  429



>ref|XP_007154976.1| hypothetical protein PHAVU_003G162300g [Phaseolus vulgaris]
 gb|ESW26970.1| hypothetical protein PHAVU_003G162300g [Phaseolus vulgaris]
Length=733

 Score =   264 bits (675),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/331 (40%), Positives = 200/331 (60%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +I  GL N  FA S+L+ FC+     + +Y   ++  IQ P I I NT+I+A  L
Sbjct  45    QIHSLIIKTGLHNTLFAQSKLIEFCALSPSQDLSYALSLFHSIQHPNIFICNTLIRAHSL  104

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 + ++E+Y  ML +G+ P+++T P+L K+C    + +LG+ +H   LKF      +V
Sbjct  105   THSPNSSLELYNQMLHSGLHPNSHTFPFLFKSCAKARATHLGKQLHAHVLKFALHCHPHV  164

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MYS L ++++A+ VFD+   R  V++T LI+ Y  +G V +AR +FDE P KD 
Sbjct  165   HTSLIHMYSQLGELKNARLVFDKSVLRDAVSFTALITGYVSEGHVDDARRLFDEIPAKDV  224

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GYVQ   F+E L  F  MQ   V  +++ +VS+LSAC HLGSL++GKW+  +
Sbjct  225   VSWNAMIAGYVQGGRFEEALACFSSMQEADVSPNKSTMVSVLSACGHLGSLELGKWIGSW  284

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V   G+  N++L  ALVDMY KCG +  A++LF  + E+D+I WN MI G++       A
Sbjct  285   VRDHGLGSNIQLVNALVDMYCKCGEIDTARELFDGIREKDLISWNTMIGGYSYLSLYAEA  344

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + LF  M  +  T P+ VTF+ +  AC+C G
Sbjct  345   LALFDLMLREKVT-PNDVTFLGVLPACACLG  374


 Score =   164 bits (416),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/309 (32%), Positives = 154/309 (50%), Gaps = 33/309 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            R+++ I    +   N MI  ++  G     +  +  M +  + P+  T+  +L ACG++ 
Sbjct  214  RLFDEIPAKDVVSWNAMIAGYVQGGRFEEALACFSSMQEADVSPNKSTMVSVLSACGHLG  273

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LG+ I       G   +  + N+L+ MY                  +C         
Sbjct  274  SLELGKWIGSWVRDHGLGSNIQLVNALVDMYC-----------------KC---------  307

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 G++  AR +FD    KD   W +MI GY   + + E L LF LM    V  ++  
Sbjct  308  -----GEIDTARELFDGIREKDLISWNTMIGGYSYLSLYAEALALFDLMLREKVTPNDVT  362

Query  387  LVSILSACAHLGSLDIGKWVHRYVEK-LGMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
             + +L ACA LG+LD+GKWVH YV+K L    N  L T+++DMYAKCGC+  A+++F   
Sbjct  363  FLGVLPACACLGALDLGKWVHAYVDKILKGTDNASLWTSIIDMYAKCGCVEAAEQVFRSN  422

Query  210  PERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
              R +   NAMISGFAMNG  E A+ LF EM  + G +PD +TFV + +AC+ +G+   G
Sbjct  423  GSRSLASRNAMISGFAMNGHAERALALFEEMIKE-GFQPDDITFVGVLSACTQAGLVDLG  481

Query  30   LKLLEKIGR  4
             +    + +
Sbjct  482  HRYFSSMNQ  490


 Score = 73.6 bits (179),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 78/335 (23%), Positives = 127/335 (38%), Gaps = 68/335 (20%)
 Frame = -2

Query  1011  GLGNNTFALSRLL-AFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTM  835
             GLG+N   ++ L+  +C     G       +++ I++  +   NTMI  +      +  +
Sbjct  289   GLGSNIQLVNALVDMYC---KCGEIDTARELFDGIREKDLISWNTMIGGYSYLSLYAEAL  345

Query  834   EMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMY  655
              ++  ML+  + P++ T   +L AC  + + +LG+ +H    K                 
Sbjct  346   ALFDLMLREKVTPNDVTFLGVLPACACLGALDLGKWVHAYVDKI----------------  389

Query  654   SSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMIS  475
               L   ++A              WT +I  Y++ G V  A  VF     +      +MIS
Sbjct  390   --LKGTDNASL------------WTSIIDMYAKCGCVEAAEQVFRSNGSRSLASRNAMIS  435

Query  474   GYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAI  295
             G+  N   +  L LF  M   G Q D+   V +LSAC   G +D+G   HRY   +    
Sbjct  436   GFAMNGHAERALALFEEMIKEGFQPDDITFVGVLSACTQAGLVDLG---HRYFSSMNQD-  491

Query  294   NVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQ  115
                               G++ KL +         +  MI   A  G  E A  +   MQ
Sbjct  492   -----------------FGISPKLQH---------YGCMIDLLARGGKFEEAKVMMGNMQ  525

Query  114   NDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
                   PDG  + SL  AC   G    G  + E++
Sbjct  526   ----MEPDGAIWGSLLNACRIHGQVEFGEYVAEQL  556



>ref|XP_010491225.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like 
[Camelina sativa]
Length=623

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/347 (39%), Positives = 208/347 (60%), Gaps = 7/347 (2%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNL--GNPT----YGWRIYERIQQPTICIVNTMIK  871
             HG +I     ++ F  SRLLA C D ++    PT    Y + I+ +IQ P + + N +I+
Sbjct  32    HGFLIRTHFISDVFVASRLLALCVDDSIIFNKPTNVSGYAYGIFSQIQYPNLFVFNLLIR  91

Query  870   AFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLM  691
              F    E +R    Y  ML + + PDN T P+L+KA   ME   +G   H Q ++FGF  
Sbjct  92    CFSTSAEPNRAFGFYTQMLNSRISPDNITFPFLIKASTEMECVTIGEQTHSQIVRFGFQN  151

Query  690   DSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETP  511
             D YV NSL+ MY++   + +A  +F +M  R VV+WT +++ Y + G V +AR +FDE P
Sbjct  152   DVYVENSLVHMYANSGLIAAAGRIFGQMRFRDVVSWTSMVAGYCKCGMVEDAREMFDEMP  211

Query  510   VKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKW  331
              ++   W  MI+GY +NNCF++ + LF +M+  G+ A+E ++VS++S+CAHLG+ + G  
Sbjct  212   HRNLFSWSIMINGYAKNNCFEKAIDLFEMMKREGLVANETVMVSVVSSCAHLGAFERGVR  271

Query  330   VHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGD  151
              H YV K  M +N+ LGTALVDMY +CG +  A  +F EL E+D + W+++I G A++G 
Sbjct  272   AHEYVVKHHMNVNLILGTALVDMYWRCGDIEKAICVFDELSEKDSLSWSSIIKGLAVHGH  331

Query  150   GENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
                A+  F +M    G  P  VTF ++ +ACS  G+  +GL++ E +
Sbjct  332   AHKAIHYFSQMVR-LGFIPRDVTFTAVLSACSHGGLVEKGLEIYEDM  377


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 60/284 (21%), Positives = 115/284 (40%), Gaps = 13/284 (5%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H Q++  G  N+ +  + L+   +  N G      RI+ +++   +    +M+  + 
Sbjct  138   EQTHSQIVRFGFQNDVYVENSLVHMYA--NSGLIAAAGRIFGQMRFRDVVSWTSMVAGYC  195

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
               G +    EM+  M    +    ++   ++              +     + G + +  
Sbjct  196   KCGMVEDAREMFDEMPHRNL----FSWSIMINGYAKNNCFEKAIDLFEMMKREGLVANET  251

Query  681   VGNSLIVMYSSLDDME----SAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDET  514
             V  S++   + L   E    + + V     +  ++  T L+  Y R GD+ +A  VFDE 
Sbjct  252   VMVSVVSSCAHLGAFERGVRAHEYVVKHHMNVNLILGTALVDMYWRCGDIEKAICVFDEL  311

Query  513   PVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
               KD   W S+I G   +    + +  F  M   G    +    ++LSAC+H G ++ G 
Sbjct  312   SEKDSLSWSSIIKGLAVHGHAHKAIHYFSQMVRLGFIPRDVTFTAVLSACSHGGLVEKGL  371

Query  333   WVHRYVEKLGMAINVRLGT--ALVDMYAKCGCLGLAQKLFYELP  208
              ++  + K+   I  RL     +VDM  + G L  A+    E+P
Sbjct  372   EIYEDM-KMVYGIEPRLEHYGCIVDMLGRAGKLAEAENFILEMP  414



>ref|NP_179644.1| mitochondrial editing factor 21 [Arabidopsis thaliana]
 sp|Q9SIL5.1|PP165_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g20540 
[Arabidopsis thaliana]
 gb|AAD25654.1| unknown protein [Arabidopsis thaliana]
 gb|AAY78689.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 gb|AEC07025.1| mitochondrial editing factor 21 [Arabidopsis thaliana]
Length=534

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/342 (36%), Positives = 202/342 (59%), Gaps = 4/342 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + +  +I  GL  ++F +++++ FC    + +  Y  R++ ++  P + + N++I+A+  
Sbjct  28    KINASIIIHGLSQSSFMVTKMVDFCD--KIEDMDYATRLFNQVSNPNVFLYNSIIRAYTH  85

Query  858   KGELSRTMEMYKHMLKTGM-CPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                    + +YK +L+     PD +T P++ K+C ++ SC LG+ +HG   KFG      
Sbjct  86    NSLYCDVIRIYKQLLRKSFELPDRFTFPFMFKSCASLGSCYLGKQVHGHLCKFGPRFHVV  145

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+LI MY   DD+  A  VFDEM  R V++W  L+S Y+R G + +A+ +F     K 
Sbjct  146   TENALIDMYMKFDDLVDAHKVFDEMYERDVISWNSLLSGYARLGQMKKAKGLFHLMLDKT  205

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MISGY    C+ E +  FR MQ+ G++ DE  L+S+L +CA LGSL++GKW+H 
Sbjct  206   IVSWTAMISGYTGIGCYVEAMDFFREMQLAGIEPDEISLISVLPSCAQLGSLELGKWIHL  265

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y E+ G      +  AL++MY+KCG +  A +LF ++  +DVI W+ MISG+A +G+   
Sbjct  266   YAERRGFLKQTGVCNALIEMYSKCGVISQAIQLFGQMEGKDVISWSTMISGYAYHGNAHG  325

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLE  16
             A+  F EMQ  A  +P+G+TF+ L +ACS  GM  EGL+  +
Sbjct  326   AIETFNEMQR-AKVKPNGITFLGLLSACSHVGMWQEGLRYFD  366



>ref|XP_002282128.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Vitis vinifera]
Length=537

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/351 (36%), Positives = 204/351 (58%), Gaps = 8/351 (2%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              + H  ++   L  ++F +++++  C+  + G   Y   +++ +  P   + N MI+A+ 
Sbjct  31    KKIHAHIVKFSLSQSSFLVTKMVDVCN--HYGETEYANLLFKGVADPNAFLYNAMIRAYK  88

Query  861   LKGELSRTMEMYKHML-----KTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGF  697
                     + +YK ML     +  + PD +T P+++K+C  +   +LG+ +HG   KFG 
Sbjct  89    HNKVYVLAITVYKQMLGNPHGENPIFPDKFTFPFVVKSCAGLMCYDLGKQVHGHVFKFGQ  148

Query  696   LMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDE  517
               ++ V NSL+ MY   D ++ A  VF+EM  R  V+W  LIS + R G +  AR +F+E
Sbjct  149   KSNTVVENSLVEMYVKCDSLDDAHRVFEEMTERDAVSWNTLISGHVRLGQMRRARAIFEE  208

Query  516   TPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIG  337
                K    W +++SGY +  C+ + L+ FR MQM G++ DE  LVS+L  CA LG+L++G
Sbjct  209   MQDKTIFSWTAIVSGYARIGCYADALEFFRRMQMVGIEPDEISLVSVLPDCAQLGALELG  268

Query  336   KWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMN  157
             KW+H Y +K G   N+ +  AL++MYAKCG +   ++LF ++ ERDVI W+ MI G A +
Sbjct  269   KWIHIYADKAGFLRNICVCNALIEMYAKCGSIDQGRRLFDQMKERDVISWSTMIVGLANH  328

Query  156   GDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             G    A+ LF+EMQ  A   P  +TFV L TAC+ +G+ +EGL+  E + R
Sbjct  329   GRAREAIELFQEMQK-AKIEPSIITFVGLLTACAHAGLLNEGLRYFESMKR  378


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/263 (25%), Positives = 107/263 (41%), Gaps = 45/263 (17%)
 Frame = -2

Query  774  LLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRC  595
            +LK C N+      + IH   +KF     S++                            
Sbjct  20   ILKDCPNIVEL---KKIHAHIVKFSLSQSSFL----------------------------  48

Query  594  VVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQM  415
                T ++   +  G+   A L+F      +  ++ +MI  Y  N  +   + +++  QM
Sbjct  49   ---VTKMVDVCNHYGETEYANLLFKGVADPNAFLYNAMIRAYKHNKVYVLAITVYK--QM  103

Query  414  TG-------VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYA  256
             G       +  D+     ++ +CA L   D+GK VH +V K G   N  +  +LV+MY 
Sbjct  104  LGNPHGENPIFPDKFTFPFVVKSCAGLMCYDLGKQVHGHVFKFGQKSNTVVENSLVEMYV  163

Query  255  KCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFV  76
            KC  L  A ++F E+ ERD + WN +ISG    G    A  +F EMQ+   T       V
Sbjct  164  KCDSLDDAHRVFEEMTERDAVSWNTLISGHVRLGQMRRARAIFEEMQDK--TIFSWTAIV  221

Query  75   SLFTACSCSGMAHEGLKLLEKIG  7
            S +    C   A E  + ++ +G
Sbjct  222  SGYARIGCYADALEFFRRMQMVG  244



>ref|XP_006450982.1| hypothetical protein CICLE_v10010823mg [Citrus clementina]
 gb|ESR64222.1| hypothetical protein CICLE_v10010823mg [Citrus clementina]
Length=736

 Score =   263 bits (673),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/331 (38%), Positives = 201/331 (61%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q+I  GL N  FALS+L+  C+    G+ +Y   ++E I++P   I N +I+   L
Sbjct  48    QVHSQIIKTGLHNTQFALSKLIEICAVSPFGDLSYALLVFETIREPNQVIWNNIIRGHSL  107

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    ++ Y  M+ +G  P+ YT P++LK+C  + + + G+ IH   LK G   D +V
Sbjct  108   SSSPVVAIKFYVRMILSGFVPNTYTFPFILKSCAKISAISEGKQIHAHVLKLGLESDPFV  167

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   ++ESA+ VF++   R  V++T LI+ Y+ +G + +AR +FDE PV+D 
Sbjct  168   HTSLINMYAQNGELESARLVFNKSSLRDAVSYTALITGYASRGYLDDARQLFDEMPVRDV  227

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY Q+  ++E L +F+ ++      +E+ +V++LSACAH+GSL++G WV   
Sbjct  228   VSWNAMIAGYAQSGRYEEALAIFQKIREENFVPNESTVVTVLSACAHMGSLELGNWVCSL  287

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E  G+  N+ +  AL+DMY+KCG L  A+ LF  + +RDVI WN MI G+    D + A
Sbjct  288   IEGHGLGSNLHVTNALIDMYSKCGGLVKARDLFESIEKRDVISWNVMIGGYTHTSDYKEA  347

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + LFR+M   +   P+ VTF+S+  AC+  G
Sbjct  348   LMLFRQMLQ-SNIEPNDVTFLSVLPACAYLG  377


 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/296 (31%), Positives = 154/296 (52%), Gaps = 33/296 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ +    +   N MI  +   G     + +++ + +    P+  T+  +L AC +M 
Sbjct  217  QLFDEMPVRDVVSWNAMIAGYAQSGRYEEALAIFQKIREENFVPNESTVVTVLSACAHMG  276

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LG  +       G   + +V N+LI MYS                 +C         
Sbjct  277  SLELGNWVCSLIEGHGLGSNLHVTNALIDMYS-----------------KC---------  310

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 G + +AR +F+    +D   W  MI GY   + +KE L LFR M  + ++ ++  
Sbjct  311  -----GGLVKARDLFESIEKRDVISWNVMIGGYTHTSDYKEALMLFRQMLQSNIEPNDVT  365

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKLGMAI-NVRLGTALVDMYAKCGCLGLAQKLFYEL  211
             +S+L ACA+LG+LD+GKW+H Y++K    + NV L T+L+DMYAKCG +  A+++F  +
Sbjct  366  FLSVLPACAYLGALDLGKWIHAYIDKNHQKLNNVSLWTSLIDMYAKCGNIKAAEQVFDGM  425

Query  210  PERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGM  43
              + +  WNAMISG AM+G  + A+ LF  M  + G +PD +TFV + +AC+ +G+
Sbjct  426  GYKTLASWNAMISGLAMHGKADKALSLFSRMIGE-GLQPDDITFVGVLSACNHAGL  480


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 135/307 (44%), Gaps = 39/307 (13%)
 Frame = -2

Query  1011  GLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTME  832
             GLG+N    + L+   S    G       ++E I++  +   N MI  +    +    + 
Sbjct  292   GLGSNLHVTNALIDMYS--KCGGLVKARDLFESIEKRDVISWNVMIGGYTHTSDYKEALM  349

Query  831   MYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLK-FGFLMDSYVGNSLIVMY  655
             +++ ML++ + P++ T   +L AC  + + +LG+ IH    K    L +  +  SLI MY
Sbjct  350   LFRQMLQSNIEPNDVTFLSVLPACAYLGALDLGKWIHAYIDKNHQKLNNVSLWTSLIDMY  409

Query  654   SSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMIS  475
             +   ++++A+ VFD M  + + +W                                +MIS
Sbjct  410   AKCGNIKAAEQVFDGMGYKTLASWN-------------------------------AMIS  438

Query  474   GYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK-WVHRYVEKLGMA  298
             G   +    + L LF  M   G+Q D+   V +LSAC H G LDIG+ + +  ++   ++
Sbjct  439   GLAMHGKADKALSLFSRMIGEGLQPDDITFVGVLSACNHAGLLDIGRQYFNAMIQDYKIS  498

Query  297   INVRLGTALVDMYAKCGCLGLAQKLFYELPER-DVICWNAMISGFAMNGD---GENAMRL  130
               ++    +VD+  + G    A+ L   +  + D   W +++    ++G    GE+  + 
Sbjct  499   PKLQHYGCMVDLLGRAGLFDEAEALLKTMEMKPDAAIWTSLLGACRVHGRLELGESVAKH  558

Query  129   FREMQND  109
               E++ +
Sbjct  559   LLELEPE  565



>emb|CDP14216.1| unnamed protein product [Coffea canephora]
Length=597

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/341 (36%), Positives = 203/341 (60%), Gaps = 4/341 (1%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H Q+I  GL ++   + R++ FC+     +  Y  +++  +  P   I NT+I+ +L
Sbjct  5     KQHHAQIIKLGLSSDNDTIGRVIKFCAISETKDLNYALKVFHTLPSPDPFIYNTIIRGYL  64

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                     +  Y  ML+  + P+N+T P L++AC    +   G+ +H   +K+GFL D +
Sbjct  65    QSNLPRNCITFYTKMLEDSVIPNNFTFPPLIRACCVDNAIQEGKQVHSHVIKYGFLSDGF  124

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+LI MY + +++E A+ VFD++  +  V+WT LI+ Y++ G + EA  VF+  PV  
Sbjct  125   AQNNLIHMYVNFNNLEDARRVFDKLAYKDDVSWTTLINGYAQLGCLDEAYKVFESMPVDK  184

Query  501   RR----VWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
             R+     W +MI+ YVQ++ F E  +LF  M++  V+ D+ +  S+LSAC  LG+L+ GK
Sbjct  185   RKNSAVSWNAMIAAYVQSSRFHEAFELFEKMRLENVKMDKFVAASMLSACIGLGALEQGK  244

Query  333   WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNG  154
             W+HRY+++  + ++ +L T ++DMY KCGCL  A ++F  L  + +  WN MI G A+NG
Sbjct  245   WIHRYIKESRIEVDSKLETTVIDMYCKCGCLDEAFEVFKGLESKGISSWNCMIGGLAING  304

Query  153   DGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
              G  A+ L +EM+ +    PD +TFVSL +AC+ SG+  EG
Sbjct  305   KGVAAIELLKEMEREKNVAPDYITFVSLLSACAHSGLVDEG  345


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 103/248 (42%), Gaps = 34/248 (14%)
 Frame = -2

Query  885  NTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLK  706
            N MI A++         E+++ M    +  D +    +L AC  + +   G+ IH     
Sbjct  193  NAMIAAYVQSSRFHEAFELFEKMRLENVKMDKFVAASMLSACIGLGALEQGKWIH-----  247

Query  705  FGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLV  526
                   Y+  S I + S L+                    T +I  Y + G + EA  V
Sbjct  248  ------RYIKESRIEVDSKLE--------------------TTVIDMYCKCGCLDEAFEV  281

Query  525  FDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQM-TGVQADEAILVSILSACAHLGS  349
            F     K    W  MI G   N      ++L + M+    V  D    VS+LSACAH G 
Sbjct  282  FKGLESKGISSWNCMIGGLAINGKGVAAIELLKEMEREKNVAPDYITFVSLLSACAHSGL  341

Query  348  LDIGKWVHRYV-EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPER-DVICWNAMI  175
            +D GK+  RY+ E  G+   +     +VD+  + G L  A+K+  E+P R DV    A++
Sbjct  342  VDEGKYYFRYMTEVYGIEPGMEHYGCMVDLLGRAGLLEEARKVIDEMPMRPDVGVLGALL  401

Query  174  SGFAMNGD  151
                ++G+
Sbjct  402  GACKIHGN  409



>ref|XP_010049068.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Eucalyptus grandis]
Length=533

 Score =   258 bits (660),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 130/346 (38%), Positives = 199/346 (58%), Gaps = 4/346 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H +++   L  + F  ++++  C     G+  Y   ++  +  P + + N +++A   
Sbjct  32    RVHARIVRRSLSQSNFLATKMVDVCD--RCGDLGYAISLFRSVAGPNVFLYNAIVRACAR  89

Query  858   KGELSRTMEMYKHMLKTG-MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                      +Y+ ML+ G + PD +T P+L+K+CG + S +LG  +H    KFG      
Sbjct  90    NFAYGLVFAVYREMLEDGKISPDEFTFPFLIKSCGGLGSEHLGSQVHAHVCKFGAAGQLV  149

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               NSLI MY+    +E A  VFDEMP R  V+W  LIS + R G+V  AR +FDE P K 
Sbjct  150   TENSLIDMYAKFGKLEDAYKVFDEMPQRDSVSWNGLISGHVRSGEVMRARELFDEMPCKT  209

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W ++ISGY Q  C+ + L++FR MQ  GV+ DE  +VS+L ACAHLG+L++GKW+H 
Sbjct  210   VVSWTTVISGYSQVGCYVDALEIFRQMQTVGVEPDEISIVSVLPACAHLGALEVGKWIHM  269

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y +K  +     +  AL++MYAKCGC+  A +LF E+  RDVI W+ MI   A +G    
Sbjct  270   YADKHRLLHRTCICNALMEMYAKCGCIKQASRLFNEMKTRDVISWSTMICSLANHGKAHE  329

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             A+ LF+ M+  AG  P+GVTF+   +AC  +G+  EG++L   + R
Sbjct  330   AIELFQAMRR-AGVDPNGVTFLGTLSACVHAGLVDEGMELFCSMKR  374


 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 61/277 (22%), Positives = 120/277 (43%), Gaps = 36/277 (13%)
 Frame = -2

Query  924  IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
            +++ +   T+    T+I  +   G     +E+++ M   G+ PD  ++  +L AC ++ +
Sbjct  201  LFDEMPCKTVVSWTTVISGYSQVGCYVDALEIFRQMQTVGVEPDEISIVSVLPACAHLGA  260

Query  744  CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
              +G+ IH    K   L  + + N+L+ MY        A+C                   
Sbjct  261  LEVGKWIHMYADKHRLLHRTCICNALMEMY--------AKC-------------------  293

Query  564  YSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAIL  385
                G + +A  +F+E   +D   W +MI     +    E ++LF+ M+  GV  +    
Sbjct  294  ----GCIKQASRLFNEMKTRDVISWSTMICSLANHGKAHEAIELFQAMRRAGVDPNGVTF  349

Query  384  VSILSACAHLGSLDIGKWVHRYVEK-LGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP  208
            +  LSAC H G +D G  +   +++   +  ++     L+D+  + GCL  A  +   +P
Sbjct  350  LGTLSACVHAGLVDEGMELFCSMKRDYELEPDIEHYGCLIDLLGRSGCLDQAMDVVQTMP  409

Query  207  ER-DVICWNAMISGFAMNGDGE---NAMRLFREMQND  109
             + D   W +++S    +G+ E    AM    E++ D
Sbjct  410  MKPDSKIWGSLLSSCRTHGNLEMAIAAMEHLIELEPD  446


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 57/122 (47%), Gaps = 3/122 (2%)
 Frame = -2

Query  396  EAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFY  217
            E + V  L +C ++  L   K VH  + +  ++ +  L T +VD+  +CG LG A  LF 
Sbjct  14   EDLFVPALRSCGNVAEL---KRVHARIVRRSLSQSNFLATKMVDVCDRCGDLGYAISLFR  70

Query  216  ELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAH  37
             +   +V  +NA++   A N        ++REM  D    PD  TF  L  +C   G  H
Sbjct  71   SVAGPNVFLYNAIVRACARNFAYGLVFAVYREMLEDGKISPDEFTFPFLIKSCGGLGSEH  130

Query  36   EG  31
             G
Sbjct  131  LG  132



>ref|XP_006475804.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Citrus sinensis]
Length=736

 Score =   263 bits (673),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/331 (38%), Positives = 201/331 (61%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q+I  GL N  FALS+L+  C+    G+ +Y   ++E I++P   I N +I+   L
Sbjct  48    QVHSQIIKTGLHNTQFALSKLIEICAVSPFGDLSYALLVFETIREPNQVIWNNIIRGHSL  107

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    ++ Y  M+ +G  P+ YT P++LK+C  + + + G+ IH   LK G   D +V
Sbjct  108   SSSPVVAIKFYVRMILSGFVPNTYTFPFILKSCAKISAISEGKQIHAHVLKLGLESDPFV  167

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   ++ESA+ VF++   R  V++T LI+ Y+ +G + +AR +FDE PV+D 
Sbjct  168   HTSLINMYAQNGELESARLVFNKSSLRDAVSYTALITGYASRGYLDDARQLFDEMPVRDV  227

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY Q+  ++E L +F+ ++      +E+ +V++LSACAH+GSL++G WV   
Sbjct  228   VSWNAMIAGYAQSGRYEEALAIFQKIREENFVPNESTVVTVLSACAHMGSLELGNWVCSL  287

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E  G+  N+ +  AL+DMY+KCG L  A+ LF  + +RDVI WN MI G+    D + A
Sbjct  288   IEGHGLGSNLHVTNALIDMYSKCGDLVKARDLFESIEKRDVISWNVMIGGYTHTSDYKEA  347

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + LFR+M   +   P+ VTF+S+  AC+  G
Sbjct  348   LMLFRQMLQ-SNIEPNDVTFLSVLPACAYLG  377


 Score =   167 bits (422),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/296 (31%), Positives = 155/296 (52%), Gaps = 33/296 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ +    +   N MI  +   G     + +++ + +    P+  T+  +L AC +M 
Sbjct  217  QLFDEMPVRDVVSWNAMIAGYAQSGRYEEALAIFQKIREENFVPNESTVVTVLSACAHMG  276

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LG  +       G   + +V N+LI MYS                 +C         
Sbjct  277  SLELGNWVCSLIEGHGLGSNLHVTNALIDMYS-----------------KC---------  310

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 GD+ +AR +F+    +D   W  MI GY   + +KE L LFR M  + ++ ++  
Sbjct  311  -----GDLVKARDLFESIEKRDVISWNVMIGGYTHTSDYKEALMLFRQMLQSNIEPNDVT  365

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKLGMAI-NVRLGTALVDMYAKCGCLGLAQKLFYEL  211
             +S+L ACA+LG+LD+GKW+H Y++K    + NV L T+L+DMYAKCG +  A+++F  +
Sbjct  366  FLSVLPACAYLGALDLGKWIHAYIDKNHQKLNNVSLWTSLIDMYAKCGNIKAAEQVFDGM  425

Query  210  PERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGM  43
              + +  WNAMISG AM+G  + A+ LF  M  + G +PD +TFV + +AC+ +G+
Sbjct  426  GYKTLASWNAMISGLAMHGKADKALSLFSRMIGE-GLQPDDITFVGVLSACNHAGL  480


 Score = 85.5 bits (210),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 136/307 (44%), Gaps = 39/307 (13%)
 Frame = -2

Query  1011  GLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTME  832
             GLG+N    + L+   S    G+      ++E I++  +   N MI  +    +    + 
Sbjct  292   GLGSNLHVTNALIDMYS--KCGDLVKARDLFESIEKRDVISWNVMIGGYTHTSDYKEALM  349

Query  831   MYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLK-FGFLMDSYVGNSLIVMY  655
             +++ ML++ + P++ T   +L AC  + + +LG+ IH    K    L +  +  SLI MY
Sbjct  350   LFRQMLQSNIEPNDVTFLSVLPACAYLGALDLGKWIHAYIDKNHQKLNNVSLWTSLIDMY  409

Query  654   SSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMIS  475
             +   ++++A+ VFD M  + + +W                                +MIS
Sbjct  410   AKCGNIKAAEQVFDGMGYKTLASWN-------------------------------AMIS  438

Query  474   GYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK-WVHRYVEKLGMA  298
             G   +    + L LF  M   G+Q D+   V +LSAC H G LDIG+ + +  ++   ++
Sbjct  439   GLAMHGKADKALSLFSRMIGEGLQPDDITFVGVLSACNHAGLLDIGRQYFNAMIQDYKIS  498

Query  297   INVRLGTALVDMYAKCGCLGLAQKLFYELPER-DVICWNAMISGFAMNGD---GENAMRL  130
               ++    +VD+  + G    A+ L   +  + D   W +++    ++G    GE+  + 
Sbjct  499   PKLQHYGCMVDLLGRAGLFDEAEALLKTMEMKPDAAIWTSLLGACRVHGRLELGESVAKH  558

Query  129   FREMQND  109
               E++ +
Sbjct  559   LLELEPE  565



>ref|XP_010546246.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305 
[Tarenaya hassleriana]
Length=544

 Score =   259 bits (661),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 132/343 (38%), Positives = 202/343 (59%), Gaps = 3/343 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H  +IT GL ++    SRLL+F +    GN  Y +     +  P++   N +++ F  
Sbjct  32    KTHALLITLGLSHDQPLSSRLLSFAALSASGNVDYAYAFLRALSNPSVSDWNAIVRGFSS  91

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                  +++ ++  ML++G+  D+ T P+L K+C  + +  LG SIHG   K G   D +V
Sbjct  92    GRNPEKSIRVFVQMLRSGVSADHMTFPFLAKSCSRLWNRELGGSIHGAVAKTGLEWDLFV  151

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSLI MY S  D+ S + +F+EMP + +V+W  ++  Y++ GD+  AR VFDE   +D 
Sbjct  152   CNSLIHMYGSFRDIASTRKLFEEMPVKNLVSWNSMLDGYAKCGDIVSARQVFDEMLERDV  211

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W SM+ GYV+++ + E L++F  M   G +A+E  +VS+  ACAHLG LD GK VHRY
Sbjct  212   VSWSSMVDGYVKSDDYDEALEIFDQMMEMGPKANEVTMVSVFCACAHLGVLDRGKTVHRY  271

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP--ERDVICWNAMISGFAMNGDGE  145
             V    + + + L T+LVDMYAKCG +  A  +F E+P  E DV+ WN+MI G A +G   
Sbjct  272   VIDESLPLTITLRTSLVDMYAKCGAIEEAWNVFREVPAGETDVLLWNSMIGGLANHGFIR  331

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLE  16
              ++ LFREM+ ++G  PD +TF+ L +ACS  G+  E     E
Sbjct  332   ESLELFREMR-ESGINPDEITFLCLLSACSHGGLVKEAWHFFE  373



>gb|KCW81521.1| hypothetical protein EUGRSUZ_C02882, partial [Eucalyptus grandis]
Length=527

 Score =   258 bits (660),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 130/346 (38%), Positives = 199/346 (58%), Gaps = 4/346 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H +++   L  + F  ++++  C     G+  Y   ++  +  P + + N +++A   
Sbjct  32    RVHARIVRRSLSQSNFLATKMVDVCD--RCGDLGYAISLFRSVAGPNVFLYNAIVRACAR  89

Query  858   KGELSRTMEMYKHMLKTG-MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                      +Y+ ML+ G + PD +T P+L+K+CG + S +LG  +H    KFG      
Sbjct  90    NFAYGLVFAVYREMLEDGKISPDEFTFPFLIKSCGGLGSEHLGSQVHAHVCKFGAAGQLV  149

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               NSLI MY+    +E A  VFDEMP R  V+W  LIS + R G+V  AR +FDE P K 
Sbjct  150   TENSLIDMYAKFGKLEDAYKVFDEMPQRDSVSWNGLISGHVRSGEVMRARELFDEMPCKT  209

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W ++ISGY Q  C+ + L++FR MQ  GV+ DE  +VS+L ACAHLG+L++GKW+H 
Sbjct  210   VVSWTTVISGYSQVGCYVDALEIFRQMQTVGVEPDEISIVSVLPACAHLGALEVGKWIHM  269

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y +K  +     +  AL++MYAKCGC+  A +LF E+  RDVI W+ MI   A +G    
Sbjct  270   YADKHRLLHRTCICNALMEMYAKCGCIKQASRLFNEMKTRDVISWSTMICSLANHGKAHE  329

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             A+ LF+ M+  AG  P+GVTF+   +AC  +G+  EG++L   + R
Sbjct  330   AIELFQAMRR-AGVDPNGVTFLGTLSACVHAGLVDEGMELFCSMKR  374


 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/277 (22%), Positives = 120/277 (43%), Gaps = 36/277 (13%)
 Frame = -2

Query  924  IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
            +++ +   T+    T+I  +   G     +E+++ M   G+ PD  ++  +L AC ++ +
Sbjct  201  LFDEMPCKTVVSWTTVISGYSQVGCYVDALEIFRQMQTVGVEPDEISIVSVLPACAHLGA  260

Query  744  CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
              +G+ IH    K   L  + + N+L+ MY        A+C                   
Sbjct  261  LEVGKWIHMYADKHRLLHRTCICNALMEMY--------AKC-------------------  293

Query  564  YSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAIL  385
                G + +A  +F+E   +D   W +MI     +    E ++LF+ M+  GV  +    
Sbjct  294  ----GCIKQASRLFNEMKTRDVISWSTMICSLANHGKAHEAIELFQAMRRAGVDPNGVTF  349

Query  384  VSILSACAHLGSLDIGKWVHRYVEK-LGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP  208
            +  LSAC H G +D G  +   +++   +  ++     L+D+  + GCL  A  +   +P
Sbjct  350  LGTLSACVHAGLVDEGMELFCSMKRDYELEPDIEHYGCLIDLLGRSGCLDQAMDVVQTMP  409

Query  207  ER-DVICWNAMISGFAMNGDGE---NAMRLFREMQND  109
             + D   W +++S    +G+ E    AM    E++ D
Sbjct  410  MKPDSKIWGSLLSSCRTHGNLEMAIAAMEHLIELEPD  446


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 57/122 (47%), Gaps = 3/122 (2%)
 Frame = -2

Query  396  EAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFY  217
            E + V  L +C ++  L   K VH  + +  ++ +  L T +VD+  +CG LG A  LF 
Sbjct  14   EDLFVPALRSCGNVAEL---KRVHARIVRRSLSQSNFLATKMVDVCDRCGDLGYAISLFR  70

Query  216  ELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAH  37
             +   +V  +NA++   A N        ++REM  D    PD  TF  L  +C   G  H
Sbjct  71   SVAGPNVFLYNAIVRACARNFAYGLVFAVYREMLEDGKISPDEFTFPFLIKSCGGLGSEH  130

Query  36   EG  31
             G
Sbjct  131  LG  132



>ref|XP_006342693.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Solanum tuberosum]
Length=628

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/337 (39%), Positives = 200/337 (59%), Gaps = 1/337 (0%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H Q++  GL  +  A+ R++ FC+    G+  Y  ++++R+ +P   I NT+I+  L
Sbjct  41    KQFHAQIVKHGLSYDNDAMGRVIKFCAISESGDLNYALQVFDRLPEPDPFIYNTVIRGLL  100

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                 L  ++  Y  ML+  + P+++T P L++ C    +   G+ IHG  +KFGF  D +
Sbjct  101   KSQMLRDSLLFYLCMLERSVWPNSFTFPPLIRVCCIDNAVEEGKQIHGHVVKFGFGFDRF  160

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+LI MY +   +E A+ VFD M  R  V+WT LIS Y++ G + EA  VFD    K 
Sbjct  161   SQNNLIHMYVNFRCLEEAKRVFDNMCERDDVSWTTLISGYAQLGYLDEAFQVFDSITEKS  220

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
               +W +MIS YVQ+N F E   LF  M   GV  D+ +  S+LSAC  LG+L  G+W+  
Sbjct  221   SVIWNAMISAYVQSNRFHEAFALFERMGSEGVVVDKFLAASMLSACTRLGALKQGEWIVE  280

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             +V+K G+ ++ +LG  ++DMY KCGCL  A + F ELP + +  WN MI G AM+G GE 
Sbjct  281   HVKKSGIELDSKLGATIIDMYCKCGCLDKAVEFFKELPRKGISSWNCMIGGLAMHGKGEA  340

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             A+ + +EM+++    PD +TFV+L +AC+ SG+  EG
Sbjct  341   AIEVLKEMESER-VAPDYITFVNLLSACAHSGLVEEG  376


 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/308 (21%), Positives = 118/308 (38%), Gaps = 61/308 (20%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSD-----------------------------PNL  949
              Q HG V+  G G + F+ + L+    +                               L
Sbjct  144   KQIHGHVVKFGFGFDRFSQNNLIHMYVNFRCLEEAKRVFDNMCERDDVSWTTLISGYAQL  203

Query  948   GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
             G     +++++ I + +  I N MI A++          +++ M   G+  D +    +L
Sbjct  204   GYLDEAFQVFDSITEKSSVIWNAMISAYVQSNRFHEAFALFERMGSEGVVVDKFLAASML  263

Query  768   KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
              AC  + +   G  I     K G  +DS +G ++I MY     ++ A   F E+P + + 
Sbjct  264   SACTRLGALKQGEWIVEHVKKSGIELDSKLGATIIDMYCKCGCLDKAVEFFKELPRKGIS  323

Query  588   AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
             +                               W  MI G   +   +  +++ + M+   
Sbjct  324   S-------------------------------WNCMIGGLAMHGKGEAAIEVLKEMESER  352

Query  408   VQADEAILVSILSACAHLGSLDIGKWVHRYV-EKLGMAINVRLGTALVDMYAKCGCLGLA  232
             V  D    V++LSACAH G ++ GK   RY+ E  G+   +     LVD+  + G L  A
Sbjct  353   VAPDYITFVNLLSACAHSGLVEEGKHYFRYMKETYGIEPGMEHYGCLVDLLGRAGLLVEA  412

Query  231   QKLFYELP  208
             +++  E+P
Sbjct  413   RRVINEMP  420



>ref|XP_007226779.1| hypothetical protein PRUPE_ppa018015mg [Prunus persica]
 gb|EMJ27978.1| hypothetical protein PRUPE_ppa018015mg [Prunus persica]
Length=624

 Score =   261 bits (666),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 130/344 (38%), Positives = 208/344 (60%), Gaps = 3/344 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H +VI  GL  +  A+ R++ FC+    G+  Y  ++++ +  P   I NT+++ +L 
Sbjct  38    QLHSKVIRLGLAADNDAMGRVIKFCALSKNGDLGYALQVFDTMLHPDAFIYNTVMRGYL-  96

Query  858   KGELSRT-MEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
             +  L R  + +Y  ML+  + P+ YT P +++AC N ++   G+ +H   +K G+  D +
Sbjct  97    QCHLPRNCIVLYSQMLQDSVTPNKYTFPSVIRACCNDDAIGEGKQVHAHVVKLGYGADGF  156

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+LI MY     +E A+ VFD+M     V+WT LI+ YS+ G V EA  +F+  P K+
Sbjct  157   CQNNLIHMYVKFQSLEEARRVFDKMLRMDAVSWTTLITGYSQCGFVDEAFELFELMPEKN  216

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MIS YVQ++ F E   LF+ M++  V+ D+ +  S+LSAC  LG+L+ GKW+H 
Sbjct  217   SVSWNAMISSYVQSDRFHEAFALFQKMRVEKVELDKFMAASMLSACTGLGALEQGKWIHG  276

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y+EK G+ ++ +L T ++DMY KCGCL  A ++F  LP + +  WN MI G AM+G GE 
Sbjct  277   YIEKSGIELDSKLATTIIDMYCKCGCLEKAFEVFNGLPHKGISSWNCMIGGLAMHGKGEA  336

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             A+ LF +MQ D    PD +TFV++ +AC+ SG+  EG +  + +
Sbjct  337   AIELFEKMQRDM-VAPDNITFVNVLSACAHSGLVEEGQRYFQSM  379


 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 65/284 (23%), Positives = 118/284 (42%), Gaps = 36/284 (13%)
 Frame = -2

Query  933  GWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGN  754
             + ++E + +      N MI +++          +++ M    +  D +    +L AC  
Sbjct  205  AFELFELMPEKNSVSWNAMISSYVQSDRFHEAFALFQKMRVEKVELDKFMAASMLSACTG  264

Query  753  MESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVL  574
            + +   G+ IHG   K G  +DS +  ++I MY     +E A  VF+ +P + + +    
Sbjct  265  LGALEQGKWIHGYIEKSGIELDSKLATTIIDMYCKCGCLEKAFEVFNGLPHKGISS----  320

Query  573  ISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADE  394
                                       W  MI G   +   +  ++LF  MQ   V  D 
Sbjct  321  ---------------------------WNCMIGGLAMHGKGEAAIELFEKMQRDMVAPDN  353

Query  393  AILVSILSACAHLGSLDIG-KWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFY  217
               V++LSACAH G ++ G ++    VE  G+         +VD+  + G L  A+KL  
Sbjct  354  ITFVNVLSACAHSGLVEEGQRYFQSMVEVHGIEPRKEHFGCMVDLLGRAGMLEEARKLIS  413

Query  216  ELP-ERDVICWNAMISGFAMNGD---GENAMRLFREMQNDAGTR  97
            E+P   DV    A++    ++G+   GE+  R+  E++ +   R
Sbjct  414  EMPMSPDVGVLGALLGACKIHGNVELGEHIGRIVIELEPENSGR  457



>ref|XP_006360941.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Solanum tuberosum]
Length=536

 Score =   258 bits (659),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 126/343 (37%), Positives = 200/343 (58%), Gaps = 3/343 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H Q++   L  +++ +++++  C D N G   Y   ++++++ P   + N++I+A+  
Sbjct  32    KIHAQIVKFSLSQSSYLVTKMVEIC-DKN-GEIEYAKLLFKQVEDPNNYLYNSIIRAYTH  89

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             K      + +YK M+   + PD YT P+++++C  +   ++G   H    KFG    + +
Sbjct  90    KQRYISCINVYKQMMICTISPDEYTYPFVIRSCSAILRVDVGEQFHVHVWKFGLYYSNVI  149

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSL+ MY   D M  A  VFDEM  R V++W  LI  + R   V +AR +FD  P K  
Sbjct  150   ANSLLDMYVKCDRMRDAHMVFDEMSDRDVISWNSLICGHVRLRQVRKARALFDVMPDKSI  209

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MISGY +  C+ + L +FR MQM GV+ D   LVS+L ACA LG+L++GKW+H Y
Sbjct  210   VSWTAMISGYTKTGCYGDALDVFRRMQMVGVKPDWISLVSVLPACAQLGALELGKWIHFY  269

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
              EK G      +  AL++MYAKCG +  A +LF ++ ERDVI W+ MI G A +G  + A
Sbjct  270   AEKYGYLRKTSVCNALMEMYAKCGSVNEAWQLFNQMSERDVISWSTMIGGLANHGRAQEA  329

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             ++LF EMQ  A   P+ +TFV L  AC+ +G+  +GL+  + +
Sbjct  330   LKLFHEMQRSA-VEPNEITFVGLLCACAHAGLCDDGLRYFDSM  371



>ref|XP_007035985.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOY06911.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=628

 Score =   260 bits (665),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 128/337 (38%), Positives = 199/337 (59%), Gaps = 1/337 (0%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H  +I  GL  +  A+ R++ FC+    G+  YG  +++ +  P   I NT+I+ +L
Sbjct  41    KQHHSHLIKLGLSADNDAMGRIIKFCAISENGHLDYGLHLFDTLPHPDAFIYNTLIRGYL  100

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
              + + +  +  Y  ML+  + P+ +T P L++AC    +   G  IH    KFGF  D++
Sbjct  101   QRQQPTHCILFYLQMLQHSVFPNKFTFPCLIRACSLANAIEQGSQIHAHVFKFGFAADTF  160

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+LI MY +   +E A+ VF+ MP+R VV+WT LIS Y++ G V EA  +F+    ++
Sbjct  161   CLNNLIHMYVNFQALEKARKVFEMMPTRDVVSWTTLISGYAQLGLVDEAFEIFELMQERN  220

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MI+ YVQ+N F E   LF  M+   V  D+ +  S+LSAC  LG+L+ GKW+H 
Sbjct  221   SVSWNAMIAAYVQSNRFHEAFALFNRMRAEKVVLDKFVAASMLSACTGLGALEQGKWIHG  280

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y++   + ++ +L T ++DMY KCGCL  A + F  L  R +  WN MI GFAM+G  E 
Sbjct  281   YIQDSRIELDAKLATTIIDMYCKCGCLEKAYETFKGLTCRGISSWNCMIGGFAMHGKWEA  340

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             A+ LF+EM+ + G  PD +TFV++ +AC+ SG+  EG
Sbjct  341   AIALFKEMEKE-GVAPDNITFVNILSACAHSGLVEEG  376


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 72/331 (22%), Positives = 125/331 (38%), Gaps = 64/331 (19%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSD-----------------------------PNL  949
             SQ H  V   G   +TF L+ L+    +                               L
Sbjct  144   SQIHAHVFKFGFAADTFCLNNLIHMYVNFQALEKARKVFEMMPTRDVVSWTTLISGYAQL  203

Query  948   GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
             G     + I+E +Q+      N MI A++          ++  M    +  D +    +L
Sbjct  204   GLVDEAFEIFELMQERNSVSWNAMIAAYVQSNRFHEAFALFNRMRAEKVVLDKFVAASML  263

Query  768   KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
              AC  + +   G+ IHG        +D+ +  ++I MY     +E A   F  +  R + 
Sbjct  264   SACTGLGALEQGKWIHGYIQDSRIELDAKLATTIIDMYCKCGCLEKAYETFKGLTCRGIS  323

Query  588   AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
             +W                                 MI G+  +  ++  + LF+ M+  G
Sbjct  324   SWNC-------------------------------MIGGFAMHGKWEAAIALFKEMEKEG  352

Query  408   VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGT--ALVDMYAKCGCLGL  235
             V  D    V+ILSACAH G ++ G++   Y+ ++  AI  R+     +VD+  + G L  
Sbjct  353   VAPDNITFVNILSACAHSGLVEEGRYYFHYMTEV-HAIERRMEHYGCMVDLLGRAGLLDD  411

Query  234   AQKLFYELP-ERDVICWNAMISGFAMNGDGE  145
             A+KL  ++P   DV    A+     ++G+ E
Sbjct  412   AKKLIDQMPMSPDVGVLGALFGACRIHGNIE  442



>ref|XP_010047809.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Eucalyptus grandis]
Length=736

 Score =   262 bits (670),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/329 (38%), Positives = 204/329 (62%), Gaps = 1/329 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q++  GL N  FALS+L+ FC+    G+ +Y   ++E I++P   I NT+I+   L
Sbjct  48    QIHCQIVKSGLHNTQFALSKLIEFCAVSPSGDLSYAVSLFESIEEPNQLIWNTIIRGHCL  107

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    +++Y  ML  G  P++YT P+LLK+C      + G+ IH   LK G   D++V
Sbjct  108   SAAPGLAIDIYVQMLLRGAMPNSYTFPFLLKSCAKAGLTHEGKQIHSHVLKLGLESDAFV  167

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   +++SA  VF++   R VV++T L++ Y+  G + EA+ +F++ PV+D 
Sbjct  168   HTSLISMYAQSGELDSAHLVFEKSSYRDVVSYTALLTGYASSGQMNEAKQLFEDIPVRDA  227

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY +   F+E ++ FR MQ   V  +E+ +V++LSAC   GS+++GKW+HR+
Sbjct  228   VSWNAMIAGYSECGQFEEAIETFRGMQKVNVMPNESTMVTVLSACPPSGSVELGKWMHRW  287

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E  G+  N RL  AL+DMY+KCG + +A+ LF  + ++DV+ WN MI G++     + A
Sbjct  288   IEDHGVGSNTRLVNALIDMYSKCGDVEIARGLFDGMSQKDVVSWNVMIGGYSHMNCYKEA  347

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSC  52
             + LFREM   +   P+ VTF+++  +C+C
Sbjct  348   LVLFREMLK-SNVEPNDVTFLNVLPSCAC  375


 Score =   160 bits (405),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 97/295 (33%), Positives = 151/295 (51%), Gaps = 33/295 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            +++E I        N MI  +   G+    +E ++ M K  + P+  T+  +L AC    
Sbjct  217  QLFEDIPVRDAVSWNAMIAGYSECGQFEEAIETFRGMQKVNVMPNESTMVTVLSACPPSG  276

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LG+ +H      G   ++ + N+LI MYS                 +C         
Sbjct  277  SVELGKWMHRWIEDHGVGSNTRLVNALIDMYS-----------------KC---------  310

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 GDV  AR +FD    KD   W  MI GY   NC+KE L LFR M  + V+ ++  
Sbjct  311  -----GDVEIARGLFDGMSQKDVVSWNVMIGGYSHMNCYKEALVLFREMLKSNVEPNDVT  365

Query  387  LVSILSACAHLGSLDIGKWVHRYVEK-LGMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
             +++L +CA L +LD+GKW+H Y+ +    + N  L T+L+DMYAKCG +  A+++F  +
Sbjct  366  FLNVLPSCACLCALDLGKWIHTYINRNFKSSTNTALYTSLIDMYAKCGNVEAAEQVFNGM  425

Query  210  PERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
              + +  WNAMISG A++G+ E A+  F  M N+ G  PD +TFV + +AC+ +G
Sbjct  426  KCKSLSSWNAMISGLAVHGEVEKALGFFSRMVNE-GLEPDDITFVGVLSACNHAG  479


 Score = 76.6 bits (187),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 67/313 (21%), Positives = 136/313 (43%), Gaps = 37/313 (12%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKG  853
             H  +   G+G+NT  ++ L+   S    G+      +++ + Q  +   N MI  +    
Sbjct  285   HRWIEDHGVGSNTRLVNALIDMYS--KCGDVEIARGLFDGMSQKDVVSWNVMIGGYSHMN  342

Query  852   ELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGN  673
                  + +++ MLK+ + P++ T   +L +C  + + +LG+ IH       ++  ++  +
Sbjct  343   CYKEALVLFREMLKSNVEPNDVTFLNVLPSCACLCALDLGKWIHT------YINRNFKSS  396

Query  672   SLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRV  493
             +   +Y+SL DM                        Y++ G+V  A  VF+    K    
Sbjct  397   TNTALYTSLIDM------------------------YAKCGNVEAAEQVFNGMKCKSLSS  432

Query  492   WGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK-WVHRYV  316
             W +MISG   +   ++ L  F  M   G++ D+   V +LSAC H GSL++ + +    +
Sbjct  433   WNAMISGLAVHGEVEKALGFFSRMVNEGLEPDDITFVGVLSACNHAGSLELARSYFSSMI  492

Query  315   EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPER-DVICWNAMISGFAMNGD---G  148
             +   ++  ++    ++D+  K G    A+ L   +  + D   W +++     +G    G
Sbjct  493   QDYRISPKLQHYGCVIDLMGKNGLFDEAEALIESMNVKPDGAIWGSLLEACRAHGKVELG  552

Query  147   ENAMRLFREMQND  109
             E   R   E++ D
Sbjct  553   ETFARHLFELEPD  565



>ref|XP_008390483.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Malus domestica]
Length=627

 Score =   260 bits (664),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 131/338 (39%), Positives = 207/338 (61%), Gaps = 3/338 (1%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H QVI  GL  +  A+ R++ FC+    G+  Y  ++++ + QP   I NT+++ +L
Sbjct  40    KQLHSQVIRLGLAADNDAMGRVIKFCALSKNGDLGYALQVFDAMPQPDAFIYNTVMRGYL  99

Query  861   LKGELSRT-MEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDS  685
              + +L R  + +Y  ML+  + P+ +T P +++AC    +   G+ +H   +K GF  D 
Sbjct  100   -QYQLPRDCIVLYSQMLQDFVTPNRFTFPSVVRACCADGAVGEGKQVHAHVVKLGFGDDG  158

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
             +  N+LI MY     ++ A+ VFD+MP   VV+WT LI+ YS+ G V EA  +F+  P K
Sbjct  159   FCQNNLIHMYVKFQSLDEARRVFDKMPRVDVVSWTTLIAGYSQWGFVDEAFEMFELMPEK  218

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             +   W +MIS YVQ++ F E   LF+ M++  V+ D+ +  S+LSAC  LG+L+ GKW+H
Sbjct  219   NSVSWNAMISSYVQSDRFHEAFALFQRMRVENVELDKFMAASMLSACTGLGALEQGKWIH  278

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
              Y+EK G+ ++ +L T ++DMY KCGCL  A ++F  LP + +  WN MI G AM+G GE
Sbjct  279   GYIEKSGIELDSKLATTIIDMYCKCGCLEKAFEVFNGLPRKGISSWNCMIGGLAMHGKGE  338

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
              A+ LF +MQ D    PD +TFV++ +AC+ SG+  +G
Sbjct  339   AAVELFEQMQRDM-VAPDNITFVNVLSACAHSGLVEKG  375


 Score = 76.3 bits (186),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 109/265 (41%), Gaps = 33/265 (12%)
 Frame = -2

Query  933  GWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGN  754
             + ++E + +      N MI +++          +++ M    +  D +    +L AC  
Sbjct  208  AFEMFELMPEKNSVSWNAMISSYVQSDRFHEAFALFQRMRVENVELDKFMAASMLSACTG  267

Query  753  MESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVL  574
            + +   G+ IHG   K G  +DS +  ++I MY     +E A  VF+ +P + + +    
Sbjct  268  LGALEQGKWIHGYIEKSGIELDSKLATTIIDMYCKCGCLEKAFEVFNGLPRKGISS----  323

Query  573  ISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADE  394
                                       W  MI G   +   +  ++LF  MQ   V  D 
Sbjct  324  ---------------------------WNCMIGGLAMHGKGEAAVELFEQMQRDMVAPDN  356

Query  393  AILVSILSACAHLGSLDIGKWVHR-YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFY  217
               V++LSACAH G ++ G+   R  VE  G+         +VD+  + G L  A+KL  
Sbjct  357  ITFVNVLSACAHSGLVEKGQQYFRCMVEVHGIEPRTEHFGCMVDLLGRAGRLEEARKLIN  416

Query  216  ELP-ERDVICWNAMISGFAMNGDGE  145
            E+P   DV    A++    ++G+ E
Sbjct  417  EMPMSPDVGVLGALLGACKIHGNVE  441



>ref|XP_011071469.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 
isoform X1 [Sesamum indicum]
Length=733

 Score =   262 bits (670),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 200/332 (60%), Gaps = 3/332 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q I  GL N  FALS+L+ FC+    GN +Y   I+  I  P   I N MI+   L
Sbjct  45    QIHSQFIKFGLHNTQFALSKLIEFCAVSPYGNLSYAMSIFNSIHDPNHVIYNMMIRGSSL  104

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    ++ Y +ML  G+ P++YT P+L K+C  + + + G+ IHGQ  KFG   D+YV
Sbjct  105   SSSPRLALDYYINMLIFGLQPNSYTFPFLFKSCTKLLTAHTGKQIHGQVFKFGLEDDAYV  164

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   +++ A+ VFD+   R  V++T LI+ Y  +G V +AR +FD  P++D 
Sbjct  165   HTSLINMYAQHGNLDDARKVFDKSTFRDPVSFTALITGYISRGYVDKARELFDAIPLRDV  224

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MISGY Q     + L LF+ M+   V  D + L+S+LSACA LG+++ G WV  +
Sbjct  225   VSWNAMISGYAQIGRSVDALSLFQEMRKAKVSPDLSTLLSVLSACARLGAIETGTWVRSW  284

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E+ G   N+RL  A++DMYAKCG L +A+ LF  + E+D++ WN MI G+A   + ++A
Sbjct  285   IEEHGHGSNLRLVNAMIDMYAKCGDLNMARSLFNSIQEKDLVSWNVMIGGYAHMNEYKDA  344

Query  138   MRLFREMQ-NDAGTRPDGVTFVSLFTACSCSG  46
             + +FR MQ ND    P+ VTF+++  AC+  G
Sbjct  345   LEIFRLMQLND--VEPNDVTFLNVIPACAHLG  374


 Score =   170 bits (430),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/300 (32%), Positives = 155/300 (52%), Gaps = 33/300 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
             +++ I    +   N MI  +   G     + +++ M K  + PD  TL  +L AC  + 
Sbjct  214  ELFDAIPLRDVVSWNAMISGYAQIGRSVDALSLFQEMRKAKVSPDLSTLLSVLSACARLG  273

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            +   G  +     + G   +  + N++I MY        A+C                  
Sbjct  274  AIETGTWVRSWIEEHGHGSNLRLVNAMIDMY--------AKC------------------  307

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 GD+  AR +F+    KD   W  MI GY   N +K+ L++FRLMQ+  V+ ++  
Sbjct  308  -----GDLNMARSLFNSIQEKDLVSWNVMIGGYAHMNEYKDALEIFRLMQLNDVEPNDVT  362

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKLGMAI-NVRLGTALVDMYAKCGCLGLAQKLFYEL  211
             ++++ ACAHLG+LD+GKW+H+Y+EK      N  L T+L++MYAKCG +  A+++FY L
Sbjct  363  FLNVIPACAHLGALDLGKWMHKYIEKHYQDFPNEMLWTSLINMYAKCGNIEAAKQIFYSL  422

Query  210  PERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
              + +  WN MISG AM+GD   A+ LF EM  + G +PD +TFV + +AC  +G+   G
Sbjct  423  QTKSLGSWNVMISGLAMHGDAYRAIELFSEMTKE-GFQPDDITFVGVLSACCHAGLVDLG  481


 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 70/315 (22%), Positives = 132/315 (42%), Gaps = 43/315 (14%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + HG      L N   A+  + A C D N+        ++  IQ+  +   N MI  +  
Sbjct  286   EEHGHGSNLRLVN---AMIDMYAKCGDLNMAR-----SLFNSIQEKDLVSWNVMIGGYAH  337

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               E    +E+++ M    + P++ T   ++ AC ++ + +LG+ +H    K         
Sbjct  338   MNEYKDALEIFRLMQLNDVEPNDVTFLNVIPACAHLGALDLGKWMHKYIEKH--------  389

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
                                 + + P+  +  WT LI+ Y++ G++  A+ +F     K  
Sbjct  390   --------------------YQDFPNEML--WTSLINMYAKCGNIEAAKQIFYSLQTKSL  427

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKW-VHR  322
               W  MISG   +      ++LF  M   G Q D+   V +LSAC H G +D+G+   + 
Sbjct  428   GSWNVMISGLAMHGDAYRAIELFSEMTKEGFQPDDITFVGVLSACCHAGLVDLGRECFNS  487

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP-ERDVICWNAMISGFAMNGD--  151
              ++   ++  ++    +VD+ A+ G    A  L   +  E D   W +++    ++ +  
Sbjct  488   MIQDFNISPQLQHYGCMVDLLARSGLFDEAVALVERMGIEPDGAIWGSILGACRIHKNLE  547

Query  150   -GENAMRLFREMQND  109
              GE A R   E++ D
Sbjct  548   LGEYAARKLFELEPD  562



>ref|XP_004247963.2| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Solanum lycopersicum]
Length=536

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/343 (36%), Positives = 199/343 (58%), Gaps = 3/343 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H Q++   L  +++ +++++  C    +G   Y   ++++++ P   + N++I+A+  
Sbjct  32    KIHAQIVKFSLTQSSYLVTKMVEICD--KIGEIEYANLLFKQVEHPNNYLYNSIIRAYTH  89

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             K      + +YK M+   + PD YT P+++++C  +   ++G   H    KFG    + +
Sbjct  90    KHRYISCINVYKQMMTCAISPDEYTYPFVIRSCSAILRVDVGEQFHVHVCKFGLYCSNVI  149

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSL+ MY   D M  A  VFDEM  R V++W  LI  + R   V +AR +FD  P K  
Sbjct  150   ANSLLDMYVKCDRMRDAHMVFDEMSDRDVISWNSLICGHVRLRQVRKARALFDVMPDKSI  209

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MISGY +  C+ + L +FR MQM GV+ D   LVS+L ACA LG+L++GKW+H Y
Sbjct  210   VSWTAMISGYTKTGCYGDALDVFRRMQMVGVKPDWISLVSVLPACAQLGALELGKWIHFY  269

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
              +K G      +  AL++MYAKCG +  A +LF ++ ERDVI W+ MI G A +G  + A
Sbjct  270   ADKYGYLRKTSVCNALMEMYAKCGSVNEAWQLFNQMSERDVISWSTMIGGLANHGRAQEA  329

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             ++LF EMQ  A   P+ +TFV L  AC+ +G+  +GL+  + +
Sbjct  330   LKLFHEMQRSA-VEPNEITFVGLLCACAHAGLCDDGLRYFDSM  371



>emb|CDX78334.1| BnaA03g02460D [Brassica napus]
Length=533

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/349 (39%), Positives = 205/349 (59%), Gaps = 4/349 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H  +IT GL       SR L+F +    G+  Y +R   R+  P     N +I+ F  
Sbjct  27    KTHALLITLGLSEEEPFASRALSFSALSPSGDVDYAYRFLTRLPNPPAFSWNFVIRGFSN  86

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                  RT+  Y  ML+ G  PD+ T P+LLK+   + +  LG S+H   +K GF+ D Y+
Sbjct  87    SKTPERTIRAYIQMLRNGFSPDHMTYPFLLKSNSRLMNRKLGGSLHSSVVKNGFVWDLYI  146

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSLI MY SL D  SA+ VFDEMP + +V W  ++  Y++ GDV  AR VFDE   +D 
Sbjct  147   CNSLIHMYGSLRDSVSARKVFDEMPDKNLVTWNSILDGYAKCGDVVSARQVFDEMTERDV  206

Query  498   RVWGSMISGYVQNNCFKEGLQLF-RLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
               W SM+ GYV++  + E L++F  +M+++ ++A+E  +VS+L ACAHLG+L+ GK VHR
Sbjct  207   VSWSSMVDGYVKSGEYSEALEVFDEMMRVSNIKANEVTMVSVLCACAHLGALNRGKAVHR  266

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLF--YELPERDVICWNAMISGFAMNGDG  148
             Y+    + + V L T+L+DMYAK G +G A  +F    + ERDV+ WNAMI G A +G  
Sbjct  267   YIVDKHLHLTVMLQTSLIDMYAKSGSIGDAWGVFCGANVEERDVLMWNAMIGGLASHGFI  326

Query  147   ENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGRA  1
               +++LF +MQ ++   PD +TF+ L  ACS  G+  E   L + + ++
Sbjct  327   RESLQLFHKMQ-ESEFEPDEITFLCLLAACSHGGLVKEAWHLFKSLEKS  374


 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 123/274 (45%), Gaps = 35/274 (13%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLK-TGMCPDNYTLPYL  772
            G+     ++++ + +  +   ++M+  ++  GE S  +E++  M++ + +  +  T+  +
Sbjct  189  GDVVSARQVFDEMTERDVVSWSSMVDGYVKSGEYSEALEVFDEMMRVSNIKANEVTMVSV  248

Query  771  LKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCV  592
            L AC ++ + N G+++H                               + + D+     V
Sbjct  249  LCACAHLGALNRGKAVH-------------------------------RYIVDKHLHLTV  277

Query  591  VAWTVLISRYSRKGDVFEARLVFDETPVKDRRV--WGSMISGYVQNNCFKEGLQLFRLMQ  418
            +  T LI  Y++ G + +A  VF    V++R V  W +MI G   +   +E LQLF  MQ
Sbjct  278  MLQTSLIDMYAKSGSIGDAWGVFCGANVEERDVLMWNAMIGGLASHGFIRESLQLFHKMQ  337

Query  417  MTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLG  238
             +  + DE   + +L+AC+H G +     + + +EK G          +VD+ ++ G + 
Sbjct  338  ESEFEPDEITFLCLLAACSHGGLVKEAWHLFKSLEKSGAEPKSEHYACMVDVLSRAGLVK  397

Query  237  LAQKLFYELP-ERDVICWNAMISGFAMNGDGENA  139
             A     E+P E       A+++G   +GD E A
Sbjct  398  DAYGFISEMPMEPTGSMLGALLNGCINHGDWELA  431



>ref|XP_010467800.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Camelina sativa]
Length=534

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/342 (35%), Positives = 201/342 (59%), Gaps = 4/342 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H  +I  GL  ++F +++++  C    +G+  Y  R++ ++  P + + N++I+A+  
Sbjct  28    KIHACIIIHGLSQSSFMVTKMVDSCD--KIGDMEYATRLFNQVSNPNVFLYNSIIRAYTH  85

Query  858   KGELSRTMEMYKHMLKTGM-CPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                    +  Y+ +L+  +  PD +T P++ K+C ++ SC LG+ +HG   K G   +  
Sbjct  86    HSLYCEVIRTYRQLLRKSIELPDRFTFPFMFKSCASLGSCYLGKQVHGHLCKIGPKFNVV  145

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+LI MY   DD+  A  VFD+M  R V++W  L+S Y+R G + +A+ +F     K 
Sbjct  146   TENALIDMYMKFDDLADAHKVFDDMSERDVISWNSLLSGYARIGQMKKAKGLFHLMTDKT  205

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MISGY    C+ E +  FR MQ+ G++ DE  L+S+L +CAHLGSL++GKW+H 
Sbjct  206   IVSWTAMISGYTGIGCYVEAMDFFREMQLAGIEPDEISLISVLPSCAHLGSLELGKWIHM  265

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y E+ G      +  AL++MY+KCG +  A +LF ++  +DVI W+ MISG+A +G+   
Sbjct  266   YAERRGFLKQTGVCNALIEMYSKCGMISQAIQLFDQMKRKDVISWSTMISGYAHHGNAHG  325

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLE  16
             A+  F  MQ  A  +P+G+TF+ L +ACS  G+  EGL   +
Sbjct  326   AIETFNGMQR-AKVKPNGITFIGLLSACSHVGLWQEGLTYFD  366



>emb|CDP18487.1| unnamed protein product [Coffea canephora]
Length=533

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/349 (38%), Positives = 203/349 (58%), Gaps = 8/349 (2%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              + H Q+I   L  + F +++++  C    +G   Y   ++ ++ +P I + N +I+A+ 
Sbjct  22    KRVHSQMIKFSLAQSNFLVTKMVDICV--QIGEIQYASLLFRQVLEPNIFLCNAIIRAYT  79

Query  861   LKGELSRTMEMYKHMLKTG-----MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGF  697
              K     T+ +YK MLK       + PD +T P++L++CG + +  LG+ +HG   K+G 
Sbjct  80    NKQMYLLTINVYKQMLKQPQGEEPIFPDKFTYPFVLRSCGGLLNVCLGKQVHGHVCKYGL  139

Query  696   LMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDE  517
               +  + NS++ MY   DDM  A  +FDEM  R V++W  LIS + + G +  AR +FDE
Sbjct  140   RSNRVIENSMLDMYVKCDDMREAHKLFDEMGERDVISWNSLISGHIKLGHLRRARSLFDE  199

Query  516   TPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIG  337
              P K+   W +MISGY +  C+ + L +FR MQM GV+ D   LV++L ACA LG+L++G
Sbjct  200   MPNKNIVSWTAMISGYTKLGCYGDALDVFRRMQMVGVEPDWISLVAVLPACAQLGALEVG  259

Query  336   KWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMN  157
             KW+H Y EK G      +  AL++MYAKCG L  A +LF  + ERDVI W+ MI   A +
Sbjct  260   KWIHFYAEKKGFLRKTCVCNALIEMYAKCGSLNEAWQLFDWISERDVISWSTMIGALANH  319

Query  156   GDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             G    A+ LF EM   A   P+ +TFV L +AC  +G+ +EGL+  + +
Sbjct  320   GRANEAIELFEEMIR-ARVEPNEITFVGLLSACGHAGLLNEGLRYFDSM  367


 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 110/265 (42%), Gaps = 39/265 (15%)
 Frame = -2

Query  951  LGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYL  772
            LG+      +++ +    I     MI  +   G     +++++ M   G+ PD  +L  +
Sbjct  187  LGHLRRARSLFDEMPNKNIVSWTAMISGYTKLGCYGDALDVFRRMQMVGVEPDWISLVAV  246

Query  771  LKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCV  592
            L AC  + +  +G+ IH    K GFL  + V N+LI MY        A+C          
Sbjct  247  LPACAQLGALEVGKWIHFYAEKKGFLRKTCVCNALIEMY--------AKC----------  288

Query  591  VAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMT  412
                         G + EA  +FD    +D   W +MI     +    E ++LF  M   
Sbjct  289  -------------GSLNEAWQLFDWISERDVISWSTMIGALANHGRANEAIELFEEMIRA  335

Query  411  GVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTA----LVDMYAKCGC  244
             V+ +E   V +LSAC H G L+ G    RY + +     +  G      LVD+  + GC
Sbjct  336  RVEPNEITFVGLLSACGHAGLLNEGL---RYFDSMRNNHTIEPGIEHYGCLVDLLGRTGC  392

Query  243  LGLAQKLFYELP-ERDVICWNAMIS  172
            L  A KL   +P   D   W +++S
Sbjct  393  LERALKLIKSMPMAPDSAIWGSLLS  417


 Score = 76.6 bits (187),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 66/269 (25%), Positives = 117/269 (43%), Gaps = 44/269 (16%)
 Frame = -2

Query  795  DNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVF  616
            ++  LP +L+ C NM      + +H Q +KF     +++   ++ +           CV 
Sbjct  5    EDMLLP-MLRNCKNMSHL---KRVHSQMIKFSLAQSNFLVTKMVDI-----------CV-  48

Query  615  DEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQ  436
                               + G++  A L+F +    +  +  ++I  Y     +   + 
Sbjct  49   -------------------QIGEIQYASLLFRQVLEPNIFLCNAIIRAYTNKQMYLLTIN  89

Query  435  LFRLMQMTGVQADEAILVS------ILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTA  274
            +++ M +   Q +E I         +L +C  L ++ +GK VH +V K G+  N  +  +
Sbjct  90   VYKQM-LKQPQGEEPIFPDKFTYPFVLRSCGGLLNVCLGKQVHGHVCKYGLRSNRVIENS  148

Query  273  LVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRP  94
            ++DMY KC  +  A KLF E+ ERDVI WN++ISG    G    A  LF EM N      
Sbjct  149  MLDMYVKCDDMREAHKLFDEMGERDVISWNSLISGHIKLGHLRRARSLFDEMPNKNIV--  206

Query  93   DGVTFVSLFTACSCSGMAHEGLKLLEKIG  7
                 +S +T   C G A +  + ++ +G
Sbjct  207  SWTAMISGYTKLGCYGDALDVFRRMQMVG  235



>ref|XP_008797556.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 
[Phoenix dactylifera]
Length=779

 Score =   263 bits (671),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 136/347 (39%), Positives = 204/347 (59%), Gaps = 3/347 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLA-FCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             Q H ++I  GL  +    SRLL   C   + G+ TY   ++ERIQ P   + NTMI++  
Sbjct  190   QVHARMIKTGLILDAIPASRLLVGLCGASDAGSLTYALMVFERIQNPNTFMWNTMIRSLS  249

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNL-GRSIHGQCLKFGFLMDS  685
                     + +Y  ML   +  ++YT P+LLKAC N+ S     + IH   +K GF +++
Sbjct  250   NGSNPEEAILLYSQMLHDAVPHNSYTFPFLLKACANLPSAAAETQQIHCHIIKTGFALEA  309

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
                NSL+ +Y+    + SA  +FD +P R  V+W  +I+ Y+R G +  AR +FD+   K
Sbjct  310   CTTNSLLHVYAKSGSILSASQLFDSIPCRDTVSWNSMINGYARSGKIEMARELFDQMENK  369

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             +   W +MI+GYV+N   KE L+LFR MQ   ++ D   L S+L+ACAHLG+LD G+W+H
Sbjct  370   NIISWTTMIAGYVENCLCKEALELFREMQAMDIEPDTVALASVLTACAHLGALDQGRWIH  429

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
              YV+K  + ++  L   L+DM+AKCG L  A  +F    ER+V  W AMI+GFA +G G 
Sbjct  430   AYVKKKQIGLDPVLRCVLMDMFAKCGELDEALAVFRNTKERNVCMWTAMIAGFAAHGQGR  489

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
              A+ LF +M+   G +P+G+TF  + TACS +GM  EG  + E+I +
Sbjct  490   EALDLFADMER-TGIKPNGITFTGVLTACSYAGMVEEGKSIFERIAK  535



>ref|XP_010680017.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26630, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=417

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/343 (39%), Positives = 201/343 (59%), Gaps = 4/343 (1%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             +Q H ++I   L +N    ++LL   S  + GN  Y   I+  I  P+    N +I+A  
Sbjct  34    TQIHAKIIRSNLTSNHLVATQLLRLYS--SYGNLNYATSIFHHIPSPSTFTWNLIIRAHT  91

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFL-MDS  685
             + G  S+++ +Y  M+ TG+ PD +T P++LKAC    +   G+ +H   +K G+   D 
Sbjct  92    INGSSSQSLILYNLMICTGVAPDKFTFPFVLKACAVTSAVEKGKEVHAMAIKTGYYGRDM  151

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
             +V N+L+ MY   D +E A+ VFDEMP R VV+ T ++S     G++  AR +FDE PV+
Sbjct  152   FVKNTLLNMYLKCDHLECARKVFDEMPVRNVVSLTTMVSGLIECGELDCARRLFDEMPVR  211

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             +   W +MI+GYV N   +E  +LF  MQ+ GV+ +E  LVS+L AC  LGSL++G WVH
Sbjct  212   NVVSWTAMINGYVANGRPQEAFELFSEMQVEGVRPNEFTLVSLLRACIELGSLELGSWVH  271

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
              Y  K G  + V LGTAL+DMY+KCG L  A+K+F  +  R +  WN+MIS   ++G G+
Sbjct  272   DYAIKNGFELGVYLGTALLDMYSKCGSLEEARKVFDMMERRSLATWNSMISSLGVHGCGD  331

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLE  16
              A+ LF EM  +    PD +TFV + +AC  +    EGL   +
Sbjct  332   EALALFEEMMEE-NVMPDAITFVGVLSACIQTHRVDEGLNYFD  373



>gb|KHN44997.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=593

 Score =   258 bits (660),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/340 (40%), Positives = 203/340 (60%), Gaps = 6/340 (2%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H  ++  GL  N  A+SR+  FCS    G+  Y  +++  +  P   + NT+ KAF 
Sbjct  5     KQQHSLLLRLGLSTNNHAMSRIFTFCSLSKHGDINYALKLFTTLPNPDTFLYNTLFKAFF  64

Query  861   -LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDS  685
              L    S ++  Y HML+  + P+ +T P L++AC   E     + +H   LKFGF  D+
Sbjct  65    SLSQTPSLSLLFYSHMLQHCVTPNAFTFPSLIRACKLEEE---AKQLHAHVLKFGFGGDT  121

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
             Y  N+LI +Y +   ++ A+ VF  M    VV+WT L+S YS+ G V EA  VF+  P K
Sbjct  122   YALNNLIHVYFAFGSLDDARRVFCTMSDPNVVSWTSLVSGYSQWGLVDEAFRVFELMPCK  181

Query  504   DRRV-WGSMISGYVQNNCFKEGLQLFRLMQM-TGVQADEAILVSILSACAHLGSLDIGKW  331
                V W +MI+ +V+ N F+E   LFR M++   ++ D  +  ++LSAC  +G+L+ G W
Sbjct  182   KNSVSWNAMIACFVKGNRFREAFALFRRMRVEKKMELDRFVAATMLSACTGVGALEQGMW  241

Query  330   VHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGD  151
             +H+YVEK G+ ++ +L T ++DMY KCGCL  A  +F  L  + V  WN MI GFAM+G 
Sbjct  242   IHKYVEKTGIVLDSKLATTIIDMYCKCGCLDKAFHVFCGLKVKRVSSWNCMIGGFAMHGK  301

Query  150   GENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             GE+A+RLF+EM+ +A   PD +TFV++ TAC+ SG+  EG
Sbjct  302   GEDAIRLFKEMEEEAMVAPDSITFVNVLTACAHSGLVEEG  341


 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 80/333 (24%), Positives = 140/333 (42%), Gaps = 65/333 (20%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLL--------------AFC--SDPNL--------GNPTY  934
              Q H  V+  G G +T+AL+ L+               FC  SDPN+        G   +
Sbjct  106   KQLHAHVLKFGFGGDTYALNNLIHVYFAFGSLDDARRVFCTMSDPNVVSWTSLVSGYSQW  165

Query  933   G-----WRIYERIQ-QPTICIVNTMIKAFLLKGELSRTMEMYKHM-LKTGMCPDNYTLPY  775
             G     +R++E +  +      N MI  F+          +++ M ++  M  D +    
Sbjct  166   GLVDEAFRVFELMPCKKNSVSWNAMIACFVKGNRFREAFALFRRMRVEKKMELDRFVAAT  225

Query  774   LLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRC  595
             +L AC  + +   G  IH    K G ++DS +  ++I MY                  +C
Sbjct  226   MLSACTGVGALEQGMWIHKYVEKTGIVLDSKLATTIIDMYC-----------------KC  268

Query  594   VVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQM  415
                           G + +A  VF    VK    W  MI G+  +   ++ ++LF+ M+ 
Sbjct  269   --------------GCLDKAFHVFCGLKVKRVSSWNCMIGGFAMHGKGEDAIRLFKEMEE  314

Query  414   TGVQADEAI-LVSILSACAHLGSLDIGKWVHRY-VEKLGMAINVRLGTALVDMYAKCGCL  241
               + A ++I  V++L+ACAH G ++ G +  RY V+  G+         +VD+ A+ G L
Sbjct  315   EAMVAPDSITFVNVLTACAHSGLVEEGWYYFRYMVDVHGIDPTKEHYGCMVDLLARAGRL  374

Query  240   GLAQKLFYELP-ERDVICWNAMISGFAMNGDGE  145
               A+K+  E+P   D     A++    ++G+ E
Sbjct  375   EEAKKVIDEMPMSPDAAVLGALLGACRIHGNLE  407


 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 61/258 (24%), Positives = 103/258 (40%), Gaps = 34/258 (13%)
 Frame = -2

Query  723  HGQCLKFGFLMDSYVGNSLIVMYSSLD---DMESAQCVFDEMPSRCVVAWTVLISRYSRK  553
            H   L+ G   +++   S I  + SL    D+  A  +F  +P+     +  L       
Sbjct  8    HSLLLRLGLSTNNH-AMSRIFTFCSLSKHGDINYALKLFTTLPNPDTFLYNTL-------  59

Query  552  GDVFEARLVFDETPVKDRRVWGSMISGYVQNNCF------------KEGLQLFRLMQMTG  409
               F+A     +TP      +  M+   V  N F            +E  QL   +   G
Sbjct  60   ---FKAFFSLSQTPSLSLLFYSHMLQHCVTPNAFTFPSLIRACKLEEEAKQLHAHVLKFG  116

Query  408  VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQ  229
               D   L +++      GSLD  + V   +       NV   T+LV  Y++ G +  A 
Sbjct  117  FGGDTYALNNLIHVYFAFGSLDDARRVFCTMSD----PNVVSWTSLVSGYSQWGLVDEAF  172

Query  228  KLFYELP-ERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSC  52
            ++F  +P +++ + WNAMI+ F        A  LFR M+ +     D     ++ +AC+ 
Sbjct  173  RVFELMPCKKNSVSWNAMIACFVKGNRFREAFALFRRMRVEKKMELDRFVAATMLSACTG  232

Query  51   SGMAHEGL---KLLEKIG  7
             G   +G+   K +EK G
Sbjct  233  VGALEQGMWIHKYVEKTG  250



>ref|XP_006341456.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800-like 
[Solanum tuberosum]
Length=531

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/348 (39%), Positives = 204/348 (59%), Gaps = 9/348 (3%)
 Frame = -2

Query  1038  QAHGQVITCGL---GNNTFALSRLL-----AFCSDPNLGNPTYGWRIYERIQQPTICIVN  883
             Q H Q IT G     ++TF L+++L        S P      Y   I+  I  P+    N
Sbjct  29    QVHAQSITNGFLFSFSSTFILTQILHSFTSILSSLPTQPTTRYPSTIFNLIHNPSTFCYN  88

Query  882   TMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKF  703
             T+I+A  L    + +   +  M +  + PD++T P++LKACG + S  LGR++H Q LKF
Sbjct  89    TIIRAHTLLSSPNTSFFYFIKMRRNSVPPDSHTFPFVLKACGLLNSPFLGRTLHSQALKF  148

Query  702   GFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVF  523
             GFL+D +V N+L+ +Y+    +  A+ VFDE   R VV++ ++I  Y + G++ EAR VF
Sbjct  149   GFLVDVFVCNNLVRVYTVSGSISDARRVFDESCDRDVVSYNLIIDGYVKAGEIGEAREVF  208

Query  522   DETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLD  343
             DE PV+D   WG++++GY + N  K+ ++LF  M    V+ D   LVS LSACA LG L 
Sbjct  209   DEMPVRDAVSWGTLMAGYAKMNQCKDAIELFDQMVTLNVKFDNVTLVSALSACAQLGELQ  268

Query  342   IGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFA  163
              GK +H Y+++ G+AI+  L T LVD+YAKCGC+ +A++LF    ++ V  WNAM+ G A
Sbjct  269   KGKTIHDYIKRKGIAIDSYLCTGLVDLYAKCGCIDIARELFEMSKDKKVFSWNAMLVGLA  328

Query  162   MNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLL  19
             M+G G+     F  M  + G  PDGVTF++L   C+  G+ HE  +  
Sbjct  329   MHGHGQLLFDYFSRMV-ETGVEPDGVTFLALLVGCNHGGLIHEARRFF  375



>ref|NP_172286.1| chloroplast RNA editing factor [Arabidopsis thaliana]
 sp|Q9LN01.1|PPR21_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g08070 
[Arabidopsis thaliana]
 gb|AAF79838.1|AC026875_18 T6D22.15 [Arabidopsis thaliana]
 gb|AEE28239.1| chloroplast RNA editing factor [Arabidopsis thaliana]
Length=741

 Score =   261 bits (668),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/330 (39%), Positives = 200/330 (61%), Gaps = 2/330 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLK  856
             H Q+I  GL N  +ALS+L+ FC   P+     Y   +++ IQ+P + I NTM +   L 
Sbjct  53    HAQMIKIGLHNTNYALSKLIEFCILSPHFEGLPYAISVFKTIQEPNLLIWNTMFRGHALS  112

Query  855   GELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVG  676
              +    +++Y  M+  G+ P++YT P++LK+C   ++   G+ IHG  LK G  +D YV 
Sbjct  113   SDPVSALKLYVCMISLGLLPNSYTFPFVLKSCAKSKAFKEGQQIHGHVLKLGCDLDLYVH  172

Query  675   NSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRR  496
              SLI MY     +E A  VFD+ P R VV++T LI  Y+ +G +  A+ +FDE PVKD  
Sbjct  173   TSLISMYVQNGRLEDAHKVFDKSPHRDVVSYTALIKGYASRGYIENAQKLFDEIPVKDVV  232

Query  495   VWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYV  316
              W +MISGY +   +KE L+LF+ M  T V+ DE+ +V+++SACA  GS+++G+ VH ++
Sbjct  233   SWNAMISGYAETGNYKEALELFKDMMKTNVRPDESTMVTVVSACAQSGSIELGRQVHLWI  292

Query  315   EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAM  136
             +  G   N+++  AL+D+Y+KCG L  A  LF  LP +DVI WN +I G+      + A+
Sbjct  293   DDHGFGSNLKIVNALIDLYSKCGELETACGLFERLPYKDVISWNTLIGGYTHMNLYKEAL  352

Query  135   RLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
              LF+EM   +G  P+ VT +S+  AC+  G
Sbjct  353   LLFQEMLR-SGETPNDVTMLSILPACAHLG  381


 Score =   181 bits (459),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/297 (34%), Positives = 156/297 (53%), Gaps = 34/297 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ I    +   N MI  +   G     +E++K M+KT + PD  T+  ++ AC    
Sbjct  221  KLFDEIPVKDVVSWNAMISGYAETGNYKEALELFKDMMKTNVRPDESTMVTVVSACAQSG  280

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LGR +H      GF  +  + N+LI +YS   ++E+A  +F+ +             
Sbjct  281  SIELGRQVHLWIDDHGFGSNLKIVNALIDLYSKCGELETACGLFERL-------------  327

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                              P KD   W ++I GY   N +KE L LF+ M  +G   ++  
Sbjct  328  ------------------PYKDVISWNTLIGGYTHMNLYKEALLLFQEMLRSGETPNDVT  369

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKL--GMAINVRLGTALVDMYAKCGCLGLAQKLFYE  214
            ++SIL ACAHLG++DIG+W+H Y++K   G+     L T+L+DMYAKCG +  A ++F  
Sbjct  370  MLSILPACAHLGAIDIGRWIHVYIDKRLKGVTNASSLRTSLIDMYAKCGDIEAAHQVFNS  429

Query  213  LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGM  43
            +  + +  WNAMI GFAM+G  + +  LF  M+   G +PD +TFV L +ACS SGM
Sbjct  430  ILHKSLSSWNAMIFGFAMHGRADASFDLFSRMRK-IGIQPDDITFVGLLSACSHSGM  485


 Score = 94.7 bits (234),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 76/261 (29%), Positives = 120/261 (46%), Gaps = 37/261 (14%)
 Frame = -2

Query  774  LLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLI---VMYSSLDDMESAQCVFDEMP  604
            LL  C  ++S    R IH Q +K G    +Y  + LI   ++    + +  A  VF  + 
Sbjct  39   LLHNCKTLQSL---RIIHAQMIKIGLHNTNYALSKLIEFCILSPHFEGLPYAISVFKTIQ  95

Query  603  SRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMIS----------GYVQNNC  454
               ++ W  +   ++   D           PV   +++  MIS           +V  +C
Sbjct  96   EPNLLIWNTMFRGHALSSD-----------PVSALKLYVCMISLGLLPNSYTFPFVLKSC  144

Query  453  -----FKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINV  289
                 FKEG Q+   +   G   D  +  S++S     G L+     H+  +K     +V
Sbjct  145  AKSKAFKEGQQIHGHVLKLGCDLDLYVHTSLISMYVQNGRLEDA---HKVFDK-SPHRDV  200

Query  288  RLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQND  109
               TAL+  YA  G +  AQKLF E+P +DV+ WNAMISG+A  G+ + A+ LF++M   
Sbjct  201  VSYTALIKGYASRGYIENAQKLFDEIPVKDVVSWNAMISGYAETGNYKEALELFKDMMK-  259

Query  108  AGTRPDGVTFVSLFTACSCSG  46
               RPD  T V++ +AC+ SG
Sbjct  260  TNVRPDESTMVTVVSACAQSG  280


 Score = 80.9 bits (198),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 129/302 (43%), Gaps = 37/302 (12%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +   G G+N   ++ L+   S    G       ++ER+    +   NT+I  +  
Sbjct  287   QVHLWIDDHGFGSNLKIVNALIDLYS--KCGELETACGLFERLPYKDVISWNTLIGGYTH  344

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    + +++ ML++G  P++ T+  +L AC ++ + ++GR IH            Y+
Sbjct  345   MNLYKEALLLFQEMLRSGETPNDVTMLSILPACAHLGAIDIGRWIH-----------VYI  393

Query  678   GNSL--IVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
                L  +   SSL                     T LI  Y++ GD+  A  VF+    K
Sbjct  394   DKRLKGVTNASSLR--------------------TSLIDMYAKCGDIEAAHQVFNSILHK  433

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
                 W +MI G+  +        LF  M+  G+Q D+   V +LSAC+H G LD+G+ + 
Sbjct  434   SLSSWNAMIFGFAMHGRADASFDLFSRMRKIGIQPDDITFVGLLSACSHSGMLDLGRHIF  493

Query  324   RYV-EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPER-DVICWNAMISGFAMNGD  151
             R + +   M   +     ++D+    G    A+++   +    D + W +++    M+G+
Sbjct  494   RTMTQDYKMTPKLEHYGCMIDLLGHSGLFKEAEEMINMMEMEPDGVIWCSLLKACKMHGN  553

Query  150   GE  145
              E
Sbjct  554   VE  555



>ref|XP_008223521.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Prunus mume]
Length=624

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 207/345 (60%), Gaps = 3/345 (1%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H QVI  GL  +  A+ R++ FC+    G+  Y  ++++ +  P   I NT+++ +L
Sbjct  37    KQLHSQVIRLGLAADNDAMGRVIKFCALSKNGDLGYALQVFDTMLHPDAFIYNTVMRGYL  96

Query  861   LKGELSRT-MEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDS  685
              + +L R  + +Y  ML+  + P+ YT P +++AC N ++    + +H   +K G+  D 
Sbjct  97    -QCQLPRNCIVLYSQMLQDSVTPNKYTFPSVIRACCNDDAIGEAKQVHAHVVKLGYGADG  155

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
             +  N+LI MY     +E A+ VFD+MP    V+WT LI+ YS+ G V EA  +F+  P K
Sbjct  156   FCQNNLIHMYVKFQSLEEARRVFDKMPRMDAVSWTTLITGYSQCGFVDEAFEIFELMPEK  215

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             +   W +MIS YVQ++ F E   LF+ M++  V+ D+ +  S+LSAC  LG+L+ GKW+H
Sbjct  216   NSVSWNAMISSYVQSDRFHEAFALFQRMRVEKVELDKFMAASMLSACTGLGALEQGKWIH  275

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
              Y+EK G+ ++ +L T ++DMY KCG L  A ++F  L  + +  WN MI G AM+G GE
Sbjct  276   GYIEKSGIELDSKLATTIIDMYCKCGFLEKAFEVFNGLSHKGISSWNCMIGGLAMHGKGE  335

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
              A+ LF +MQ D    PD +TFV++ +AC+ SG+  EG +  + +
Sbjct  336   AAIELFEKMQRDM-VAPDNITFVNVLSACAHSGLVEEGQRYFQSM  379


 Score = 73.9 bits (180),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 60/265 (23%), Positives = 108/265 (41%), Gaps = 33/265 (12%)
 Frame = -2

Query  933  GWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGN  754
             + I+E + +      N MI +++          +++ M    +  D +    +L AC  
Sbjct  205  AFEIFELMPEKNSVSWNAMISSYVQSDRFHEAFALFQRMRVEKVELDKFMAASMLSACTG  264

Query  753  MESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVL  574
            + +   G+ IHG   K G  +DS +  ++I MY     +E A  VF+ +  + + +W   
Sbjct  265  LGALEQGKWIHGYIEKSGIELDSKLATTIIDMYCKCGFLEKAFEVFNGLSHKGISSWNC-  323

Query  573  ISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADE  394
                                          MI G   +   +  ++LF  MQ   V  D 
Sbjct  324  ------------------------------MIGGLAMHGKGEAAIELFEKMQRDMVAPDN  353

Query  393  AILVSILSACAHLGSLDIG-KWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFY  217
               V++LSACAH G ++ G ++    +E  G+         +VD+  + G L  A+KL  
Sbjct  354  ITFVNVLSACAHSGLVEEGQRYFQSMIEVHGIEPRKEHFGCMVDLLGRAGMLEEARKLIS  413

Query  216  ELP-ERDVICWNAMISGFAMNGDGE  145
            E+P   DV    A++    ++G+ E
Sbjct  414  EMPMSPDVGILGALLGACKIHGNVE  438



>ref|XP_010688051.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 
[Beta vulgaris subsp. vulgaris]
Length=735

 Score =   261 bits (667),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/346 (39%), Positives = 206/346 (60%), Gaps = 1/346 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q+I  GL N  FALS+L+ FC+  + G+ +Y   I++ I++P   + NT+I+   L
Sbjct  47    QIHSQIIKTGLHNTQFALSKLIEFCAIDSSGDLSYAVSIFDTIEEPNTLVWNTVIRGQCL  106

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                L   +E+Y  M+ + + P++YT P +LK C    S + G  IHG  LK G   D++V
Sbjct  107   SSSLINALELYVGMISSEVVPNSYTFPSILKCCAKSGSTHEGEQIHGHVLKLGLDSDAFV  166

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+    ++ A+ VFD+ P R  V++T LI+ Y+ +G + +AR +FDE PVKD 
Sbjct  167   HTSLINMYAQNGKLDCARQVFDKSPHRDPVSYTTLITGYASRGYLEDARKLFDEIPVKDV  226

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY+Q + F + +  F  M    V  +E+ ++S+LSACA  G+L++GKWV  +
Sbjct  227   VSWNAMIAGYLQRSQFDQSVSFFEEMLRARVMPNESTMLSVLSACAQSGNLELGKWVRDW  286

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E+ G    +RL  AL+DMYAKC  L  A+ LF  LP++D+I WN MI G+      + A
Sbjct  287   IEENGFGAKLRLVNALIDMYAKCDDLVTARSLFEGLPQKDLISWNVMIGGYTHGSFYKEA  346

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGRA  1
             + LFREM  +    P+ VTF+++  AC+  G    G  +   I R+
Sbjct  347   LCLFREML-ELRVVPNDVTFLNVLPACAQLGALDYGKWIHAYINRS  391


 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 102/366 (28%), Positives = 170/366 (46%), Gaps = 62/366 (17%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLL--------------AFCSDPNLGNPTY-----------  934
             Q HG V+  GL ++ F  + L+               F   P+    +Y           
Sbjct  150   QIHGHVLKLGLDSDAFVHTSLINMYAQNGKLDCARQVFDKSPHRDPVSYTTLITGYASRG  209

Query  933   ----GWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLK  766
                   ++++ I    +   N MI  +L + +  +++  ++ ML+  + P+  T+  +L 
Sbjct  210   YLEDARKLFDEIPVKDVVSWNAMIAGYLQRSQFDQSVSFFEEMLRARVMPNESTMLSVLS  269

Query  765   ACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVA  586
             AC    +  LG+ +     + GF     + N+LI MY+  DD+ +A              
Sbjct  270   ACAQSGNLELGKWVRDWIEENGFGAKLRLVNALIDMYAKCDDLVTA--------------  315

Query  585   WTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGV  406
                              R +F+  P KD   W  MI GY   + +KE L LFR M    V
Sbjct  316   -----------------RSLFEGLPQKDLISWNVMIGGYTHGSFYKEALCLFREMLELRV  358

Query  405   QADEAILVSILSACAHLGSLDIGKWVHRYVEK-LGMAINVRLGTALVDMYAKCGCLGLAQ  229
               ++   +++L ACA LG+LD GKW+H Y+ +      N  L T+L++MYAKCG +  A+
Sbjct  359   VPNDVTFLNVLPACAQLGALDYGKWIHAYINRSFNSLTNTALLTSLINMYAKCGDIEAAK  418

Query  228   KLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCS  49
             ++F  +  R    WNA+I G AM+GD  +++ LF  M ++ G RPD +TFV + +AC+ +
Sbjct  419   QVFDSMKTRSPASWNALICGLAMHGDATHSLDLFSRMVHE-GFRPDDITFVGILSACTQA  477

Query  48    GMAHEG  31
             G+   G
Sbjct  478   GLVDLG  483


 Score = 77.4 bits (189),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 59/286 (21%), Positives = 120/286 (42%), Gaps = 32/286 (11%)
 Frame = -2

Query  924  IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
            ++E + Q  +   N MI  +         + +++ ML+  + P++ T   +L AC  + +
Sbjct  318  LFEGLPQKDLISWNVMIGGYTHGSFYKEALCLFREMLELRVVPNDVTFLNVLPACAQLGA  377

Query  744  CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
             + G+ IH           +Y+  S                 F+ + +  ++  T LI+ 
Sbjct  378  LDYGKWIH-----------AYINRS-----------------FNSLTNTALL--TSLINM  407

Query  564  YSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAIL  385
            Y++ GD+  A+ VFD    +    W ++I G   +      L LF  M   G + D+   
Sbjct  408  YAKCGDIEAAKQVFDSMKTRSPASWNALICGLAMHGDATHSLDLFSRMVHEGFRPDDITF  467

Query  384  VSILSACAHLGSLDIGK-WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP  208
            V ILSAC   G +D+G+ + +  ++   ++  V     ++D+  + G    A+ L   +P
Sbjct  468  VGILSACTQAGLVDLGQSYFNSMIQDYKISPKVHHYGCMIDLLGRAGLFDEAEALMSTMP  527

Query  207  -ERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVS  73
             E D   W ++++   ++   E A +    +     + P     +S
Sbjct  528  MEPDGAIWGSLLAACKLHKKVEMAEKFANHLFELEPSNPGPYVLLS  573



>ref|XP_006476161.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Citrus sinensis]
Length=541

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/351 (36%), Positives = 207/351 (59%), Gaps = 8/351 (2%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              + H Q++   L  + F +++++  C+    G+  Y   +++++++P + + N MI+A+ 
Sbjct  31    KKIHTQILKYLLSQSNFLVTKMIDVCNSG--GDLAYASLLFKQVKEPNVFLYNAMIRAYT  88

Query  861   LKGELSRTMEMYKHMLK---TG--MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGF  697
                     + +YK ML+   TG  + PD +TLP+++K+C  +   +LG+ IH    KFG 
Sbjct  89    NNHLYGLAINLYKQMLRDPRTGSLILPDKFTLPFVIKSCAGLLCPSLGKQIHAHVCKFGL  148

Query  696   LMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDE  517
                S   N+L+ +Y   D++  A  VF+EM  R +VAW  LIS Y+R G + +AR++FD+
Sbjct  149   KSHSITENALLDLYGKCDELIEAHKVFEEMTDRDIVAWNNLISGYARLGQMKKARMLFDK  208

Query  516   TPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIG  337
              P K    W +MISGY     + E L +FR MQM G++ DE  +VS+L ACA LGSL++G
Sbjct  209   MPYKTIVSWTAMISGYTHIGSYAEALDVFRQMQMVGIEPDEISIVSVLPACAQLGSLELG  268

Query  336   KWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMN  157
             +W+H Y +K  +     +  AL++MY KCGC+  A +LF ++ ERDV+ W+ +I G A +
Sbjct  269   EWIHMYCDKNHLLRRTVICNALIEMYIKCGCINQASQLFDQMVERDVVSWSTVIGGLANH  328

Query  156   GDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             G    A+ LF EMQ      P+ +TF+ L +AC+ +G  +EGL   + + R
Sbjct  329   GKAHKAIHLFHEMQR-LKVPPNDITFIGLLSACAHTGFWNEGLMYFDSMKR  378


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 120/279 (43%), Gaps = 71/279 (25%)
 Frame = -2

Query  774  LLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRC  595
            +L++C N+      + IH Q LK+     +++   +I + +S  D+  A  +F ++    
Sbjct  20   ILQSCENLIEL---KKIHTQILKYLLSQSNFLVTKMIDVCNSGGDLAYASLLFKQV----  72

Query  594  VVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLM--  421
                        ++ +VF               ++ +MI  Y  N+ +   + L++ M  
Sbjct  73   ------------KEPNVF---------------LYNAMIRAYTNNHLYGLAINLYKQMLR  105

Query  420  -QMTG--VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKC  250
               TG  +  D+  L  ++ +CA L    +GK +H +V K G+  +     AL+D+Y KC
Sbjct  106  DPRTGSLILPDKFTLPFVIKSCAGLLCPSLGKQIHAHVCKFGLKSHSITENALLDLYGKC  165

Query  249  GCLGLAQKLFYELPERDVICWN-------------------------------AMISGFA  163
              L  A K+F E+ +RD++ WN                               AMISG+ 
Sbjct  166  DELIEAHKVFEEMTDRDIVAWNNLISGYARLGQMKKARMLFDKMPYKTIVSWTAMISGYT  225

Query  162  MNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
              G    A+ +FR+MQ   G  PD ++ VS+  AC+  G
Sbjct  226  HIGSYAEALDVFRQMQM-VGIEPDEISIVSVLPACAQLG  263



>ref|XP_009338904.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305, 
partial [Pyrus x bretschneideri]
Length=548

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/347 (38%), Positives = 207/347 (60%), Gaps = 3/347 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  ++T GL  +    S++L+F +  NLGN  Y +R++ ++  PTI   NT+I+ +  
Sbjct  38    QIHALLLTLGLSQHHLLTSKILSFSALSNLGNIEYSYRVFSQLSHPTIFYWNTVIRGYSN  97

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 +R++ ++  ML+ G+ PD  T P+L+KA   +    LG ++H    K GF  D ++
Sbjct  98    SKNPNRSLSVFVKMLRHGVSPDYLTYPFLVKASARLLKRELGMAVHAHIAKDGFESDRFI  157

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSLI MY++  D+  A+ VFD +P R  V+W  ++  Y++ GDV  AR VF+  P  + 
Sbjct  158   SNSLIHMYATCRDIMYARKVFDGIPVRNSVSWNSMLDGYAKCGDVNSAREVFELMPEHNV  217

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W S+I GYV+   F E L +F  M + G +A+E  +VS+LSAC HLG+L+ GK +HRY
Sbjct  218   VSWSSLIDGYVKAGEFSEALAVFERMCVVGPKANEVTMVSVLSACTHLGALEQGKVMHRY  277

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFY--ELPERDVICWNAMISGFAMNGDGE  145
             + +  + + + L T+LVDMYAKCG +  A  +F    L + D++ WNAMI G AM+G  +
Sbjct  278   MAENELPLTLALQTSLVDMYAKCGAIEEALCVFRGGSLHQSDLLIWNAMIGGLAMHGLVQ  337

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
              A+++F EMQ   G  PD +T++ L +AC+  G+  E     E IG+
Sbjct  338   QALKIFSEMQ-IIGIAPDEITYLCLLSACAHGGLVKEAWHFFECIGK  383


 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 64/295 (22%), Positives = 124/295 (42%), Gaps = 33/295 (11%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            G+      ++E + +  +   +++I  ++  GE S  + +++ M   G   +  T+  +L
Sbjct  200  GDVNSAREVFELMPEHNVVSWSSLIDGYVKAGEFSEALAVFERMCVVGPKANEVTMVSVL  259

Query  768  KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
             AC ++ +   G+ +H    +    +   +  SL+ MY+    +E A CVF         
Sbjct  260  SACTHLGALEQGKVMHRYMAENELPLTLALQTSLVDMYAKCGAIEEALCVF---------  310

Query  588  AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
                      R G + ++ L+          +W +MI G   +   ++ L++F  MQ+ G
Sbjct  311  ----------RGGSLHQSDLL----------IWNAMIGGLAMHGLVQQALKIFSEMQIIG  350

Query  408  VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQ  229
            +  DE   + +LSACAH G +         + K GM         +VD+ A+ G +  A 
Sbjct  351  IAPDEITYLCLLSACAHGGLVKEAWHFFECIGKHGMTPKCEHYACMVDVLARGGQVVEAY  410

Query  228  KLFYEL-PERDVICWNAMISGFAMNGD---GENAMRLFREMQNDAGTRPDGVTFV  76
            +   ++  E       A++SG   +G     E   +   E+Q D   R  G++ V
Sbjct  411  QFICQMSKEPTASMLGALLSGCMNHGKLDLAEIVGKKLIEIQPDHDGRYVGLSNV  465



>ref|XP_002524104.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF38314.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=810

 Score =   262 bits (670),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/280 (43%), Positives = 185/280 (66%), Gaps = 1/280 (0%)
 Frame = -2

Query  843  RTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLI  664
            ++   Y    + G+ PDN T P+L+KAC  + S ++G   HG  ++ GF  D YV NSL+
Sbjct  522  QSFHFYIQSQRLGIFPDNLTYPFLVKACTQLGSIDMGMQAHGHVVRHGFENDVYVQNSLV  581

Query  663  VMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGS  484
             MYS+L D+ +A  +F  M    VV+WT +I+ Y++ GDV  AR +FD+ P K+   W +
Sbjct  582  NMYSNLGDIRAASYIFQTMSQLDVVSWTSMIAGYNKSGDVESARKLFDKMPEKNLVTWST  641

Query  483  MISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLG  304
            MISGY +NNCF + ++L+ ++Q  GVQA+E ++VS++S+CAHLG+L++G+  H YV +  
Sbjct  642  MISGYAKNNCFNKAIELYNVLQSEGVQANETVMVSVISSCAHLGALELGEKAHDYVVRNK  701

Query  303  MAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFR  124
            + +N+ LGTALVDMYA+CG +  A ++F EL E+D + W A+I+GFAM+G  E A++ F 
Sbjct  702  ITVNLILGTALVDMYARCGSIDKAVQVFDELGEKDALSWTALIAGFAMHGHAEKALQYFS  761

Query  123  EMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
            EM    G  P  +TF ++ +ACS  G+   G+K+ E + R
Sbjct  762  EMIR-TGLTPRDITFTAVLSACSHRGLVERGMKIFETMKR  800


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 63/119 (53%), Gaps = 0/119 (0%)
 Frame = -2

Query  474  GYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAI  295
            GY  +    +    +   Q  G+  D      ++ AC  LGS+D+G   H +V + G   
Sbjct  513  GYSGSESPGQSFHFYIQSQRLGIFPDNLTYPFLVKACTQLGSIDMGMQAHGHVVRHGFEN  572

Query  294  NVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREM  118
            +V +  +LV+MY+  G +  A  +F  + + DV+ W +MI+G+  +GD E+A +LF +M
Sbjct  573  DVYVQNSLVNMYSNLGDIRAASYIFQTMSQLDVVSWTSMIAGYNKSGDVESARKLFDKM  631


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/265 (19%), Positives = 106/265 (40%), Gaps = 64/265 (24%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGN--------------PTYGW---------  928
             QAHG V+  G  N+ +  + L+   S  NLG+                  W         
Sbjct  560   QAHGHVVRHGFENDVYVQNSLVNMYS--NLGDIRAASYIFQTMSQLDVVSWTSMIAGYNK  617

Query  927   --------RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYL  772
                     ++++++ +  +   +TMI  +      ++ +E+Y  +   G+  +   +  +
Sbjct  618   SGDVESARKLFDKMPEKNLVTWSTMISGYAKNNCFNKAIELYNVLQSEGVQANETVMVSV  677

Query  771   LKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCV  592
             + +C ++ +  LG   H   ++    ++  +G +L+ MY+    ++ A  VFDE+  +  
Sbjct  678   ISSCAHLGALELGEKAHDYVVRNKITVNLILGTALVDMYARCGSIDKAVQVFDELGEKDA  737

Query  591   VAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMT  412
             ++WT LI+ ++  G                                 ++ LQ F  M  T
Sbjct  738   LSWTALIAGFAMHGHA-------------------------------EKALQYFSEMIRT  766

Query  411   GVQADEAILVSILSACAHLGSLDIG  337
             G+   +    ++LSAC+H G ++ G
Sbjct  767   GLTPRDITFTAVLSACSHRGLVERG  791



>gb|KCW79820.1| hypothetical protein EUGRSUZ_C01164, partial [Eucalyptus grandis]
Length=490

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/336 (39%), Positives = 210/336 (63%), Gaps = 8/336 (2%)
 Frame = -2

Query  999  NTFALSRLLAFCSDPNLGNP---TYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEM  829
            N  A+  LL+  +    G+P   +Y   I+E ++     + NTMI+  +  G     + +
Sbjct  1    NPSAIGPLLSVAATS--GDPCFFSYACSIFEHLRCRNTFMYNTMIRGHVQSGSPVAAVSL  58

Query  828  YKHMLKTGMCPDNYTLPYLLKACGNM--ESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMY  655
            Y  ML +G+  +NYT P L+KAC  +  +S ++G  +H   +KFG+ +D +V ++LI  Y
Sbjct  59   YSAMLGSGVEGNNYTFPPLIKACIFLGPDSKSIGLLVHAHVVKFGYHVDPFVVSALIEFY  118

Query  654  SSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMIS  475
            SS+ D+ +A+ +FD    R VV WT L+  Y + GD+  ARL+FDE P ++   W +M++
Sbjct  119  SSVCDLGNARKLFDGTTVRDVVTWTALVDGYGKAGDLENARLLFDEMPERNVISWSAMMA  178

Query  474  GYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAI  295
             Y + + FKE L LFR MQ  G++ +E++LVS+L+ACAHLG++  G WVH Y +++    
Sbjct  179  AYSRVSDFKEVLSLFRQMQEVGIEPNESVLVSVLTACAHLGAVTQGIWVHSYAKRVNFIS  238

Query  294  NVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQ  115
            N  L TALVDMY++CG + LA  +F+ + ++D   WNAMI+G A+NG+   ++ LF++M 
Sbjct  239  NRILATALVDMYSRCGLVDLALSVFHNISDKDAEAWNAMIAGVALNGEAVKSLDLFKKMT  298

Query  114  NDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIG  7
               GT+P   TFV+L TAC+ + M  EGL+L E++G
Sbjct  299  AH-GTQPTESTFVALLTACTHAKMTKEGLRLFEEMG  333



>ref|XP_003541335.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Glycine max]
Length=607

 Score =   258 bits (659),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 135/339 (40%), Positives = 203/339 (60%), Gaps = 6/339 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL-  862
             Q H  ++  GL  N  A+SR+  FCS    G+  Y  +++  +  P   + NT+ KAF  
Sbjct  20    QQHSLLLRLGLSTNNHAMSRIFTFCSLSKHGDINYALKLFTTLPNPDTFLYNTLFKAFFS  79

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
             L    S ++  Y HML+  + P+ +T P L++AC   E     + +H   LKFGF  D+Y
Sbjct  80    LSQTPSLSLLFYSHMLQHCVTPNAFTFPSLIRACKLEEE---AKQLHAHVLKFGFGGDTY  136

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+LI +Y +   ++ A+ VF  M    VV+WT L+S YS+ G V EA  VF+  P K 
Sbjct  137   ALNNLIHVYFAFGSLDDARRVFCTMSDPNVVSWTSLVSGYSQWGLVDEAFRVFELMPCKK  196

Query  501   RRV-WGSMISGYVQNNCFKEGLQLFRLMQM-TGVQADEAILVSILSACAHLGSLDIGKWV  328
               V W +MI+ +V+ N F+E   LFR M++   ++ D  +  ++LSAC  +G+L+ G W+
Sbjct  197   NSVSWNAMIACFVKGNRFREAFALFRRMRVEKKMELDRFVAATMLSACTGVGALEQGMWI  256

Query  327   HRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDG  148
             H+YVEK G+ ++ +L T ++DMY KCGCL  A  +F  L  + V  WN MI GFAM+G G
Sbjct  257   HKYVEKTGIVLDSKLATTIIDMYCKCGCLDKAFHVFCGLKVKRVSSWNCMIGGFAMHGKG  316

Query  147   ENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             E+A+RLF+EM+ +A   PD +TFV++ TAC+ SG+  EG
Sbjct  317   EDAIRLFKEMEEEAMVAPDSITFVNVLTACAHSGLVEEG  355


 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 80/332 (24%), Positives = 140/332 (42%), Gaps = 65/332 (20%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLL--------------AFC--SDPNL--------GNPTYG  931
             Q H  V+  G G +T+AL+ L+               FC  SDPN+        G   +G
Sbjct  121   QLHAHVLKFGFGGDTYALNNLIHVYFAFGSLDDARRVFCTMSDPNVVSWTSLVSGYSQWG  180

Query  930   -----WRIYERIQ-QPTICIVNTMIKAFLLKGELSRTMEMYKHM-LKTGMCPDNYTLPYL  772
                  +R++E +  +      N MI  F+          +++ M ++  M  D +    +
Sbjct  181   LVDEAFRVFELMPCKKNSVSWNAMIACFVKGNRFREAFALFRRMRVEKKMELDRFVAATM  240

Query  771   LKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCV  592
             L AC  + +   G  IH    K G ++DS +  ++I MY                  +C 
Sbjct  241   LSACTGVGALEQGMWIHKYVEKTGIVLDSKLATTIIDMYC-----------------KC-  282

Query  591   VAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMT  412
                          G + +A  VF    VK    W  MI G+  +   ++ ++LF+ M+  
Sbjct  283   -------------GCLDKAFHVFCGLKVKRVSSWNCMIGGFAMHGKGEDAIRLFKEMEEE  329

Query  411   GVQADEAI-LVSILSACAHLGSLDIGKWVHRY-VEKLGMAINVRLGTALVDMYAKCGCLG  238
              + A ++I  V++L+ACAH G ++ G +  RY V+  G+         +VD+ A+ G L 
Sbjct  330   AMVAPDSITFVNVLTACAHSGLVEEGWYYFRYMVDVHGIDPTKEHYGCMVDLLARAGRLE  389

Query  237   LAQKLFYELP-ERDVICWNAMISGFAMNGDGE  145
              A+K+  E+P   D     A++    ++G+ E
Sbjct  390   EAKKVIDEMPMSPDAAVLGALLGACRIHGNLE  421


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 64/272 (24%), Positives = 108/272 (40%), Gaps = 37/272 (14%)
 Frame = -2

Query  765  ACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLD---DMESAQCVFDEMPSRC  595
            AC +M      +  H   L+ G   +++   S I  + SL    D+  A  +F  +P+  
Sbjct  11   ACSSMAEV---KQQHSLLLRLGLSTNNH-AMSRIFTFCSLSKHGDINYALKLFTTLPNPD  66

Query  594  VVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCF------------  451
               +  L          F+A     +TP      +  M+   V  N F            
Sbjct  67   TFLYNTL----------FKAFFSLSQTPSLSLLFYSHMLQHCVTPNAFTFPSLIRACKLE  116

Query  450  KEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTAL  271
            +E  QL   +   G   D   L +++      GSLD  + V   +       NV   T+L
Sbjct  117  EEAKQLHAHVLKFGFGGDTYALNNLIHVYFAFGSLDDARRVFCTMSD----PNVVSWTSL  172

Query  270  VDMYAKCGCLGLAQKLFYELP-ERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRP  94
            V  Y++ G +  A ++F  +P +++ + WNAMI+ F        A  LFR M+ +     
Sbjct  173  VSGYSQWGLVDEAFRVFELMPCKKNSVSWNAMIACFVKGNRFREAFALFRRMRVEKKMEL  232

Query  93   DGVTFVSLFTACSCSGMAHEGL---KLLEKIG  7
            D     ++ +AC+  G   +G+   K +EK G
Sbjct  233  DRFVAATMLSACTGVGALEQGMWIHKYVEKTG  264



>ref|XP_010047826.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like 
[Eucalyptus grandis]
Length=534

 Score =   256 bits (653),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/336 (39%), Positives = 210/336 (63%), Gaps = 8/336 (2%)
 Frame = -2

Query  999  NTFALSRLLAFCSDPNLGNP---TYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEM  829
            N  A+  LL+  +    G+P   +Y   I+E ++     + NTMI+  +  G     + +
Sbjct  43   NPSAIGPLLSVAATS--GDPCFFSYACSIFEHLRCRNTFMYNTMIRGHVQSGSPVAAVSL  100

Query  828  YKHMLKTGMCPDNYTLPYLLKACGNM--ESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMY  655
            Y  ML +G+  +NYT P L+KAC  +  +S ++G  +H   +KFG+ +D +V ++LI  Y
Sbjct  101  YSAMLGSGVEGNNYTFPPLIKACIFLGPDSKSIGLLVHAHVVKFGYHVDPFVVSALIEFY  160

Query  654  SSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMIS  475
            SS+ D+ +A+ +FD    R VV WT L+  Y + GD+  ARL+FDE P ++   W +M++
Sbjct  161  SSVCDLGNARKLFDGTTVRDVVTWTALVDGYGKAGDLENARLLFDEMPERNVISWSAMMA  220

Query  474  GYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAI  295
             Y + + FKE L LFR MQ  G++ +E++LVS+L+ACAHLG++  G WVH Y +++    
Sbjct  221  AYSRVSDFKEVLSLFRQMQEVGIEPNESVLVSVLTACAHLGAVTQGIWVHSYAKRVNFIS  280

Query  294  NVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQ  115
            N  L TALVDMY++CG + LA  +F+ + ++D   WNAMI+G A+NG+   ++ LF++M 
Sbjct  281  NRILATALVDMYSRCGLVDLALSVFHNISDKDAEAWNAMIAGVALNGEAVKSLDLFKKMT  340

Query  114  NDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIG  7
               GT+P   TFV+L TAC+ + M  EGL+L E++G
Sbjct  341  AH-GTQPTESTFVALLTACTHAKMTKEGLRLFEEMG  375



>ref|XP_006842814.1| hypothetical protein AMTR_s00081p00056740 [Amborella trichopoda]
 gb|ERN04489.1| hypothetical protein AMTR_s00081p00056740 [Amborella trichopoda]
Length=406

 Score =   252 bits (643),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 128/331 (39%), Positives = 189/331 (57%), Gaps = 2/331 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q    GL N+ FALS+++ FCS    G+  +   ++  I +P   I NT+I+   L
Sbjct  51    QIHAQFFKTGLHNDQFALSKIIEFCSISPFGDLDFAHLLFGTISEPNQFIWNTLIRGHSL  110

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                   ++ +Y  ML +   P+NYT P+LLK+C    +   GR IHGQ +KF   +D ++
Sbjct  111   SSTPMDSLSLYIAMLLSLTPPNNYTFPFLLKSCACELAVEEGRQIHGQIIKFDLELDPFI  170

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI +Y+   D+  A  VF   P    V+WT LI  +S  G + EAR +FD+ PVKD 
Sbjct  171   HTSLINLYAKFGDLGCACSVFYSSPRSDPVSWTALIDGFSSNGHLNEARKLFDQCPVKDV  230

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W ++ISGY Q+    E L LF  M   G + + + + S+LSACA  GS++IG+WVH +
Sbjct  231   VSWNAIISGYTQSGAHDEALNLFEKMVGDGFRPNVSTMASVLSACASSGSIEIGRWVHSW  290

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +++  +  N  L  +L+DMY+KCG + +A  LF E+PERD + WN MI G A  G  + A
Sbjct  291   IQENRLGSNPNLVNSLIDMYSKCGSIKIAHHLFDEMPERDRVSWNVMIGGCAHAGFYKEA  350

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + LFR MQ      P+ VTF+++   C+  G
Sbjct  351   LSLFRRMQ--LFEEPNEVTFLTILPVCAQLG  379


 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/206 (28%), Positives = 94/206 (46%), Gaps = 32/206 (16%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            +++++     +   N +I  +   G     + +++ M+  G  P+  T+  +L AC +  
Sbjct  220  KLFDQCPVKDVVSWNAIISGYTQSGAHDEALNLFEKMVGDGFRPNVSTMASVLSACASSG  279

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  +GR +H    +     +  + NSLI MYS                 +C         
Sbjct  280  SIEIGRWVHSWIQENRLGSNPNLVNSLIDMYS-----------------KC---------  313

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 G +  A  +FDE P +DR  W  MI G      +KE L LFR MQ+   + +E  
Sbjct  314  -----GSIKIAHHLFDEMPERDRVSWNVMIGGCAHAGFYKEALSLFRRMQLFE-EPNEVT  367

Query  387  LVSILSACAHLGSLDIGKWVHRYVEK  310
             ++IL  CA LG+LD+GKW+H Y++K
Sbjct  368  FLTILPVCAQLGALDLGKWIHAYIDK  393


 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 76/307 (25%), Positives = 135/307 (44%), Gaps = 68/307 (22%)
 Frame = -2

Query  864  LLKGELSRTMEMYKHMLK---TGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFL  694
            LL   LS   ++   + K   T    D+ TL +LL++C +M+     + IH Q  K G  
Sbjct  7    LLSPPLSSPQQLPLSISKLRHTNSIKDHPTL-FLLQSCTSMKQL---KQIHAQFFKTGLH  62

Query  693  MDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDET  514
             D +  + +I   S                          IS +   GD+  A L+F   
Sbjct  63   NDQFALSKIIEFCS--------------------------ISPF---GDLDFAHLLFGTI  93

Query  513  PVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
               ++ +W ++I G+  ++   + L L+  M ++    +      +L +CA   +++ G+
Sbjct  94   SEPNQFIWNTLIRGHSLSSTPMDSLSLYIAMLLSLTPPNNYTFPFLLKSCACELAVEEGR  153

Query  333  WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLA--------------------------  232
             +H  + K  + ++  + T+L+++YAK G LG A                          
Sbjct  154  QIHGQIIKFDLELDPFIHTSLINLYAKFGDLGCACSVFYSSPRSDPVSWTALIDGFSSNG  213

Query  231  -----QKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLF  67
                 +KLF + P +DV+ WNA+ISG+  +G  + A+ LF +M  D G RP+  T  S+ 
Sbjct  214  HLNEARKLFDQCPVKDVVSWNAIISGYTQSGAHDEALNLFEKMVGD-GFRPNVSTMASVL  272

Query  66   TACSCSG  46
            +AC+ SG
Sbjct  273  SACASSG  279



>ref|XP_009381432.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800-like 
[Musa acuminata subsp. malaccensis]
Length=513

 Score =   255 bits (651),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 126/311 (41%), Positives = 186/311 (60%), Gaps = 2/311 (1%)
 Frame = -2

Query  939  TYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKAC  760
             Y   ++  I  P+    N +I+   L       + ++ HM ++ + PD++T P++LKAC
Sbjct  71   AYALALFRSIPSPSTFPHNLLIRVHTLLSSPIPALLLFAHMRRSSVAPDSHTFPFVLKAC  130

Query  759  GNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPS-RCVVAW  583
              + S NLGRS+H Q LKFGF  D YV NSLI  Y+S   +  AQ +FDE PS R VV +
Sbjct  131  ARLRSPNLGRSLHSQALKFGFAADLYVRNSLISTYNSCLSLLEAQGLFDECPSARDVVTY  190

Query  582  TVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQ  403
              LI  Y + GD   AR +FD+ P +D   WG++++GY Q   F+E +  F  M  TG +
Sbjct  191  NTLIDGYVKAGDFAFARKLFDDMPERDVVSWGTLLAGYSQMGQFEEAISFFDQMLATGTR  250

Query  402  ADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKL  223
             DE  LVS+LS CA LG LD G+ +H Y++K    +NV L T LVDMYAKCGC+ +A ++
Sbjct  251  PDEVALVSVLSCCAQLGKLDRGEAIHEYIKKNRAKLNVYLSTGLVDMYAKCGCISVAVEI  310

Query  222  FYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGM  43
            F   P +++  WNA+I G A++G+G+ ++  F  M+   G  PDGVTF+ +  ACS +G+
Sbjct  311  FESTPRKNLFTWNAIIVGLAVHGNGQLSLEYFDRMRA-VGVEPDGVTFLGVLVACSHAGL  369

Query  42   AHEGLKLLEKI  10
                  L +++
Sbjct  370  IEMARSLFDEM  380


 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 54/272 (20%), Positives = 114/272 (42%), Gaps = 33/272 (12%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            G+  +  ++++ + +  +    T++  +   G+    +  +  ML TG  PD   L  +L
Sbjct  201  GDFAFARKLFDDMPERDVVSWGTLLAGYSQMGQFEEAISFFDQMLATGTRPDEVALVSVL  260

Query  768  KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
              C  +   + G +IH    K    ++ Y+   L+ MY        A+C           
Sbjct  261  SCCAQLGKLDRGEAIHEYIKKNRAKLNVYLSTGLVDMY--------AKC-----------  301

Query  588  AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
                        G +  A  +F+ TP K+   W ++I G   +   +  L+ F  M+  G
Sbjct  302  ------------GCISVAVEIFESTPRKNLFTWNAIIVGLAVHGNGQLSLEYFDRMRAVG  349

Query  408  VQADEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLA  232
            V+ D    + +L AC+H G +++ + +   +E + G+   ++    + D+  + G +   
Sbjct  350  VEPDGVTFLGVLVACSHAGLIEMARSLFDEMESIYGVERELKHYGCMADLLGRAGLVEET  409

Query  231  QKLFYELPER-DVICWNAMISGFAMNGDGENA  139
             ++   +P + D   W  M++G  + G+ E A
Sbjct  410  MEMIKGMPMKGDAYVWGGMLAGCRIQGNVEIA  441



>ref|XP_009402625.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Musa acuminata subsp. malaccensis]
Length=551

 Score =   256 bits (654),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/348 (34%), Positives = 209/348 (60%), Gaps = 5/348 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H +V+   L  + +  +++++ CS    G   Y   +++ +++P   + N MI+++  
Sbjct  30    RVHARVVVSALSQSCYLATQIISVCSAG--GRLEYAALVFDHVEEPNAFLYNEMIRSYAK  87

Query  858   KGELSRTMEMYKHMLKTG-MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                    + +YK M++   +  D +T P+++KAC  +   +LGR +H +  K G   +S 
Sbjct  88    NSHFLEAVGLYKQMVRQDHVFADGFTYPFVIKACAGLPVLHLGRQVHARVSKSGLGSNSI  147

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             + NSLI MY+  DD+  A C+FDEM  R V++W ++I+ ++R G + +AR +FD  P + 
Sbjct  148   IQNSLIEMYTKCDDLVDAHCLFDEMAERDVISWNMMITAHARSGQMRKARALFDTMPKRS  207

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W ++ISGY  + C+ + +++F  MQ  G++ D+  +VS+L ACAHLG+L++GKW+H 
Sbjct  208   VVSWTALISGYTSSGCYSDAIKVFHRMQSEGLEPDDISIVSVLPACAHLGALELGKWIHA  267

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             +  K  +     +  AL++MYAKCG +  A +LF ++ +RDVI W+ MI G A +G   +
Sbjct  268   FCNKRKLLEKTFICNALMEMYAKCGSIDQAHQLFGDMRDRDVISWSTMIGGLATHGRALD  327

Query  141   AMRLFREMQNDAG--TRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             A++LF EM+ + G   RP+ +TF+ L +ACS +G+  EGL   E + +
Sbjct  328   AIKLFVEMEEEKGKRVRPNCITFLGLLSACSHAGLVDEGLWYFESMKK  375


 Score = 88.2 bits (217),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 126/267 (47%), Gaps = 32/267 (12%)
 Frame = -2

Query  924  IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
            +++ + + ++     +I  +   G  S  ++++  M   G+ PD+ ++  +L AC ++ +
Sbjct  199  LFDTMPKRSVVSWTALISGYTSSGCYSDAIKVFHRMQSEGLEPDDISIVSVLPACAHLGA  258

Query  744  CNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISR  565
              LG+ IH  C K   L  +++ N+L+ MY+    ++ A  +F +M  R V++W+ +I  
Sbjct  259  LELGKWIHAFCNKRKLLEKTFICNALMEMYAKCGSIDQAHQLFGDMRDRDVISWSTMIGG  318

Query  564  YSRKGDVFEA-RLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
             +  G   +A +L  +    K +RV         + NC                      
Sbjct  319  LATHGRALDAIKLFVEMEEEKGKRV---------RPNCI--------------------T  349

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
             + +LSAC+H G +D G W    ++K+ G+  ++     +V + ++ GC+  A +L   +
Sbjct  350  FLGLLSACSHAGLVDEGLWYFESMKKVYGLDPDIEHYGCMVHLLSRAGCIRRAVELVDGM  409

Query  210  P-ERDVICWNAMISGFAMNGDGENAMR  133
            P   DV  W +++    ++GD E A++
Sbjct  410  PFPPDVSIWGSLLCACRIHGDVETAVK  436



>ref|XP_009795612.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g66520-like [Nicotiana sylvestris]
Length=626

 Score =   258 bits (658),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/337 (38%), Positives = 196/337 (58%), Gaps = 1/337 (0%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H Q+I  GL  +  A+ R++ FC+    G+  Y  ++++++  P   I NT+I+ +L
Sbjct  39    KQFHAQIIKLGLSCDNDAMGRVIKFCTTLESGDLNYALQMFDKLPNPDTFIYNTIIRGYL  98

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                 L  ++  Y HML+  + P+N+T P +++AC    +   G+ IHG  +KFGF  D +
Sbjct  99    QFQLLKESVLFYSHMLERSVSPNNFTFPLVIRACCIDNAVEEGKQIHGHVIKFGFGFDKF  158

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
               N+LI MY +   +E A+ V D M  +  V+WT LIS Y++ G + EA  VFD    K 
Sbjct  159   SQNNLIHMYVNFHFLEEAKWVLDHMYEKDDVSWTTLISGYAQLGYLAEAFRVFDSIAEKS  218

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MIS YV NN F +   LF  M    V  D+ I  S+LSAC  LG+L  G+W+  
Sbjct  219   SVCWNAMISAYVHNNQFHQAFALFERMMSEDVGIDKFIAASMLSACTRLGALKQGEWIVE  278

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
              V+K  + ++ +L T+++DMY KCGCL  A + F  LP + +  WN MI G AM+G GE 
Sbjct  279   QVKKSRIDLDSKLATSIIDMYCKCGCLDKALQFFKGLPRKGISSWNCMIGGLAMHGKGEA  338

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             A+ L +EM+++    PD +TFV+L +AC+ SG+  EG
Sbjct  339   AIELLKEMESER-VAPDYITFVNLLSACAHSGLIEEG  374


 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/308 (21%), Positives = 117/308 (38%), Gaps = 61/308 (20%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSD-----------------------------PNL  949
              Q HG VI  G G + F+ + L+    +                               L
Sbjct  142   KQIHGHVIKFGFGFDKFSQNNLIHMYVNFHFLEEAKWVLDHMYEKDDVSWTTLISGYAQL  201

Query  948   GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
             G     +R+++ I + +    N MI A++   +  +   +++ M+   +  D +    +L
Sbjct  202   GYLAEAFRVFDSIAEKSSVCWNAMISAYVHNNQFHQAFALFERMMSEDVGIDKFIAASML  261

Query  768   KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
              AC  + +   G  I  Q  K    +DS +  S+I MY     ++ A   F  +P + + 
Sbjct  262   SACTRLGALKQGEWIVEQVKKSRIDLDSKLATSIIDMYCKCGCLDKALQFFKGLPRKGIS  321

Query  588   AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
             +W                                 MI G   +   +  ++L + M+   
Sbjct  322   SWNC-------------------------------MIGGLAMHGKGEAAIELLKEMESER  350

Query  408   VQADEAILVSILSACAHLGSLDIGK-WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLA  232
             V  D    V++LSACAH G ++ GK + H   E+ G+   +     LVD+  + G L  A
Sbjct  351   VAPDYITFVNLLSACAHSGLIEEGKHYFHYMKEEYGIEPGMEHYGCLVDLLGRAGLLEEA  410

Query  231   QKLFYELP  208
             +K+  E+P
Sbjct  411   RKIIKEMP  418



>gb|AEP33772.1| organelle transcript processing 82, partial [Draba nemorosa]
Length=526

 Score =   255 bits (652),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/330 (39%), Positives = 198/330 (60%), Gaps = 2/330 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLK  856
             H Q+I  GL N  +ALS+L+ FC   P+     Y   ++E IQ+P + I NTM +   L 
Sbjct  7     HAQMIKTGLHNTNYALSKLIEFCVLSPHFDGLPYAISVFETIQEPNLLIWNTMFRGHALS  66

Query  855   GELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVG  676
              +    + +Y  M+  G+ P+ YT P+LLK+C   ++   G+ IHG  LK G+ +D YV 
Sbjct  67    SDPVSALYLYVCMISLGLLPNCYTFPFLLKSCAKSKAFREGQQIHGHVLKLGYDLDLYVH  126

Query  675   NSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRR  496
              SLI MY     +E A+ VFD+   R VV++T LI  Y+ +G +  A+ +FDE PVKD  
Sbjct  127   TSLISMYVQNGRLEDARKVFDQSSHRDVVSYTALIKGYASRGYIENAQKLFDEIPVKDVV  186

Query  495   VWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYV  316
              W +MISGY +   +KE L+LF+ M  T V+ DE+ +V+++SACA  GS+++G+ VH ++
Sbjct  187   SWNAMISGYAETGNYKEALELFKDMMKTNVRPDESTMVTVVSACAQSGSIELGRQVHLWI  246

Query  315   EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAM  136
             +  G   N+++  AL+D+Y+KCG +  A  LF  L  +DVI WN +I G+      + A+
Sbjct  247   DDHGFGSNLKIVNALIDLYSKCGEVETACGLFEGLSYKDVISWNTLIGGYTHMNLYKEAL  306

Query  135   RLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
              LF+EM   +G  P+ VT +S+  AC+  G
Sbjct  307   LLFQEMLR-SGESPNDVTMLSILPACAHLG  335


 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/310 (34%), Positives = 159/310 (51%), Gaps = 34/310 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ I    +   N MI  +   G     +E++K M+KT + PD  T+  ++ AC    
Sbjct  175  KLFDEIPVKDVVSWNAMISGYAETGNYKEALELFKDMMKTNVRPDESTMVTVVSACAQSG  234

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LGR +H      GF      G++L ++                           LI 
Sbjct  235  SIELGRQVHLWIDDHGF------GSNLKIV-------------------------NALID  263

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
             YS+ G+V  A  +F+    KD   W ++I GY   N +KE L LF+ M  +G   ++  
Sbjct  264  LYSKCGEVETACGLFEGLSYKDVISWNTLIGGYTHMNLYKEALLLFQEMLRSGESPNDVT  323

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKL--GMAINVRLGTALVDMYAKCGCLGLAQKLFYE  214
            ++SIL ACAHLG++DIG+W+H Y+ K   G+     L T+L+DMYAKCG +  A+++F  
Sbjct  324  MLSILPACAHLGAIDIGRWIHVYINKRLKGVTNASSLLTSLIDMYAKCGDIEAAKQVFDS  383

Query  213  LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHE  34
            +  R +  WNAMI GFAM+G    A  LF +M+ + G  PD +TFV L +ACS SGM   
Sbjct  384  MLTRSLSSWNAMIFGFAMHGKANAAFDLFSKMRKN-GIDPDDITFVGLLSACSHSGMLDL  442

Query  33   GLKLLEKIGR  4
            G  +   + +
Sbjct  443  GRHIFRSMSQ  452


 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 137/303 (45%), Gaps = 39/303 (13%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +   G G+N   ++ L+   S    G       ++E +    +   NT+I  +  
Sbjct  241   QVHLWIDDHGFGSNLKIVNALIDLYS--KCGEVETACGLFEGLSYKDVISWNTLIGGYTH  298

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIH---GQCLKFGFLMD  688
                    + +++ ML++G  P++ T+  +L AC ++ + ++GR IH    + LK G    
Sbjct  299   MNLYKEALLLFQEMLRSGESPNDVTMLSILPACAHLGAIDIGRWIHVYINKRLK-GVTNA  357

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
             S +  SLI MY+   D+E+A+ VFD M +R + +W  +I  ++  G   +A   FD    
Sbjct  358   SSLLTSLIDMYAKCGDIEAAKQVFDSMLTRSLSSWNAMIFGFAMHG---KANAAFD----  410

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWV  328
                                     LF  M+  G+  D+   V +LSAC+H G LD+G+ +
Sbjct  411   ------------------------LFSKMRKNGIDPDDITFVGLLSACSHSGMLDLGRHI  446

Query  327   HRYV-EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP-ERDVICWNAMISGFAMNG  154
              R + +   +   +     ++D+   CG    A+++   +P E D + W +++    M+ 
Sbjct  447   FRSMSQDYKITPKLEHYGCMIDLLGHCGLFKEAKEMIRTMPMEPDGVIWCSLLKACKMHN  506

Query  153   DGE  145
             + E
Sbjct  507   NVE  509


 Score = 92.4 bits (228),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 74/252 (29%), Positives = 113/252 (45%), Gaps = 44/252 (17%)
 Frame = -2

Query  732  RSIHGQCLKFGFLMDSYVGNSLI---VMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRY  562
            R IH Q +K G    +Y  + LI   V+    D +  A  VF+ +    ++ W  +   +
Sbjct  4    RMIHAQMIKTGLHNTNYALSKLIEFCVLSPHFDGLPYAISVFETIQEPNLLIWNTMFRGH  63

Query  561  SRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNC---------------FKEGLQLFR  427
            +   D           PV    ++  MIS  +  NC               F+EG Q+  
Sbjct  64   ALSSD-----------PVSALYLYVCMISLGLLPNCYTFPFLLKSCAKSKAFREGQQIHG  112

Query  426  LMQMTGVQADEAILVSILSACAHLGSLDIGKWV-----HRYVEKLGMAINVRLGTALVDM  262
             +   G   D  +  S++S     G L+  + V     HR         +V   TAL+  
Sbjct  113  HVLKLGYDLDLYVHTSLISMYVQNGRLEDARKVFDQSSHR---------DVVSYTALIKG  163

Query  261  YAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVT  82
            YA  G +  AQKLF E+P +DV+ WNAMISG+A  G+ + A+ LF++M      RPD  T
Sbjct  164  YASRGYIENAQKLFDEIPVKDVVSWNAMISGYAETGNYKEALELFKDMMK-TNVRPDEST  222

Query  81   FVSLFTACSCSG  46
             V++ +AC+ SG
Sbjct  223  MVTVVSACAQSG  234



>ref|XP_010318680.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800 
[Solanum lycopersicum]
Length=531

 Score =   255 bits (652),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 133/351 (38%), Positives = 210/351 (60%), Gaps = 9/351 (3%)
 Frame = -2

Query  1038  QAHGQVITCGL---GNNTFALSRLLA-----FCSDPNLGNPTYGWRIYERIQQPTICIVN  883
             Q H Q +T G     N+TF L+++L        S P+     Y   I+  I  P+    N
Sbjct  29    QVHAQSVTNGFLFSFNSTFILTQILHSFTSLLSSLPSQPTTRYPSAIFNLIHSPSTFCYN  88

Query  882   TMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKF  703
             T+I+A  L    + +   +  M +  + PD++T P++LKACG + S  LG+++H Q LKF
Sbjct  89    TIIRAHTLLASPNTSFFYFIKMRRNSVPPDSHTFPFVLKACGLLNSLFLGKTLHSQALKF  148

Query  702   GFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVF  523
             GFL+D++V N+L+ +Y+    +  A+ VFDE   R VV++ ++I  Y + G++ EAR VF
Sbjct  149   GFLVDAFVCNNLVHVYTVSGSIGDARKVFDESCDRDVVSYNLIIDGYVKAGEIGEAREVF  208

Query  522   DETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLD  343
             DE PV+D   +G++++GY + N  +  ++LF  M M  V+ D   LVS LSACA +G L+
Sbjct  209   DEMPVRDAVSYGTLLAGYAKMNQCRNAIELFDQMVMLNVKVDNVALVSALSACAQMGELE  268

Query  342   IGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFA  163
              GK +H Y+++  +AI+  L T LVD+YAKCGC+ +A++LF    ++ V  WNAM+ G A
Sbjct  269   KGKTIHDYIKRKRIAIDSYLCTGLVDLYAKCGCIDIARELFEMSKDKKVFSWNAMLVGLA  328

Query  162   MNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             M+G G+     F  M  + G +PDGVTF++L   C+  G+ HE  +  E++
Sbjct  329   MHGYGQLLFDYFSRMV-ETGVQPDGVTFLALLVGCNHGGLIHEARRFFEEM  378



>gb|AEP33769.1| organelle transcript processing 82, partial [Olimarabidopsis 
pumila]
Length=710

 Score =   259 bits (662),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 129/330 (39%), Positives = 199/330 (60%), Gaps = 2/330 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLK  856
             H Q+I  GL N  +ALS+LL  C   P+     Y   +++ IQ+P + I NTM +   L 
Sbjct  22    HAQMIKTGLHNTNYALSKLLEXCVLSPHFDGLPYAISVFDTIQEPXLLIWNTMFRGHALS  81

Query  855   GELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVG  676
              +    +++Y  M+  G+ P++YT P+LLK+C    +   G+ +HGQ LKFGF +D Y+ 
Sbjct  82    SDPVSALKLYVCMVSLGLLPNSYTFPFLLKSCAKSXAFKEGQQLHGQVLKFGFDLDLYIH  141

Query  675   NSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRR  496
              SLI MY     +E AQ V D+   R VV++T LI+ Y+ +G +  A  +FDE PVKD  
Sbjct  142   TSLISMYVQNGRLEDAQKVXDKSSHRDVVSYTALITGYASRGXIESAHKMFDEIPVKDVV  201

Query  495   VWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYV  316
              W + ISGY +   +KE L+LF+ M  T V+ DE+ +V++LSACA  GS+++G+ VH ++
Sbjct  202   SWNAXISGYAETGNYKEALELFKKMMKTNVRPDESTMVTVLSACAQSGSIELGRQVHSWI  261

Query  315   EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAM  136
                G   N+++  AL+D+Y+KCG L  A  LF  L  +DVI WN +I G+      + A+
Sbjct  262   NDHGFGXNLKIVNALIDLYSKCGELETACGLFQGLSNKDVISWNTLIGGYTHMNLYKEAL  321

Query  135   RLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
              LF++M   +G +P+ VT +S+ +AC+  G
Sbjct  322   LLFQDMLR-SGEKPNDVTMLSILSACAHLG  350


 Score =   185 bits (470),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 103/310 (33%), Positives = 162/310 (52%), Gaps = 34/310 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ I    +   N  I  +   G     +E++K M+KT + PD  T+  +L AC    
Sbjct  190  KMFDEIPVKDVVSWNAXISGYAETGNYKEALELFKKMMKTNVRPDESTMVTVLSACAQSG  249

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LGR +H      GF  +  + N+LI +YS   ++E+A  +F  + ++ V++      
Sbjct  250  SIELGRQVHSWINDHGFGXNLKIVNALIDLYSKCGELETACGLFQGLSNKDVIS------  303

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                                     W ++I GY   N +KE L LF+ M  +G + ++  
Sbjct  304  -------------------------WNTLIGGYTHMNLYKEALLLFQDMLRSGEKPNDVT  338

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKL--GMAINVRLGTALVDMYAKCGCLGLAQKLFYE  214
            ++SILSACAHLG++DIG+W+H Y++K   G+     L T+L+DMYAKCG +  AQ++F  
Sbjct  339  MLSILSACAHLGAIDIGRWIHVYIDKRLKGVTNASSLRTSLIDMYAKCGDIEAAQQVFDS  398

Query  213  LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHE  34
            +  R +  WNAMI GFAM+G    A  +F  M+ + G  PD +TFV L +ACS SGM   
Sbjct  399  MLNRSLSSWNAMIFGFAMHGRANAAFDIFSRMRKN-GIEPDDITFVGLLSACSHSGMLDL  457

Query  33   GLKLLEKIGR  4
            G  +   + R
Sbjct  458  GRHIFRSMTR  467


 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/261 (28%), Positives = 119/261 (46%), Gaps = 25/261 (10%)
 Frame = -2

Query  792  NYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLI---VMYSSLDDMESAQC  622
            N+    LL  C  ++S    R IH Q +K G    +Y  + L+   V+    D +  A  
Sbjct  2    NHPSLSLLHXCKTLQSL---RIIHAQMIKTGLHNTNYALSKLLEXCVLSPHFDGLPYAIS  58

Query  621  VFDEMPSRCVVAWTVLISRYSRKGDVFEARLVF----DETPVKDRRVWGSMISGYVQNNC  454
            VFD +    ++ W  +   ++   D   A  ++        + +   +  ++    ++  
Sbjct  59   VFDTIQEPXLLIWNTMFRGHALSSDPVSALKLYVCMVSLGLLPNSYTFPFLLKSCAKSXA  118

Query  453  FKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWV-----HRYVEKLGMAINV  289
            FKEG QL   +   G   D  I  S++S     G L+  + V     HR         +V
Sbjct  119  FKEGQQLHGQVLKFGFDLDLYIHTSLISMYVQNGRLEDAQKVXDKSSHR---------DV  169

Query  288  RLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQND  109
               TAL+  YA  G +  A K+F E+P +DV+ WNA ISG+A  G+ + A+ LF++M   
Sbjct  170  VSYTALITGYASRGXIESAHKMFDEIPVKDVVSWNAXISGYAETGNYKEALELFKKMMK-  228

Query  108  AGTRPDGVTFVSLFTACSCSG  46
               RPD  T V++ +AC+ SG
Sbjct  229  TNVRPDESTMVTVLSACAQSG  249


 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 67/302 (22%), Positives = 129/302 (43%), Gaps = 37/302 (12%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +   G G N   ++ L+   S    G       +++ +    +   NT+I  +  
Sbjct  256   QVHSWINDHGFGXNLKIVNALIDLYS--KCGELETACGLFQGLSNKDVISWNTLIGGYTH  313

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    + +++ ML++G  P++ T+  +L AC ++ + ++GR IH            Y+
Sbjct  314   MNLYKEALLLFQDMLRSGEKPNDVTMLSILSACAHLGAIDIGRWIH-----------VYI  362

Query  678   GNSL--IVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
                L  +   SSL                     T LI  Y++ GD+  A+ VFD    +
Sbjct  363   DKRLKGVTNASSLR--------------------TSLIDMYAKCGDIEAAQQVFDSMLNR  402

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
                 W +MI G+  +        +F  M+  G++ D+   V +LSAC+H G LD+G+ + 
Sbjct  403   SLSSWNAMIFGFAMHGRANAAFDIFSRMRKNGIEPDDITFVGLLSACSHSGMLDLGRHIF  462

Query  324   RYVEK-LGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP-ERDVICWNAMISGFAMNGD  151
             R + +   +   +     ++D+    G    A+K+   +  E D + W +++    M+G+
Sbjct  463   RSMTRDYKLMPKLEHYGCMIDLXGHSGLFKEAEKMINTMEMEPDGVIWCSLLKACKMHGN  522

Query  150   GE  145
              E
Sbjct  523   VE  524



>ref|XP_009131053.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305 
[Brassica rapa]
Length=533

 Score =   255 bits (651),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 140/350 (40%), Positives = 204/350 (58%), Gaps = 7/350 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H  +IT GL       SR L+F +    G+  Y +R   R+  P     N +I+ F  
Sbjct  27    KTHALLITLGLSEEEPFASRALSFSALSPSGDVDYAYRFLTRLPNPPAFSWNFVIRGFSN  86

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                  RT+  Y  ML+ G  PD+ T P+LLK+   + +  LG S+H   +K GF+ D Y+
Sbjct  87    SKTPERTIRAYIQMLRNGFSPDHMTYPFLLKSNSRLMNRKLGGSLHSSVVKNGFVWDLYI  146

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSLI MY SL D  SA+ VFDEMP + +V W  ++  Y++ GDV  AR VFDE   +D 
Sbjct  147   CNSLIHMYGSLRDSVSARKVFDEMPDKNLVTWNSILDGYAKCGDVVSARQVFDEMTERDV  206

Query  498   RVWGSMISGYVQNNCFKEGLQLF-RLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
               W SM+ GYV++  + E L++F  +M+++ ++A+E  +VS+L ACAHLG+L+ GK VHR
Sbjct  207   VSWSSMVDGYVKSGEYSEALEVFDEMMRVSNIKANEVTMVSVLCACAHLGALNRGKAVHR  266

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLF--YELPERDVICWNAMISGFAMNGDG  148
             Y+    + + V L T+L+DMYAK G +G A  +F    + E DV+ WNAMI G A +G  
Sbjct  267   YIVDKHLPLTVMLQTSLIDMYAKSGSIGDAWGVFCGANVKETDVLMWNAMIGGLASHGFI  326

Query  147   ENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG---LKLLEKIG  7
               +++LF +MQ ++   PD +TF+ L  ACS  G+  E     K LEK G
Sbjct  327   RESLQLFHKMQ-ESEFEPDEITFLCLLAACSHGGLVKEAWYLFKSLEKSG  375


 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 123/274 (45%), Gaps = 35/274 (13%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLK-TGMCPDNYTLPYL  772
            G+     ++++ + +  +   ++M+  ++  GE S  +E++  M++ + +  +  T+  +
Sbjct  189  GDVVSARQVFDEMTERDVVSWSSMVDGYVKSGEYSEALEVFDEMMRVSNIKANEVTMVSV  248

Query  771  LKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCV  592
            L AC ++ + N G+++H                               + + D+     V
Sbjct  249  LCACAHLGALNRGKAVH-------------------------------RYIVDKHLPLTV  277

Query  591  VAWTVLISRYSRKGDVFEARLVFDETPVKDRRV--WGSMISGYVQNNCFKEGLQLFRLMQ  418
            +  T LI  Y++ G + +A  VF    VK+  V  W +MI G   +   +E LQLF  MQ
Sbjct  278  MLQTSLIDMYAKSGSIGDAWGVFCGANVKETDVLMWNAMIGGLASHGFIRESLQLFHKMQ  337

Query  417  MTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLG  238
             +  + DE   + +L+AC+H G +    ++ + +EK G          +VD+ ++ G + 
Sbjct  338  ESEFEPDEITFLCLLAACSHGGLVKEAWYLFKSLEKSGAEPKSEHYACMVDVLSRAGLVK  397

Query  237  LAQKLFYELP-ERDVICWNAMISGFAMNGDGENA  139
             A     E+P E       A+++G   +GD E A
Sbjct  398  DAYGFISEMPMEPTGSMLGALLNGCINHGDWELA  431



>gb|KDP32370.1| hypothetical protein JCGZ_13295 [Jatropha curcas]
Length=736

 Score =   259 bits (663),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/331 (39%), Positives = 198/331 (60%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q+I  GL    FALS+L+ FC+    G+ +Y   +++ I++P   I N +I+ F L
Sbjct  48    QIHSQIIKTGLHKTQFALSKLIEFCAISPFGDLSYALLLFDTIEKPNQVIWNNIIRGFSL  107

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 +  +E Y HM+ +G+ P++YT P++LK+C  +   + G+ IH   LK G   D++V
Sbjct  108   SESPNLAIEYYVHMILSGVNPNSYTFPFVLKSCAKIALPHEGKQIHAHILKLGLENDAFV  167

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   ++E A+ VFD+   R VV++T LI+ Y+  G + EAR +FDE PV+D 
Sbjct  168   HTSLITMYAQNCELEHARLVFDKSSMRDVVSFTALITGYASSGFMDEARELFDEIPVRDV  227

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MISGY Q+  F+E L LF  M    V  + + ++S+LSAC+  GS+ +G WV  +
Sbjct  228   VSWNAMISGYTQSGQFEEALALFEEMHRASVTPNMSTMLSVLSACSQSGSIKVGNWVCSW  287

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E+ G+  N++L  ALVDMYAKCG L  A  LF  +  ++V+ WN MI G+      + A
Sbjct  288   IEERGLGSNIKLVNALVDMYAKCGDLEKANNLFESVENKNVVSWNVMIGGYTHMSCYKEA  347

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + LFR M   +   P+ VT +S+  AC+  G
Sbjct  348   LELFRRML-QSNLEPNDVTLLSILPACANLG  377


 Score =   159 bits (403),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/296 (31%), Positives = 154/296 (52%), Gaps = 33/296 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
             +++ I    +   N MI  +   G+    + +++ M +  + P+  T+  +L AC    
Sbjct  217  ELFDEIPVRDVVSWNAMISGYTQSGQFEEALALFEEMHRASVTPNMSTMLSVLSACSQSG  276

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  +G  +     + G   +  + N+L+ MY        A+C                  
Sbjct  277  SIKVGNWVCSWIEERGLGSNIKLVNALVDMY--------AKC------------------  310

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 GD+ +A  +F+    K+   W  MI GY   +C+KE L+LFR M  + ++ ++  
Sbjct  311  -----GDLEKANNLFESVENKNVVSWNVMIGGYTHMSCYKEALELFRRMLQSNLEPNDVT  365

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKLGMAI-NVRLGTALVDMYAKCGCLGLAQKLFYEL  211
            L+SIL ACA+LG L +GKW+H Y++K    + N  L T+L+ MYAKCG +  A+++F E+
Sbjct  366  LLSILPACANLGDLGLGKWIHAYIDKNRQRMANGALWTSLIYMYAKCGNIEAAKQIFDEM  425

Query  210  PERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGM  43
              + +  WNAMISGFAM+G  + A+ LF  M N+ G  PD +TFV + +AC+ +G+
Sbjct  426  NPKSLASWNAMISGFAMHGHADIALNLFSRMTNE-GFIPDNITFVGVLSACNHAGL  480


 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 67/285 (24%), Positives = 122/285 (43%), Gaps = 42/285 (15%)
 Frame = -2

Query  1011  GLGNN---TFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSR  841
             GLG+N     AL  + A C D    N      ++E ++   +   N MI  +        
Sbjct  292   GLGSNIKLVNALVDMYAKCGDLEKAN-----NLFESVENKNVVSWNVMIGGYTHMSCYKE  346

Query  840   TMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLM-DSYVGNSLI  664
              +E+++ ML++ + P++ TL  +L AC N+    LG+ IH    K    M +  +  SLI
Sbjct  347   ALELFRRMLQSNLEPNDVTLLSILPACANLGDLGLGKWIHAYIDKNRQRMANGALWTSLI  406

Query  663   VMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGS  484
              MY+   ++E+A+ +FDEM  + + +W                                +
Sbjct  407   YMYAKCGNIEAAKQIFDEMNPKSLASWN-------------------------------A  435

Query  483   MISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK-WVHRYVEKL  307
             MISG+  +      L LF  M   G   D    V +LSAC H G LD+G+ +    +++ 
Sbjct  436   MISGFAMHGHADIALNLFSRMTNEGFIPDNITFVGVLSACNHAGLLDLGRQYFSSMIQQY  495

Query  306   GMAINVRLGTALVDMYAKCGCLGLAQKLFYELPER-DVICWNAMI  175
              ++  ++    ++ +  + G    A+ L   +  + D   W +++
Sbjct  496   NISPKLQHYGCMIGLLGRAGLFDEAEILMKNMEMKPDGAIWGSLL  540



>ref|XP_006586001.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g40405-like isoform X3 [Glycine max]
Length=553

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/346 (37%), Positives = 202/346 (58%), Gaps = 4/346 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q++  G+ NN     + +A  +  N  N  Y  ++      PT+  +N+MI+A+  
Sbjct  27    QIHAQLVVKGILNNPHFHGQFVATIALHNTTNLDYANKLLNHNNNPTLFTLNSMIRAYSK  86

Query  858   KGELSRTMEMYKHMLKTG---MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMD  688
                 S++   Y ++L +    + PDNYT  +L++ C  +++   G  +HG  +K GF +D
Sbjct  87    SSTPSKSFHFYANILHSNNNNLSPDNYTFTFLVRTCAQLQAHVTGLCVHGAVIKHGFELD  146

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
              +V   L+ MY+ L  + S   VFD      +V  T +++  ++ GD+  AR +FDE P 
Sbjct  147   PHVQTGLVFMYAELGCLSSCHNVFDGAVEPDLVTQTAMLNACAKCGDIDFARKMFDEMPE  206

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWV  328
             +D   W +MI+GY Q    +E L +F LMQM GV+ +E  +V +LSAC HL  LD G+WV
Sbjct  207   RDHVTWNAMIAGYAQCGRSREALDVFHLMQMEGVKLNEVSMVLVLSACTHLQVLDHGRWV  266

Query  327   HRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDG  148
             H YVE+  + + V LGTALVDMYAKCG +  A ++F+ + ER+V  W++ I G AMNG G
Sbjct  267   HAYVERYKVRMTVTLGTALVDMYAKCGNVDRAMQVFWGMKERNVYTWSSAIGGLAMNGFG  326

Query  147   ENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             E ++ LF +M+ + G +P+G+TF+S+   CS  G+  EG K  + +
Sbjct  327   EESLDLFNDMKRE-GVQPNGITFISVLKGCSVVGLVEEGRKHFDSM  371



>ref|XP_006450596.1| hypothetical protein CICLE_v10010742mg [Citrus clementina]
 gb|ESR63836.1| hypothetical protein CICLE_v10010742mg [Citrus clementina]
Length=605

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/351 (36%), Positives = 207/351 (59%), Gaps = 8/351 (2%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              + H Q++   L  + F +++++  C+    G+  Y   +++++++P + + N MI+A+ 
Sbjct  31    KKIHTQILKYLLSQSNFLVTKMIDVCNSG--GDLAYASLLFKQVKEPNVFLYNAMIRAYT  88

Query  861   LKGELSRTMEMYKHMLK---TG--MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGF  697
                     + +YK ML+   TG  + PD +TLP+++K+C  +   +LG+ IH    KFG 
Sbjct  89    NNHLYGLAINLYKQMLRDPRTGSLILPDKFTLPFVIKSCAGLLCPSLGKQIHAHVCKFGL  148

Query  696   LMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDE  517
                S   N+L+ +Y   D++  A  VF+EM  R +VAW  LIS Y+R G + +AR++FD+
Sbjct  149   KSHSITENALLDLYGKCDELIEAHKVFEEMTDRDIVAWNNLISGYARLGQMKKARMLFDK  208

Query  516   TPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIG  337
              P K    W +MISGY     + E L +FR MQM G++ DE  +VS+L ACA LGSL++G
Sbjct  209   MPYKTIVSWTAMISGYTHIGSYAEALDVFRQMQMVGIEPDEISIVSVLPACAQLGSLELG  268

Query  336   KWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMN  157
             +W+H Y +K  +     +  AL++MY KCGC+  A +LF ++ ERDV+ W+ +I G A +
Sbjct  269   EWIHMYCDKNHLLRRTVICNALIEMYIKCGCINQASQLFDQMVERDVVSWSTVIGGLANH  328

Query  156   GDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             G    A+ LF EMQ      P+ +TF+ L +AC+ +G  +EGL   + + R
Sbjct  329   GKAHKAIHLFHEMQR-LKVPPNDITFIGLLSACAHTGFWNEGLMYFDSMKR  378


 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 120/279 (43%), Gaps = 71/279 (25%)
 Frame = -2

Query  774  LLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRC  595
            +L++C N+      + IH Q LK+     +++   +I + +S  D+  A  +F ++    
Sbjct  20   ILQSCENLIEL---KKIHTQILKYLLSQSNFLVTKMIDVCNSGGDLAYASLLFKQV----  72

Query  594  VVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLM--  421
                        ++ +VF               ++ +MI  Y  N+ +   + L++ M  
Sbjct  73   ------------KEPNVF---------------LYNAMIRAYTNNHLYGLAINLYKQMLR  105

Query  420  -QMTG--VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKC  250
               TG  +  D+  L  ++ +CA L    +GK +H +V K G+  +     AL+D+Y KC
Sbjct  106  DPRTGSLILPDKFTLPFVIKSCAGLLCPSLGKQIHAHVCKFGLKSHSITENALLDLYGKC  165

Query  249  GCLGLAQKLFYELPERDVICWN-------------------------------AMISGFA  163
              L  A K+F E+ +RD++ WN                               AMISG+ 
Sbjct  166  DELIEAHKVFEEMTDRDIVAWNNLISGYARLGQMKKARMLFDKMPYKTIVSWTAMISGYT  225

Query  162  MNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
              G    A+ +FR+MQ   G  PD ++ VS+  AC+  G
Sbjct  226  HIGSYAEALDVFRQMQM-VGIEPDEISIVSVLPACAQLG  263



>ref|XP_010940912.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Elaeis guineensis]
Length=566

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/342 (39%), Positives = 203/342 (59%), Gaps = 7/342 (2%)
 Frame = -2

Query  1038  QAHGQVITCG-LGNNTFA--LSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKA  868
             Q H  + T   L   T A  LSRLL FC+    G+  Y   ++ R+  PT+   N MI+A
Sbjct  49    QIHAHITTSPHLDPRTAASLLSRLLFFCATSPAGSLPYASALFRRLPSPTLSAYNAMIRA  108

Query  867   FLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMD  688
             + +       + +Y  ML  G+ PD+ T P+L K C        GRS+H    K G  +D
Sbjct  109   YAMPSSPLIPLSLYVQMLAAGVRPDHLTFPFLFKHCSLRLDSAAGRSLHAHVSKLGLHLD  168

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
              +V N++I MYS+   ++SA+ +F+EMP R VV+W  ++  Y R G++  A  +F +   
Sbjct  169   IFVQNAMIYMYSTCGLVDSARRLFEEMPHRDVVSWNSILIGYLRCGELDLALHLFLDMKE  228

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG---VQADEAILVSILSACAHLGSLDIG  337
             ++ R W S+I+G+ Q    +E L LF  MQ +     + D+  + S++SACA LG+LD G
Sbjct  229   RNTRTWNSIITGFAQGGRSREALALFHEMQHSANECAKPDKVTVASVVSACASLGALDQG  288

Query  336   KWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMN  157
             KWVH Y+++ G+  +V +GTAL+DMY KCGC+  A ++F E+P +DV+ W AMIS FA++
Sbjct  289   KWVHGYLKRHGLEFDVVIGTALIDMYGKCGCVERAVEVFQEMPNKDVLAWTAMISAFAIH  348

Query  156   GDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             G GE A  L  EM+   GT+P+ VTF +L +AC+ +G+  +G
Sbjct  349   GLGEEAFGLLEEMERH-GTKPNYVTFGALLSACAHAGLVEKG  389


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/257 (24%), Positives = 109/257 (42%), Gaps = 36/257 (14%)
 Frame = -2

Query  885  NTMIKAFLLKGELSRTMEMYKHMLKTG---MCPDNYTLPYLLKACGNMESCNLGRSIHGQ  715
            N++I  F   G     + ++  M  +      PD  T+  ++ AC ++ + + G+ +HG 
Sbjct  235  NSIITGFAQGGRSREALALFHEMQHSANECAKPDKVTVASVVSACASLGALDQGKWVHGY  294

Query  714  CLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEA  535
              + G   D  +G +LI MY                  +C              G V  A
Sbjct  295  LKRHGLEFDVVIGTALIDMYG-----------------KC--------------GCVERA  323

Query  534  RLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHL  355
              VF E P KD   W +MIS +  +   +E   L   M+  G + +     ++LSACAH 
Sbjct  324  VEVFQEMPNKDVLAWTAMISAFAIHGLGEEAFGLLEEMERHGTKPNYVTFGALLSACAHA  383

Query  354  GSLDIGKWVHRYVEKLGM-AINVRLGTALVDMYAKCGCLGLAQKLFYELP-ERDVICWNA  181
            G ++ G W    ++++ +    ++    +VD+  + G    A++L   +P E D   W A
Sbjct  384  GLVEKGWWCFNVMKQIYLIEPQLQHYACMVDLLGRAGLFEEAERLIRSMPMEPDSYVWGA  443

Query  180  MISGFAMNGDGENAMRL  130
            ++    M+G+ E   R+
Sbjct  444  LLGACRMHGNVELGERV  460



>gb|ACP39950.1| pentatricopeptide repeat protein [Gossypium hirsutum]
 gb|ACP39951.1| pentatricopeptide repeat protein [Gossypium hirsutum]
Length=532

 Score =   254 bits (650),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/359 (36%), Positives = 228/359 (64%), Gaps = 3/359 (1%)
 Frame = -2

Query  1095  STGRClkllekcknlkqLSQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYE  916
             ++ RCL LLE+C+ + Q+ Q H  +I      + FA  ++++  +  +  + ++ ++++ 
Sbjct  9     ASQRCLSLLEQCRTMSQIKQMHSHLIVSASRLDPFAAGKIISLFAVSSNADISHAYKLFL  68

Query  915   RIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNL  736
              +   T  I NT+I+ F+ K E +  + +YK+ML+TG  P+NYT  ++L+AC   ++  +
Sbjct  69    SLPHRTTFIWNTIIRIFVEKNENATALSLYKNMLQTGFLPNNYTFSFVLRAC--TDNSPV  126

Query  735   GRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSR  556
             G + H Q +K G+    +V N LI +Y++   +E+A+ +FD    R V+ WT LI+ Y +
Sbjct  127   GLASHAQVIKLGWESYDFVLNGLIHLYANWSSVEAARKLFDVSTCRDVITWTALINGYVK  186

Query  555   KGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSI  376
              G V  AR +FD+ P ++   W +MI+GYV    F+E L+LF  +Q+TG++ + A +V  
Sbjct  187   SGHVEFARELFDQMPERNEVSWSAMITGYVHMGMFREALELFNDLQLTGLRPNHAGIVGA  246

Query  375   LSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDV  196
             L+AC++LGSLD G+W+H YV++ G  ++  LGTALVDMYAKCGC+ +A  +F ++P++D 
Sbjct  247   LTACSYLGSLDHGRWIHAYVDRNGTELDRVLGTALVDMYAKCGCIEIACSVFEKMPDKDA  306

Query  195   ICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLL  19
               + ++ISG A +G   +A++LF  MQ++    P+ VTF+ + +ACS  G+  EGL++ 
Sbjct  307   FAFTSLISGLANHGQSADAIQLFGRMQSEK-VIPNEVTFICVLSACSRMGLVDEGLRIF  364


 Score = 79.3 bits (194),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 64/270 (24%), Positives = 121/270 (45%), Gaps = 33/270 (12%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            G+  +   +++++ +      + MI  ++  G     +E++  +  TG+ P++  +   L
Sbjct  188  GHVEFARELFDQMPERNEVSWSAMITGYVHMGMFREALELFNDLQLTGLRPNHAGIVGAL  247

Query  768  KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
             AC  + S + GR IH    + G  +D  +G +L+ MY+    +E A  VF++M      
Sbjct  248  TACSYLGSLDHGRWIHAYVDRNGTELDRVLGTALVDMYAKCGCIEIACSVFEKM------  301

Query  588  AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
                                     P KD   + S+ISG   +    + +QLF  MQ   
Sbjct  302  -------------------------PDKDAFAFTSLISGLANHGQSADAIQLFGRMQSEK  336

Query  408  VQADEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLA  232
            V  +E   + +LSAC+ +G +D G  +   +  + G+   V+    +VD+  + G L  A
Sbjct  337  VIPNEVTFICVLSACSRMGLVDEGLRIFNCMSVVYGIEPGVQHYGCMVDLLGRAGLLEEA  396

Query  231  QKLFYELP-ERDVICWNAMISGFAMNGDGE  145
            ++L  E+P E D     A+++   ++GD E
Sbjct  397  KRLVREMPMEPDSYVLGALLNSCRVHGDVE  426



>ref|XP_008242855.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like, 
partial [Prunus mume]
Length=355

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 193/333 (58%), Gaps = 10/333 (3%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLL-AFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             Q +  ++TC L  N +A++ LL A  +  +     Y   I++        + NTMI+ ++
Sbjct  26    QIYAHLLTCRLPENPYAIAPLLSASATSKDASLFCYACSIFKHHHHRNTFMYNTMIRGYV  85

Query  861   LKGELSRT----MEMYKHMLKTGMCPDNYTLPYLLKACGNM--ESCNLGRSIHGQCLKFG  700
             L   LS T    +  Y  ML  G  P+NYT P L+KAC  +   S   GR +H   +KFG
Sbjct  86    L---LSHTPIPAILCYLDMLNRGFVPNNYTFPPLIKACTILIPNSKLSGRLVHAHVVKFG  142

Query  699   FLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFD  520
             +  D +V +SLI  YS + DME+A+ VFD+ P R VV WT +I  Y + GDV  AR +FD
Sbjct  143   YRDDPFVLSSLIEFYSVIHDMETAKLVFDKSPKRDVVVWTAMIDGYGKAGDVENARALFD  202

Query  519   ETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDI  340
             E P ++   W +M++ Y + N F+E L LFR MQ  G   +E++LVS+L+A AHLG++  
Sbjct  203   EMPERNAISWSAMMAAYSRVNHFREVLSLFRQMQEVGTMPNESVLVSVLTASAHLGAVTQ  262

Query  339   GKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAM  160
             G WVH Y ++  +  N  L TALVDMY+KCG +  A  +F  +  +D   WNAMI+G AM
Sbjct  263   GLWVHSYAKRYNLESNKILATALVDMYSKCGYVEAALWVFEGISNKDARAWNAMIAGVAM  322

Query  159   NGDGENAMRLFREMQNDAGTRPDGVTFVSLFTA  61
             NGD   ++ LF +M    G +P   TFV++ TA
Sbjct  323   NGDARKSLELFNKMVEYGGVQPTETTFVAVLTA  355



>ref|XP_011028546.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Populus euphratica]
Length=654

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/344 (39%), Positives = 205/344 (60%), Gaps = 4/344 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H +++  GL  + + L++L+   +  N+    Y   I+ R++ P   + N +I+ +L+
Sbjct  64    QVHARILLNGLDQSCYVLAKLIRTLTKLNIPMDPYPLSIFNRVKYPNPFLYNALIRGYLI  123

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFG-FLMDSY  682
             +  L+ + E Y  M K G+ P ++T   LLKACG      LGR IHGQ +  G F  D +
Sbjct  124   EESLNESTEFYSLMRKEGVVPVSFTFTALLKACGAKMDVGLGRQIHGQTILVGGFGEDLH  183

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             VGNS+I MY     +E  + VFDEMP+R  ++WT LIS Y++ G++  A  +FD  PVKD
Sbjct  184   VGNSMIGMYIKCGFLECGRKVFDEMPNRDAISWTELISAYAKSGNMESAGELFDGLPVKD  243

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W  M+SG+ QN   +E ++ F  MQ  GV+ DE  L+ ++SACA LG+     W+  
Sbjct  244   MVAWTVMVSGFAQNAKPREAIRFFEKMQEFGVETDEITLIGVISACAQLGAAKYADWIRD  303

Query  321   YVEK--LGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDG  148
               EK   G   +V +G+AL+DMY+KCG +G A ++F  + ER+V  +++MI GFAM+G  
Sbjct  304   VAEKSEFGGKHSVVVGSALIDMYSKCGSVGDAYRVFQGMKERNVYSYSSMILGFAMHGLA  363

Query  147   ENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLE  16
              +AM+LF EM      +P+ VTF+ + TACS +GM  +G ++ E
Sbjct  364   HDAMKLFDEMVKTE-IKPNRVTFIGVLTACSHAGMVEQGWQIFE  406


 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 70/142 (49%), Gaps = 2/142 (1%)
 Frame = -2

Query  594  VVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQM  415
            VV  + LI  YS+ G V +A  VF     ++   + SMI G+  +    + ++LF  M  
Sbjct  316  VVVGSALIDMYSKCGSVGDAYRVFQGMKERNVYSYSSMILGFAMHGLAHDAMKLFDEMVK  375

Query  414  TGVQADEAILVSILSACAHLGSLDIGKWVHRYVEK-LGMAINVRLGTALVDMYAKCGCLG  238
            T ++ +    + +L+AC+H G ++ G  +   +EK  G+  +    T +VD+  + G L 
Sbjct  376  TEIKPNRVTFIGVLTACSHAGMVEQGWQIFELMEKCYGIKPSADHYTCMVDLLGRAGRLQ  435

Query  237  LAQKLFYELP-ERDVICWNAMI  175
             A +L   +P E     W A++
Sbjct  436  EAHELVKTMPIEPHGGVWGALL  457



>ref|XP_004295922.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Fragaria vesca subsp. vesca]
Length=524

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/344 (37%), Positives = 207/344 (60%), Gaps = 2/344 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             Q    +   G   + +A +++++FC+   N  +  + + ++  +   T  I N MI+ F 
Sbjct  23    QVQSHLAVSGTLFDPYAAAKVISFCALSHNPHHLRHAYHLFRFMPTRTTYIWNLMIRTFT  82

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                + ++ + +Y +ML+TG  PDNYT  + L+A   + S   G  IH   ++ G+    +
Sbjct  83    DSNDPTQALSLYTNMLRTGSSPDNYTFSFALRASAALSSLYFGVMIHTHAIRLGWESYDF  142

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             V N L+ +Y + + M+SA+ +FD    + VV WT L++ Y + G +  AR +FDE P K+
Sbjct  143   VQNGLVHLYVTCESMDSARKLFDMCFCKDVVTWTALVNGYVKCGQIVTARHLFDEMPEKN  202

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MI+G+V    F+E L++F  MQ  GV  + A +V  L+AC ++G+LD G+W+H 
Sbjct  203   AVSWSTMINGFVHLGMFREALEVFADMQAAGVSPNRAGIVGALTACGYVGALDQGRWIHA  262

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             YV++ GM ++V LGTA+VDMYAKCGC+  +  +F E+ ERDV  + ++ISGFA NG+  N
Sbjct  263   YVKRKGMRLDVVLGTAVVDMYAKCGCVETSCAVFDEMRERDVFAFTSLISGFANNGECVN  322

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             A+ LF+ M+ D G  P+ VTFV + +ACS  GM  EGLK+   +
Sbjct  323   AVSLFKRME-DEGVAPNEVTFVCVLSACSRVGMVDEGLKVFRSM  365



>ref|XP_010095598.1| hypothetical protein L484_007437 [Morus notabilis]
 gb|EXB61171.1| hypothetical protein L484_007437 [Morus notabilis]
Length=631

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/342 (38%), Positives = 200/342 (58%), Gaps = 3/342 (1%)
 Frame = -2

Query  1035  AHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLK  856
              H ++I  G   + F +  LL  CS  NL +  Y  +I++RIQ P + +   +I  F+L 
Sbjct  47    THAKIIRNGQEQDPFIVFELLRLCS--NLNSIDYASKIFQRIQTPNVFLYTALIDGFVLH  104

Query  855   GELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVG  676
             G     + +Y  M+   + PDNY +   LKACG   +  LGR IHGQ +K G   +  V 
Sbjct  105   GSYFDAILLYCRMIDDSIVPDNYAVVSALKACGFQLALKLGREIHGQVMKLGLCSNRSVK  164

Query  675   NSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRR  496
               L+ +Y    ++E A+ VFDEMP R  VA TV+++ Y   G V EA  VF +   KD  
Sbjct  165   MKLMELYGKCGELEDARRVFDEMPERDFVASTVMMTSYLHHGFVREASAVFKQVRRKDTV  224

Query  495   VWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYV  316
              W +MI G V+N      L++FR MQM  V+ +EA +V +LSAC+HLG+L++G+WVH Y+
Sbjct  225   CWTAMIDGLVKNGEMNWALEVFREMQMENVKPNEATIVCVLSACSHLGALELGRWVHSYM  284

Query  315   EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAM  136
              K  + +N  +G AL++MYA+CG +   +K+F E+ ERD+  +N++I+G  M+G    A+
Sbjct  285   GKYEIKLNHIVGGALINMYARCGDIDKVKKVFDEMNERDISTYNSIIAGLGMHGKSIEAI  344

Query  135   RLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
              +FR M N+ G RP+ +TFV +  ACS  G+   G ++   +
Sbjct  345   EMFRAMLNN-GFRPNSITFVGVLNACSHRGLVELGFEMFHSM  385



>gb|KDO79692.1| hypothetical protein CISIN_1g048358mg [Citrus sinensis]
Length=541

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/351 (36%), Positives = 206/351 (59%), Gaps = 8/351 (2%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              + H Q++   L  + F +++++  C+    G+  Y   +++++++P + + N MI+A+ 
Sbjct  31    KKIHTQILKYLLSQSNFLVTKMIDVCNSG--GDLAYASLLFKQVKEPNVFLYNAMIRAYT  88

Query  861   LKGELSRTMEMYKHMLK---TG--MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGF  697
                     + +YK ML+   TG  + PD +TLP+++K+C  +   +LG+ IH    KFG 
Sbjct  89    NNHLYGLAINLYKQMLRDPRTGSLILPDKFTLPFVIKSCAGLLCPSLGKQIHAHVCKFGL  148

Query  696   LMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDE  517
                S   N+L+ +Y   D++  A  VF+EM  R +VAW  LIS Y+R G + +AR++FD+
Sbjct  149   KSHSITENALLDLYGKCDELIEAHKVFEEMTDRDIVAWNNLISGYARLGQMKKARMLFDK  208

Query  516   TPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIG  337
              P      W +MISGY     + E L +FR MQM G++ DE  +VS+L ACA LGSL++G
Sbjct  209   MPYTTIVSWTAMISGYTHIGSYAEALDVFRQMQMVGIEPDEISIVSVLPACAQLGSLELG  268

Query  336   KWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMN  157
             +W+H Y +K  +     +  AL++MY KCGC+  A +LF ++ ERDV+ W+ +I G A +
Sbjct  269   EWIHMYCDKNHLLRRTVICNALIEMYIKCGCINQASQLFDQMVERDVVSWSTVIGGLANH  328

Query  156   GDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             G    A+ LF EMQ      P+ +TF+ L +AC+ +G  +EGL   + + R
Sbjct  329   GKAHKAIHLFHEMQR-LKVPPNDITFIGLLSACAHTGFWNEGLMYFDSMKR  378


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 120/279 (43%), Gaps = 71/279 (25%)
 Frame = -2

Query  774  LLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRC  595
            +L++C N+      + IH Q LK+     +++   +I + +S  D+  A  +F ++    
Sbjct  20   ILQSCENLIEL---KKIHTQILKYLLSQSNFLVTKMIDVCNSGGDLAYASLLFKQV----  72

Query  594  VVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLM--  421
                        ++ +VF               ++ +MI  Y  N+ +   + L++ M  
Sbjct  73   ------------KEPNVF---------------LYNAMIRAYTNNHLYGLAINLYKQMLR  105

Query  420  -QMTG--VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKC  250
               TG  +  D+  L  ++ +CA L    +GK +H +V K G+  +     AL+D+Y KC
Sbjct  106  DPRTGSLILPDKFTLPFVIKSCAGLLCPSLGKQIHAHVCKFGLKSHSITENALLDLYGKC  165

Query  249  GCLGLAQKLFYELPERDVICWN-------------------------------AMISGFA  163
              L  A K+F E+ +RD++ WN                               AMISG+ 
Sbjct  166  DELIEAHKVFEEMTDRDIVAWNNLISGYARLGQMKKARMLFDKMPYTTIVSWTAMISGYT  225

Query  162  MNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
              G    A+ +FR+MQ   G  PD ++ VS+  AC+  G
Sbjct  226  HIGSYAEALDVFRQMQM-VGIEPDEISIVSVLPACAQLG  263



>ref|XP_009367935.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Pyrus x bretschneideri]
Length=542

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/346 (37%), Positives = 200/346 (58%), Gaps = 6/346 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H Q++   L  + F L++++  C   N G+  Y   ++E++ +P + + N  I+A+  
Sbjct  32    KIHAQIVKLSLSQSNFLLTKMVDVCD--NSGDLRYAGLLFEQVMEPNVFLFNATIRAYTH  89

Query  858   KGELSRTMEMYKHMLKTG---MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMD  688
                    + +YK ML+       PD +T P+++K+C  +    LGR +H Q  KFG    
Sbjct  90    NQMYDLAINLYKQMLREAENQKLPDKFTFPFVIKSCAAIFCEVLGRQVHAQVCKFGPKSH  149

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
               + N+L+ +Y   D++  A  VFD M    V++W  L+S Y R G +  AR VF+E P 
Sbjct  150   LLIENALMDLYLKCDNLADAHKVFDGMSEPDVISWNSLLSGYVRLGKMRGARAVFEEIPN  209

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWV  328
             K    W +M+SGY    C+ E L +FR MQM  ++ DE  +VS+L ACA LG+L++GKW+
Sbjct  210   KTIVSWTAMVSGYTGIRCYAEALDMFRRMQMLDIEPDEISIVSVLPACAQLGALEVGKWI  269

Query  327   HRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDG  148
             H Y EK  +  +V +  AL++MY KCGC+  A  LF ++ ERDVI W+ MI+G A  G  
Sbjct  270   HMYSEKKLLLQSVCVCNALIEMYVKCGCIDQAWHLFDQMLERDVISWSTMIAGLANYGKA  329

Query  147   ENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
               A+ LFREMQ      P+GVTF+ L +AC+ +G+ +EG+K  + +
Sbjct  330   REAVELFREMQI-VKVEPNGVTFLGLLSACTHAGLWNEGVKYFDSM  374



>ref|XP_008392585.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305 
[Malus domestica]
Length=516

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/347 (38%), Positives = 205/347 (59%), Gaps = 3/347 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  ++T GL  +    S++L+F +  NLGN  Y +R++ ++  PTI   NT+I+ +  
Sbjct  6     QIHALLLTLGLSQHHSLTSKILSFSALSNLGNIEYSYRVFSQLPHPTIFYWNTVIRGYSN  65

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 +R++ ++  ML+ G+ PD  T P+L+KA   +    LG ++H    K GF  D ++
Sbjct  66    SKNPNRSLSVFVKMLRDGVSPDYLTYPFLVKASARLLKRELGMAVHAHIAKNGFESDRFI  125

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSLI MY++  D+  A  VFD +P R  V+W  ++  Y++ GDV  A+ VF+  P  + 
Sbjct  126   SNSLIHMYATCRDIMYAHKVFDGIPVRNSVSWNSMLDGYAKCGDVNSAQEVFELMPEHNV  185

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W S+I GYV+   F E L +F  M + G +A+E  +VS+LSAC HLG+L+ GK +HRY
Sbjct  186   VSWSSLIDGYVKAGKFSEALAVFERMCVVGPKANEVTMVSVLSACTHLGALEQGKVMHRY  245

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFY--ELPERDVICWNAMISGFAMNGDGE  145
             + +  + + + L T+LVDMYAKCG +  A  +F    L + DV+ WNAMI G AM+G  +
Sbjct  246   MVENELPLTLALQTSLVDMYAKCGAIEEALGVFRGGSLHQSDVLIWNAMIGGLAMHGLVQ  305

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
              A+ +F EMQ   G  PD +T++ L +AC+  G+  E     E +G+
Sbjct  306   QALEIFSEMQ-IIGIAPDEITYLCLLSACAHRGLVKEAWHFFECLGK  351


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 61/295 (21%), Positives = 123/295 (42%), Gaps = 33/295 (11%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            G+      ++E + +  +   +++I  ++  G+ S  + +++ M   G   +  T+  +L
Sbjct  168  GDVNSAQEVFELMPEHNVVSWSSLIDGYVKAGKFSEALAVFERMCVVGPKANEVTMVSVL  227

Query  768  KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
             AC ++ +   G+ +H   ++    +   +  SL+ MY+    +E A  VF         
Sbjct  228  SACTHLGALEQGKVMHRYMVENELPLTLALQTSLVDMYAKCGAIEEALGVF---------  278

Query  588  AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
                      R G + ++          D  +W +MI G   +   ++ L++F  MQ+ G
Sbjct  279  ----------RGGSLHQS----------DVLIWNAMIGGLAMHGLVQQALEIFSEMQIIG  318

Query  408  VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQ  229
            +  DE   + +LSACAH G +         + K GM         +VD+ A+ G +  A 
Sbjct  319  IAPDEITYLCLLSACAHRGLVKEAWHFFECLGKHGMTPKCEHYACMVDVLARGGQVVEAY  378

Query  228  KLFYELPERDVIC-WNAMISGFAMNGD---GENAMRLFREMQNDAGTRPDGVTFV  76
            +   ++ +        A++SG   +G     E   +   E+Q D   R  G++ V
Sbjct  379  QFICQMSKEPTXSMLGALLSGCMNHGKLDLAEIVGKKLIEIQPDHDGRYVGLSNV  433



>ref|XP_007013367.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
 gb|EOY30986.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
Length=847

 Score =   260 bits (664),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 134/331 (40%), Positives = 191/331 (58%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +I  GL +  FALS+L+ FC+    G+  Y   ++E I +P   I NTMI+ F L
Sbjct  106   QVHCHIIKTGLHHTQFALSKLIEFCAVSPFGDLPYALLLFESIDEPNQVIWNTMIRGFSL  165

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                   T+E Y  M+ +G+ P++YT P++LK+C    S   G+ IHGQ LK G   D++V
Sbjct  166   SSSPGLTLEFYVKMIWSGIVPNSYTFPFVLKSCAKTASTQEGKQIHGQVLKLGLESDAFV  225

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   +  +A+ VFD+   R  V++T LI+ Y   G +  AR +FDE P++D 
Sbjct  226   HTSLINMYAQNGEFGNARLVFDKSHLRDTVSYTALITGYVSIGYMENARKLFDEIPIRDV  285

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY Q    +E L  F  M    V  +E+ LVS+LSACA  GSL++G WV  +
Sbjct  286   VSWNAMIAGYAQTGQHEEALAFFEEMIGANVVPNESTLVSVLSACAQSGSLELGTWVRSW  345

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             + + G+  N+ L  AL+DMY+KCG L  A  LF  L +RDVI WN MI G+      + A
Sbjct  346   INEHGLGSNIHLANALIDMYSKCGDLDTAFDLFEGLQQRDVISWNVMIGGYTHMSYYKEA  405

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + LFR M   +   P  VTF+S+  AC+  G
Sbjct  406   LGLFRRMLR-SNIEPSDVTFLSVLPACANLG  435


 Score =   172 bits (435),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 104/362 (29%), Positives = 176/362 (49%), Gaps = 62/362 (17%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLL-AFCSDPNLGNP-----------------------TYG  931
             Q HGQV+  GL ++ F  + L+  +  +   GN                        + G
Sbjct  209   QIHGQVLKLGLESDAFVHTSLINMYAQNGEFGNARLVFDKSHLRDTVSYTALITGYVSIG  268

Query  930   W-----RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLK  766
             +     ++++ I    +   N MI  +   G+    +  ++ M+   + P+  TL  +L 
Sbjct  269   YMENARKLFDEIPIRDVVSWNAMIAGYAQTGQHEEALAFFEEMIGANVVPNESTLVSVLS  328

Query  765   ACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVA  586
             AC    S  LG  +     + G   + ++ N+LI MYS   D+++A   FD         
Sbjct  329   ACAQSGSLELGTWVRSWINEHGLGSNIHLANALIDMYSKCGDLDTA---FD---------  376

Query  585   WTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGV  406
                                +F+    +D   W  MI GY   + +KE L LFR M  + +
Sbjct  377   -------------------LFEGLQQRDVISWNVMIGGYTHMSYYKEALGLFRRMLRSNI  417

Query  405   QADEAILVSILSACAHLGSLDIGKWVHRYVEK-LGMAINVRLGTALVDMYAKCGCLGLAQ  229
             +  +   +S+L ACA+LG+LD+GKW+H Y++K    + N+ L T+L+DMYAKCG +  AQ
Sbjct  418   EPSDVTFLSVLPACANLGALDLGKWIHAYIDKNFQNSTNISLWTSLIDMYAKCGSIEAAQ  477

Query  228   KLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCS  49
             ++F  + ++++  WNAMISG AM+G  + A+ LF +M    G +PD +TFV + +AC+ +
Sbjct  478   QVFNGMEQKNLASWNAMISGLAMHGLADKALELFSQMMG-GGLKPDDITFVGVLSACTHA  536

Query  48    GM  43
             G+
Sbjct  537   GL  538


 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 70/306 (23%), Positives = 135/306 (44%), Gaps = 37/306 (12%)
 Frame = -2

Query  1011  GLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTME  832
             GLG+N    + L+   S    G+    + ++E +QQ  +   N MI  +         + 
Sbjct  350   GLGSNIHLANALIDMYS--KCGDLDTAFDLFEGLQQRDVISWNVMIGGYTHMSYYKEALG  407

Query  831   MYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYS  652
             +++ ML++ + P + T   +L AC N+ + +LG+ IH         +D    NS      
Sbjct  408   LFRRMLRSNIEPSDVTFLSVLPACANLGALDLGKWIHA-------YIDKNFQNS------  454

Query  651   SLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISG  472
                                +  WT LI  Y++ G +  A+ VF+    K+   W +MISG
Sbjct  455   -----------------TNISLWTSLIDMYAKCGSIEAAQQVFNGMEQKNLASWNAMISG  497

Query  471   YVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK-WVHRYVEKLGMAI  295
                +    + L+LF  M   G++ D+   V +LSAC H G LD+G+ +    V++  ++ 
Sbjct  498   LAMHGLADKALELFSQMMGGGLKPDDITFVGVLSACTHAGLLDLGRQYFSSMVQEYAISP  557

Query  294   NVRLGTALVDMYAKCGCLGLAQKLFYELPER-DVICWNAMISGFAMNGD---GENAMRLF  127
             +++    +V++  + G    A+ L   +  + D   W +++    ++     GE+  +  
Sbjct  558   DLQHYGCMVNLLGRAGLFDEAEALIQNMEMKPDGAIWGSLLGACRVHKRVELGESVAQRL  617

Query  126   REMQND  109
              E++ D
Sbjct  618   LELEPD  623



>ref|XP_010251341.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g59200, chloroplastic [Nelumbo nucifera]
Length=695

 Score =   257 bits (656),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/337 (39%), Positives = 199/337 (59%), Gaps = 3/337 (1%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             ++ H ++I   + +N F  ++ ++ C   N  NP+Y  R++E++  P   + N MI+ F+
Sbjct  51    TEIHARIIRNSIHHNNFVATKFVSACFSFN--NPSYATRVFEQVPDPNQFLWNNMIRGFV  108

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
               G     +  Y  M+  G  P+N+T P++LKAC  + +   G+ +HG  LK G   D Y
Sbjct  109   HVGLHEDALIFYYKMINHGSLPNNFTYPFVLKACSELLALEEGKVLHGHILKLGLSSDVY  168

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             V  SL+ MY S   + +A+ VFD M  R VVAW  +++ Y R G V  A  +FD  P+++
Sbjct  169   VQTSLLDMYGSSGGILAARQVFDRMTDRDVVAWNAILASYVRYGLVEAANELFDSMPIRN  228

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MISGYV+    +E L  F  MQ  GV+ D+  +V++LSA A LG LD+G  +H 
Sbjct  229   VSSWTTMISGYVEVGYSREALDFFHRMQAVGVEPDKMAIVTVLSAIADLGLLDVGIRIHD  288

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             YVE   + I+  LGTAL+DMYAKCG +G AQ++F  +  + + C+NAMISGFA +G G+ 
Sbjct  289   YVESNRIDIDAFLGTALIDMYAKCGSIGNAQEVFEGINSKTISCYNAMISGFAAHGMGKQ  348

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             ++ +FR+ Q   G   D +T + + TACS SG+   G
Sbjct  349   SIEVFRDAQR-TGIGIDDITMIGVLTACSHSGLVDMG  384


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/256 (22%), Positives = 113/256 (44%), Gaps = 33/256 (13%)
 Frame = -2

Query  882  TMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKF  703
            TMI  ++  G     ++ +  M   G+ PD   +  +L A  ++   ++G  IH      
Sbjct  234  TMISGYVEVGYSREALDFFHRMQAVGVEPDKMAIVTVLSAIADLGLLDVGIRIHDYVESN  293

Query  702  GFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVF  523
               +D+++G +LI MY        A+C                       G +  A+ VF
Sbjct  294  RIDIDAFLGTALIDMY--------AKC-----------------------GSIGNAQEVF  322

Query  522  DETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLD  343
            +    K    + +MISG+  +   K+ +++FR  Q TG+  D+  ++ +L+AC+H G +D
Sbjct  323  EGINSKTISCYNAMISGFAAHGMGKQSIEVFRDAQRTGIGIDDITMIGVLTACSHSGLVD  382

Query  342  IGKWVHRYVEK-LGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGF  166
            +G+     ++K  G+   +     +VD+  + G    A K+  E  E D++    +    
Sbjct  383  MGRMYFNLMKKDYGIEPKMEHYGCMVDLLGRAGRFDEAMKIV-ESIEADLVILGTLAFAC  441

Query  165  AMNGDGENAMRLFREM  118
             ++G+ E   ++ R +
Sbjct  442  RIHGNMELGEKIARRI  457



>ref|XP_008803808.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Phoenix dactylifera]
Length=549

 Score =   253 bits (647),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/340 (37%), Positives = 206/340 (61%), Gaps = 1/340 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  ++  G   + +A  +L+AF +    G+  +   ++ R+   +  + NTMI+A + 
Sbjct  33    QIHAHLLVSGAIADPYAAGKLVAFLALSARGDLAHAGLLFHRLPCRSAFLWNTMIRAHVD  92

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             +      + +YK ML TG  P+NYT  ++L+AC ++ S + G+  H Q +K G+    +V
Sbjct  93    RNRPLEALSLYKQMLSTGFSPNNYTFSFILRACLDLSSLSDGQKFHAQIVKLGWEPYDFV  152

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N LI +YSS  D++SA+ +FD   +R V++WT ++S Y++ G +  AR +FD  P ++ 
Sbjct  153   QNGLIHVYSSCGDIDSARRLFDGSSNRDVISWTAIVSGYAKSGRIDAARELFDRMPERNA  212

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+ Y Q   F+E L  F  MQ+ GV+ + A +V  LSAC  LG+LD G+W+H +
Sbjct  213   VSWSAMITSYSQIGRFREALDFFNEMQLAGVRPNHAGIVGALSACGSLGALDQGRWIHAF  272

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             VE+  M ++  LGTAL+DMYAKCG +  A ++F  + ERDV  + +MISG + +G  E A
Sbjct  273   VERNTMELDRVLGTALIDMYAKCGSIETALQVFDAMSERDVFAYTSMISGLSNHGHSEKA  332

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLL  19
             + LF +M+ + G RP+ VTF+ + +AC   G+  +G ++L
Sbjct  333   IDLFLKMREE-GVRPNEVTFICVLSACGRMGLVDQGREIL  371



>ref|XP_010277978.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Nelumbo nucifera]
Length=593

 Score =   254 bits (650),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/346 (38%), Positives = 206/346 (60%), Gaps = 2/346 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALS-RLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             Q H Q+ T GL  +   L  R L+  +  + G+  Y   I+ ++  P I   NTMI+A+ 
Sbjct  6     QIHAQLTTTGLMLSDVHLQGRFLSLAASLDSGDLHYPALIFSQLHHPNIFFYNTMIRAYS  65

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
             +      ++ +Y  +L+  + PD YT P+LLKAC    +   G+S+HGQ +KFG     Y
Sbjct  66    MTVTPLNSISVYTQILQANLLPDIYTFPFLLKACSQGPAFVQGQSVHGQAVKFGLDSYIY  125

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             V N+LI  YS    +E A+ +FD      VV+W  +IS Y+R G +  A+ +FD+ P ++
Sbjct  126   VNNALIHFYSITGHIEDARQLFDGAEELDVVSWNSMISSYARIGHIRTAKSLFDQMPDRN  185

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W ++I+GYVQ    +E L  F  MQ   ++ +E  LVS+LSACA LG+L+ GKWVH 
Sbjct  186   TISWSALIAGYVQCGLSREALSHFSRMQAELIKPNEVTLVSVLSACAQLGALEQGKWVHG  245

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y++   M  +V LGT+L+DMYAKCG + LA+++F  +  ++++ W  MI G AM+G G+ 
Sbjct  246   YLKSNNMEGSVFLGTSLIDMYAKCGEVELAKEVFNGMKAKNLLAWTTMIKGLAMHGRGQV  305

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             A+ L+ +M+  AG  PD VTF+ +  AC+ SG+  +G ++ E + R
Sbjct  306   ALALYSDMEM-AGIVPDDVTFIGVLCACTHSGLVDQGRQIFESMSR  350


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 81/349 (23%), Positives = 155/349 (44%), Gaps = 22/349 (6%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKG  853
             HGQ +  GL +  +  + L+ F S    G+     ++++  ++  +   N+MI ++   G
Sbjct  112   HGQAVKFGLDSYIYVNNALIHFYSIT--GHIEDARQLFDGAEELDVVSWNSMISSYARIG  169

Query  852   ELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSI--HGQCLKFGFLMDSYV  679
              +     ++  M      PD  T+ +     G ++ C L R    H   ++   +  + V
Sbjct  170   HIRTAKSLFDQM------PDRNTISWSALIAGYVQ-CGLSREALSHFSRMQAELIKPNEV  222

Query  678   G-NSLIVMYSSLDDMESAQCVFDEMPSR----CVVAWTVLISRYSRKGDVFEARLVFDET  514
                S++   + L  +E  + V   + S      V   T LI  Y++ G+V  A+ VF+  
Sbjct  223   TLVSVLSACAQLGALEQGKWVHGYLKSNNMEGSVFLGTSLIDMYAKCGEVELAKEVFNGM  282

Query  513   PVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
               K+   W +MI G   +   +  L L+  M+M G+  D+   + +L AC H G +D G+
Sbjct  283   KAKNLLAWTTMIKGLAMHGRGQVALALYSDMEMAGIVPDDVTFIGVLCACTHSGLVDQGR  342

Query  333   WVHRYVEK-LGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP-ERDVICWNAMISGFAM  160
              +   + +  G+   +     +VD+ A+CG L  A+ +   +P E D + W A+++G   
Sbjct  343   QIFESMSRNYGILPKIEHYGCMVDLLARCGLLDEAKHMVDNMPMEPDALIWGALMAGCRY  402

Query  159   NGDGENAMRLFREMQNDAGTRPD-GVTFVSLFTACSCSGMAHEGLKLLE  16
               + E A  + +++       PD G  +V L    + SG   +  K+ E
Sbjct  403   YRNVELAEYVGKQLIQ---LEPDNGGVYVLLANIYAASGRLQDARKVRE  448



>ref|XP_003530680.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g40405-like isoform X1 [Glycine max]
Length=616

 Score =   255 bits (651),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 128/347 (37%), Positives = 202/347 (58%), Gaps = 4/347 (1%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H Q++  G+ NN     + +A  +  N  N  Y  ++      PT+  +N+MI+A+ 
Sbjct  26    KQIHAQLVVKGILNNPHFHGQFVATIALHNTTNLDYANKLLNHNNNPTLFTLNSMIRAYS  85

Query  861   LKGELSRTMEMYKHMLKTG---MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLM  691
                  S++   Y ++L +    + PDNYT  +L++ C  +++   G  +HG  +K GF +
Sbjct  86    KSSTPSKSFHFYANILHSNNNNLSPDNYTFTFLVRTCAQLQAHVTGLCVHGAVIKHGFEL  145

Query  690   DSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETP  511
             D +V   L+ MY+ L  + S   VFD      +V  T +++  ++ GD+  AR +FDE P
Sbjct  146   DPHVQTGLVFMYAELGCLSSCHNVFDGAVEPDLVTQTAMLNACAKCGDIDFARKMFDEMP  205

Query  510   VKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKW  331
              +D   W +MI+GY Q    +E L +F LMQM GV+ +E  +V +LSAC HL  LD G+W
Sbjct  206   ERDHVTWNAMIAGYAQCGRSREALDVFHLMQMEGVKLNEVSMVLVLSACTHLQVLDHGRW  265

Query  330   VHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGD  151
             VH YVE+  + + V LGTALVDMYAKCG +  A ++F+ + ER+V  W++ I G AMNG 
Sbjct  266   VHAYVERYKVRMTVTLGTALVDMYAKCGNVDRAMQVFWGMKERNVYTWSSAIGGLAMNGF  325

Query  150   GENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             GE ++ LF +M+ + G +P+G+TF+S+   CS  G+  EG K  + +
Sbjct  326   GEESLDLFNDMKRE-GVQPNGITFISVLKGCSVVGLVEEGRKHFDSM  371



>gb|KHN13481.1| Putative pentatricopeptide repeat-containing protein [Glycine 
soja]
Length=592

 Score =   254 bits (650),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 128/347 (37%), Positives = 202/347 (58%), Gaps = 4/347 (1%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H Q++  G+ NN     + +A  +  N  N  Y  ++      PT+  +N+MI+A+ 
Sbjct  2     KQIHAQLVVKGILNNPHFHGQFVATIALHNTTNLDYANKLLNHNNNPTLFTLNSMIRAYS  61

Query  861   LKGELSRTMEMYKHMLKTG---MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLM  691
                  S++   Y ++L +    + PDNYT  +L++ C  +++   G  +HG  +K GF +
Sbjct  62    KSSTPSKSFHFYANILHSNNNNLSPDNYTFTFLVRTCAQLQAHVTGLCVHGAVIKHGFEL  121

Query  690   DSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETP  511
             D +V   L+ MY+ L  + S   VFD      +V  T +++  ++ GD+  AR +FDE P
Sbjct  122   DPHVQTGLVFMYAELGCLSSCHNVFDGAVEPDLVTQTAMLNACAKCGDIDFARKMFDEMP  181

Query  510   VKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKW  331
              +D   W +MI+GY Q    +E L +F LMQM GV+ +E  +V +LSAC HL  LD G+W
Sbjct  182   ERDHVTWNAMIAGYAQCGRSREALDVFHLMQMEGVKLNEVSMVLVLSACTHLQVLDHGRW  241

Query  330   VHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGD  151
             VH YVE+  + + V LGTALVDMYAKCG +  A ++F+ + ER+V  W++ I G AMNG 
Sbjct  242   VHAYVERYKVRMTVTLGTALVDMYAKCGNVDRAMQVFWGMKERNVYTWSSAIGGLAMNGF  301

Query  150   GENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             GE ++ LF +M+ + G +P+G+TF+S+   CS  G+  EG K  + +
Sbjct  302   GEESLDLFNDMKRE-GVQPNGITFISVLKGCSVVGLVEEGRKHFDSM  347



>ref|XP_007227273.1| hypothetical protein PRUPE_ppa017736mg [Prunus persica]
 gb|EMJ28472.1| hypothetical protein PRUPE_ppa017736mg [Prunus persica]
Length=544

 Score =   253 bits (647),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/348 (36%), Positives = 209/348 (60%), Gaps = 8/348 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H Q++   L  + F +++++  C   N GN  Y   +++++ +P + + N MI+A+  
Sbjct  32    KIHAQIVKFSLSQSNFLVTKMVDVCD--NSGNLGYASLLFKQVLEPNVFLFNAMIRAYTH  89

Query  858   KGELSRTMEMYKHMLK-----TGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFL  694
                    + +YK M +       + PD +T P+++K+C  +    LG  IH Q  KFG  
Sbjct  90    HQMYDLAVTLYKQMPRYSQAENPIFPDKFTFPFIIKSCAGLFCEGLGTQIHAQVRKFGPK  149

Query  693   MDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDET  514
                 + N+L+ +Y+  +++  A  VFD M    VV+W  L+S Y+R G + +AR VF+E 
Sbjct  150   SHLLIENALLDLYTKCENLTDAHKVFDGMTEMDVVSWNSLLSGYARLGQMRKARGVFEEI  209

Query  513   PVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
             P K    W +MISGY +  C+ + L +FR MQ+ G++ADE  +VS+L ACA LG+L++GK
Sbjct  210   PNKTIVSWTTMISGYTRIGCYADALDIFRQMQVLGIEADEISIVSVLPACAQLGALEVGK  269

Query  333   WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNG  154
             W+H Y +K  +  +  +  AL++MY KCGC+  A +LF ++ ERDVI W+ MI+G A +G
Sbjct  270   WIHMYSDKKRLLQSTCVCNALIEMYVKCGCVDQAWQLFDKMLERDVISWSTMIAGLANHG  329

Query  153   DGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
                 A++LF+ MQ  A  +P+G+TF+ L +AC+ +G+ +EG+K  + +
Sbjct  330   KAREAIKLFQGMQR-AKVKPNGITFLGLLSACTHAGLWNEGVKYFDSM  376


 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 112/269 (42%), Gaps = 44/269 (16%)
 Frame = -2

Query  795  DNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVF  616
            +++ +P LL  C N       + IH Q +KF     +++                     
Sbjct  14   EDFFVPTLLN-CKNTSGL---KKIHAQIVKFSLSQSNFLV--------------------  49

Query  615  DEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQ  436
                       T ++      G++  A L+F +    +  ++ +MI  Y  +  +   + 
Sbjct  50   -----------TKMVDVCDNSGNLGYASLLFKQVLEPNVFLFNAMIRAYTHHQMYDLAVT  98

Query  435  LFRLMQMTGVQADEAILVS------ILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTA  274
            L++ M     QA+  I         I+ +CA L    +G  +H  V K G   ++ +  A
Sbjct  99   LYKQMPRYS-QAENPIFPDKFTFPFIIKSCAGLFCEGLGTQIHAQVRKFGPKSHLLIENA  157

Query  273  LVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRP  94
            L+D+Y KC  L  A K+F  + E DV+ WN+++SG+A  G    A  +F E+ N   T  
Sbjct  158  LLDLYTKCENLTDAHKVFDGMTEMDVVSWNSLLSGYARLGQMRKARGVFEEIPNK--TIV  215

Query  93   DGVTFVSLFTACSCSGMAHEGLKLLEKIG  7
               T +S +T   C   A +  + ++ +G
Sbjct  216  SWTTMISGYTRIGCYADALDIFRQMQVLG  244



>ref|XP_010557591.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 
[Tarenaya hassleriana]
Length=741

 Score =   258 bits (658),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 134/335 (40%), Positives = 201/335 (60%), Gaps = 6/335 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFC--SDPNLGNPTYGWRIYERIQQPTICIVNTMIKAF  865
             Q H Q+I  GL N  + LS+L+ FC  S  + G P Y   I+E IQ+P + I NTMI+  
Sbjct  50    QIHAQMIKTGLHNTNYGLSKLIEFCVLSRFSDGLP-YAVSIFETIQEPNLLIWNTMIRGH  108

Query  864   LLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDS  685
              L       ++ Y  M+  G+ P++YT P++LK+C    +   G+ +HG  LK G  +D 
Sbjct  109   SLSSSSISALQWYVRMISLGLVPNSYTFPFVLKSCAKSGAIREGKQVHGHVLKHGLDLDL  168

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
             YV  SLI MY+   ++E A  VFD  P R  V++T +I+ Y+ KG +  AR +FDE PV+
Sbjct  169   YVHTSLISMYAQNGELEDAHMVFDNSPHRDAVSFTAIITGYASKGCIENARKLFDEIPVR  228

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             D   W +MISGYV+ + + E L+LF+ M    V  DE+ +VS+LSACA  G +++ +WVH
Sbjct  229   DVVSWNAMISGYVETSRYNEALELFKEMIEVSVTPDESTMVSVLSACAKSGDINLCRWVH  288

Query  324   RYV--EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGD  151
              ++     G ++N++L  AL+DMY+KCG +  A+ LF  L +RDVI WN MI G+     
Sbjct  289   SWICDHHHGFSLNLQLVNALIDMYSKCGDIQTARDLFEGLSQRDVISWNIMIGGYTRMNV  348

Query  150   GENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
              + ++ LF+EM   +G  P+ VT +S+  AC+  G
Sbjct  349   YKESLLLFQEMLR-SGESPNDVTMLSILPACAHLG  382


 Score =   179 bits (455),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 106/307 (35%), Positives = 162/307 (53%), Gaps = 31/307 (10%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ I    +   N MI  ++     +  +E++K M++  + PD  T+  +L AC    
Sbjct  220  KLFDEIPVRDVVSWNAMISGYVETSRYNEALELFKEMIEVSVTPDESTMVSVLSACAKSG  279

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
              NL R +H       ++ D + G SL           + Q V              LI 
Sbjct  280  DINLCRWVHS------WICDHHHGFSL-----------NLQLV------------NALID  310

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
             YS+ GD+  AR +F+    +D   W  MI GY + N +KE L LF+ M  +G   ++  
Sbjct  311  MYSKCGDIQTARDLFEGLSQRDVISWNIMIGGYTRMNVYKESLLLFQEMLRSGESPNDVT  370

Query  387  LVSILSACAHLGSLDIGKWVHRYVE-KLGMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
            ++SIL ACAHLG+ DIGKWVH Y++ KL    N  L T+L+DMYAKCG +  A+++F   
Sbjct  371  MLSILPACAHLGATDIGKWVHVYIDKKLKNIKNPSLRTSLIDMYAKCGNIEAAKQVFGST  430

Query  210  PERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
              R +  WNAMISGFAM+G  + A  LF  M+ + G  PD +TFV L +ACS +G+   G
Sbjct  431  GNRSLASWNAMISGFAMHGRADAAFDLFSRMKEN-GIEPDDITFVGLLSACSHAGLLELG  489

Query  30   LKLLEKI  10
             ++ + +
Sbjct  490  HRIFKSM  496



>ref|XP_009620111.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g08070-like [Nicotiana tomentosiformis]
Length=709

 Score =   257 bits (656),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/332 (39%), Positives = 197/332 (59%), Gaps = 3/332 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             + H Q I  GL N+ FALS+L+ FC+ +PN  + +Y   I+   + P   + N +I+ + 
Sbjct  49    KVHSQFIKFGLHNSQFALSKLVEFCAVNPN-DDLSYALSIFNTTENPNHVMFNMIIRGYS  107

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
             L    +  +E Y+ +L +G  P++YT P++ K+C  +    +G+ IHG   K G + D Y
Sbjct  108   LSEYPNLAIEFYEKLLFSGNLPNSYTFPFVFKSCAKIMDTQMGKMIHGHVFKLGLMNDVY  167

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             V  SLI MY+   +++ A+ VFD+   R  V++T LI+ Y+ KG V +AR +FDE PV+D
Sbjct  168   VHASLINMYAQNGELDDARLVFDKSSKRDAVSFTALINGYALKGRVDDARKLFDEMPVRD  227

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MISGY Q   F+E L LF +M+   V    + L+S+LSACA  G L +G  V  
Sbjct  228   VVSWNAMISGYTQMGRFEEALMLFEVMRNVNVTPSVSTLLSVLSACARAGELKLGSRVRS  287

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             ++E  G+ +N+RL  AL+DMYAKCG L  A+ LF  L E+D++ WN MI G+   G+   
Sbjct  288   WIEDHGLGLNIRLVNALIDMYAKCGNLDSARDLFEGLEEKDLVSWNVMIGGYTHTGNYRE  347

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             A+ +F  MQ  A   P+ VT +S+  AC+  G
Sbjct  348   ALAVFHRMQQ-ANMAPNDVTLLSILPACAHLG  378


 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/259 (29%), Positives = 121/259 (47%), Gaps = 32/259 (12%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ +    +   N MI  +   G     + +++ M    + P   TL  +L AC    
Sbjct  218  KLFDEMPVRDVVSWNAMISGYTQMGRFEEALMLFEVMRNVNVTPSVSTLLSVLSACARAG  277

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
               LG  +       G  ++  + N+LI MY        A+C                  
Sbjct  278  ELKLGSRVRSWIEDHGLGLNIRLVNALIDMY--------AKC------------------  311

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 G++  AR +F+    KD   W  MI GY     ++E L +F  MQ   +  ++  
Sbjct  312  -----GNLDSARDLFEGLEEKDLVSWNVMIGGYTHTGNYREALAVFHRMQQANMAPNDVT  366

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKLGMAI-NVRLGTALVDMYAKCGCLGLAQKLFYEL  211
            L+SIL ACAHLG+LD+GKW+H Y+ K    + N  L T L++MYAKCG +  A+++F  +
Sbjct  367  LLSILPACAHLGALDLGKWIHAYINKHYQHLQNTSLWTTLINMYAKCGAITAAKQVFQGM  426

Query  210  PERDVICWNAMISGFAMNG  154
              + +  +N MISG AM+G
Sbjct  427  KTKTLASYNVMISGLAMHG  445


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 106/229 (46%), Gaps = 20/229 (9%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            GN      ++E +++  +   N MI  +   G     + ++  M +  M P++ TL  +L
Sbjct  312  GNLDSARDLFEGLEEKDLVSWNVMIGGYTHTGNYREALAVFHRMQQANMAPNDVTLLSIL  371

Query  768  KACGNMESCNLGRSIHGQCLK-FGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCV  592
             AC ++ + +LG+ IH    K +  L ++ +  +LI MY+    + +A+ VF  M ++ +
Sbjct  372  PACAHLGALDLGKWIHAYINKHYQHLQNTSLWTTLINMYAKCGAITAAKQVFQGMKTKTL  431

Query  591  VAWTVLISRYSRKGDV-FEARLV-------------FDETPVKDRRVWGSMISGYVQNNC  454
             ++ V+IS  +  G     A LV             +  TP    + +G MI    +   
Sbjct  432  ASYNVMISGLAMHGTACSHAGLVDLGQEYFNTMIQSYKYTP--KLQHYGCMIDLLGRAGK  489

Query  453  FKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKL  307
            F E + +   M    V+ D AI  S+L AC    +L++G++  + + +L
Sbjct  490  FDEAMAMIESMD---VKPDGAIWGSLLGACRIHKNLELGEYAAKNLFEL  535



>ref|XP_010245284.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Nelumbo nucifera]
 ref|XP_010245285.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Nelumbo nucifera]
Length=540

 Score =   253 bits (646),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 123/350 (35%), Positives = 207/350 (59%), Gaps = 8/350 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H  ++   L  + F +++++  CS    G+  Y   +++++ +P + + N MI+A+  
Sbjct  30    KIHSHILKYSLSQSNFLVTKMVHICSIN--GDTDYATLLFQQMIEPNVFLYNAMIRAYTH  87

Query  858   KGELSRTMEMYKHML-----KTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFL  694
                 S  +  YK ++     K  + PD +T P+++KAC  +   +LG+ IHG   K G  
Sbjct  88    NHLYSEAISNYKQIMRNPQDKKFIFPDKFTFPFVIKACAGLLQLDLGKQIHGHVCKCGPP  147

Query  693   MDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDET  514
             ++S V NSL+ MY+  D+M  A  VF+ M  +  V+W  ++S ++R G++ +AR +F+  
Sbjct  148   LNSVVDNSLVDMYTKCDEMTDAYKVFEGMTEKDAVSWNTIVSGHARLGEMSKARAIFEAM  207

Query  513   PVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
             P K    W ++ISGY +   + + L  FR MQ  G++ DE  +VS+L ACA LG+L++GK
Sbjct  208   PDKTVISWTALISGYTRIGSYPDALYAFRRMQEVGIEPDEISVVSVLPACAQLGALELGK  267

Query  333   WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNG  154
             W+H Y +K G+     +  AL++MYAKCG +G A KLF ++P+RDVI W+ MI G A +G
Sbjct  268   WIHFYSDKNGLLQKTFVCNALIEMYAKCGSIGQAWKLFAQMPDRDVISWSTMIGGLANHG  327

Query  153   DGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
                 A+ LF EM+  +   P+ +TF+ L +ACS +G   EGL+ L+ + +
Sbjct  328   KVREAIELFEEMRK-SPVEPNSITFLGLLSACSHAGFLAEGLQYLDSMKK  376



>ref|XP_002892433.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH68692.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=741

 Score =   257 bits (657),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 128/330 (39%), Positives = 200/330 (61%), Gaps = 2/330 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLK  856
             H Q+I  GL N  +ALS+LL  C   P+     Y   ++E IQ+P + I NTM +   L 
Sbjct  53    HAQMIKTGLHNTNYALSKLLELCVISPHFDGLPYAISVFETIQEPNLLIWNTMFRGHALS  112

Query  855   GELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVG  676
              +    +++Y  M+  G+ P++YT P+LLK+C   ++   G+ IHG  LK G+ +D +V 
Sbjct  113   SDPVSALKLYVCMISLGLLPNSYTFPFLLKSCAKSKAFKEGQQIHGHVLKLGYDLDLFVH  172

Query  675   NSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRR  496
              SLI +Y     +E A+ VFD  P R VV++T LI  Y+ +G +  A+ +FDE PVKD  
Sbjct  173   TSLISVYVQNGRLEDARKVFDRSPHRDVVSYTALIKGYASRGYIESAQKLFDEIPVKDVV  232

Query  495   VWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYV  316
              W +MISGY +   +KE L+LF+ M  T ++ DE+ +V+++SACA  GS+++G+ VH ++
Sbjct  233   SWNAMISGYAETGNYKEALELFKEMMKTNIRPDESTMVTVVSACAQSGSIELGRQVHSWI  292

Query  315   EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAM  136
             +  G   N+++  +L+D+Y+KCG L  A  LF  L  +DVI WN +I G+      + A+
Sbjct  293   DDHGFGSNLKIVNSLMDLYSKCGELETACGLFEGLLYKDVISWNTLIGGYTHMNLYKEAL  352

Query  135   RLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
              LF+EM   +G RP+ VT +S+  AC+  G
Sbjct  353   LLFQEMLR-SGERPNDVTMLSILPACAHLG  381


 Score =   179 bits (455),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/297 (34%), Positives = 158/297 (53%), Gaps = 34/297 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ I    +   N MI  +   G     +E++K M+KT + PD  T+  ++ AC    
Sbjct  221  KLFDEIPVKDVVSWNAMISGYAETGNYKEALELFKEMMKTNIRPDESTMVTVVSACAQSG  280

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LGR +H      GF  +  + NSL+ +YS   ++E+A  +F+ +  + V++      
Sbjct  281  SIELGRQVHSWIDDHGFGSNLKIVNSLMDLYSKCGELETACGLFEGLLYKDVIS------  334

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                                     W ++I GY   N +KE L LF+ M  +G + ++  
Sbjct  335  -------------------------WNTLIGGYTHMNLYKEALLLFQEMLRSGERPNDVT  369

Query  387  LVSILSACAHLGSLDIGKWVHRYVEK-LGMAINV-RLGTALVDMYAKCGCLGLAQKLFYE  214
            ++SIL ACAHLG++DIG+W+H Y++K L  A N   L T+L+DMYAKCG +  A ++F  
Sbjct  370  MLSILPACAHLGAIDIGRWIHVYIDKRLKSATNASSLRTSLIDMYAKCGDIEAAHQVFNS  429

Query  213  LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGM  43
            +  + +  WNAMI GFAM+G  + A  +F  M+   G  PD +TFV L +ACS SGM
Sbjct  430  ILHKSLSSWNAMIFGFAMHGRADAAFDIFSRMRK-IGIEPDDITFVGLLSACSRSGM  485



>ref|XP_009618113.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 
[Nicotiana tomentosiformis]
 ref|XP_009618114.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 
[Nicotiana tomentosiformis]
Length=627

 Score =   255 bits (651),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 128/336 (38%), Positives = 192/336 (57%), Gaps = 1/336 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q   Q+I  GL  +  A+ R++ FC+    G+  Y  +++ ++  P   I NT+I+ +L 
Sbjct  41    QFQAQIIKLGLSCDNDAMGRVIKFCATFESGDLNYALQVFHKLPNPDTFIYNTIIRGYLQ  100

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                L  ++  Y HML+  + P+N+T P +++AC    +   G+ IHG  +KFGF  D + 
Sbjct  101   SQLLKESLLFYSHMLERSVRPNNFTFPLVIRACCIDNAVEEGKQIHGHVIKFGFGFDKFS  160

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N+LI MY +   +E A  VFD M  +  V+WT LIS +++ G + EA  VFD    K  
Sbjct  161   QNNLIHMYVNFHFLEEAMMVFDSMYEKDDVSWTTLISGFAQLGYLAEAFRVFDSNSEKSS  220

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MIS YV NN F +   LF  M    V  D  I  S+LSAC  LG+L  G+W+   
Sbjct  221   VCWNAMISAYVHNNQFHQAFALFERMMSEDVVIDNFIAASMLSACTRLGALKQGEWIVEQ  280

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V+K  + ++ +L T ++DMY+KCGCL  A + F  LP + +  WN MI G AM+G GE A
Sbjct  281   VKKSRIDLDSKLATTIIDMYSKCGCLDKALQFFKGLPRKGISSWNCMIGGLAMHGKGEAA  340

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             + L +EM++     PD +TFV+L +AC+ SG+  EG
Sbjct  341   IELLKEMESKK-VAPDYITFVNLLSACAHSGLIEEG  375


 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/307 (21%), Positives = 118/307 (38%), Gaps = 61/307 (20%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSD-----------------------------PNLG  946
             Q HG VI  G G + F+ + L+    +                               LG
Sbjct  144   QIHGHVIKFGFGFDKFSQNNLIHMYVNFHFLEEAMMVFDSMYEKDDVSWTTLISGFAQLG  203

Query  945   NPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLK  766
                  +R+++   + +    N MI A++   +  +   +++ M+   +  DN+    +L 
Sbjct  204   YLAEAFRVFDSNSEKSSVCWNAMISAYVHNNQFHQAFALFERMMSEDVVIDNFIAASMLS  263

Query  765   ACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVA  586
             AC  + +   G  I  Q  K    +DS +  ++I MYS    ++ A   F  +P + + +
Sbjct  264   ACTRLGALKQGEWIVEQVKKSRIDLDSKLATTIIDMYSKCGCLDKALQFFKGLPRKGISS  323

Query  585   WTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGV  406
                                            W  MI G   +   +  ++L + M+   V
Sbjct  324   -------------------------------WNCMIGGLAMHGKGEAAIELLKEMESKKV  352

Query  405   QADEAILVSILSACAHLGSLDIGKWVHRYV-EKLGMAINVRLGTALVDMYAKCGCLGLAQ  229
               D    V++LSACAH G ++ GK+   Y+ E  G+   +     LVD+  + G L  A+
Sbjct  353   APDYITFVNLLSACAHSGLIEEGKYYFHYMKEAYGIEPGMEHYGCLVDLLGRAGLLEEAR  412

Query  228   KLFYELP  208
             K+  E+P
Sbjct  413   KIIKEMP  419



>ref|XP_011078947.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Sesamum indicum]
 ref|XP_011078948.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Sesamum indicum]
 ref|XP_011078949.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Sesamum indicum]
 ref|XP_011078950.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Sesamum indicum]
 ref|XP_011078951.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Sesamum indicum]
 ref|XP_011078953.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Sesamum indicum]
Length=624

 Score =   255 bits (651),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 121/336 (36%), Positives = 195/336 (58%), Gaps = 0/336 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +I  GL ++  A+ R++ FC+    G+  Y  +++  +  P   I NTM + +L 
Sbjct  37    QHHAHIIKLGLSSDNDAMGRVIRFCALSESGDLNYALKVFASLPHPDAFIYNTMFRGYLE  96

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    + +Y HML+  + P+ ++ P +++AC    +    + +H   +K GF  DS+ 
Sbjct  97    ARLYRDCIVLYAHMLEKFVTPNKFSFPPVIRACCVDNAVKEAKQVHAHVIKLGFSEDSFC  156

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N+LI MY +   +E A+ VFD +  +  V+WT LIS YSR G V EA +VF+  P+K+ 
Sbjct  157   QNNLIHMYVNFKSLEEAKRVFDSLDKKDDVSWTTLISGYSRWGCVDEAFVVFESLPIKNS  216

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W ++I+ +VQNN F+E   LF  M+   V  D  +  S+LSAC  LG+L+ G+W++ Y
Sbjct  217   AAWNAVIAAHVQNNRFREAFNLFERMRKENVAMDNFVAASMLSACTGLGALEQGEWIYDY  276

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +    + ++ +L T ++DMY KCGCL  A ++F  L  + V  WN MI GFAM+G G+ A
Sbjct  277   IRSSAIEVDPKLATTILDMYCKCGCLDKAVEVFNGLSSKGVSSWNCMIGGFAMHGKGKAA  336

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             + L ++M+ +    PD VTFV++  AC+ SG+  EG
Sbjct  337   IELLKKMEAETMVTPDYVTFVNVLGACAHSGLVEEG  372


 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 71/314 (23%), Positives = 137/314 (44%), Gaps = 13/314 (4%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  VI  G   ++F  + L+      N  +     R+++ + +       T+I  +  
Sbjct  140   QVHAHVIKLGFSEDSFCQNNLIHMYV--NFKSLEEAKRVFDSLDKKDDVSWTTLISGYSR  197

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
              G +     +++ +        N  +   ++     E+ NL   +     K    MD++V
Sbjct  198   WGCVDEAFVVFESLPIKNSAAWNAVIAAHVQNNRFREAFNLFERMR----KENVAMDNFV  253

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVA----WTVLISRYSRKGDVFEARLVFDETP  511
               S++   + L  +E  + ++D + S  +       T ++  Y + G + +A  VF+   
Sbjct  254   AASMLSACTGLGALEQGEWIYDYIRSSAIEVDPKLATTILDMYCKCGCLDKAVEVFNGLS  313

Query  510   VKDRRVWGSMISGYVQNNCFKEGLQLFRLMQM-TGVQADEAILVSILSACAHLGSLDIGK  334
              K    W  MI G+  +   K  ++L + M+  T V  D    V++L ACAH G ++ GK
Sbjct  314   SKGVSSWNCMIGGFAMHGKGKAAIELLKKMEAETMVTPDYVTFVNVLGACAHSGLVEEGK  373

Query  333   WVHRYV-EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPER-DVICWNAMISGFAM  160
             +   Y+ E  G+A  +     LVD+  + G L  A+K+  E+P R DV    A +    +
Sbjct  374   YYFSYMTEVYGIAAGMEHYGCLVDLLGRAGMLEEARKVINEMPFRPDVGVLGAFLGACRI  433

Query  159   NGDGENAMRLFREM  118
             +G+ + A  + R++
Sbjct  434   HGNSDMAEEIGRQV  447



>ref|XP_008354505.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Malus domestica]
Length=528

 Score =   252 bits (644),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 133/348 (38%), Positives = 207/348 (59%), Gaps = 7/348 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLL-AFCSDPNLGNPTYGWRIYERIQ-QPTICIVNTMIKAF  865
             Q H  ++TC L  N +A++ LL A  +  +    +Y   I++       I + NTMI+  
Sbjct  26    QIHAHILTCRLPENLYAIAPLLSAAATSKDASFLSYACSIFKHHHNHRNIFMYNTMIRGC  85

Query  864   LLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNL---GRSIHGQCLKFGFL  694
             +        +  Y  ML  G  P+NYT P L+KAC  + + NL   GR +HG  ++FG+ 
Sbjct  86    VQSHSPVPAISYYLDMLNYGFVPNNYTFPPLIKAC-TILALNLKLSGRLVHGHAIQFGYG  144

Query  693   MDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDET  514
              D +V +SLI  Y+ + DME+A+ VFD+ P+R VV WT +I  Y + G+V  AR +FD+ 
Sbjct  145   DDPFVISSLIEFYAVIYDMETAKMVFDKSPNRDVVVWTAMIDGYGKTGNVENARALFDKM  204

Query  513   PVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
             P ++   W +M++ Y + N F+E L LFR MQ  G + +E++LVS+L+A AHLG++  G 
Sbjct  205   PERNTISWSAMMAAYSRVNDFREVLXLFRQMQEAGTKPNESVLVSVLTASAHLGAVTQGL  264

Query  333   WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNG  154
             WVH Y ++  + +N RL TALVDMY+KCG +  A  +F  +  +D   WNAMI+G A+NG
Sbjct  265   WVHSYAKRCNLVLNTRLATALVDMYSKCGYVEAALXVFEGILNKDAKAWNAMIAGVAING  324

Query  153   DGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             D   ++ LF  M  D   +P   TFV++ +AC+ +    +GL+L +++
Sbjct  325   DALKSLELFNNMVLDR-IQPTETTFVAVLSACTHAKTVDKGLELFDQM  371


 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 74/354 (21%), Positives = 143/354 (40%), Gaps = 66/354 (19%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCS--------------DPN---------------LGNP  940
             HG  I  G G++ F +S L+ F +               PN                GN 
Sbjct  135   HGHAIQFGYGDDPFVISSLIEFYAVIYDMETAKMVFDKSPNRDVVVWTAMIDGYGKTGNV  194

Query  939   TYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKAC  760
                  +++++ +      + M+ A+    +    + +++ M + G  P+   L  +L A 
Sbjct  195   ENARALFDKMPERNTISWSAMMAAYSRVNDFREVLXLFRQMQEAGTKPNESVLVSVLTAS  254

Query  759   GNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWT  580
              ++ +   G  +H    +   ++++ +  +L+ MYS                 +C     
Sbjct  255   AHLGAVTQGLWVHSYAKRCNLVLNTRLATALVDMYS-----------------KC-----  292

Query  579   VLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQA  400
                      G V  A  VF+    KD + W +MI+G   N    + L+LF  M +  +Q 
Sbjct  293   ---------GYVEAALXVFEGILNKDAKAWNAMIAGVAINGDALKSLELFNNMVLDRIQP  343

Query  399   DEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLAQKL  223
              E   V++LSAC H  ++D G  +   +E L G+   +     +VD+ A+ G +  A+K 
Sbjct  344   TETTFVAVLSACTHAKTVDKGLELFDQMETLYGVKPGLEHYACIVDLLARAGMVEEAEKF  403

Query  222   FYE----LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVS  73
               +    L   D   W A+++   ++G+ E   R ++++  D G    G+  +S
Sbjct  404   IEDKMGGLGRGDANVWGALLAACRVHGNVEVGDRTWKKLA-DMGVADCGIHVLS  456



>ref|XP_008389944.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Malus domestica]
Length=528

 Score =   252 bits (644),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 133/348 (38%), Positives = 207/348 (59%), Gaps = 7/348 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLL-AFCSDPNLGNPTYGWRIYERIQ-QPTICIVNTMIKAF  865
             Q H  ++TC L  N +A++ LL A  +  +    +Y   I++       I + NTMI+  
Sbjct  26    QIHAHILTCRLPENLYAIAPLLSAAATSKDASFLSYACSIFKHHHNHRNIFMYNTMIRGC  85

Query  864   LLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNL---GRSIHGQCLKFGFL  694
             +        +  Y  ML  G  P+NYT P L+KAC  + + NL   GR +HG  ++FG+ 
Sbjct  86    VQSHSPVPAISYYLDMLNYGFVPNNYTFPPLIKAC-TILALNLKLSGRLVHGHAIQFGYG  144

Query  693   MDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDET  514
              D +V +SLI  Y+ + DME+A+ VFD+ P+R VV WT +I  Y + G+V  AR +FD+ 
Sbjct  145   DDPFVISSLIEFYAVIYDMETAKMVFDKSPNRDVVVWTAMIDGYGKTGNVENARALFDKM  204

Query  513   PVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
             P ++   W +M++ Y + N F+E L LFR MQ  G + +E++LVS+L+A AHLG++  G 
Sbjct  205   PERNTISWSAMMAAYSRVNDFREVLXLFRQMQEAGTKPNESVLVSVLTASAHLGAVTQGL  264

Query  333   WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNG  154
             WVH Y ++  + +N RL TALVDMY+KCG +  A  +F  +  +D   WNAMI+G A+NG
Sbjct  265   WVHSYAKRCNLVLNTRLATALVDMYSKCGYVEAALXVFEGILNKDAKAWNAMIAGVAING  324

Query  153   DGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             D   ++ LF  M  D   +P   TFV++ +AC+ +    +GL+L +++
Sbjct  325   DALKSLELFNNMVLDR-IQPTETTFVAVLSACTHAKTVDKGLELFDQM  371


 Score = 79.7 bits (195),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 74/354 (21%), Positives = 143/354 (40%), Gaps = 66/354 (19%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCS--------------DPN---------------LGNP  940
             HG  I  G G++ F +S L+ F +               PN                GN 
Sbjct  135   HGHAIQFGYGDDPFVISSLIEFYAVIYDMETAKMVFDKSPNRDVVVWTAMIDGYGKTGNV  194

Query  939   TYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKAC  760
                  +++++ +      + M+ A+    +    + +++ M + G  P+   L  +L A 
Sbjct  195   ENARALFDKMPERNTISWSAMMAAYSRVNDFREVLXLFRQMQEAGTKPNESVLVSVLTAS  254

Query  759   GNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWT  580
              ++ +   G  +H    +   ++++ +  +L+ MYS                 +C     
Sbjct  255   AHLGAVTQGLWVHSYAKRCNLVLNTRLATALVDMYS-----------------KC-----  292

Query  579   VLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQA  400
                      G V  A  VF+    KD + W +MI+G   N    + L+LF  M +  +Q 
Sbjct  293   ---------GYVEAALXVFEGILNKDAKAWNAMIAGVAINGDALKSLELFNNMVLDRIQP  343

Query  399   DEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLAQKL  223
              E   V++LSAC H  ++D G  +   +E L G+   +     +VD+ A+ G +  A+K 
Sbjct  344   TETTFVAVLSACTHAKTVDKGLELFDQMETLYGVKPGLEHYACIVDLLARAGMVEEAEKF  403

Query  222   FYE----LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVS  73
               +    L   D   W A+++   ++G+ E   R ++++  D G    G+  +S
Sbjct  404   IEDKMGGLGRGDANVWGALLAACRVHGNVEVGDRTWKKLA-DMGVADCGIHVLS  456



>ref|XP_010275968.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Nelumbo nucifera]
Length=546

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/350 (38%), Positives = 204/350 (58%), Gaps = 15/350 (4%)
 Frame = -2

Query  1038  QAHGQVITCG---LGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKA  868
             Q H  +IT     + ++ F ++RLL FC+  + G+ +Y   ++  I+ P + + NTMI+A
Sbjct  28    QIHSHIITSPGIPIHDHYFLVTRLLFFCATSHSGSLSYATNVFHHIEHPNVFVYNTMIRA  87

Query  867   FLLK-------GELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCL  709
                +            ++ +YK M + G+ PD+ T P+L K C      + G+SIH Q +
Sbjct  88    HATRMINDGSDAHSCPSLILYKQMFRNGVRPDHLTFPFLAKECTRRLDAHAGKSIHVQVI  147

Query  708   KFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARL  529
             K G   D +V NS+I MY+S   +  A+C+FDEM +R VV+W  +I  + R GD+  A  
Sbjct  148   KVGLSEDLFVQNSMINMYASCGFLNHARCIFDEMSARDVVSWNSMIIGFLRGGDLDSAFD  207

Query  528   VFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG----VQADEAILVSILSACA  361
             +F     ++   W S+I+G+VQ    KE L  F  MQ+      V+ D+  + S LSACA
Sbjct  208   LFKMMKKRNVITWNSIITGFVQGGRPKEALDFFHEMQVLDDDGTVRPDKITVASALSACA  267

Query  360   HLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNA  181
               G+LD GKW+H Y+++ G+  ++ + +ALVDMY KCGC+  A ++F E+PE+DV+ W  
Sbjct  268   SFGALDHGKWIHSYLKRSGLECDMVISSALVDMYGKCGCVERAIEVFKEMPEKDVLAWTT  327

Query  180   MISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             MIS  A++G  E A  LF+EMQ   GT+P+ VTFV L +A + SG+   G
Sbjct  328   MISVLALHGFAEEAFDLFKEMQIQ-GTKPNHVTFVGLLSASAHSGLVEAG  376


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 80/335 (24%), Positives = 133/335 (40%), Gaps = 70/335 (21%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKG  853
             H QVI  GL  + F  + ++   +  + G   +   I++ +    +   N+MI  FL  G
Sbjct  143   HVQVIKVGLSEDLFVQNSMINMYA--SCGFLNHARCIFDEMSARDVVSWNSMIIGFLRGG  200

Query  852   ELSRTMEMYKHMLK----------TGMC-------------------------PDNYTLP  778
             +L    +++K M K          TG                           PD  T+ 
Sbjct  201   DLDSAFDLFKMMKKRNVITWNSIITGFVQGGRPKEALDFFHEMQVLDDDGTVRPDKITVA  260

Query  777   YLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSR  598
               L AC +  + + G+ IH    + G   D  + ++L+ MY                  +
Sbjct  261   SALSACASFGALDHGKWIHSYLKRSGLECDMVISSALVDMYG-----------------K  303

Query  597   CVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQ  418
             C              G V  A  VF E P KD   W +MIS    +   +E   LF+ MQ
Sbjct  304   C--------------GCVERAIEVFKEMPEKDVLAWTTMISVLALHGFAEEAFDLFKEMQ  349

Query  417   MTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCL  241
             + G + +    V +LSA AH G ++ G+W    + ++  +    +    +VD+ ++ G  
Sbjct  350   IQGTKPNHVTFVGLLSASAHSGLVEAGRWCFDVMTQVYSIEPQAQHYACMVDILSRAGLF  409

Query  240   GLAQKLFYELP-ERDVICWNAMISGFAMNGDGENA  139
               A+ L   +P E DV  W A++ G  M+G+ E A
Sbjct  410   EEAEGLIQSMPMEPDVFVWGALLGGCHMHGNVEMA  444



>ref|XP_006586000.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g40405-like isoform X2 [Glycine max]
Length=634

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/347 (37%), Positives = 202/347 (58%), Gaps = 4/347 (1%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H Q++  G+ NN     + +A  +  N  N  Y  ++      PT+  +N+MI+A+ 
Sbjct  26    KQIHAQLVVKGILNNPHFHGQFVATIALHNTTNLDYANKLLNHNNNPTLFTLNSMIRAYS  85

Query  861   LKGELSRTMEMYKHMLKTG---MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLM  691
                  S++   Y ++L +    + PDNYT  +L++ C  +++   G  +HG  +K GF +
Sbjct  86    KSSTPSKSFHFYANILHSNNNNLSPDNYTFTFLVRTCAQLQAHVTGLCVHGAVIKHGFEL  145

Query  690   DSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETP  511
             D +V   L+ MY+ L  + S   VFD      +V  T +++  ++ GD+  AR +FDE P
Sbjct  146   DPHVQTGLVFMYAELGCLSSCHNVFDGAVEPDLVTQTAMLNACAKCGDIDFARKMFDEMP  205

Query  510   VKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKW  331
              +D   W +MI+GY Q    +E L +F LMQM GV+ +E  +V +LSAC HL  LD G+W
Sbjct  206   ERDHVTWNAMIAGYAQCGRSREALDVFHLMQMEGVKLNEVSMVLVLSACTHLQVLDHGRW  265

Query  330   VHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGD  151
             VH YVE+  + + V LGTALVDMYAKCG +  A ++F+ + ER+V  W++ I G AMNG 
Sbjct  266   VHAYVERYKVRMTVTLGTALVDMYAKCGNVDRAMQVFWGMKERNVYTWSSAIGGLAMNGF  325

Query  150   GENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             GE ++ LF +M+ + G +P+G+TF+S+   CS  G+  EG K  + +
Sbjct  326   GEESLDLFNDMKRE-GVQPNGITFISVLKGCSVVGLVEEGRKHFDSM  371



>ref|XP_008797883.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g40405 [Phoenix dactylifera]
Length=633

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/344 (38%), Positives = 200/344 (58%), Gaps = 2/344 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             QAH Q++  GL  +  A++ LLA C+      P Y   IY RI +P +   N +++    
Sbjct  46    QAHAQLVVRGLTASRAAMAHLLAHCALCTSAPPHYFHAIYARIDRPNVFAANNLLRCLAR  105

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 S ++  Y    + G+  +NYT P+LL+AC        G  +H   +K GF  D YV
Sbjct  106   SAAPSDSLLFYSRSRRAGVLTNNYTFPFLLQACSRTPVVAEGAQVHAHVVKLGFDGDLYV  165

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSR-CVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
              N+LI  YSS  +M+ ++ VF+E P R  VV+W  +++ Y+R G +  A  +F+  P +D
Sbjct  166   RNALIHFYSSCCEMDESERVFNEFPERRDVVSWNAMLAGYARTGRIDVAEELFEGMPERD  225

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MI GYVQ    ++GL+LFR M   G   +EA LV++LSA A LG L+ G+++H 
Sbjct  226   AISWSTMIMGYVQGGILEKGLKLFREMVDKGEMVNEAALVTVLSASAQLGLLENGQFIHS  285

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
              ++     I + +GTALVDMYAKCG + L++++F  +P+RDV  WNAM+ G A +G G+ 
Sbjct  286   NIKARNFPITLAVGTALVDMYAKCGSIKLSKQVFDGMPQRDVFAWNAMVCGLATHGMGKE  345

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             A+ LF+   N+ G RP  VTFV +  ACS +G+  EG +  + +
Sbjct  346   ALELFQRFLNE-GLRPTSVTFVGVLNACSRAGLVAEGRQYFKSM  388


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/246 (21%), Positives = 101/246 (41%), Gaps = 33/246 (13%)
 Frame = -2

Query  885  NTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLK  706
            +TMI  ++  G L + +++++ M+  G   +   L  +L A   +     G+ IH     
Sbjct  230  STMIMGYVQGGILEKGLKLFREMVDKGEMVNEAALVTVLSASAQLGLLENGQFIHSNIKA  289

Query  705  FGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLV  526
              F +   VG +L+ MY        A+C                       G +  ++ V
Sbjct  290  RNFPITLAVGTALVDMY--------AKC-----------------------GSIKLSKQV  318

Query  525  FDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSL  346
            FD  P +D   W +M+ G   +   KE L+LF+     G++      V +L+AC+  G +
Sbjct  319  FDGMPQRDVFAWNAMVCGLATHGMGKEALELFQRFLNEGLRPTSVTFVGVLNACSRAGLV  378

Query  345  DIGK-WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP-ERDVICWNAMIS  172
              G+ +    +E  G+   +     +VD+  + G +  A +L   +    D + W  ++ 
Sbjct  379  AEGRQYFKSMIEDYGIEPEMEHYGCIVDLLGRAGLVSEALELIEGMSVSPDPVLWGTLLG  438

Query  171  GFAMNG  154
               ++G
Sbjct  439  ACKIHG  444



>ref|XP_010250474.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800 
[Nelumbo nucifera]
Length=522

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/348 (38%), Positives = 206/348 (59%), Gaps = 6/348 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGN--NTFALSRLL---AFCSDPNLGNPTYGWRIYERIQQPTICIVNTMI  874
             Q H Q  T GL +   +  L+++L   +        +P Y  RI+ +I  P+    NT+I
Sbjct  23    QVHAQATTRGLMSLYPSLILTKILYTFSLLDHLTTTSPHYPLRIFNQIPNPSTFCYNTII  82

Query  873   KAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFL  694
             + + L       + ++  M +  + PD +T P++LKA   + +  L +++H Q +KFGF 
Sbjct  83    RVYTLLSSPLSALSLFAKMRRLCIPPDTHTFPFVLKASVRLRALALAKTLHSQVVKFGFG  142

Query  693   MDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDET  514
              D +V NSLI +YS L  M  A  +FD  P R VV++  +I  + + G+   AR +FDE 
Sbjct  143   SDLFVLNSLIHVYSDLGSMTDACQLFDVTPQRDVVSYNSIIHGFVKAGNTSRARDIFDEM  202

Query  513   PVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
              V+D   WG++++GY Q N  KE +QLF  M  +G++ +   LVS LSACA LG+LD GK
Sbjct  203   LVRDDVTWGTLLAGYAQMNQCKEAIQLFNQMLASGLKPNNIALVSALSACAQLGALDQGK  262

Query  333   WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNG  154
              +H ++E+  + ++  L T LVDMYAKCGC+ LA+++F    E+ +  WNAMI G AM+G
Sbjct  263   IIHNHIEQNQIRLDAFLATGLVDMYAKCGCIDLAREVFESSEEKKLFTWNAMIVGLAMHG  322

Query  153   DGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             DGE ++  FR M+ +AG +PDGV+F+ +   CS +G+ +E  +L   +
Sbjct  323   DGELSLEYFRRMK-EAGIKPDGVSFLGVLVGCSHAGLVNEAQQLFNDM  369



>ref|XP_010251726.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Nelumbo nucifera]
Length=624

 Score =   254 bits (649),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/338 (38%), Positives = 203/338 (60%), Gaps = 3/338 (1%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              Q H Q+I  GL  +  A+ R++ FC+    G+  Y  ++++++  P   I NT+I+ +L
Sbjct  37    KQFHSQIIRLGLSTDNDAMGRIIKFCAISESGDLNYALKVFDKLPHPDAFIYNTIIRGYL  96

Query  861   LKGELSRT-MEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDS  685
              + +L+R  +  Y  ML+  + P+ +T P +L+AC    +   G+ IH   LKFGF  D 
Sbjct  97    -EAQLTRNCIFFYFRMLQDSVAPNRFTFPSILRACCMDNATEEGKQIHAHVLKFGFGEDL  155

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
                N+LI MY++   +  AQ VFD++    VV+W  LI+ YSR G V +A  VF   P +
Sbjct  156   VSQNNLIHMYANFGRLGEAQRVFDKIHQPDVVSWITLITGYSRLGFVDQAYKVFSLMPER  215

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             +   W +MI+ YVQ+N F E   +F  M+   V+ D+ +  S+LSAC  LG+L+ G+W+H
Sbjct  216   NSVSWNAMIAAYVQSNRFHEAFAVFDRMRAEKVELDKFVAASMLSACTGLGALERGEWIH  275

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
              Y+E  G+ ++ +L T ++DMY KCG L  A ++F  L +R +  WN MI G AM+G GE
Sbjct  276   GYIESRGIEMDSKLATTVIDMYCKCGFLEKAIEVFGGLSQRGISSWNCMIGGLAMHGQGE  335

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
              A++LF+EM+ +    PD +TFV+L +AC+ +G+  EG
Sbjct  336   AAIQLFKEMEKEV-VAPDNITFVNLLSACAHAGLVKEG  372


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/310 (22%), Positives = 115/310 (37%), Gaps = 65/310 (21%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPT----ICIV----  886
              Q H  V+  G G +  + + L+   +  N G      R++++I QP     I ++    
Sbjct  140   KQIHAHVLKFGFGEDLVSQNNLIHMYA--NFGRLGEAQRVFDKIHQPDVVSWITLITGYS  197

Query  885   -----------------------NTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPY  775
                                    N MI A++          ++  M    +  D +    
Sbjct  198   RLGFVDQAYKVFSLMPERNSVSWNAMIAAYVQSNRFHEAFAVFDRMRAEKVELDKFVAAS  257

Query  774   LLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRC  595
             +L AC  + +   G  IHG     G  MDS +  ++I MY     +E A  VF  +  R 
Sbjct  258   MLSACTGLGALERGEWIHGYIESRGIEMDSKLATTVIDMYCKCGFLEKAIEVFGGLSQRG  317

Query  594   VVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQM  415
             + +W                                 MI G   +   +  +QLF+ M+ 
Sbjct  318   ISSWNC-------------------------------MIGGLAMHGQGEAAIQLFKEMEK  346

Query  414   TGVQADEAILVSILSACAHLGSLDIGKWVHRYV-EKLGMAINVRLGTALVDMYAKCGCLG  238
               V  D    V++LSACAH G +  G++  RY+ E  G+   +     +VD+  + G L 
Sbjct  347   EVVAPDNITFVNLLSACAHAGLVKEGRYYFRYMTEVYGIEPKMEHFGCIVDLLGRAGLLE  406

Query  237   LAQKLFYELP  208
              A+ L  E+P
Sbjct  407   EARNLIDEMP  416



>gb|AEP33758.1| organelle transcript processing 82, partial [Barbarea verna]
Length=710

 Score =   256 bits (654),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/330 (40%), Positives = 195/330 (59%), Gaps = 2/330 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLK  856
             H Q+I  GL N  +ALSRLL FC   PN     Y   ++E IQ+P + I NTM +   L 
Sbjct  22    HAQMIKTGLHNTNYALSRLLEFCILSPNFDGLPYAISVFETIQEPNLLIWNTMFRGHALS  81

Query  855   GELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVG  676
              +    +++Y  M+  G+ P++YT P+LLK+C  ++    G+ IHG  LK G+ +D YV 
Sbjct  82    SDPVSAIKLYVCMISLGLLPNSYTFPFLLKSCAKLKVSKEGQQIHGHVLKLGYELDLYVH  141

Query  675   NSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRR  496
              SLI MY      + A  VFD    R VV++T LI+ Y+ +G +  A+ +FDE PVKD  
Sbjct  142   TSLISMYVKNGRWKDAHKVFDGSSHRDVVSYTALITGYASRGYIESAQKMFDEIPVKDVV  201

Query  495   VWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYV  316
              W ++ISGY      KE L LF+ M  T V+ DE+ +V+++SACA  GS+ +G+ VH ++
Sbjct  202   SWNAIISGYADTGNNKEALDLFKEMMKTNVKPDESTMVTVVSACAQSGSIQLGRQVHSWI  261

Query  315   EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAM  136
             +  G+  N+++  AL+D+Y+KCG +  A  LF  L  +DVI WN MI G+      + A+
Sbjct  262   DDHGLGSNLKIVNALIDLYSKCGEVETACGLFQGLSNKDVISWNTMIGGYTHLNLYKEAL  321

Query  135   RLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
              LF+EM   +G  P+ VT +S+  AC+  G
Sbjct  322   LLFQEMLR-SGENPNDVTMLSILPACAQLG  350


 Score =   166 bits (421),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/308 (31%), Positives = 156/308 (51%), Gaps = 34/308 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ I    +   N +I  +   G     ++++K M+KT + PD  T+  ++ AC    
Sbjct  190  KMFDEIPVKDVVSWNAIISGYADTGNNKEALDLFKEMMKTNVKPDESTMVTVVSACAQSG  249

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LGR +H      G   +  + N+LI +YS   ++E+A  +F  + ++ V++      
Sbjct  250  SIQLGRQVHSWIDDHGLGSNLKIVNALIDLYSKCGEVETACGLFQGLSNKDVIS------  303

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                                     W +MI GY   N +KE L LF+ M  +G   ++  
Sbjct  304  -------------------------WNTMIGGYTHLNLYKEALLLFQEMLRSGENPNDVT  338

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKL--GMAINVRLGTALVDMYAKCGCLGLAQKLFYE  214
            ++SIL ACA LG++D G+W+H Y++K   G+     L T+L+DMYAKCG +  A ++F  
Sbjct  339  MLSILPACAQLGAIDFGRWIHVYIDKRIKGVTNASSLRTSLIDMYAKCGDIEAAHQVFNS  398

Query  213  LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHE  34
            +  R +   NAMI GFAM+G    A  +F  M+ + G  PD +TFV L +ACS SGM   
Sbjct  399  MHHRTLSACNAMIFGFAMHGRANAAFDIFSRMRKN-GIEPDDITFVGLLSACSHSGMLDL  457

Query  33   GLKLLEKI  10
            G ++   +
Sbjct  458  GRRIFRSM  465



>ref|XP_006417732.1| hypothetical protein EUTSA_v10006910mg [Eutrema salsugineum]
 gb|ESQ36085.1| hypothetical protein EUTSA_v10006910mg [Eutrema salsugineum]
Length=740

 Score =   256 bits (655),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/332 (38%), Positives = 198/332 (60%), Gaps = 2/332 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             + H Q+I  GL N  +ALS+L+  C   P+    TY   ++E IQ+P   I NTM++   
Sbjct  50    KIHAQMIKTGLHNTNYALSKLIELCVLSPHFEGLTYAISVFETIQEPNQLIWNTMLRGHA  109

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
             L  +   ++++Y  M+  G+ P++YT P+LLK+C    +   G+ IHG  LKFG+ +D Y
Sbjct  110   LSSDPVSSLKLYVSMISLGLLPNSYTFPFLLKSCAKSNTLREGQQIHGHVLKFGYGLDLY  169

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             V  SLI MY+    +E AQ VFD    R VV++T LI+ Y+ +G    A+ +FDE P KD
Sbjct  170   VHTSLISMYAQNGRLEDAQQVFDRSSHRDVVSYTALITGYASRGYTQSAQKMFDEIPDKD  229

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MISGYV+   +KE  +LF  M  + V  DE+ +V++LSACA  GS+++G+ VH 
Sbjct  230   VVSWNAMISGYVETGYYKEAFELFEDMMKSNVSPDESTMVTVLSACAQSGSIELGRQVHS  289

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             +++  G   N+++  AL+D+Y+KCG +  A  LF  +  +DV+ WN +I G+      + 
Sbjct  290   WIDDHGFGSNLKIVNALIDLYSKCGEVATACGLFEGMSYKDVVSWNTLIGGYTHMSLYKE  349

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             A+ LF+EM   +   P+ VT +S+  AC+  G
Sbjct  350   ALLLFQEMLR-SNESPNDVTMLSILPACAHLG  380


 Score =   177 bits (449),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 157/308 (51%), Gaps = 34/308 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ I    +   N MI  ++  G      E+++ M+K+ + PD  T+  +L AC    
Sbjct  220  KMFDEIPDKDVVSWNAMISGYVETGYYKEAFELFEDMMKSNVSPDESTMVTVLSACAQSG  279

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LGR +H      GF  +  + N+LI +YS                 +C         
Sbjct  280  SIELGRQVHSWIDDHGFGSNLKIVNALIDLYS-----------------KC---------  313

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 G+V  A  +F+    KD   W ++I GY   + +KE L LF+ M  +    ++  
Sbjct  314  -----GEVATACGLFEGMSYKDVVSWNTLIGGYTHMSLYKEALLLFQEMLRSNESPNDVT  368

Query  387  LVSILSACAHLGSLDIGKWVHRYVEK--LGMAINVRLGTALVDMYAKCGCLGLAQKLFYE  214
            ++SIL ACAHLG++DIG+W+H Y+ K   G+     L T+L+DMYAKCG +  A ++F  
Sbjct  369  MLSILPACAHLGAIDIGRWIHVYIAKKLKGVTNASSLRTSLIDMYAKCGDIEAAHQVFNS  428

Query  213  LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHE  34
            +  R +  WNAMI GFAM+G    A  LF  M+ + G  PDG+TFV L +ACS SGM   
Sbjct  429  MLHRSLSSWNAMIFGFAMHGRANAAFDLFSRMRKN-GIEPDGITFVGLLSACSHSGMLDL  487

Query  33   GLKLLEKI  10
            G ++   +
Sbjct  488  GRRIFRSM  495


 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 72/326 (22%), Positives = 135/326 (41%), Gaps = 37/326 (11%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +   G G+N   ++ L+   S    G       ++E +    +   NT+I  +  
Sbjct  286   QVHSWIDDHGFGSNLKIVNALIDLYS--KCGEVATACGLFEGMSYKDVVSWNTLIGGYTH  343

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLK--FGFLMDS  685
                    + +++ ML++   P++ T+  +L AC ++ + ++GR IH    K   G    S
Sbjct  344   MSLYKEALLLFQEMLRSNESPNDVTMLSILPACAHLGAIDIGRWIHVYIAKKLKGVTNAS  403

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
              +  SLI MY+   D+E+A  VF+ M  R + +W  +I  ++  G    A   FD     
Sbjct  404   SLRTSLIDMYAKCGDIEAAHQVFNSMLHRSLSSWNAMIFGFAMHG---RANAAFD-----  455

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
                                    LF  M+  G++ D    V +LSAC+H G LD+G+ + 
Sbjct  456   -----------------------LFSRMRKNGIEPDGITFVGLLSACSHSGMLDLGRRIF  492

Query  324   R-YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP-ERDVICWNAMISGFAMNGD  151
             R   +   +   +     ++D+    G    A+++   +P E D + W +++     +G+
Sbjct  493   RSMTQDYNITPKLEHYGCMIDLLGHSGLFNEAKEMINTMPMEPDGVIWCSLLKACKTHGN  552

Query  150   GENAMRLFREMQNDAGTRPDGVTFVS  73
              E A    + +       P     +S
Sbjct  553   LELAESFAQNLMKVEPENPGSYVLLS  578



>emb|CBI28140.3| unnamed protein product [Vitis vinifera]
Length=580

 Score =   253 bits (646),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/325 (39%), Positives = 204/325 (63%), Gaps = 5/325 (2%)
 Frame = -2

Query  999  NTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKH  820
            + F+ S+++AFC+  + G+  Y   ++ +I  PT    N++I+ +  K    + +  Y+ 
Sbjct  9    DPFSASKIVAFCALHDSGSLPYARLVFNQIPNPTTFTCNSIIRGYTNKNLPRQAILFYQL  68

Query  819  MLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDD  640
            M+  G+ PD +T P L K+CG +  C  G+ +H    K GF  D+Y+ N+L+ MYS+   
Sbjct  69   MMLQGLDPDRFTFPSLFKSCGVL--CE-GKQLHCHSTKLGFASDAYIQNTLMNMYSNCGC  125

Query  639  MESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRV-WGSMISGYVQ  463
            + SA+ VFD+M ++ VV+W  +I  Y++     EA  +F    +      W  MI+G+V+
Sbjct  126  LVSARKVFDKMVNKSVVSWATMIGAYAQWDLPHEAIKLFRRMEIASNLFCWNIMINGHVE  185

Query  462  NNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRL  283
            ++ ++E L LF  MQ++GV+ D+  + S+L AC HLG+L++GKW+H Y+EK  + ++V L
Sbjct  186  DSDYEEALSLFNEMQLSGVKGDKVTMASLLIACTHLGALELGKWLHVYIEKEKIEVDVAL  245

Query  282  GTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAG  103
            GTALVDMYAKCG +  A ++F E+PE+DV+ W A+I G AM G G  A+ LF EMQ  + 
Sbjct  246  GTALVDMYAKCGSIESAMRVFQEMPEKDVMTWTALIVGLAMCGQGLKALELFHEMQM-SE  304

Query  102  TRPDGVTFVSLFTACSCSGMAHEGL  28
             +PD +TFV +  ACS +G+ +EG+
Sbjct  305  VKPDAITFVGVLAACSHAGLVNEGI  329



>ref|XP_010096333.1| hypothetical protein L484_021080 [Morus notabilis]
 gb|EXB63808.1| hypothetical protein L484_021080 [Morus notabilis]
Length=615

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/338 (39%), Positives = 201/338 (59%), Gaps = 3/338 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q++T GL N+   L + +A  +  N  N  Y  ++ ++   PT+   N+MI+A+  
Sbjct  27    QIHAQLLTNGLLNDPNRLGQFVATIAIHNPNNLDYSNQVLDQCHFPTLFAFNSMIRAYSK  86

Query  858   KGELSRTMEMYKHMLKTG--MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDS  685
                  ++   Y  +L +   + P NYTL ++++AC  +     G S+HG  +K GF  D 
Sbjct  87    TSTPHKSFHFYNRILMSNDNLSPYNYTLNFMVRACAQLSGSETGPSVHGAVIKQGFENDP  146

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
             ++ + LI MY+ L  + S   VF  +P   VV  T ++S  ++ GDV  AR +FDE P +
Sbjct  147   HIQSGLIFMYAELGRLSSCHRVFGVIPEPGVVCQTAMVSACAKCGDVGLARDLFDEMPQR  206

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             D   W +MI+GY Q    +E L LF +MQ+ GV+ +E  +VS+LSAC+HLG+LD GKW H
Sbjct  207   DHVAWNAMIAGYAQCGKSREALALFHMMQVDGVKVNEVSMVSVLSACSHLGALDHGKWAH  266

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
              Y+E   + + V LGTAL+DMYAKCG +  A ++F+ + E++V  W++ + G AMNG GE
Sbjct  267   AYIEINRLRMTVNLGTALIDMYAKCGDMKRAMEVFWGMREKNVYTWSSAMGGLAMNGFGE  326

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
               + LF  M+ D G +P+ VTFV++F  CS  G+  EG
Sbjct  327   KCLELFSLMKRD-GVQPNEVTFVAVFRGCSVVGLVAEG  363



>ref|XP_007014547.1| Pentatricopeptide repeat protein isoform 2 [Theobroma cacao]
 gb|EOY32166.1| Pentatricopeptide repeat protein isoform 2 [Theobroma cacao]
Length=511

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/345 (36%), Positives = 212/345 (61%), Gaps = 3/345 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q    +I      + +A  R+++FC+     + ++ ++++  +Q  T  I NT+I+AF+ 
Sbjct  6     QMQSHLIVSATLLDPYAAGRIISFCAVSADADLSHAYKLFLSLQHRTTFIWNTIIRAFVE  65

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             +   +  + +YK+ML++G  P+NYT  ++L+AC    S  L    H   +K G+    +V
Sbjct  66    RNANATAISLYKNMLQSGFLPNNYTFSFVLRACTTYSSTALAS--HALVIKLGWESYDFV  123

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N LI +Y++L  M++A+ +F+   +R V+ WT L++ Y + G    AR +FD+ P ++ 
Sbjct  124   LNGLIHLYANLSLMDAARKLFNVSTNRDVITWTSLLNGYVQSGQAEFARELFDQMPERNA  183

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GYVQ   F+E + LF  MQ++G++ + A +V  L+ACA LG+LD G+W+H Y
Sbjct  184   VSWSAMITGYVQMGMFREAMGLFNDMQLSGLRPNHAGIVGALTACAFLGALDHGRWIHAY  243

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V++ GM ++  LGTALVDMYAKCGC+ +A  +F E+P +DV  + ++ISG A +     A
Sbjct  244   VDRNGMELDRVLGTALVDMYAKCGCIEMACSVFDEMPYKDVFAFTSLISGLANHDQSARA  303

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             + LF  MQ++ G  P+ VTF+ + +ACS  G+  EGL++   + +
Sbjct  304   IELFARMQSE-GVVPNEVTFICVLSACSRMGLVDEGLRIFNYMSK  347


 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 70/270 (26%), Positives = 120/270 (44%), Gaps = 33/270 (12%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            G   +   +++++ +      + MI  ++  G     M ++  M  +G+ P++  +   L
Sbjct  166  GQAEFARELFDQMPERNAVSWSAMITGYVQMGMFREAMGLFNDMQLSGLRPNHAGIVGAL  225

Query  768  KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
             AC  + + + GR IH    + G  +D  +G +L+ MY        A+C   EM      
Sbjct  226  TACAFLGALDHGRWIHAYVDRNGMELDRVLGTALVDMY--------AKCGCIEMACS---  274

Query  588  AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
                                VFDE P KD   + S+ISG   ++     ++LF  MQ  G
Sbjct  275  --------------------VFDEMPYKDVFAFTSLISGLANHDQSARAIELFARMQSEG  314

Query  408  VQADEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLA  232
            V  +E   + +LSAC+ +G +D G  +  Y+ K+ G+   V+    LVD+  + G    A
Sbjct  315  VVPNEVTFICVLSACSRMGLVDEGLRIFNYMSKVYGIEPGVQHYGCLVDLLGRAGLFEEA  374

Query  231  QKLFYELP-ERDVICWNAMISGFAMNGDGE  145
             KL  E+P E D     A+++   M+GD E
Sbjct  375  NKLVREMPMEPDSYVLGALLNSCRMHGDVE  404



>ref|XP_011038349.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Populus euphratica]
Length=540

 Score =   251 bits (642),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/344 (38%), Positives = 207/344 (60%), Gaps = 2/344 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPT-YGWRIYERIQQPTICIVNTMIKAFL  862
             Q    +       + ++ +++L+  +  N  +   Y  R++  +Q  +  I NTM++AF+
Sbjct  29    QIQSHLTVTATLKDPYSAAKILSLHAHSNAKSSLFYAERLFLCLQNKSTFIWNTMMQAFV  88

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
              K E  R   +YKHML++   P+N+T  ++++AC ++ +  +G   HGQ +KFG+    +
Sbjct  89    EKNEPMRAFSLYKHMLESNYLPNNFTFSFVIRACIDVFNLQMGLCFHGQVIKFGWESYDF  148

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             V N LI +Y++   M+ A+ +FD    R VV WT LIS Y   G V  AR +FD  P K+
Sbjct  149   VQNGLIHLYANCGFMDLARNMFDMSIKRDVVTWTCLISGYLNSGQVLIARELFDRMPEKN  208

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                WG+MI GYV+   F+E L++F  MQ++G + + A +V  L+ACA LG+LD G+W++ 
Sbjct  209   PVSWGAMIGGYVRIGFFQEALEVFYDMQVSGFRLNRASIVGALTACAFLGALDQGRWIYA  268

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             YV++  M+++  LGTAL+DMYAKCGC+ +A  +F E+ +RDV  +  +ISG A +   E 
Sbjct  269   YVKRHHMSLDRMLGTALIDMYAKCGCIEMACSVFDEMDDRDVYAFTCLISGLANHDKSEA  328

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             A+ LF  MQ D G  P+ VTFV +  ACS  GM  EGL + E +
Sbjct  329   AIALFNRMQ-DEGVVPNEVTFVCVLNACSRMGMVDEGLGIFESM  371



>ref|XP_009122264.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540 
[Brassica rapa]
Length=612

 Score =   253 bits (646),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/311 (41%), Positives = 190/311 (61%), Gaps = 1/311 (0%)
 Frame = -2

Query  936  YGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACG  757
            Y  RI+ +IQ P + + N +I+ F    E S+    Y  ML+  + PDN T P+L+KA  
Sbjct  61   YAHRIFSQIQSPNLFVFNLLIRTFSTSPEASKAYNFYTQMLRLCIPPDNITFPFLIKASA  120

Query  756  NMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTV  577
             ME    G  IH   ++FGF  D YV NSL+ MY++   + SA  VF  M  R VV+WT 
Sbjct  121  EMECVRTGEQIHSHVVRFGFHNDVYVENSLVHMYATCGLIASAGRVFGAMSFRNVVSWTS  180

Query  576  LISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQAD  397
            ++  Y + G V +AR +FDE P ++   W  MI+GY ++N F+E ++LF +M+  GV A+
Sbjct  181  MVDGYCKCGLVDDAREMFDEMPHRNLVTWSIMINGYAKSNRFEEAVELFEVMRREGVVAN  240

Query  396  EAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFY  217
            E ++VS++S+CAHLG+L +G   H YV + GM +N+ LGTALV+MY +CG +  A  +F 
Sbjct  241  ETVMVSVVSSCAHLGALGVGVRAHEYVVENGMGVNLVLGTALVEMYWRCGEMEKAVSVFQ  300

Query  216  ELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAH  37
            EL E+D + W+++I G A++G G  A+  F EM    G  P  VTF ++ +ACS  G+  
Sbjct  301  ELDEKDSLSWSSIIKGLAVHGHGHKAVGYFSEMVR-LGFVPRDVTFTAVLSACSHGGLVE  359

Query  36   EGLKLLEKIGR  4
            +G +L E + R
Sbjct  360  KGFELYEMMKR  370



>ref|XP_002322762.2| hypothetical protein POPTR_0016s06560g [Populus trichocarpa]
 gb|EEF04523.2| hypothetical protein POPTR_0016s06560g [Populus trichocarpa]
Length=543

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/280 (42%), Positives = 180/280 (64%), Gaps = 1/280 (0%)
 Frame = -2

Query  843  RTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLI  664
            ++   Y    + G+ PDN T P+L+KAC    S ++G   HGQ ++ GF  D YV NSL+
Sbjct  22   KSFHFYVQSKRNGLVPDNLTYPFLVKACTQKGSLDMGIQAHGQIIRHGFDSDVYVQNSLV  81

Query  663  VMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGS  484
             MYS+L D++SA  VF  +    VV+WT +++ Y + GDV  AR +FD+ P K+   W  
Sbjct  82   TMYSTLGDIKSASYVFRRISCLDVVSWTSMVAGYIKSGDVTSARKLFDKMPEKNLVTWSV  141

Query  483  MISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLG  304
            MISGY +N+ F + ++L+ L+Q  GV A+E ++VS++++CAHLG+L++G+  H Y+ +  
Sbjct  142  MISGYAKNSFFDKAIELYFLLQSEGVHANETVMVSVIASCAHLGALELGERAHDYILRNK  201

Query  303  MAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFR  124
            M +N+ LGTALVDMYA+CG +  A  +F +LP RD + W  +I+GFAM+G  E A+  F 
Sbjct  202  MTVNLILGTALVDMYARCGSIDKAIWVFDQLPGRDALSWTTLIAGFAMHGYAEKALEYFS  261

Query  123  EMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             M+  AG  P  +TF ++ +ACS  G+   GL+L E + R
Sbjct  262  RMEK-AGLTPREITFTAVLSACSHGGLVERGLELFESMKR  300


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 71/312 (23%), Positives = 142/312 (46%), Gaps = 20/312 (6%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             QAHGQ+I  G  ++ +  + L+   S   LG+      ++ RI    +    +M+  ++ 
Sbjct  60    QAHGQIIRHGFDSDVYVQNSLVTMYS--TLGDIKSASYVFRRISCLDVVSWTSMVAGYIK  117

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCL--KFGFLMDS  685
              G+++   +++  M      P+   + + +   G  ++    ++I    L    G   + 
Sbjct  118   SGDVTSARKLFDKM------PEKNLVTWSVMISGYAKNSFFDKAIELYFLLQSEGVHANE  171

Query  684   YVGNSLIVMYSSLDDMESAQCVFD-----EMPSRCVVAWTVLISRYSRKGDVFEARLVFD  520
              V  S+I   + L  +E  +   D     +M    ++  T L+  Y+R G + +A  VFD
Sbjct  172   TVMVSVIASCAHLGALELGERAHDYILRNKMTVNLILG-TALVDMYARCGSIDKAIWVFD  230

Query  519   ETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDI  340
             + P +D   W ++I+G+  +   ++ L+ F  M+  G+   E    ++LSAC+H G ++ 
Sbjct  231   QLPGRDALSWTTLIAGFAMHGYAEKALEYFSRMEKAGLTPREITFTAVLSACSHGGLVER  290

Query  339   GKWVHRYVEKLGMAINVRLGTA--LVDMYAKCGCLGLAQKLFYELPER-DVICWNAMISG  169
             G  +   + K    I  RL     +VD+  + G L  A+K   E+P + +   W A++  
Sbjct  291   GLELFESM-KRDYRIEPRLEHYGCMVDLLGRAGKLAEAEKFVNEMPMKPNAPIWGALLGA  349

Query  168   FAMNGDGENAMR  133
               ++ + E A R
Sbjct  350   CRIHKNSEIAER  361



>ref|XP_011028518.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Populus euphratica]
Length=634

 Score =   253 bits (647),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/342 (40%), Positives = 202/342 (59%), Gaps = 10/342 (3%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNP-TYGWRIYERIQQPTICIVNTMIKAFL  862
             Q H Q+I  GL ++   +  L+ FC+  +  +  TY  ++++ I QP   + NT+IK FL
Sbjct  42    QYHSQIIRLGLSSHNHLIPPLINFCARASTSDALTYALKLFDSIPQPDAFLYNTIIKGFL  101

Query  861   LKGEL--SRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMD  688
                 L  +  + +Y HML+  + P+N+T P LL AC  ++    G  IH    KFGF   
Sbjct  102   HSQLLPTNSILLLYSHMLQNSVLPNNFTFPSLLGACRKIQH---GMQIHAHLFKFGFGTH  158

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
             S   NSLI MY +   +E A+ VF  +P    ++WT LIS YS+ G + EA  +F   P 
Sbjct  159   SVCLNSLIHMYVTFQALEEARRVFHTIPHPDSISWTSLISGYSKWGLIDEAFTIFQLMPQ  218

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLF-RLMQMTGVQADEAILVSILSACAHLGSLDIGKW  331
             K+   W +M++ YVQ N F E   LF R+   T    D+ +  ++LSAC  LG+LD GKW
Sbjct  219   KNSASWNAMMAAYVQTNRFHEAFALFDRMKAETNNVLDKFVATTMLSACTGLGALDQGKW  278

Query  330   VHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYE--LPERDVICWNAMISGFAMN  157
             +H Y+++ G+ ++ +L TA+VDMY KCGCL  A ++F+   LP R +  WN MI G AM+
Sbjct  279   IHEYIKRNGIELDSKLTTAIVDMYCKCGCLEKALQVFHSMPLPCRWISSWNCMIGGLAMH  338

Query  156   GDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             G+GE A++LF+EM+      PD +TF++L TAC+ SG+  EG
Sbjct  339   GNGEAAIQLFKEMERKR-VAPDDITFLNLLTACAHSGLVEEG  379


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 101/244 (41%), Gaps = 31/244 (13%)
 Frame = -2

Query  933  GWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHM-LKTGMCPDNYTLPYLLKACG  757
             + I++ + Q      N M+ A++          ++  M  +T    D +    +L AC 
Sbjct  209  AFTIFQLMPQKNSASWNAMMAAYVQTNRFHEAFALFDRMKAETNNVLDKFVATTMLSACT  268

Query  756  NMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTV  577
             + + + G+ IH    + G  +DS +  +++ MY     +E A  VF  MP  C   W  
Sbjct  269  GLGALDQGKWIHEYIKRNGIELDSKLTTAIVDMYCKCGCLEKALQVFHSMPLPC--RWI-  325

Query  576  LISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQAD  397
                                        W  MI G   +   +  +QLF+ M+   V  D
Sbjct  326  --------------------------SSWNCMIGGLAMHGNGEAAIQLFKEMERKRVAPD  359

Query  396  EAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLAQKLF  220
            +   +++L+ACAH G ++ G+    Y+ ++ G+   +     +VD+  + G +  A+KL 
Sbjct  360  DITFLNLLTACAHSGLVEEGRNYFSYMIRVYGIEPRMEHFGCMVDLLGRAGMVLEARKLI  419

Query  219  YELP  208
             E+P
Sbjct  420  DEMP  423


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 85/219 (39%), Gaps = 30/219 (14%)
 Frame = -2

Query  570  SRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEG--LQLFRLMQMTGVQAD  397
            +R S    +  A  +FD  P  D  ++ ++I G++ +        L L+  M    V  +
Sbjct  67   ARASTSDALTYALKLFDSIPQPDAFLYNTIIKGFLHSQLLPTNSILLLYSHMLQNSVLPN  126

Query  396  EAILVSILSAC----------AHLGSLDIG-------KWVHRYVEKLGMAINVRL-----  283
                 S+L AC          AHL     G         +H YV    +    R+     
Sbjct  127  NFTFPSLLGACRKIQHGMQIHAHLFKFGFGTHSVCLNSLIHMYVTFQALEEARRVFHTIP  186

Query  282  ------GTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFRE  121
                   T+L+  Y+K G +  A  +F  +P+++   WNAM++ +        A  LF  
Sbjct  187  HPDSISWTSLISGYSKWGLIDEAFTIFQLMPQKNSASWNAMMAAYVQTNRFHEAFALFDR  246

Query  120  MQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
            M+ +     D     ++ +AC+  G   +G  + E I R
Sbjct  247  MKAETNNVLDKFVATTMLSACTGLGALDQGKWIHEYIKR  285



>ref|XP_006385170.1| hypothetical protein POPTR_0004s24500g [Populus trichocarpa]
 gb|ERP62967.1| hypothetical protein POPTR_0004s24500g [Populus trichocarpa]
Length=632

 Score =   253 bits (647),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/342 (40%), Positives = 201/342 (59%), Gaps = 10/342 (3%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNP-TYGWRIYERIQQPTICIVNTMIKAFL  862
             Q H Q+I  GL ++   +  L+ FC+  +  +  TY  ++++ I QP   + NT+IK FL
Sbjct  40    QYHSQIIRLGLSSHNHLIPPLINFCARASTSDALTYALKLFDSIPQPDAFLYNTIIKGFL  99

Query  861   LKGEL--SRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMD  688
                 L  +  + +Y HML+  + P+N+T P LL AC  ++    G  IH    KFGF   
Sbjct  100   HSQLLPTNSILLLYSHMLQNSVLPNNFTFPSLLIACRKIQH---GMQIHAHLFKFGFGAH  156

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
             S   NSLI MY +   +E A+ VF  +P    V+WT LIS YS+ G + EA  +F   P 
Sbjct  157   SVCLNSLIHMYVTFQALEEARRVFHTIPHPDSVSWTSLISGYSKWGLIDEAFTIFQLMPQ  216

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQA-DEAILVSILSACAHLGSLDIGKW  331
             K+   W +M++ YVQ N F E   LF  M+       D+ +  ++LSAC  LG+LD GKW
Sbjct  217   KNSASWNAMMAAYVQTNRFHEAFALFDRMKAENNNVLDKFVATTMLSACTGLGALDQGKW  276

Query  330   VHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPE--RDVICWNAMISGFAMN  157
             +H Y+++ G+ ++ +L TA+VDMY KCGCL  A ++F+ LP   R +  WN MI G AM+
Sbjct  277   IHEYIKRNGIELDSKLTTAIVDMYCKCGCLEKALQVFHSLPLPCRWISSWNCMIGGLAMH  336

Query  156   GDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             G+GE A++LF+EM+      PD +TF++L TAC+ SG+  EG
Sbjct  337   GNGEAAIQLFKEMERQR-VAPDDITFLNLLTACAHSGLVEEG  377


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 52/244 (21%), Positives = 100/244 (41%), Gaps = 31/244 (13%)
 Frame = -2

Query  933  GWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHM-LKTGMCPDNYTLPYLLKACG  757
             + I++ + Q      N M+ A++          ++  M  +     D +    +L AC 
Sbjct  207  AFTIFQLMPQKNSASWNAMMAAYVQTNRFHEAFALFDRMKAENNNVLDKFVATTMLSACT  266

Query  756  NMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTV  577
             + + + G+ IH    + G  +DS +  +++ MY     +E A  VF  +P  C   W  
Sbjct  267  GLGALDQGKWIHEYIKRNGIELDSKLTTAIVDMYCKCGCLEKALQVFHSLPLPC--RWI-  323

Query  576  LISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQAD  397
                                        W  MI G   +   +  +QLF+ M+   V  D
Sbjct  324  --------------------------SSWNCMIGGLAMHGNGEAAIQLFKEMERQRVAPD  357

Query  396  EAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLAQKLF  220
            +   +++L+ACAH G ++ G+    Y+ ++ G+   +     +VD+  + G +  A+KL 
Sbjct  358  DITFLNLLTACAHSGLVEEGRNYFSYMIRVYGIEPRMEHFGCMVDLLGRAGMVPEARKLI  417

Query  219  YELP  208
             E+P
Sbjct  418  DEMP  421


 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 85/219 (39%), Gaps = 30/219 (14%)
 Frame = -2

Query  570  SRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEG--LQLFRLMQMTGVQAD  397
            +R S    +  A  +FD  P  D  ++ ++I G++ +        L L+  M    V  +
Sbjct  65   ARASTSDALTYALKLFDSIPQPDAFLYNTIIKGFLHSQLLPTNSILLLYSHMLQNSVLPN  124

Query  396  EAILVSILSAC----------AHLGSLDIG-------KWVHRYVEKLGMAINVRL-----  283
                 S+L AC          AHL     G         +H YV    +    R+     
Sbjct  125  NFTFPSLLIACRKIQHGMQIHAHLFKFGFGAHSVCLNSLIHMYVTFQALEEARRVFHTIP  184

Query  282  ------GTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFRE  121
                   T+L+  Y+K G +  A  +F  +P+++   WNAM++ +        A  LF  
Sbjct  185  HPDSVSWTSLISGYSKWGLIDEAFTIFQLMPQKNSASWNAMMAAYVQTNRFHEAFALFDR  244

Query  120  MQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
            M+ +     D     ++ +AC+  G   +G  + E I R
Sbjct  245  MKAENNNVLDKFVATTMLSACTGLGALDQGKWIHEYIKR  283



>ref|XP_004253185.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Solanum lycopersicum]
Length=626

 Score =   253 bits (646),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 130/336 (39%), Positives = 201/336 (60%), Gaps = 1/336 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q++  GL ++  A+ R++ FC+   LG+ +Y  ++++++ +P   I NT+I+  L 
Sbjct  40    QFHAQIVKHGLSHDNDAMGRVIKFCAISELGDLSYALQVFDKLPEPDPFIYNTVIRGLLK  99

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                L  ++  Y  ML++ + P+++T P L++ C    +   G+ IHG  +KFGF  D + 
Sbjct  100   SQMLRDSLLFYLCMLESSVRPNSFTFPPLIRVCCIDNAVEEGKQIHGHVVKFGFGFDRFS  159

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N+LI MY S   +E A+ VFD M  R  V+ T LIS Y++ G V EA  VFD    K  
Sbjct  160   QNNLIHMYVSFRCLEEAKRVFDNMCERDDVSLTTLISGYAQLGYVDEAFQVFDSIREKSC  219

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
              +W +MIS YVQ+N F E   LF  M   GV  D+ +  S+LSAC  LG+L  G+W+  +
Sbjct  220   VIWNAMISAYVQSNRFHEAFALFERMGCEGVVVDKFLAASMLSACTRLGALKQGEWIVEH  279

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V+K G+ ++ +L   +VDMY KCGCL  A + F  L  + +  WN MI G AM+G+GE A
Sbjct  280   VKKSGIELDSKLSATIVDMYCKCGCLDKAVEFFQGLSRKGISSWNCMIGGLAMHGEGEAA  339

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             + + +EM+++    PD +TFV+L +AC+ SG+  EG
Sbjct  340   IEVLKEMESER-VAPDYITFVNLLSACAHSGLVEEG  374


 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 103/250 (41%), Gaps = 32/250 (13%)
 Frame = -2

Query  954  NLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPY  775
             LG     +++++ I++ +  I N MI A++          +++ M   G+  D +    
Sbjct  200  QLGYVDEAFQVFDSIREKSCVIWNAMISAYVQSNRFHEAFALFERMGCEGVVVDKFLAAS  259

Query  774  LLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRC  595
            +L AC  + +   G  I     K G  +DS +  +++ MY     ++ A   F  +    
Sbjct  260  MLSACTRLGALKQGEWIVEHVKKSGIELDSKLSATIVDMYCKCGCLDKAVEFFQGL----  315

Query  594  VVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQM  415
                       SRKG                   W  MI G   +   +  +++ + M+ 
Sbjct  316  -----------SRKG----------------ISSWNCMIGGLAMHGEGEAAIEVLKEMES  348

Query  414  TGVQADEAILVSILSACAHLGSLDIGKWVHRYV-EKLGMAINVRLGTALVDMYAKCGCLG  238
              V  D    V++LSACAH G ++ GK   RY+ E  G+   +     LVD+  + G L 
Sbjct  349  ERVAPDYITFVNLLSACAHSGLVEEGKHYFRYMKETYGIEPGMEHYGCLVDLLGRAGLLV  408

Query  237  LAQKLFYELP  208
             A+++  ++P
Sbjct  409  EARRVVNDMP  418



>ref|XP_010541645.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Tarenaya hassleriana]
Length=550

 Score =   251 bits (641),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/347 (36%), Positives = 205/347 (59%), Gaps = 8/347 (2%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
              + HG +I   L  + F +++++  C     G   Y  R+++ +  P + + N++I+A+ 
Sbjct  27    KKIHGCIIKHRLSQSNFLVTKMVDACDKA--GAMAYANRLFKGVIDPNVFLYNSIIRAYT  84

Query  861   LKGELSRTMEMYKHMLKTG-----MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGF  697
                  +  + +YK MLK       + PD +T P+++K+C  +    LG+ +HG   KF  
Sbjct  85    HHSMYNDAVGVYKLMLKNPESENPVVPDRFTFPFVIKSCAGLGFYELGKQVHGHLFKFRP  144

Query  696   LMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDE  517
                    N+LI MY+  DD+ +A  VFDEM  R V++W  L+S Y+R G + +AR +F  
Sbjct  145   KFHVVTKNALIDMYTKFDDVVNAHRVFDEMYERDVISWNSLVSGYARLGQMRKARALFCT  204

Query  516   TPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIG  337
              P K    W +MISGY +   + + + +FR MQ+ G+  DE  ++S+L +CAHLG+L++G
Sbjct  205   MPDKTIVSWTAMISGYTKIGSYVDAVDIFRQMQIAGIGPDEISVISVLPSCAHLGALELG  264

Query  336   KWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMN  157
             KW+HRY E+ G      +  AL++MY+KCG +  A +LF ++ E+DVI W+ MISGFA +
Sbjct  265   KWIHRYSERKGFLKQTGVCNALIEMYSKCGVISQAIQLFDQMHEKDVISWSTMISGFANH  324

Query  156   GDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLE  16
             G+   A+  FREMQ    T P+G+TF+ L +AC+ +G+  EGL+  +
Sbjct  325   GNACEAIETFREMQRTNVT-PNGITFLGLLSACAHAGLWKEGLRYFK  370



>ref|XP_010112156.1| hypothetical protein L484_019895 [Morus notabilis]
 gb|EXC32781.1| hypothetical protein L484_019895 [Morus notabilis]
Length=549

 Score =   251 bits (641),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/352 (36%), Positives = 204/352 (58%), Gaps = 10/352 (3%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H  ++   L  + F +++++  C     G   Y   +++++ Q  + + N +IKA+  
Sbjct  32    KIHALIVKFSLSQSNFLVTKMVDVCD--KTGQVEYASLLFQQVVQGNVFLYNAIIKAYAN  89

Query  858   KGELSRTMEMYKHML-------KTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFG  700
                 S  + +YK M+       K  M P+ +T P+++K+C  +   +LGR +H    KFG
Sbjct  90    NSRYSLALILYKQMVSQISEDEKNPMLPNKFTFPFVVKSCAGLLCVSLGRQVHAHVWKFG  149

Query  699   FLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFD  520
                 S   N+L+ MY     +E A  +F+EM  R +V+W  L+S Y+R G + +AR +F+
Sbjct  150   TKSHSITDNALMDMYMKCGSLEYAHKLFEEMRERDLVSWNGLLSGYARLGQMRKARELFE  209

Query  519   ETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDI  340
             E P K    W  +ISGYV   C+ E L++FR MQM  ++ DE  ++S+L ACA LG L+I
Sbjct  210   EMPDKSIVSWTVLISGYVGIGCYSEALEIFREMQMLDIEPDEVSVISVLPACAQLGVLEI  269

Query  339   GKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAM  160
             GKW+H Y +K G++ +  +  AL++MYAKCGC+  A +LF ++ ERDV+ W+ MI G A 
Sbjct  270   GKWIHIYSDKNGLSRSTGVCNALIEMYAKCGCIDPALQLFEKMMERDVVSWSTMIGGLAN  329

Query  159   NGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             +G    A+ LFR+MQ      P+G+TF+ L +AC  +G  +EGLK  + + +
Sbjct  330   HGKAHEAIELFRDMQR-TRIEPNGITFLGLLSACIHAGFWNEGLKYFDSMRK  380


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 67/293 (23%), Positives = 120/293 (41%), Gaps = 74/293 (25%)
 Frame = -2

Query  795  DNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVF  616
            +N  LP   + C ++++    + IH   +KF     +++   ++ +      +E A  +F
Sbjct  14   ENLFLP-TFRNCTHLKTL---KKIHALIVKFSLSQSNFLVTKMVDVCDKTGQVEYASLLF  69

Query  615  DEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQ  436
             ++                 +G+VF               ++ ++I  Y  N+ +   L 
Sbjct  70   QQVV----------------QGNVF---------------LYNAIIKAYANNSRYSLALI  98

Query  435  LFRLMQMTGVQADEA--------ILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLG  280
            L++ M ++ +  DE             ++ +CA L  + +G+ VH +V K G   +    
Sbjct  99   LYKQM-VSQISEDEKNPMLPNKFTFPFVVKSCAGLLCVSLGRQVHAHVWKFGTKSHSITD  157

Query  279  TALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDA--  106
             AL+DMY KCG L  A KLF E+ ERD++ WN ++SG+A  G    A  LF EM + +  
Sbjct  158  NALMDMYMKCGSLEYAHKLFEEMRERDLVSWNGLLSGYARLGQMRKARELFEEMPDKSIV  217

Query  105  ----------------------------GTRPDGVTFVSLFTACSCSGMAHEG  31
                                           PD V+ +S+  AC+  G+   G
Sbjct  218  SWTVLISGYVGIGCYSEALEIFREMQMLDIEPDEVSVISVLPACAQLGVLEIG  270



>ref|XP_009394320.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Musa acuminata subsp. malaccensis]
Length=512

 Score =   250 bits (638),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/341 (37%), Positives = 204/341 (60%), Gaps = 1/341 (0%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKG  853
             H  ++  G  ++ +A  +L+AFC+  + G+  Y   ++  +   +  + NTMI+A + +G
Sbjct  8     HAHLLVSGTISDPYAAGKLVAFCAVSDRGDLDYAGLVFRCLPCRSAFLWNTMIRAHVERG  67

Query  852   ELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGN  673
               +  + +Y  M   G  P+NYT  +LL+AC + +S + GR  H   +  G+    +V N
Sbjct  68    RPADALRLYYQMFAAGFLPNNYTFSFLLRACLDRDSLSDGRKFHAMIVGLGWESYDFVQN  127

Query  672   SLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRV  493
              LI MYS    ++SA+ +FD   +R V++WT +I+ Y++ G +  AR +FD  P ++   
Sbjct  128   GLIHMYSYCGCVDSARKLFDCSSNRDVISWTAMINGYAKLGKLDAARELFDRMPERNAVS  187

Query  492   WGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVE  313
             W +MI+ Y Q   FKE L++F  MQ+  VQ + A +V  LSAC  LG+LD GKW+H + E
Sbjct  188   WSAMITMYAQFGRFKEALEVFSEMQLARVQPNHAGIVGALSACGSLGALDQGKWIHVFAE  247

Query  312   KLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMR  133
             + GM ++  LGTAL+DMYAKCGC+  A ++F+ +PERDV  + AMISG + +   E AM 
Sbjct  248   RNGMELDKILGTALIDMYAKCGCVNNALEVFHSMPERDVYAYTAMISGLSNSRHIEEAMD  307

Query  132   LFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             LF  M+ + G RP+ VTF+ + +AC   G+   G ++ E +
Sbjct  308   LFSRMEEE-GVRPNEVTFICVLSACGRMGLVDRGREIFESM  347


 Score = 85.5 bits (210),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 120/272 (44%), Gaps = 33/272 (12%)
 Frame = -2

Query  954  NLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPY  775
             LG       +++R+ +      + MI  +   G     +E++  M    + P++  +  
Sbjct  166  KLGKLDAARELFDRMPERNAVSWSAMITMYAQFGRFKEALEVFSEMQLARVQPNHAGIVG  225

Query  774  LLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRC  595
             L ACG++ + + G+ IH    + G  +D  +G +LI MY        A+C         
Sbjct  226  ALSACGSLGALDQGKWIHVFAERNGMELDKILGTALIDMY--------AKC---------  268

Query  594  VVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQM  415
                          G V  A  VF   P +D   + +MISG   +   +E + LF  M+ 
Sbjct  269  --------------GCVNNALEVFHSMPERDVYAYTAMISGLSNSRHIEEAMDLFSRMEE  314

Query  414  TGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLG  238
             GV+ +E   + +LSAC  +G +D G+ +   +E +  +   V     LVD+  + G + 
Sbjct  315  EGVRPNEVTFICVLSACGRMGLVDRGREIFESMEGVYKIKPGVEHHGCLVDLLGRAGRVE  374

Query  237  LAQKLFYELP-ERDVICWNAMISGFAMNGDGE  145
             A+K+  E+P E D     A+++  +M+G+ E
Sbjct  375  EAKKVVREMPMEPDSYVLGALLNACSMHGEAE  406



>ref|XP_007014546.1| Pentatricopeptide repeat protein isoform 1 [Theobroma cacao]
 gb|EOY32165.1| Pentatricopeptide repeat protein isoform 1 [Theobroma cacao]
Length=537

 Score =   251 bits (640),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/345 (36%), Positives = 212/345 (61%), Gaps = 3/345 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q    +I      + +A  R+++FC+     + ++ ++++  +Q  T  I NT+I+AF+ 
Sbjct  32    QMQSHLIVSATLLDPYAAGRIISFCAVSADADLSHAYKLFLSLQHRTTFIWNTIIRAFVE  91

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
             +   +  + +YK+ML++G  P+NYT  ++L+AC    S  L    H   +K G+    +V
Sbjct  92    RNANATAISLYKNMLQSGFLPNNYTFSFVLRACTTYSSTALAS--HALVIKLGWESYDFV  149

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N LI +Y++L  M++A+ +F+   +R V+ WT L++ Y + G    AR +FD+ P ++ 
Sbjct  150   LNGLIHLYANLSLMDAARKLFNVSTNRDVITWTSLLNGYVQSGQAEFARELFDQMPERNA  209

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GYVQ   F+E + LF  MQ++G++ + A +V  L+ACA LG+LD G+W+H Y
Sbjct  210   VSWSAMITGYVQMGMFREAMGLFNDMQLSGLRPNHAGIVGALTACAFLGALDHGRWIHAY  269

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V++ GM ++  LGTALVDMYAKCGC+ +A  +F E+P +DV  + ++ISG A +     A
Sbjct  270   VDRNGMELDRVLGTALVDMYAKCGCIEMACSVFDEMPYKDVFAFTSLISGLANHDQSARA  329

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             + LF  MQ++ G  P+ VTF+ + +ACS  G+  EGL++   + +
Sbjct  330   IELFARMQSE-GVVPNEVTFICVLSACSRMGLVDEGLRIFNYMSK  373


 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 70/270 (26%), Positives = 120/270 (44%), Gaps = 33/270 (12%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            G   +   +++++ +      + MI  ++  G     M ++  M  +G+ P++  +   L
Sbjct  192  GQAEFARELFDQMPERNAVSWSAMITGYVQMGMFREAMGLFNDMQLSGLRPNHAGIVGAL  251

Query  768  KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
             AC  + + + GR IH    + G  +D  +G +L+ MY        A+C   EM      
Sbjct  252  TACAFLGALDHGRWIHAYVDRNGMELDRVLGTALVDMY--------AKCGCIEMACS---  300

Query  588  AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
                                VFDE P KD   + S+ISG   ++     ++LF  MQ  G
Sbjct  301  --------------------VFDEMPYKDVFAFTSLISGLANHDQSARAIELFARMQSEG  340

Query  408  VQADEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLGLA  232
            V  +E   + +LSAC+ +G +D G  +  Y+ K+ G+   V+    LVD+  + G    A
Sbjct  341  VVPNEVTFICVLSACSRMGLVDEGLRIFNYMSKVYGIEPGVQHYGCLVDLLGRAGLFEEA  400

Query  231  QKLFYELP-ERDVICWNAMISGFAMNGDGE  145
             KL  E+P E D     A+++   M+GD E
Sbjct  401  NKLVREMPMEPDSYVLGALLNSCRMHGDVE  430



>emb|CDP13645.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   250 bits (639),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/346 (37%), Positives = 202/346 (58%), Gaps = 7/346 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLL-AFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             Q H Q+I  GL ++     RL+ ++ S  +L   +Y   ++E I  P     N++I+   
Sbjct  44    QLHAQLIVSGLIHHPLNPGRLIESYVSTSHL---SYALSVFESISCPDTFAYNSLIRGLT  100

Query  861   LKGEL--SRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMD  688
             L      ++++ +Y+  L  G+ PDNYT  ++LK+C  M + + G+ +H Q +K G    
Sbjct  101   LGHHFLDNQSLRLYQEFLSNGLNPDNYTFTFVLKSCSRMRATSEGKQVHAQIIKAGMEPT  160

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
             ++V +SLI MYS+   MESA+ +   +    V+    +I+ +  +G    AR +FD+   
Sbjct  161   THVLSSLISMYSNCGHMESAERLLASVSDGSVLVMNAMITGHLNQGQFGIARELFDKMSK  220

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWV  328
             +D   W +MI+GY ++N   E L  F+ M    VQ +EA LVS LSACAHLG+LD G+W+
Sbjct  221   RDTATWSTMITGYSKSNMHAEALSTFQEMVANRVQLNEATLVSALSACAHLGALDQGRWI  280

Query  327   HRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDG  148
             H Y+EK G+ + VRL TA+VDMYAKCGC+ L+ ++F  +PE+DV+ W  +ISGFA +G+ 
Sbjct  281   HTYIEKNGVNVQVRLATAMVDMYAKCGCIDLSYEVFKNMPEKDVVAWGVIISGFAAHGEA  340

Query  147   ENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
                  LF +M  + G  P+ V FV++ +ACS +G    G     ++
Sbjct  341   RRCFELFNQMIEN-GISPNEVIFVAMLSACSHAGCVESGFHYFNEM  385


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/243 (23%), Positives = 99/243 (41%), Gaps = 38/243 (16%)
 Frame = -2

Query  732  RSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRK  553
            + +H Q +  G +            +  L+            P R       LI  Y   
Sbjct  43   KQLHAQLIVSGLI------------HHPLN------------PGR-------LIESYVST  71

Query  552  GDVFEARLVFDETPVKDRRVWGSMISGYVQNNCF--KEGLQLFRLMQMTGVQADEAILVS  379
              +  A  VF+     D   + S+I G    + F   + L+L++     G+  D      
Sbjct  72   SHLSYALSVFESISCPDTFAYNSLIRGLTLGHHFLDNQSLRLYQEFLSNGLNPDNYTFTF  131

Query  378  ILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERD  199
            +L +C+ + +   GK VH  + K GM     + ++L+ MY+ CG +  A++L   + +  
Sbjct  132  VLKSCSRMRATSEGKQVHAQIIKAGMEPTTHVLSSLISMYSNCGHMESAERLLASVSDGS  191

Query  198  VICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLL  19
            V+  NAMI+G    G    A  LF +M     ++ D  T+ ++ T  S S M  E L   
Sbjct  192  VLVMNAMITGHLNQGQFGIARELFDKM-----SKRDTATWSTMITGYSKSNMHAEALSTF  246

Query  18   EKI  10
            +++
Sbjct  247  QEM  249



>ref|XP_008234336.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Prunus mume]
Length=530

 Score =   250 bits (639),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 134/352 (38%), Positives = 206/352 (59%), Gaps = 17/352 (5%)
 Frame = -2

Query  1038  QAHGQVITCGL---GNNTFALSRLLAFC--SDPNLGNPTYGWRIYERIQQPTICIVNTMI  874
             + H Q+I        +  F ++RLL F   SD + G+  Y   ++  I+ P + + N MI
Sbjct  23    KIHTQIIKSPFLSTDDQAFLITRLLFFSAISDSDSGSHRYAAHVFRAIKDPNLYVYNVMI  82

Query  873   KAFLLKGELSR--------TMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHG  718
             +++      S         ++ +YK ML  G+ P+  T P+L+K C +      GRS H 
Sbjct  83    RSYACTKISSEDETLSSFGSLLLYKQMLCDGISPNCLTFPFLVKECTSRLDGGTGRSFHA  142

Query  717   QCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFE  538
             Q +K+G   D ++ NSLI MYS+   + SA+ +FDEM  R VV+W  +I  Y R G++ E
Sbjct  143   QVVKYGLDNDVFIQNSLIGMYSACGFLNSARTLFDEMLERDVVSWNSMIKGYLRSGNLDE  202

Query  537   ARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG---VQADEAILVSILSA  367
             A  +F +   ++   W SMI+G+VQ    KE L+LF  MQ+T    V+ D+  + S+L+A
Sbjct  203   ALNLFGKMNKRNIITWNSMITGFVQGGQPKEALELFHEMQITSDDMVKPDKITIASVLAA  262

Query  366   CAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICW  187
             CAHLG++D G WVH Y+ + G+  +V +GTALVDMY KCGC+  A ++F E+P +D + W
Sbjct  263   CAHLGAVDHGIWVHAYLRRSGLESDVVIGTALVDMYGKCGCVDKAYEVFREMPNKDTLAW  322

Query  186   NAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
              AMIS  A++G G  A  +F++M+   G +P+ VTFV L +AC+ SG+   G
Sbjct  323   TAMISVLALHGFGNEAFDIFKQMET-TGVKPNHVTFVGLLSACAHSGLLETG  373


 Score = 94.7 bits (234),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 82/336 (24%), Positives = 136/336 (40%), Gaps = 67/336 (20%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCS------------DPNLGNPTYGWR------------  925
             H QV+  GL N+ F  + L+   S            D  L      W             
Sbjct  141   HAQVVKYGLDNDVFIQNSLIGMYSACGFLNSARTLFDEMLERDVVSWNSMIKGYLRSGNL  200

Query  924   -----IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTG---MCPDNYTLPYLL  769
                  ++ ++ +  I   N+MI  F+  G+    +E++  M  T    + PD  T+  +L
Sbjct  201   DEALNLFGKMNKRNIITWNSMITGFVQGGQPKEALELFHEMQITSDDMVKPDKITIASVL  260

Query  768   KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
              AC ++ + + G  +H    + G   D  +G +L+ MY                  +C  
Sbjct  261   AACAHLGAVDHGIWVHAYLRRSGLESDVVIGTALVDMYG-----------------KC--  301

Query  588   AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
                         G V +A  VF E P KD   W +MIS    +    E   +F+ M+ TG
Sbjct  302   ------------GCVDKAYEVFREMPNKDTLAWTAMISVLALHGFGNEAFDIFKQMETTG  349

Query  408   VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRL--GTALVDMYAKCGCLGL  235
             V+ +    V +LSACAH G L+ G+W    + K    I  +L     +VD+ ++ G +  
Sbjct  350   VKPNHVTFVGLLSACAHSGLLETGRWCFDAM-KCVYLIEPQLYHYACMVDILSRAGLIEE  408

Query  234   AQKLFYELPER-DVICWNAMISGFAMNGDGENAMRL  130
             A++    +P + D   W A++ G  ++G  E   RL
Sbjct  409   AERFIRSMPMKPDAFVWCALLGGCQIHGKVELGERL  444


 Score = 73.6 bits (179),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 119/293 (41%), Gaps = 66/293 (23%)
 Frame = -2

Query  786  TLPYLLKACGNMESCNLGRSIHGQCLKFGFLM--DSYVGNSLIVMYSSLDDMES-----A  628
            TL +LL+   N+      + IH Q +K  FL   D     + ++ +S++ D +S     A
Sbjct  7    TLLHLLEEFKNIREL---KKIHTQIIKSPFLSTDDQAFLITRLLFFSAISDSDSGSHRYA  63

Query  627  QCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFK  448
              VF  +    +  + V+I  Y+      E     DET       +GS++          
Sbjct  64   AHVFRAIKDPNLYVYNVMIRSYACTKISSE-----DET----LSSFGSLL----------  104

Query  447  EGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALV  268
                L++ M   G+  +      ++  C        G+  H  V K G+  +V +  +L+
Sbjct  105  ----LYKQMLCDGISPNCLTFPFLVKECTSRLDGGTGRSFHAQVVKYGLDNDVFIQNSLI  160

Query  267  DMYAKCGCLGLAQKLFYELPERDV-------------------------------ICWNA  181
             MY+ CG L  A+ LF E+ ERDV                               I WN+
Sbjct  161  GMYSACGFLNSARTLFDEMLERDVVSWNSMIKGYLRSGNLDEALNLFGKMNKRNIITWNS  220

Query  180  MISGFAMNGDGENAMRLFREMQ--NDAGTRPDGVTFVSLFTACSCSGMAHEGL  28
            MI+GF   G  + A+ LF EMQ  +D   +PD +T  S+  AC+  G    G+
Sbjct  221  MITGFVQGGQPKEALELFHEMQITSDDMVKPDKITIASVLAACAHLGAVDHGI  273



>ref|XP_008465017.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 
isoform X1 [Cucumis melo]
Length=739

 Score =   255 bits (651),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 128/331 (39%), Positives = 197/331 (60%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +I  GL N  FALS+L+ F +    G+ +Y   ++  I+ P + I N+MI+   +
Sbjct  47    QIHAHIIKTGLHNTHFALSKLIEFSAVSRSGDISYAISLFSSIEDPNLFIWNSMIRGLSM  106

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    +  +  M+ +G+ P++YT P+LLK+C  + S   G+ IH   LK GF+ D ++
Sbjct  107   SLSPVLALVFFVRMIYSGVEPNSYTFPFLLKSCAKLASAREGKQIHAHVLKLGFVSDVFI  166

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   +M +AQ +FD+   R  +++T LI+ Y+  G +  AR +FDE PVKD 
Sbjct  167   HTSLINMYAQSGEMNNAQLIFDQSNFRDAISFTALIAGYALWGYMDRARQLFDEMPVKDV  226

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY Q    KE L LF  M+   V  +E+ +VS+LSACA   +LD+G  +  +
Sbjct  227   VSWNAMIAGYAQMGRSKEALLLFEDMRKENVPPNESTIVSVLSACAQSNALDLGNSMRSW  286

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E  G+  N++L  AL+DMY+KCG L  A++LF ++PERDVI WN MI G+      + A
Sbjct  287   IEDRGLRSNLKLVNALIDMYSKCGDLPTARELFDDMPERDVISWNVMIGGYTHMCSYKEA  346

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + LFREM   +G  P  +TF+S+  +C+  G
Sbjct  347   LALFREMLA-SGVEPTEITFLSILPSCAHLG  376


 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/306 (31%), Positives = 156/306 (51%), Gaps = 32/306 (10%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ +    +   N MI  +   G     + +++ M K  + P+  T+  +L AC    
Sbjct  216  QLFDEMPVKDVVSWNAMIAGYAQMGRSKEALLLFEDMRKENVPPNESTIVSVLSACAQSN  275

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            + +LG S+       G   +  + N+LI MYS                 +C         
Sbjct  276  ALDLGNSMRSWIEDRGLRSNLKLVNALIDMYS-----------------KC---------  309

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 GD+  AR +FD+ P +D   W  MI GY     +KE L LFR M  +GV+  E  
Sbjct  310  -----GDLPTARELFDDMPERDVISWNVMIGGYTHMCSYKEALALFREMLASGVEPTEIT  364

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP  208
             +SIL +CAHLG++D+GKW+H Y+ K   +++  L T+L+D+YAKCG +  A+++F  + 
Sbjct  365  FLSILPSCAHLGAIDLGKWIHAYINKNFNSVSTSLSTSLIDLYAKCGNIVAARQVFDGMN  424

Query  207  ERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGL  28
             + +  WNAMI G AM+G  + A  LF +M +D G  P+ +TFV + +AC  +G+   G 
Sbjct  425  IKSLASWNAMICGLAMHGQADEAFELFSKMSSD-GIEPNEITFVGVLSACKHAGLVDLGH  483

Query  27   KLLEKI  10
            ++   +
Sbjct  484  QIFSSM  489


 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/282 (21%), Positives = 115/282 (41%), Gaps = 37/282 (13%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
             +++ + +  +   N MI  +         + +++ ML +G+ P   T   +L +C ++ 
Sbjct  317  ELFDDMPERDVISWNVMIGGYTHMCSYKEALALFREMLASGVEPTEITFLSILPSCAHLG  376

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            + +LG+ IH           +Y+  +                      S      T LI 
Sbjct  377  AIDLGKWIH-----------AYINKNF--------------------NSVSTSLSTSLID  405

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
             Y++ G++  AR VFD   +K    W +MI G   +    E  +LF  M   G++ +E  
Sbjct  406  LYAKCGNIVAARQVFDGMNIKSLASWNAMICGLAMHGQADEAFELFSKMSSDGIEPNEIT  465

Query  387  LVSILSACAHLGSLDIGKWV-HRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
             V +LSAC H G +D+G  +    V+   ++   +    ++D+  + G    A+ L   +
Sbjct  466  FVGVLSACKHAGLVDLGHQIFSSMVQDYKISPKSQHYGCMIDLLGRAGLFEEAESLIQNM  525

Query  210  PER-DVICWNAMISGFAMNGDGE----NAMRLFREMQNDAGT  100
              + D   W +++     +G  E     A RLF    ++ G 
Sbjct  526  EVKPDGAIWGSLLGACRDHGRVELGELVAERLFELEPDNPGA  567



>gb|KDP31652.1| hypothetical protein JCGZ_14968 [Jatropha curcas]
Length=592

 Score =   251 bits (642),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/345 (36%), Positives = 203/345 (59%), Gaps = 1/345 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +   GL   T  +S+L+AF S  N GN +Y   +++RI +P   + N MI+ +  
Sbjct  6     QIHAHMFKTGLVLETITVSKLVAFVSSSNSGNISYARTVFDRISRPNTFMWNAMIRGYAN  65

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               +    + +Y  ML   +  + YT P+LLKAC  + +    + IH   +K GF  D Y 
Sbjct  66    SNKSEHALILYYQMLCHSIPHNVYTFPFLLKACSRLSALEEIQQIHAYIIKLGFGSDIYS  125

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSL+  Y++   ++SAQ +FD +    VV+W  +I  Y +  D   A  +F + P ++ 
Sbjct  126   TNSLLHAYAASGSIKSAQVLFDRISQPDVVSWNSMIHGYMKCNDTETAYELFQDMPTRNA  185

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               + +MISGYVQ    +E L++F+ MQ  G++ D   L S+LSACAHLG+LD G+W+H Y
Sbjct  186   ISYTAMISGYVQAGLHQEALKVFQEMQSAGIKPDRVELASVLSACAHLGALDQGRWIHAY  245

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             ++K  + I+  LG+ L+DMYAKCG +  A  +F ++  ++V  W A+I GFA++G G++A
Sbjct  246   IKKNEIQIDQILGSVLIDMYAKCGGMEEALGVFKKIGNKNVYVWTAIIYGFAIHGHGQDA  305

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             +  F++M   AG +P+ +TF ++ TACS +G+  +G  L + + +
Sbjct  306   LYWFKQMLK-AGIKPNLITFTAILTACSYAGLVEDGKSLFQSMEK  349


 Score = 85.9 bits (211),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 76/351 (22%), Positives = 150/351 (43%), Gaps = 71/351 (20%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLL-AFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             Q H  +I  G G++ ++ + LL A+ +    G+      +++RI QP +   N+MI  ++
Sbjct  109   QIHAYIIKLGFGSDIYSTNSLLHAYAAS---GSIKSAQVLFDRISQPDVVSWNSMIHGYM  165

Query  861   ----------------LKGELSRT---------------MEMYKHMLKTGMCPDNYTLPY  775
                              +  +S T               +++++ M   G+ PD   L  
Sbjct  166   KCNDTETAYELFQDMPTRNAISYTAMISGYVQAGLHQEALKVFQEMQSAGIKPDRVELAS  225

Query  774   LLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRC  595
             +L AC ++ + + GR IH    K    +D  +G+ LI MY+    ME             
Sbjct  226   VLSACAHLGALDQGRWIHAYIKKNEIQIDQILGSVLIDMYAKCGGME-------------  272

Query  594   VVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQM  415
                               EA  VF +   K+  VW ++I G+  +   ++ L  F+ M  
Sbjct  273   ------------------EALGVFKKIGNKNVYVWTAIIYGFAIHGHGQDALYWFKQMLK  314

Query  414   TGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKL-GMAINVRLGTALVDMYAKCGCLG  238
              G++ +     +IL+AC++ G ++ GK + + +EK+  +   +     +VD+  + G L 
Sbjct  315   AGIKPNLITFTAILTACSYAGLVEDGKSLFQSMEKVYSLKPTIEHYGCMVDLLGRAGLLK  374

Query  237   LAQKLFYELPER-DVICWNAMISGFAMNGD---GENAMRLFREMQNDAGTR  97
              A+ L   +P + + + W A+++   ++G+   G+   ++  E   D G R
Sbjct  375   EAKDLIERMPVKPNPVIWGALLNACHIHGNIELGKQIGKILIEEDPDHGGR  425



>ref|XP_008777202.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800 
[Phoenix dactylifera]
Length=513

 Score =   249 bits (637),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 190/316 (60%), Gaps = 1/316 (0%)
 Frame = -2

Query  957  PNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLP  778
            P   +  Y   ++  I  P+    N +I+   L     + + ++  M +  + PD+++ P
Sbjct  56   PPTHSIDYALSLFHHIPSPSTFSYNLLIRVHTLLSFPFQALLLFARMRRLSIPPDSHSFP  115

Query  777  YLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSR  598
            + LKAC  + S  LGR++H Q  K GF  D +V N+LI +Y+S   M  A+ +FD++ S 
Sbjct  116  FALKACARLRSLPLGRTLHSQAFKSGFAADLFVRNTLISVYASSHSMLDARRLFDQISSP  175

Query  597  CVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQ  418
             VVA+  LI  Y + GD+  AR +FDE P +D   WG++++GY +   FK+ LQLF  M 
Sbjct  176  EVVAYNTLIDGYVKAGDMTLARKLFDEMPARDAVSWGTLLAGYSRMRQFKDALQLFDRML  235

Query  417  MTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLG  238
              G + D+  LVS+LS CA LG+LD G+ +HRY+++   A+NV L T+LVDMYAKCG + 
Sbjct  236  AAGSRPDDVALVSVLSCCAQLGALDRGEVIHRYIKENRAALNVYLLTSLVDMYAKCGRID  295

Query  237  LAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTAC  58
            +A ++F   P +++  WNA++ G AM+G GE ++R F  M    G RPDGVTF+ +  AC
Sbjct  296  VATEMFESTPHKNLFTWNAIVVGLAMHGHGERSLRYFERMIG-VGVRPDGVTFLGVLVAC  354

Query  57   SCSGMAHEGLKLLEKI  10
            S +G+     +L +++
Sbjct  355  SHAGLTDAARRLFDEM  370



>ref|XP_006383156.1| hypothetical protein POPTR_0005s12100g [Populus trichocarpa]
 gb|ERP60953.1| hypothetical protein POPTR_0005s12100g [Populus trichocarpa]
Length=654

 Score =   253 bits (646),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 132/344 (38%), Positives = 201/344 (58%), Gaps = 4/344 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H +++  GL  + + L++L+   +  N+    Y   I+ ++  P   + N +I+ +L+
Sbjct  64    QVHARILLNGLDQSCYVLAKLIRTLTKLNIPVDPYPLSIFNQVNYPNPFLYNALIRGYLI  123

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFG-FLMDSY  682
             +  L  + E Y  M K G+ P ++T   L KACG      LGR IHGQ +  G F  D +
Sbjct  124   EERLKESTEFYSLMRKEGVVPVSFTFTALFKACGAKMDVGLGRQIHGQTILVGGFGEDLH  183

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             VGNS+I MY     +E  + VFDEMP+R V++WT LIS Y + G++  A  +FD  PVKD
Sbjct  184   VGNSMIDMYIKCGFLECGRKVFDEMPNRDVISWTELISAYVKSGNMESAGELFDGLPVKD  243

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W  M+SG+ QN   +E +  F  MQ  GV+ DE  L+ ++SACA LG+     W+  
Sbjct  244   MVAWTVMVSGFAQNAKPREAIMFFEKMQEFGVETDEITLIGVISACAQLGAAKYADWIRD  303

Query  321   YVEK--LGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDG  148
               EK   G   +V +G+AL+DMY+KCG +G A ++F  + ER+V  +++MI GFAM+G  
Sbjct  304   VAEKSEFGGKHSVVVGSALIDMYSKCGSVGDAYRVFQGMKERNVYSYSSMILGFAMHGRV  363

Query  147   ENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLE  16
              +AM+LF EM      +P+ VTF+ + TACS +GM  +G ++ E
Sbjct  364   HDAMKLFDEMVKTE-IKPNRVTFIGVLTACSHAGMVEQGWQIFE  406


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 70/142 (49%), Gaps = 2/142 (1%)
 Frame = -2

Query  594  VVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQM  415
            VV  + LI  YS+ G V +A  VF     ++   + SMI G+  +    + ++LF  M  
Sbjct  316  VVVGSALIDMYSKCGSVGDAYRVFQGMKERNVYSYSSMILGFAMHGRVHDAMKLFDEMVK  375

Query  414  TGVQADEAILVSILSACAHLGSLDIGKWVHRYVEK-LGMAINVRLGTALVDMYAKCGCLG  238
            T ++ +    + +L+AC+H G ++ G  +   +EK  G+  +    T +VD+  + G L 
Sbjct  376  TEIKPNRVTFIGVLTACSHAGMVEQGWQIFELMEKCYGIKPSADHYTCMVDLLGRAGRLQ  435

Query  237  LAQKLFYELP-ERDVICWNAMI  175
             A +L   +P E     W A++
Sbjct  436  EAHELVKTMPIEPHGGVWGALL  457



>ref|XP_010313693.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 
[Solanum lycopersicum]
Length=731

 Score =   254 bits (650),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 128/331 (39%), Positives = 192/331 (58%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
               H   I  GL N  FALS+LL FC     G  +Y   I+     P   + N +I+ + L
Sbjct  43    NVHTHFIKFGLHNTQFALSKLLEFCVTNPYGELSYALSIFNSTDDPNHVMYNMIIRGYSL  102

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 S  ++ Y+ +L +G  P++YT P+L K+C  +    +G++IHG   K G + D YV
Sbjct  103   SSSPSFAIDFYEKLLFSGNKPNSYTFPFLFKSCAKIMDTQMGKTIHGHVFKLGLMTDVYV  162

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   +M+ A+ VFD+  +R  V++T LI+ Y+ KG V +AR +FDE PV+D 
Sbjct  163   HASLINMYAQNGEMDDARLVFDKSSNRDAVSFTALINGYALKGRVGDARGLFDEMPVRDV  222

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MISGY Q   F+E L LF  M+   V    + L+S+LSACA +G L +G WV  +
Sbjct  223   VSWNAMISGYAQVGRFEEALVLFEEMRNVNVVPSVSTLLSVLSACARVGELKLGNWVRSW  282

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E   + +N+RL  AL+DMY+KCG +  A+ LF  L E+D++ WN MI G+   G  ++A
Sbjct  283   IEDHRLGLNIRLVNALIDMYSKCGDVKTARMLFEGLEEKDLVSWNVMIGGYTHCGYYKDA  342

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + +F  MQ +    P+ VT +S+  AC+  G
Sbjct  343   LAVFHRMQQEV-IDPNDVTLLSILPACAHLG  372


 Score = 77.0 bits (188),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 73/308 (24%), Positives = 127/308 (41%), Gaps = 70/308 (23%)
 Frame = -2

Query  924  IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMES  745
            ++E +++  +   N MI  +   G     + ++  M +  + P++ TL  +L AC ++ +
Sbjct  314  LFEGLEEKDLVSWNVMIGGYTHCGYYKDALAVFHRMQQEVIDPNDVTLLSILPACAHLGA  373

Query  744  CNLGRSIHGQCLK-FGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
             +LG+ IH    K +  L ++ +  SLI MY+    + +A+ VF  M ++ + ++ V+IS
Sbjct  374  LDLGKWIHVYIDKHYQHLQNTSLWTSLINMYAKCGAIAAAKQVFQGMRTKTLASYNVMIS  433

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
              +  GD +EA                               L+LFR M   G++ D+  
Sbjct  434  GLAMHGDAYEA-------------------------------LELFRKMTEEGMKPDDIT  462

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP  208
             VS+LSAC H G +D+G+      E     I     T  +  Y   GC            
Sbjct  463  FVSVLSACNHAGLVDLGR------EYFITMIQSYKYTPKLQHY---GC------------  501

Query  207  ERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGL  28
                     MI      G  + AM +   M+     +PDG  + SL  +C      H+ L
Sbjct  502  ---------MIDLLGRAGKFDEAMNMIESME----IKPDGAIWGSLLGSCRI----HKNL  544

Query  27   KLLEKIGR  4
            +L E   +
Sbjct  545  ELGEYAAK  552



>emb|CBI38215.3| unnamed protein product [Vitis vinifera]
Length=595

 Score =   251 bits (642),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 139/360 (39%), Positives = 195/360 (54%), Gaps = 36/360 (10%)
 Frame = -2

Query  984  SRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELS-RTMEMYKHMLKT  808
            +RL A C+     +P Y   +  +++ P + + N +I+        S   + +YK ML  
Sbjct  75   TRLSALCAQSLPIDPRYALSLLAQLRTPNLPLYNAIIRGLATSNNDSIEGLVVYKQMLSK  134

Query  807  GMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESA  628
            G+ PDNYT+P++LKAC    +   G  +HGQ +K G   D YV N+L+ MY+  D + SA
Sbjct  135  GIVPDNYTIPFVLKACAESRAVREGEEVHGQAIKMGLASDVYVSNTLMRMYAVCDVIRSA  194

Query  627  QCVFDEMPSRCVVAWTVLISRYSRKG------------------DVFE------------  538
            + VFD  P R +V+WT +I  Y + G                  DVF             
Sbjct  195  RKVFDTSPQRDLVSWTTMIQGYVKMGFAREGVGLYIIRNSNVNLDVFVGNALVDMYLKCG  254

Query  537  ----ARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILS  370
                AR VF E PVK+   W SMISG  Q   FKE L +FR MQ  GV+ D+  LV++L+
Sbjct  255  DANFARKVFQEMPVKNVVSWNSMISGLAQKGQFKESLYMFRKMQRLGVKPDDVTLVAVLN  314

Query  369  ACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVIC  190
            +CA+LG L++GKWVH Y+++  +  +  +G ALVDMYAKCG +  A  +F  +  +DV  
Sbjct  315  SCANLGVLELGKWVHAYLDRNQIRADGFIGNALVDMYAKCGSIDQACWVFQAMNRKDVYS  374

Query  189  WNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
            + AMI G AM+G G  A+ LF EM    G  PD VTFV + TACS  G+  EG K  E +
Sbjct  375  YTAMIVGLAMHGQGGKALDLFSEMPK-MGIEPDEVTFVGVLTACSHVGLVEEGRKYFEDM  433



>ref|XP_008389535.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g40405 [Malus domestica]
Length=615

 Score =   252 bits (643),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 130/338 (38%), Positives = 198/338 (59%), Gaps = 3/338 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q++  GL N+       +A  +  N  N  Y  ++  + Q PT+   N+MI+A+  
Sbjct  27    QIHSQLLVNGLLNDRHLSGHFVAAIALRNPINLDYSNQVLHQCQNPTLFAFNSMIRAYSK  86

Query  858   KGELSRTMEMYKHMLKT--GMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDS  685
                 S++   Y  +L++   + PDNYT  +L++ C  + +   G ++HG  +K GF  D 
Sbjct  87    SSTPSKSFHFYSRILRSSDNLSPDNYTFNFLVRTCAQLLARETGPTVHGGLIKHGFENDP  146

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
             +V + LI MY+ L  ++    VF E+    +V  T ++S  +R GDV  AR +FDE P +
Sbjct  147   HVQSGLIFMYAELGSLDPCHRVFREIVEPDLVCQTAMVSACARCGDVGFARDLFDEMPQR  206

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             D   W +MI+GY Q    +E L LF LMQM GV+ +E  +VS+LSAC+HLG+LD G+W H
Sbjct  207   DPVAWNAMIAGYAQCGKSREALNLFHLMQMEGVRVNEVSMVSVLSACSHLGALDQGRWAH  266

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
              Y+EK  + + V LGTAL+DMYAKCG +  A ++F+ + E++V  W++ + G AMNG GE
Sbjct  267   AYIEKNKVRMTVTLGTALIDMYAKCGNMNKAMEVFWGMKEKNVYTWSSALGGLAMNGFGE  326

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
               + LF  M N  G  P+ VTFVS+   C+  G+  +G
Sbjct  327   KCLELFSLM-NKEGVHPNEVTFVSVLRGCTVVGLVEKG  363



>ref|XP_008465018.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 
isoform X2 [Cucumis melo]
Length=734

 Score =   254 bits (649),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 128/331 (39%), Positives = 197/331 (60%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +I  GL N  FALS+L+ F +    G+ +Y   ++  I+ P + I N+MI+   +
Sbjct  47    QIHAHIIKTGLHNTHFALSKLIEFSAVSRSGDISYAISLFSSIEDPNLFIWNSMIRGLSM  106

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    +  +  M+ +G+ P++YT P+LLK+C  + S   G+ IH   LK GF+ D ++
Sbjct  107   SLSPVLALVFFVRMIYSGVEPNSYTFPFLLKSCAKLASAREGKQIHAHVLKLGFVSDVFI  166

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   +M +AQ +FD+   R  +++T LI+ Y+  G +  AR +FDE PVKD 
Sbjct  167   HTSLINMYAQSGEMNNAQLIFDQSNFRDAISFTALIAGYALWGYMDRARQLFDEMPVKDV  226

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY Q    KE L LF  M+   V  +E+ +VS+LSACA   +LD+G  +  +
Sbjct  227   VSWNAMIAGYAQMGRSKEALLLFEDMRKENVPPNESTIVSVLSACAQSNALDLGNSMRSW  286

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E  G+  N++L  AL+DMY+KCG L  A++LF ++PERDVI WN MI G+      + A
Sbjct  287   IEDRGLRSNLKLVNALIDMYSKCGDLPTARELFDDMPERDVISWNVMIGGYTHMCSYKEA  346

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + LFREM   +G  P  +TF+S+  +C+  G
Sbjct  347   LALFREMLA-SGVEPTEITFLSILPSCAHLG  376


 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/306 (31%), Positives = 156/306 (51%), Gaps = 32/306 (10%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ +    +   N MI  +   G     + +++ M K  + P+  T+  +L AC    
Sbjct  216  QLFDEMPVKDVVSWNAMIAGYAQMGRSKEALLLFEDMRKENVPPNESTIVSVLSACAQSN  275

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            + +LG S+       G   +  + N+LI MYS                 +C         
Sbjct  276  ALDLGNSMRSWIEDRGLRSNLKLVNALIDMYS-----------------KC---------  309

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 GD+  AR +FD+ P +D   W  MI GY     +KE L LFR M  +GV+  E  
Sbjct  310  -----GDLPTARELFDDMPERDVISWNVMIGGYTHMCSYKEALALFREMLASGVEPTEIT  364

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP  208
             +SIL +CAHLG++D+GKW+H Y+ K   +++  L T+L+D+YAKCG +  A+++F  + 
Sbjct  365  FLSILPSCAHLGAIDLGKWIHAYINKNFNSVSTSLSTSLIDLYAKCGNIVAARQVFDGMN  424

Query  207  ERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGL  28
             + +  WNAMI G AM+G  + A  LF +M +D G  P+ +TFV + +AC  +G+   G 
Sbjct  425  IKSLASWNAMICGLAMHGQADEAFELFSKMSSD-GIEPNEITFVGVLSACKHAGLVDLGH  483

Query  27   KLLEKI  10
            ++   +
Sbjct  484  QIFSSM  489


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/282 (21%), Positives = 115/282 (41%), Gaps = 37/282 (13%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
             +++ + +  +   N MI  +         + +++ ML +G+ P   T   +L +C ++ 
Sbjct  317  ELFDDMPERDVISWNVMIGGYTHMCSYKEALALFREMLASGVEPTEITFLSILPSCAHLG  376

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            + +LG+ IH           +Y+  +                      S      T LI 
Sbjct  377  AIDLGKWIH-----------AYINKNF--------------------NSVSTSLSTSLID  405

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
             Y++ G++  AR VFD   +K    W +MI G   +    E  +LF  M   G++ +E  
Sbjct  406  LYAKCGNIVAARQVFDGMNIKSLASWNAMICGLAMHGQADEAFELFSKMSSDGIEPNEIT  465

Query  387  LVSILSACAHLGSLDIGKWV-HRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
             V +LSAC H G +D+G  +    V+   ++   +    ++D+  + G    A+ L   +
Sbjct  466  FVGVLSACKHAGLVDLGHQIFSSMVQDYKISPKSQHYGCMIDLLGRAGLFEEAESLIQNM  525

Query  210  PER-DVICWNAMISGFAMNGDGE----NAMRLFREMQNDAGT  100
              + D   W +++     +G  E     A RLF    ++ G 
Sbjct  526  EVKPDGAIWGSLLGACRDHGRVELGELVAERLFELEPDNPGA  567



>ref|XP_010928067.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Elaeis guineensis]
Length=635

 Score =   252 bits (644),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/346 (35%), Positives = 208/346 (60%), Gaps = 2/346 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERI-QQPTICIVNTMIKAFL  862
             Q H  +I  G   +T  LS + A C+  +    +Y  +I+ R   QP   + N+ + +  
Sbjct  48    QLHSHLIKSGRPLSTLPLSSVAAVCALSSPSAFSYARQIFHRAAHQPETVLWNSRLNSLA  107

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                  +  + ++  + ++ +  D +TL ++LKAC  + + +LGR++HG   K GF  D +
Sbjct  108   SSASPADALALFARLRRSDIALDTFTLSFVLKACSKLSALSLGRAVHGLVEKLGFHSDLF  167

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             + N+++ MY+S  +M+ A+ +FD+MP R VV W ++I++Y++ G++  AR +FD  P + 
Sbjct  168   LLNTVLHMYASCGEMDIARLLFDKMPIRDVVTWNIMITQYTKVGEMDIARELFDSMPERS  227

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
              R W ++I+GYVQ    ++ + LF  M+  G++ +E  +V++L+ACA LG+LD+G+ VH 
Sbjct  228   IRSWTALIAGYVQCRNPRQAIHLFHEMEAAGMRPNEVTVVAVLAACADLGALDLGRRVHE  287

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y ++ G   N+++   L+DMY KCGCL +A+++F  +  R V+ W+AMI G AM+G GE 
Sbjct  288   YSDQCGFQKNIQVCNTLIDMYIKCGCLAIARRVFDGMEVRSVVSWSAMIGGHAMHGQGEE  347

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             A+ LF  M   AG +P+ VTFV L  ACS  G+  EG +    + R
Sbjct  348   ALELFSRMTR-AGFQPNAVTFVGLLHACSHMGLLEEGRQFFASMSR  392



>ref|XP_006421782.1| hypothetical protein CICLE_v10004643mg [Citrus clementina]
 ref|XP_006490271.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Citrus sinensis]
 gb|ESR35022.1| hypothetical protein CICLE_v10004643mg [Citrus clementina]
 gb|KDO65335.1| hypothetical protein CISIN_1g038890mg [Citrus sinensis]
Length=569

 Score =   251 bits (640),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 138/349 (40%), Positives = 212/349 (61%), Gaps = 14/349 (4%)
 Frame = -2

Query  1038  QAHGQVIT--CGLGNNTFAL-SRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKA  868
             + H Q+I   C   N+  +L +RLL FC+    G+ +Y   ++  I++  +   N MI+A
Sbjct  46    EIHTQIIKSPCLQTNDHHSLITRLLFFCALSVSGSLSYATNVFSHIKRSDLYTYNIMIRA  105

Query  867   FLLKGELS------RTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLK  706
                K   +      + +++YK ML TG+ PD  T P+LLK C       +G S++GQ +K
Sbjct  106   NACKSSETNDTHSGKCLKLYKQMLCTGISPDCLTFPFLLKECTKRLDGLVGASVYGQVVK  165

Query  705   FGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLV  526
             FG   D +V NS+I ++ +   + SA+ +FDEM +R VV+W  +I  Y R GD+  A  +
Sbjct  166   FGVCDDVFVQNSVISLFMACGFVTSARMLFDEMSNRDVVSWNAMIIGYLRSGDLDVALDL  225

Query  525   FDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQ----ADEAILVSILSACAH  358
             F     ++   W S+I+G+VQ    +E L+LF+ MQ + V+     D+  + S+LSACA+
Sbjct  226   FRRMKKRNIFSWNSIITGFVQGGRAREALELFQEMQSSSVEEMVKPDKITIASVLSACAY  285

Query  357   LGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAM  178
             LG++D GKWVH Y+ + G+  +V +GTALVDMY KCGC+  A  +F E+P++D + W AM
Sbjct  286   LGAIDHGKWVHGYLRRSGLDCDVVIGTALVDMYGKCGCVERAYGVFKEMPKKDTLAWTAM  345

Query  177   ISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
             IS FA+NG G+ A   FREM+ + G RP+ VTFV L +AC+ SG+  +G
Sbjct  346   ISVFALNGYGKEAFDTFREMEAE-GVRPNHVTFVGLLSACAHSGLVEKG  393


 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 124/278 (45%), Gaps = 45/278 (16%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGM----CPDNYTL  781
            G+      ++ R+++  I   N++I  F+  G     +E+++ M  + +     PD  T+
Sbjct  217  GDLDVALDLFRRMKKRNIFSWNSIITGFVQGGRAREALELFQEMQSSSVEEMVKPDKITI  276

Query  780  PYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPS  601
              +L AC  + + + G+ +HG   + G   D  +G +L+ MY                  
Sbjct  277  ASVLSACAYLGAIDHGKWVHGYLRRSGLDCDVVIGTALVDMYG-----------------  319

Query  600  RCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLM  421
            +C              G V  A  VF E P KD   W +MIS +  N   KE    FR M
Sbjct  320  KC--------------GCVERAYGVFKEMPKKDTLAWTAMISVFALNGYGKEAFDTFREM  365

Query  420  QMTGVQADEAILVSILSACAHLGSLDIGKWV-----HRYVEKLGMAINVRLGTALVDMYA  256
            +  GV+ +    V +LSACAH G ++ G+W      H Y+    +  +V     ++D+ +
Sbjct  366  EAEGVRPNHVTFVGLLSACAHSGLVEKGRWCFVMMRHVYL----VEPHVYHYACMIDILS  421

Query  255  KCGCLGLAQKLFYELP-ERDVICWNAMISGFAMNGDGE  145
            + G    A++L   +P E DV  W A++ G  M+G+ E
Sbjct  422  RAGLFSEAERLIRSMPMEPDVFVWGALLGGCQMHGNVE  459



>ref|XP_009630094.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
isoform X2 [Nicotiana tomentosiformis]
Length=737

 Score =   254 bits (649),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/332 (39%), Positives = 195/332 (59%), Gaps = 3/332 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             + H Q I  GL N+ FALS+L+ FC+ +PN  + +Y   I+   + P   + N +I+ + 
Sbjct  49    KVHSQFIKFGLHNSQFALSKLVEFCAVNPN-DDLSYALSIFNTTENPNHVMFNMIIRGYS  107

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
             L    +  +E Y+ +L +G  P++YT P++ K+C  +    +G+ IHG   K G + D Y
Sbjct  108   LSEYPNLAIEFYEKLLFSGNLPNSYTFPFVFKSCAKIMDTQMGKMIHGHVFKLGLMNDVY  167

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             V  SLI MY+   +++  + VFD+   R  V++T LI+ Y+ KG V +AR +FDE PV+D
Sbjct  168   VHASLINMYAQNGELDDVRLVFDKSSKRDAVSFTALINGYALKGRVDDARKLFDEMPVRD  227

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MISGY Q   F+E L LF  M+   V    + L+S+LSACA  G L +G  V  
Sbjct  228   VVSWNAMISGYTQMGRFEEALMLFEEMRNVNVTPSVSTLLSVLSACARAGELKLGSRVRS  287

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             ++E  G+ +N+RL  AL+DMYAKCG L  A+ LF  L E+D++ WN MI G+   G+   
Sbjct  288   WIEDHGLGLNIRLVNALIDMYAKCGNLDSARDLFEGLEEKDLVSWNVMIGGYTHTGNYRE  347

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             A+ +F  MQ  A   P+ VT +S+  AC+  G
Sbjct  348   ALAVFHRMQQ-ANMAPNDVTLLSILPACAHLG  378


 Score = 85.9 bits (211),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 75/316 (24%), Positives = 131/316 (41%), Gaps = 70/316 (22%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            GN      ++E +++  +   N MI  +   G     + ++  M +  M P++ TL  +L
Sbjct  312  GNLDSARDLFEGLEEKDLVSWNVMIGGYTHTGNYREALAVFHRMQQANMAPNDVTLLSIL  371

Query  768  KACGNMESCNLGRSIHGQCLK-FGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCV  592
             AC ++ + +LG+ IH    K +  L ++ +  +LI MY+    + +A+ VF  M ++ +
Sbjct  372  PACAHLGALDLGKWIHAYINKHYQHLQNTSLWTTLINMYAKCGAITAAKQVFQGMKTKTL  431

Query  591  VAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMT  412
             ++ V+IS  +  GD +EA                               L+LFR M   
Sbjct  432  ASYNVMISGLAMHGDAYEA-------------------------------LELFRKMTEE  460

Query  411  GVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLA  232
            G++ D+   VS+L+AC+H G +D+G+    Y   +  + N    T  +  Y   GC    
Sbjct  461  GMKPDDITFVSVLTACSHAGLVDLGQ---EYFNTMIQSYNY---TPKLQHY---GC----  507

Query  231  QKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSC  52
                             MI      G  + AM +   M      +PDG  + SL  AC  
Sbjct  508  -----------------MIDLLGRAGKFDEAMAMIESMD----MKPDGAIWGSLLGACRI  546

Query  51   SGMAHEGLKLLEKIGR  4
                H+ L+L E   +
Sbjct  547  ----HKNLELGEYAAK  558



>ref|XP_010675197.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like 
[Beta vulgaris subsp. vulgaris]
Length=538

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/343 (36%), Positives = 211/343 (62%), Gaps = 2/343 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q    +I  G  ++ +A  +L++  ++ +  + ++ +++       +  + N++IK F+ 
Sbjct  32    QIQSHLIISGTISDAYAAGKLVSAFAN-HRSHLSHAYKLLIHSPNRSNYMWNSLIKLFID  90

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               E  + + +YK+M  +G  P+NYT  ++L+A   +    LG  +H QC+K G+    ++
Sbjct  91    NNEPIKAISLYKNMFASGSYPNNYTFSFILRASNCLCDLPLGLMLHSQCIKLGWESYDFI  150

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              N LI  Y+  D +E  + +FD   ++ VV WT +I+ Y + G V +AR +FD  P ++ 
Sbjct  151   QNGLIHFYAMCDAIEMCRKLFDVSATKDVVTWTAVINGYVKVGRVEDARELFDRMPERNV  210

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY Q   FKE L+LF  MQM+G + + + +V  LSACA LG+LD G+W+H Y
Sbjct  211   VSWSAMITGYAQMGFFKEALELFNDMQMSGFRPNHSSVVGALSACASLGALDQGRWIHVY  270

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             V++  M ++V+LGTALVDMYAKCGC+ +A ++F ++P +DV  + ++IS F+ +G  E A
Sbjct  271   VDRNNMELDVKLGTALVDMYAKCGCIEMANRVFEDMPSKDVFAFTSLISAFSNHGQSERA  330

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             + LF+ MQ     +P+GVTF+ + +ACS  G+  EGL++ + +
Sbjct  331   IELFKRMQR-GEVKPNGVTFICVLSACSRMGLIEEGLEIFDTM  372



>ref|XP_011093233.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Sesamum indicum]
 ref|XP_011093234.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Sesamum indicum]
Length=652

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/349 (37%), Positives = 205/349 (59%), Gaps = 4/349 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H   I   L  +++ +++LL   S  N+   +YG RI+ ++  P + +   +I+ + +
Sbjct  62    QTHAYTIRKCLHESSYIMAKLLRMLSKINICMESYGARIFSQVMYPNVFLYTALIRGYWV  121

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFG-FLMDSY  682
              G    ++ +Y  M K G+ P  +T   LLK      + N GR +HG+ +K G F  D +
Sbjct  122   DGLFGESVLVYNSMRKDGITPVTFTFTALLKVAATEMNVNFGRQLHGESIKLGGFSEDLF  181

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             VGN LI MY     ++  + VF+EMP + +++WT LI  Y++ GD+  A  +FDE PVKD
Sbjct  182   VGNVLIDMYLKCGWLDCGRRVFNEMPGQDLISWTSLIDAYAKGGDMDSASELFDELPVKD  241

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +M++G+VQN   +E L+ F  MQ  GVQ DE  LV I++ACA LG+L    WV  
Sbjct  242   MVAWTAMVTGFVQNAKPREALEYFERMQSVGVQTDEVTLVGIVNACAQLGALKYANWVRD  301

Query  321   YVEKLGM--AINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDG  148
               E LG   A +V +G+A +DMY+KCGC+  A K+F  + +++V  +++MI G A++G  
Sbjct  302   VAESLGFGPANDVHVGSAFIDMYSKCGCVDDAYKVFKSMHKKNVYSYSSMIIGLAIHGRA  361

Query  147   ENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGRA  1
              +A+ LF EM      +P+ VTF+ + TACS +G+A +G +L E + ++
Sbjct  362   SSAIELFEEMVK-TDVKPNSVTFIGVLTACSHAGLAEQGKRLFEMMEKS  409



>ref|XP_009630093.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
isoform X1 [Nicotiana tomentosiformis]
Length=737

 Score =   254 bits (648),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/332 (39%), Positives = 196/332 (59%), Gaps = 3/332 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             + H Q I  GL N+ FALS+L+ FC+ +PN  + +Y   I+   + P   + N +I+ + 
Sbjct  49    KVHSQFIKFGLHNSQFALSKLVEFCAVNPN-DDLSYALSIFNTTENPNHVMFNMIIRGYS  107

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
             L    +  +E Y+ +L +G  P++YT P++ K+C  +    +G+ IHG   K G + D Y
Sbjct  108   LSEYPNLAIEFYEKLLFSGNLPNSYTFPFVFKSCAKIMDTQMGKMIHGHVFKLGLMNDVY  167

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             V  SLI MY+   +++ A+ VFD+   R  V++T LI+ Y+ KG V +AR +FDE PV+D
Sbjct  168   VHASLINMYAQNGELDDARLVFDKSSKRDAVSFTALINGYALKGRVDDARKLFDEMPVRD  227

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W +MISGY Q   F+E L LF +M+   V    + L+S+LSACA  G L +G  V  
Sbjct  228   VVSWNAMISGYTQMGRFEEALMLFEVMRNVNVTPSVSTLLSVLSACARAGELKLGSRVRS  287

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             ++E  G+  N+RL  AL+DM+AKCG L  A+ LF  L E+D++ WN MI G+   G+   
Sbjct  288   WIEDHGLGPNIRLVNALIDMFAKCGNLDSARDLFEGLEEKDLVSWNVMIGGYTHTGNYRE  347

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             A+ +F  MQ  A   P+ VT +S+  AC+  G
Sbjct  348   ALAVFHRMQQ-ANMAPNDVTLLSILPACAHLG  378


 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/300 (31%), Positives = 147/300 (49%), Gaps = 33/300 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ +    +   N MI  +   G     + +++ M    + P   TL  +L AC    
Sbjct  218  KLFDEMPVRDVVSWNAMISGYTQMGRFEEALMLFEVMRNVNVTPSVSTLLSVLSACARAG  277

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
               LG  +       G   +  + N+LI M+        A+C                  
Sbjct  278  ELKLGSRVRSWIEDHGLGPNIRLVNALIDMF--------AKC------------------  311

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 G++  AR +F+    KD   W  MI GY     ++E L +F  MQ   +  ++  
Sbjct  312  -----GNLDSARDLFEGLEEKDLVSWNVMIGGYTHTGNYREALAVFHRMQQANMAPNDVT  366

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKLGMAI-NVRLGTALVDMYAKCGCLGLAQKLFYEL  211
            L+SIL ACAHLG+LD+GKW+H Y+ K    + N  L T L++MYAKCG +  A+++F  +
Sbjct  367  LLSILPACAHLGALDLGKWIHAYINKHYQHLQNTSLWTTLINMYAKCGAITAAKQVFQGM  426

Query  210  PERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
              + +  +N MISG AM+GD   A+ LFR+M  + G +PD +TFVS+ TACS +G+   G
Sbjct  427  KTKTLASYNVMISGLAMHGDAYEALELFRKMTEE-GMKPDDITFVSVLTACSHAGLVDLG  485


 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 83/340 (24%), Positives = 140/340 (41%), Gaps = 78/340 (23%)
 Frame = -2

Query  1011  GLGNN---TFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSR  841
             GLG N     AL  + A C     GN      ++E +++  +   N MI  +   G    
Sbjct  293   GLGPNIRLVNALIDMFAKC-----GNLDSARDLFEGLEEKDLVSWNVMIGGYTHTGNYRE  347

Query  840   TMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLK-FGFLMDSYVGNSLI  664
              + ++  M +  M P++ TL  +L AC ++ + +LG+ IH    K +  L ++ +  +LI
Sbjct  348   ALAVFHRMQQANMAPNDVTLLSILPACAHLGALDLGKWIHAYINKHYQHLQNTSLWTTLI  407

Query  663   VMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGS  484
              MY+    + +A+ VF  M ++ + ++ V+IS  +  GD +EA                 
Sbjct  408   NMYAKCGAITAAKQVFQGMKTKTLASYNVMISGLAMHGDAYEA-----------------  450

Query  483   MISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLG  304
                           L+LFR M   G++ D+   VS+L+AC+H G +D+G+    Y   + 
Sbjct  451   --------------LELFRKMTEEGMKPDDITFVSVLTACSHAGLVDLGQ---EYFNTMI  493

Query  303   MAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFR  124
              + N    T  +  Y   GC                     MI      G  + AM +  
Sbjct  494   QSYNY---TPKLQHY---GC---------------------MIDLLGRAGKFDEAMAMIE  526

Query  123   EMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
              M      +PDG  + SL  AC      H+ L+L E   +
Sbjct  527   SMD----MKPDGAIWGSLLGACRI----HKNLELGEYAAK  558



>gb|AEP33773.1| organelle transcript processing 82, partial [Lobularia maritima]
Length=695

 Score =   253 bits (646),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/330 (39%), Positives = 196/330 (59%), Gaps = 2/330 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLK  856
             H Q+I  GL N  +ALS+L+ FC   P+     Y   ++E IQ+P + I NTM +   L 
Sbjct  7     HAQMIKTGLHNTNYALSKLIEFCVLSPHFDGLPYAISVFETIQEPNLLIWNTMFRGHALS  66

Query  855   GELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVG  676
              +    + +Y  M+  G+ P+ YT P+LLK+C   ++   G+ IHG  LK G+ +D YV 
Sbjct  67    SDPVSALYLYVCMISLGLLPNCYTFPFLLKSCAKSKAFREGQQIHGHVLKLGYDLDLYVH  126

Query  675   NSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRR  496
              SLI MY     +E A+ VFD+   R VV++T LI+ Y+ KG +  A+ +FDE P+KD  
Sbjct  127   TSLISMYVQNGRLEDARKVFDQSSHRDVVSYTALITGYASKGYIASAQKMFDEIPIKDVV  186

Query  495   VWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYV  316
              W +MISGY +    KE L+LF+ M  T V+ DE+ +VS++SACA   S+++G+ VH ++
Sbjct  187   SWNAMISGYAETGNNKEALELFKEMMKTNVRPDESTMVSVVSACAQSASIELGRQVHSWI  246

Query  315   EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAM  136
             +  G   N+++  AL+D+Y KCG +  A  LF  L  +DVI WN +I G+      + A+
Sbjct  247   DDHGFGSNLKIVNALIDLYIKCGEVETACGLFEGLSYKDVISWNTLIGGYTHMNLYKEAL  306

Query  135   RLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
              LF+EM   +G  P+ VT +S+  AC+  G
Sbjct  307   LLFQEMLR-SGESPNDVTMLSILPACAHLG  335


 Score =   173 bits (438),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/297 (33%), Positives = 154/297 (52%), Gaps = 34/297 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ I    +   N MI  +   G     +E++K M+KT + PD  T+  ++ AC    
Sbjct  175  KMFDEIPIKDVVSWNAMISGYAETGNNKEALELFKEMMKTNVRPDESTMVSVVSACAQSA  234

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LGR +H      GF  +  + N+LI +Y    ++E+A  +F+ +  + V++      
Sbjct  235  SIELGRQVHSWIDDHGFGSNLKIVNALIDLYIKCGEVETACGLFEGLSYKDVIS------  288

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                                     W ++I GY   N +KE L LF+ M  +G   ++  
Sbjct  289  -------------------------WNTLIGGYTHMNLYKEALLLFQEMLRSGESPNDVT  323

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKL--GMAINVRLGTALVDMYAKCGCLGLAQKLFYE  214
            ++SIL ACAHLG+++IG+W+H Y+ K   G+A      T+L+DMYAKCG +  AQ++F  
Sbjct  324  MLSILPACAHLGAIEIGRWIHVYINKRLKGVANASSHRTSLIDMYAKCGDIEAAQQVFDS  383

Query  213  LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGM  43
            +  R +  WNAMI GFAM+G    A  +F  M+ +    PD +TFV L +ACS SGM
Sbjct  384  ILNRSLSSWNAMIFGFAMHGRANAAFDIFSRMRKNE-IEPDDITFVGLLSACSHSGM  439


 Score = 83.6 bits (205),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 132/303 (44%), Gaps = 39/303 (13%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +   G G+N   ++ L+        G       ++E +    +   NT+I  +  
Sbjct  241   QVHSWIDDHGFGSNLKIVNALIDLYI--KCGEVETACGLFEGLSYKDVISWNTLIGGYTH  298

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIH---GQCLKFGFLMD  688
                    + +++ ML++G  P++ T+  +L AC ++ +  +GR IH    + LK G    
Sbjct  299   MNLYKEALLLFQEMLRSGESPNDVTMLSILPACAHLGAIEIGRWIHVYINKRLK-GVANA  357

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
             S    SLI MY+   D+E+AQ VFD + +R + +W  +I  ++  G    A   FD    
Sbjct  358   SSHRTSLIDMYAKCGDIEAAQQVFDSILNRSLSSWNAMIFGFAMHG---RANAAFD----  410

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWV  328
                                     +F  M+   ++ D+   V +LSAC+H G LD+G+ +
Sbjct  411   ------------------------IFSRMRKNEIEPDDITFVGLLSACSHSGMLDLGRHI  446

Query  327   HRYV-EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP-ERDVICWNAMISGFAMNG  154
              R + E   +   +     ++D+    G    A+++   +  E D + W +++    M+G
Sbjct  447   FRSMKEDYKITPKLEHYGCMIDLLGHSGLFKEAEEMINTMEMEPDGVIWCSLLKACKMHG  506

Query  153   DGE  145
             + E
Sbjct  507   NVE  509



>ref|XP_004135465.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g40405-like [Cucumis sativus]
Length=614

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/347 (37%), Positives = 204/347 (59%), Gaps = 4/347 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q++  GL NN   L + +A  +  N  N  Y  +I ++  +PT+  +N+MI+A+  
Sbjct  27    QIHTQLVINGLLNNRELLGQFVASIAVRNPTNLLYSNQILDQCAKPTLFALNSMIRAYSK  86

Query  858   KGELSRTMEMYKHMLKTG--MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDS  685
                  ++ + Y  +L++   M PDNYT  +L++ C    +C  G ++HG  +K GF  D 
Sbjct  87    SLTPHKSFQFYNKILQSNDVMSPDNYTFNFLVRTCAQ-SACEAGPAVHGALIKHGFEYDP  145

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
             +V + LI MY+ +  + S   VF+ +    +V  T ++S  ++ GD+  AR +FD  P +
Sbjct  146   HVESGLIFMYAEMSCLSSCHRVFESVQKPDLVCQTTMVSACAKCGDIGFARNLFDSMPQR  205

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             D   W +MI+GY Q    +E L LF+LMQM GV+ +E  ++S+++AC HLG+LD GKW H
Sbjct  206   DFVSWNAMIAGYAQRGQSREALNLFKLMQMDGVKVNEVSMISVVTACTHLGALDQGKWAH  265

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
              Y+EK  + + V LGTALVDMY KCG +  A K+F+E+ E++V  W+  I G AMNG G+
Sbjct  266   AYIEKNKIQMTVNLGTALVDMYFKCGNVDRALKVFWEMNEKNVYTWSTAIGGLAMNGYGQ  325

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
               + LF  M+++ G  P+ +TF+S+   CS  G   EG    + + R
Sbjct  326   KCLELFSFMKHE-GIAPNEITFISVLKGCSVVGFVDEGRSHFDSMKR  371



>emb|CDP10401.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 201/345 (58%), Gaps = 8/345 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNP---TYGWRIYERIQQPTICIVNTMIKA  868
             Q H   +   L  N  +++ LL+F +     NP   +Y   I++ +Q  T  + NTMI+ 
Sbjct  31    QVHAHFLKLYLPENPSSIAPLLSFAATSK--NPAFFSYARTIFQNLQYKTTFLYNTMIRG  88

Query  867   FLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNM-ESCNL-GRSIHGQCLKFGFL  694
             ++        +  YK MLK G+ P+NYT   L KAC  + +  NL G  +H   LK   +
Sbjct  89    YVQSHLAKPAISCYKSMLKDGLIPNNYTFTPLFKACSLVSQEFNLAGLLVHCHVLKLCLV  148

Query  693   MDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDET  514
              D ++ +SLI  YSS  +M+ A+ +FDE+P R VV WT +I  Y + G V EAR +F+E 
Sbjct  149   YDPFISSSLIEFYSSSLEMDKARMLFDEIPRRDVVLWTTMIDGYGKVGQVEEARALFEEM  208

Query  513   PVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
             P ++   W ++++GY ++  FKE L L+R M+   V+ +E++LV++L+ACA LG+L  G 
Sbjct  209   PERNVISWSALMAGYSRSGDFKEVLDLYRRMEEAAVKPNESVLVTVLTACAQLGALSQGL  268

Query  333   WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNG  154
             WVH Y    G   N  L TALVDMY+KCG + LA  +FY +  +D   WNA+ISGFAMNG
Sbjct  269   WVHSYARSCGYEDNQILATALVDMYSKCGLVELASSVFYGIVNKDSGAWNAIISGFAMNG  328

Query  153   DGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLL  19
                 ++ LF  M    GT+P   TFV++ +AC+ + M  +GL L 
Sbjct  329   YATRSLELFDHMVL-GGTQPSEATFVAVISACTHASMVDKGLWLF  372



>gb|AEP33761.1| organelle transcript processing 82, partial [Crucihimalaya wallichii]
Length=710

 Score =   253 bits (646),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/330 (39%), Positives = 196/330 (59%), Gaps = 2/330 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLK  856
             H Q+I  GL N  +ALS+L+ FC   P+     Y   ++E IQ+P + I NTM +   L 
Sbjct  22    HAQMIKTGLHNTNYALSKLIEFCVLSPHFDGLPYAISVFETIQEPNLLIWNTMFRGHALS  81

Query  855   GELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVG  676
              +    + +Y  M+  G+ P+ YT P+LLK+C   ++   G+ IHG  LK G+ +D YV 
Sbjct  82    SDPVSALYLYVCMISLGLLPNCYTFPFLLKSCAKSKAFREGQQIHGHVLKLGYDLDLYVH  141

Query  675   NSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRR  496
              SLI MY     +E A+ VFD+   R VV++T LI+ Y+ KG +  A+ +FDE P+KD  
Sbjct  142   TSLISMYVQNGRLEDARKVFDQSSHRDVVSYTALITGYASKGYIASAQKMFDEIPIKDVV  201

Query  495   VWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYV  316
              W +MISGY +    KE L+LF+ M  T V+ DE+ +VS++SACA   S+++G+ VH ++
Sbjct  202   SWNAMISGYAETGNNKEALELFKEMMKTNVRPDESTMVSVVSACAQSASIELGRQVHSWI  261

Query  315   EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAM  136
             +  G   N+++  AL+D+Y KCG +  A  LF  L  +DVI WN +I G+      + A+
Sbjct  262   DDHGFGSNLKIVNALIDLYIKCGEVETACGLFEGLSYKDVISWNTLIGGYTHMNLYKEAL  321

Query  135   RLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
              LF+EM   +G  P+ VT +S+  AC+  G
Sbjct  322   LLFQEMLR-SGESPNDVTMLSILPACAHLG  350


 Score =   173 bits (438),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/297 (33%), Positives = 154/297 (52%), Gaps = 34/297 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ I    +   N MI  +   G     +E++K M+KT + PD  T+  ++ AC    
Sbjct  190  KMFDEIPIKDVVSWNAMISGYAETGNNKEALELFKEMMKTNVRPDESTMVSVVSACAQSA  249

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LGR +H      GF  +  + N+LI +Y    ++E+A  +F+ +  + V++      
Sbjct  250  SIELGRQVHSWIDDHGFGSNLKIVNALIDLYIKCGEVETACGLFEGLSYKDVIS------  303

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                                     W ++I GY   N +KE L LF+ M  +G   ++  
Sbjct  304  -------------------------WNTLIGGYTHMNLYKEALLLFQEMLRSGESPNDVT  338

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKL--GMAINVRLGTALVDMYAKCGCLGLAQKLFYE  214
            ++SIL ACAHLG+++IG+W+H Y+ K   G+A      T+L+DMYAKCG +  AQ++F  
Sbjct  339  MLSILPACAHLGAIEIGRWIHVYINKRLKGVANASSHRTSLIDMYAKCGDIEAAQQVFDS  398

Query  213  LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGM  43
            +  R +  WNAMI GFAM+G    A  +F  M+ +    PD +TFV L +ACS SGM
Sbjct  399  ILNRSLSSWNAMIFGFAMHGRANAAFDIFSRMRKNE-IEPDDITFVGLLSACSHSGM  454


 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 69/303 (23%), Positives = 130/303 (43%), Gaps = 39/303 (13%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +   G G+N   ++ L+        G       ++E +    +   NT+I  +  
Sbjct  256   QVHSWIDDHGFGSNLKIVNALIDLYI--KCGEVETACGLFEGLSYKDVISWNTLIGGYTH  313

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIH---GQCLKFGFLMD  688
                    + +++ ML++G  P++ T+  +L AC ++ +  +GR IH    + LK G    
Sbjct  314   MNLYKEALLLFQEMLRSGESPNDVTMLSILPACAHLGAIEIGRWIHVYINKRLK-GVANA  372

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
             S    SLI MY+   D+E+AQ VFD + +R + +W  +I  ++  G    A   FD    
Sbjct  373   SSHRTSLIDMYAKCGDIEAAQQVFDSILNRSLSSWNAMIFGFAMHG---RANAAFD----  425

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWV  328
                                     +F  M+   ++ D+   V +LSAC+H G LD+G+ +
Sbjct  426   ------------------------IFSRMRKNEIEPDDITFVGLLSACSHSGMLDLGRHI  461

Query  327   HRYV-EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP-ERDVICWNAMISGFAMNG  154
              R + E   +   +     ++D+    G    A+++   +  E D + W +++    M  
Sbjct  462   FRSMKEDYKITPKLEHYGCMIDLLGHSGLFKEAEEMINTMEMEPDGVIWCSLLKACKMYA  521

Query  153   DGE  145
             + E
Sbjct  522   NVE  524



>ref|XP_008803598.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Phoenix dactylifera]
Length=537

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/349 (38%), Positives = 210/349 (60%), Gaps = 11/349 (3%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLA---FCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKA  868
             Q H   I   L   T+  SR+LA   F  +P++ +      +++RI +PTI   NTMIKA
Sbjct  47    QLHAHAIALDLVRYTYVTSRILALYAFHPNPDIHSARL---VFDRIPEPTIFNWNTMIKA  103

Query  867   FLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMD  688
                     + +  Y HM + G+ P+ +T P+ +KAC  + S +    IHGQ +KFGF +D
Sbjct  104   HSRTPHPEKGLLFYSHMRRRGLPPNMHTFPFAIKACARLSSLS---QIHGQIVKFGFYLD  160

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
              +V +SLI  YS L  +E A  VFDE  +R +V WT LIS +  +G V  AR +F+    
Sbjct  161   VFVTSSLIRYYSHLGRLEFASQVFDESSNRNLVCWTSLISAHCARGLVDRAREIFERMSE  220

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG-VQADEAILVSILSACAHLGSLDIGKW  331
             ++   W ++I+GYVQN+  +E ++LFR ++  G V+ ++++LVS+L+ACA LG+++ G+W
Sbjct  221   RNEVSWSAIITGYVQNDRPEEAIELFRELKRHGSVKLNDSLLVSVLNACAGLGAVEEGRW  280

Query  330   VHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGD  151
             +H Y+++ G    V LGTAL+D Y+KCG +  A+++F ++  +DV  W+AM+ G A+NG 
Sbjct  281   IHDYIDRRGTHYGVELGTALLDFYSKCGFIESAREVFCKMACKDVTAWSAMVMGQALNGL  340

Query  150   GENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
               +A+  F EM       P+ VTFV + TAC+  G+  EG   LE + R
Sbjct  341   THSAIETFSEMLG-CKVMPNAVTFVGVLTACNHGGLVDEGWAYLEDMSR  388


 Score = 79.7 bits (195),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 78/319 (24%), Positives = 142/319 (45%), Gaps = 21/319 (7%)
 Frame = -2

Query  1041  SQAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             SQ HGQ++  G   + F  S L+ + S  +LG   +  ++++      +    ++I A  
Sbjct  146   SQIHGQIVKFGFYLDVFVTSSLIRYYS--HLGRLEFASQVFDESSNRNLVCWTSLISAHC  203

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSI--HGQCLKFGFLMD  688
              +G + R  E+++ M +      +  +   ++     E+  L R +  HG       L D
Sbjct  204   ARGLVDRAREIFERMSERNEVSWSAIITGYVQNDRPEEAIELFRELKRHGSVK----LND  259

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSR----CVVAWTVLISRYSRKGDVFEARLVFD  520
             S +  S++   + L  +E  + + D +  R     V   T L+  YS+ G +  AR VF 
Sbjct  260   SLL-VSVLNACAGLGAVEEGRWIHDYIDRRGTHYGVELGTALLDFYSKCGFIESAREVFC  318

Query  519   ETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDI  340
             +   KD   W +M+ G   N      ++ F  M    V  +    V +L+AC H G +D 
Sbjct  319   KMACKDVTAWSAMVMGQALNGLTHSAIETFSEMLGCKVMPNAVTFVGVLTACNHGGLVDE  378

Query  339   GKWVHRYVEKL----GMAINVRLGTALVDMYAKCGCLGLAQKLFYELP-ERDVICWNAMI  175
             G W   Y+E +    G++  +     +VD+ ++ G    A++L   +P E D   W A++
Sbjct  379   G-WA--YLEDMSRVYGLSPTIEHYGCVVDLLSRAGRTAEAERLIRCMPMEPDGAIWGALL  435

Query  174   SGFAMNGDGENAMRLFREM  118
              G  M+G+ E   R+ R +
Sbjct  436   HGCLMHGNAELGERVGRRV  454



>gb|AEP33767.1| organelle transcript processing 82, partial [Matthiola incana]
Length=694

 Score =   253 bits (645),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/331 (40%), Positives = 200/331 (60%), Gaps = 3/331 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLK  856
             H Q+I  GL N  +ALS+LL FC   P+     Y   +++ IQ+P + I NTM +   L 
Sbjct  8     HAQMIKTGLHNTNYALSKLLEFCVVSPHFDGFPYAISVFDTIQEPNLLIWNTMFRGHALS  67

Query  855   GELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVG  676
              +    +++Y  M+  G+ PD+YT P+LLK+C   +    G+ IHG  LK GF +D YV 
Sbjct  68    SDPVSALKLYLVMISLGLLPDSYTFPFLLKSCAKSKIRKEGQQIHGHVLKLGFDLDIYVH  127

Query  675   NSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRR  496
              SLI MY+    +E A+ VFD    R VV++T LI+ Y  +G +  A+ +FDE P KD  
Sbjct  128   TSLISMYAQNGRLEDARKVFDISSHRDVVSYTALIAGYVSRGYIESAQKLFDEIPGKDVV  187

Query  495   VWGSMISGYVQNNCFKEGLQLFR-LMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
              W +MISGYV+   +KE L+LF+ +M MT V+ DE+ +V+++SACA   S+++G+ VH +
Sbjct  188   SWNAMISGYVETGNYKEALELFKEMMMMTNVRPDESTMVTVVSACAQSDSIELGRHVHSW  247

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +   G A N+++  AL+D+Y+K G +  A +LF  L  +DVI WN +I G+      + A
Sbjct  248   INDHGFASNLKIVNALIDLYSKFGEVETACELFDGLWNKDVISWNTLIGGYTHMNLYKEA  307

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + LF+EM   +G  P+ VT +S+  AC+  G
Sbjct  308   LLLFQEMLR-SGETPNDVTMLSILPACAHLG  337


 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/313 (34%), Positives = 161/313 (51%), Gaps = 37/313 (12%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLK-TGMCPDNYTLPYLLKACGNM  751
            ++++ I    +   N MI  ++  G     +E++K M+  T + PD  T+  ++ AC   
Sbjct  176  KLFDEIPGKDVVSWNAMISGYVETGNYKEALELFKEMMMMTNVRPDESTMVTVVSACAQS  235

Query  750  ESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLI  571
            +S  LGR +H      GF  +  + N+LI +YS           F E+ + C +      
Sbjct  236  DSIELGRHVHSWINDHGFASNLKIVNALIDLYSK----------FGEVETACEL------  279

Query  570  SRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEA  391
                           FD    KD   W ++I GY   N +KE L LF+ M  +G   ++ 
Sbjct  280  ---------------FDGLWNKDVISWNTLIGGYTHMNLYKEALLLFQEMLRSGETPNDV  324

Query  390  ILVSILSACAHLGSLDIGKWVHRYVEK--LGMAINV-RLGTALVDMYAKCGCLGLAQKLF  220
             ++SIL ACAHLG++DIG+W+H Y+ K   G+  NV  L T+L+DMYAKCG +  AQ++F
Sbjct  325  TMLSILPACAHLGAIDIGRWIHVYINKKLKGVVTNVSSLQTSLIDMYAKCGDIDAAQQVF  384

Query  219  -YELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGM  43
               +  R +  WNAMISGFAM+G    A  +F  M+ + G  PD +TFV L +ACS SGM
Sbjct  385  DSSMSNRSLSTWNAMISGFAMHGRANAAFDIFSRMRMN-GIEPDDITFVGLLSACSHSGM  443

Query  42   AHEGLKLLEKIGR  4
               G  +   + R
Sbjct  444  LDLGRNIFRSMTR  456


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/305 (24%), Positives = 137/305 (45%), Gaps = 41/305 (13%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
               H  +   G  +N   ++ L+   S    G       +++ +    +   NT+I  +  
Sbjct  243   HVHSWINDHGFASNLKIVNALIDLYS--KFGEVETACELFDGLWNKDVISWNTLIGGYTH  300

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIH---GQCLKFGFLMD  688
                    + +++ ML++G  P++ T+  +L AC ++ + ++GR IH    + LK      
Sbjct  301   MNLYKEALLLFQEMLRSGETPNDVTMLSILPACAHLGAIDIGRWIHVYINKKLKGVVTNV  360

Query  687   SYVGNSLIVMYSSLDDMESAQCVFD-EMPSRCVVAWTVLISRYSRKGDVFEARLVFDETP  511
             S +  SLI MY+   D+++AQ VFD  M +R +  W  +IS ++  G    A   FD   
Sbjct  361   SSLQTSLIDMYAKCGDIDAAQQVFDSSMSNRSLSTWNAMISGFAMHG---RANAAFD---  414

Query  510   VKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKW  331
                                      +F  M+M G++ D+   V +LSAC+H G LD+G+ 
Sbjct  415   -------------------------IFSRMRMNGIEPDDITFVGLLSACSHSGMLDLGRN  449

Query  330   VHRYVEKLGMAINVRLGTA--LVDMYAKCGCLGLAQKLFYELP-ERDVICWNAMISGFAM  160
             + R + + G  I  +L     ++D+    G    A+++   +P E D + W +++    +
Sbjct  450   IFRSMTR-GYEITPKLEHYGCMIDLLGHSGLFKEAEEMINTMPMEPDGVIWCSLLKACKI  508

Query  159   NGDGE  145
             +G+ E
Sbjct  509   HGNLE  513



>ref|XP_002524455.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF37895.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=486

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/331 (39%), Positives = 194/331 (59%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H QVI  GL N  FALS+L+ FC     G+ +Y   +++ I +P   I N +I+   L
Sbjct  42    QIHSQVIKTGLHNTHFALSKLIEFCVISPYGDLSYALLLFKSIGKPNQIIWNNIIRGLSL  101

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                    ++ Y  M+ +G  P+ YT P++LK+C  + S + G+ IHGQ LK GF  D++V
Sbjct  102   SESPILAIQYYVDMISSGFTPNTYTYPFVLKSCARISSTHEGKQIHGQILKLGFDNDAFV  161

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY    ++ +A+ VF+    R VV++T LI+ Y+ +G + +A  +FDE PV+D 
Sbjct  162   HTSLITMYVQNGELGNARLVFERSSMRDVVSYTALITGYASRGFLDQALELFDEIPVRDV  221

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY Q+  F+E L  F  M    V  + + L+S+LSACA  GSL +G WV  +
Sbjct  222   VSWNAMIAGYTQSGRFEEALIFFEEMLRANVTPNMSTLLSVLSACAQSGSLKMGNWVSSW  281

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E+ G+  N+++  AL+DMYAKCG L  A  LF  +  ++VI WN MI G+      + A
Sbjct  282   IEEHGLESNIKVMNALIDMYAKCGDLENALHLFEGIKNKNVISWNVMIGGYTHLSCYKEA  341

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + LFR+M   +   P+ VT +S+  AC+  G
Sbjct  342   LGLFRQML-QSNVEPNDVTLLSILPACANLG  371


 Score =   167 bits (422),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 108/362 (30%), Positives = 171/362 (47%), Gaps = 62/362 (17%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLA-FCSDPNLGNPT--------------------YGWR-  925
             Q HGQ++  G  N+ F  + L+  +  +  LGN                      Y  R 
Sbjct  145   QIHGQILKLGFDNDAFVHTSLITMYVQNGELGNARLVFERSSMRDVVSYTALITGYASRG  204

Query  924   -------IYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLK  766
                    +++ I    +   N MI  +   G     +  ++ ML+  + P+  TL  +L 
Sbjct  205   FLDQALELFDEIPVRDVVSWNAMIAGYTQSGRFEEALIFFEEMLRANVTPNMSTLLSVLS  264

Query  765   ACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVA  586
             AC    S  +G  +     + G   +  V N+LI MY        A+C            
Sbjct  265   ACAQSGSLKMGNWVSSWIEEHGLESNIKVMNALIDMY--------AKC------------  304

Query  585   WTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGV  406
                        GD+  A  +F+    K+   W  MI GY   +C+KE L LFR M  + V
Sbjct  305   -----------GDLENALHLFEGIKNKNVISWNVMIGGYTHLSCYKEALGLFRQMLQSNV  353

Query  405   QADEAILVSILSACAHLGSLDIGKWVHRYVEK-LGMAINVRLGTALVDMYAKCGCLGLAQ  229
             + ++  L+SIL ACA+LG+L +GKW+H Y++K +    N  L T+L+DMYAKCG + +A 
Sbjct  354   EPNDVTLLSILPACANLGALGLGKWIHAYIDKNMKNLANNALWTSLIDMYAKCGNIEVAN  413

Query  228   KLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCS  49
             ++F  +  + +  WNAMISGFAM+G  + A+ LF  M  + G  PD +TF+ + +AC+ +
Sbjct  414   QIFDGMNPKSLASWNAMISGFAMHGQADLAISLFSRMTKE-GLVPDNITFIGVLSACNHA  472

Query  48    GM  43
             G+
Sbjct  473   GL  474


 Score = 79.3 bits (194),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 88/205 (43%), Gaps = 30/205 (15%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
             ++E I+   +   N MI  +         + +++ ML++ + P++ TL  +L AC N+ 
Sbjct  312  HLFEGIKNKNVISWNVMIGGYTHLSCYKEALGLFRQMLQSNVEPNDVTLLSILPACANLG  371

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            +  LG+ IH    K    M +   N+L                           WT LI 
Sbjct  372  ALGLGKWIHAYIDKN---MKNLANNAL---------------------------WTSLID  401

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
             Y++ G++  A  +FD    K    W +MISG+  +      + LF  M   G+  D   
Sbjct  402  MYAKCGNIEVANQIFDGMNPKSLASWNAMISGFAMHGQADLAISLFSRMTKEGLVPDNIT  461

Query  387  LVSILSACAHLGSLDIGKWVHRYVE  313
             + +LSAC H G LD+G   H +++
Sbjct  462  FIGVLSACNHAGLLDLGHINHFHID  486



>ref|XP_009394237.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 
[Musa acuminata subsp. malaccensis]
Length=623

 Score =   251 bits (641),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/347 (40%), Positives = 199/347 (57%), Gaps = 3/347 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLA-FCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFL  862
             Q H  ++  GL  +    SRLLA  C  P+ G+ TY    +ER++     + NTMI+A  
Sbjct  35    QIHATMVKTGLVLDAVPASRLLAALCRSPDDGSLTYALLFFERLRCRNTFMWNTMIRALS  94

Query  861   LKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESC-NLGRSIHGQCLKFGFLMDS  685
                   + + +Y  M    M  + YT P+LLKAC  + S     + +H   +K GF  + 
Sbjct  95    DSNLPEQAVILYCQMRSDAMPHNPYTFPFLLKACVALPSALPETQQVHSHIIKHGFASEV  154

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
             Y  NSL+ +Y+      SA+ +FD MP R  + W  +I  Y++ G +  AR +FD    K
Sbjct  155   YTANSLLRVYAKSGCTGSARKLFDRMPCRDAITWNSMIDGYAKSGRLEMARQLFDLMEEK  214

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             +   W SMI+G V+N  FKE L+LF  M +T V+AD   L S L+AC HLG+LD G+W+H
Sbjct  215   NVVSWTSMITGCVENCLFKEALELFGEMLVTEVEADARALTSALTACTHLGALDQGRWIH  274

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
              Y++K  M ++  LG  LVDMYAKCG L  A  +F  + ER+V  W AMI+G A++G G 
Sbjct  275   TYIKKRQMQLDPALGCVLVDMYAKCGELDEALSIFETIRERNVAVWTAMIAGLAVHGLGR  334

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
              A+ LF+EM+ DAG +P+ +T  S  TACS +GM  EG  L E+I +
Sbjct  335   EALDLFKEME-DAGVKPNHITVTSALTACSYAGMVEEGGSLFERITK  380



>ref|XP_008393901.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Malus domestica]
Length=542

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/346 (36%), Positives = 199/346 (58%), Gaps = 6/346 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H Q++   L  + F +++++  C   N G+  Y   ++E++ +P + + N MI+A   
Sbjct  32    KIHAQIVKLSLSQSNFLVTKMVDVCD--NSGDLRYAGLLFEQVMEPNVFLFNAMIRANTH  89

Query  858   KGELSRTMEMYKHMLKTG---MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMD  688
                    + +YK ML+       PD +T P+++K+C  +    LGR +H Q  KFG    
Sbjct  90    NQIYDLAISLYKQMLREAENQKLPDKFTFPFVIKSCAAIFCEVLGRQVHAQVCKFGPKSH  149

Query  687   SYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPV  508
               + N+L+ +Y   D++  A  VFD M    V++W  L+S Y R G +  AR VF+E P 
Sbjct  150   LLIENALMDLYLKCDNLADAHKVFDGMSEPDVISWNSLLSGYVRLGKMRGARAVFEEIPX  209

Query  507   KDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWV  328
             K    W +M+SGY +  C+ E L +FR MQM   + DE  +VS+L AC+ LG+L++GKW+
Sbjct  210   KTIVSWTAMVSGYTRIGCYAEALDMFRRMQMLDNEPDEISIVSVLPACSQLGALEVGKWI  269

Query  327   HRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDG  148
             H Y EK  +  +V +  AL++MY KCGC+  A  LF ++ ERDVI W+ MI+G A  G  
Sbjct  270   HMYSEKKQLLQSVCVCNALIEMYMKCGCIDEAWHLFDQMLERDVISWSTMIAGLANYGKA  329

Query  147   ENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
               A+ LF+EMQ      P+GVTF+ L +AC+ +G+  EG+K  + +
Sbjct  330   XEAVELFQEMQI-XKVEPNGVTFLGLLSACTHAGLWBEGVKYFDSM  374



>ref|XP_010243684.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic [Nelumbo nucifera]
Length=547

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/337 (37%), Positives = 203/337 (60%), Gaps = 3/337 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKG  853
             H  +I  GL  +T A SR+LAF +    G+  Y + ++ +IQ P +   NT+I+ F    
Sbjct  43    HAHIIKTGLAKDTIAASRVLAFSATSPAGDINYAYSVFSQIQNPNLFTWNTIIRGFSQSS  102

Query  852   ELSRTMEMYKHMLKTG-MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVG  676
                R + ++  ML++  + P   T P L KA   +   + G  +HG+ +K G   D ++ 
Sbjct  103   TPLRAISLFTDMLQSSPIEPQRLTYPSLFKAYAQLGLAHDGTQLHGRIIKLGLESDPFIR  162

Query  675   NSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRR  496
             N++I MY++   +  A  +FD + +  VVAW  +I+  ++ G++ ++R +FD+ P +   
Sbjct  163   NTIIFMYATCGFLIEACRLFD-VSNSDVVAWNSMITGLAKFGEIDQSRRLFDKMPKRSTI  221

Query  495   VWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYV  316
              W SMISGYV+N  FKE + LF  MQ  G++     +VS+L+AC+ LG+L+ G+W+H Y+
Sbjct  222   SWNSMISGYVRNGNFKEAMDLFDEMQKEGIKPSGFTIVSLLNACSGLGALEQGEWLHTYI  281

Query  315   EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAM  136
             EK  +  N  + TA++DMY KCGC+  A ++F  + E+ + CWN+MI G A+NG G+ A+
Sbjct  282   EKNEIETNSIVSTAIIDMYCKCGCVDKALQVFETISEKGLSCWNSMILGLAINGCGKEAI  341

Query  135   RLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLK  25
             + F  +Q+ +G RPD V+F+ + TACS SGM +E  K
Sbjct  342   QFFSRLQS-SGLRPDDVSFIGVLTACSHSGMVNEARK  377


 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/272 (25%), Positives = 125/272 (46%), Gaps = 33/272 (12%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            R+++++ + +    N+MI  ++  G     M+++  M K G+ P  +T+  LL AC  + 
Sbjct  210  RLFDKMPKRSTISWNSMISGYVRNGNFKEAMDLFDEMQKEGIKPSGFTIVSLLNACSGLG  269

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            +   G  +H           +Y+                     +E+ +  +V+ T +I 
Sbjct  270  ALEQGEWLH-----------TYIEK-------------------NEIETNSIVS-TAIID  298

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
             Y + G V +A  VF+    K    W SMI G   N C KE +Q F  +Q +G++ D+  
Sbjct  299  MYCKCGCVDKALQVFETISEKGLSCWNSMILGLAINGCGKEAIQFFSRLQSSGLRPDDVS  358

Query  387  LVSILSACAHLGSLDIG-KWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
             + +L+AC+H G ++   K+     E   +   V+  + +VD   + G L  A++    +
Sbjct  359  FIGVLTACSHSGMVNEARKYFSAMKETYNIEPTVKHYSCMVDALGRAGLLEEAEEFIINM  418

Query  210  PER-DVICWNAMISGFAMNGDGENAMRLFREM  118
            PE  D I W++++S    +G+ E   R  R+M
Sbjct  419  PENPDAIIWSSLLSACRKHGNSEMGKRAARQM  450


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/133 (25%), Positives = 65/133 (49%), Gaps = 5/133 (4%)
 Frame = -2

Query  402  ADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYA--KCGCLGLAQ  229
            +D   L  +   C ++  L   + +H ++ K G+A +    + ++   A    G +  A 
Sbjct  21   SDHPSLSMLEKRCTNMSDL---QKLHAHIIKTGLAKDTIAASRVLAFSATSPAGDINYAY  77

Query  228  KLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCS  49
             +F ++   ++  WN +I GF+ +     A+ LF +M   +   P  +T+ SLF A +  
Sbjct  78   SVFSQIQNPNLFTWNTIIRGFSQSSTPLRAISLFTDMLQSSPIEPQRLTYPSLFKAYAQL  137

Query  48   GMAHEGLKLLEKI  10
            G+AH+G +L  +I
Sbjct  138  GLAHDGTQLHGRI  150



>ref|XP_010092397.1| hypothetical protein L484_023776 [Morus notabilis]
 gb|EXB51073.1| hypothetical protein L484_023776 [Morus notabilis]
Length=523

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/343 (38%), Positives = 200/343 (58%), Gaps = 3/343 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q++  GL N      RL+   S   +    Y   I+  I  P +   NT+++  +L
Sbjct  27    QVHAQLVVSGLVNRPPNGGRLVE--SYVRVSQTQYALAIFNTIHSPDVFAYNTIMRGLML  84

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               +   ++ MY+ +L  G+ PDN+T  ++LKAC +M++   G+ +H + +K G   D++V
Sbjct  85    GKDPYNSLLMYEKLLMNGLIPDNFTYTFVLKACSHMKALIEGKQVHCRMIKAGIAPDTHV  144

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              +SLI MY+S   +  A+ V  E      +A   +IS Y  KG V +AR +F++   KD 
Sbjct  145   HSSLINMYASSGSIACAERVLGEFKEENTLAMNAMISGYLSKGHVDKARAMFEKMAAKDV  204

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W ++I+GY  N  +KE L +F+ M    V  +E+ LVS LSAC HLG+LD G W+H Y
Sbjct  205   ASWSAVIAGYRDNAMYKEALSIFQEMVAFRVSPNESALVSSLSACGHLGALDQGMWIHAY  264

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             ++K  + +++ LGTALVDMYAKCGC+    K+F +LP RDV+ W A+ISGFA +G  E  
Sbjct  265   IDKNKVKLSITLGTALVDMYAKCGCIESCYKVFRKLPNRDVVTWGAVISGFANHGKPEKC  324

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
               LF EM ++ G RP+ V FV++ +ACS +G    G +   ++
Sbjct  325   FELFGEMVSE-GVRPNEVIFVAILSACSRAGYVELGSQYFHQM  366


 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 78/350 (22%), Positives = 142/350 (41%), Gaps = 69/350 (20%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H ++I  G+  +T   S L+   +    G+     R+    ++     +N MI  +L 
Sbjct  128   QVHCRMIKAGIAPDTHVHSSLINMYASS--GSIACAERVLGEFKEENTLAMNAMISGYLS  185

Query  858   KGELSRTMEMYKHMLKTGMC-------------------------------PDNYTLPYL  772
             KG + +   M++ M    +                                P+   L   
Sbjct  186   KGHVDKARAMFEKMAAKDVASWSAVIAGYRDNAMYKEALSIFQEMVAFRVSPNESALVSS  245

Query  771   LKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCV  592
             L ACG++ + + G  IH    K    +   +G +L+ MY+    +ES   VF ++     
Sbjct  246   LSACGHLGALDQGMWIHAYIDKNKVKLSITLGTALVDMYAKCGCIESCYKVFRKL-----  300

Query  591   VAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMT  412
                                       P +D   WG++ISG+  +   ++  +LF  M   
Sbjct  301   --------------------------PNRDVVTWGAVISGFANHGKPEKCFELFGEMVSE  334

Query  411   GVQADEAILVSILSACAHLGSLDIG-KWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGL  235
             GV+ +E I V+ILSAC+  G +++G ++ H+ V   G+  ++     +VD+  + G L  
Sbjct  335   GVRPNEVIFVAILSACSRAGYVELGSQYFHQMVNDFGIVPSIEHYGCMVDLLGRAGRLAE  394

Query  234   AQKLFYELPER-DVICWNAMISGFAMNGD---GENAMRLFREMQNDAGTR  97
             A++    +PE+ + I W A +S    + D   G  A R   E++  +G R
Sbjct  395   AEEFIVAMPEKPNSIIWGAFLSACRTHKDPKRGTVAFRHLMELEPTSGDR  444



>ref|XP_010262425.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g40405 [Nelumbo nucifera]
Length=611

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/343 (37%), Positives = 204/343 (59%), Gaps = 2/343 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q++  GL N+ + L + +A  +  +  N  Y  ++ ++   PT+  +N+MI+A+  
Sbjct  26    QIHAQLLINGLLNDPYCLGQFVASIALNHQNNLAYSDQLLDQSHNPTVFALNSMIRAYSR  85

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                  R  + Y  +L++   PDNYT  +L+++C  + S +   ++H   +K G   + +V
Sbjct  86    SSTPQRGFQFYNRILQSN-TPDNYTFTFLVRSCTQVSSSDAALAVHAAIIKHGSDSNRHV  144

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              + LI MY+ L  + SA+ +F E+    +V+ T ++S  +R G+V  A+ +FDE P +D 
Sbjct  145   QSGLINMYAELGFLGSARKLFSEIREPDLVSQTAMVSACARCGEVDFAQNLFDEMPYRDP  204

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY Q    KE L LF LMQM G + +EA +VS+LSAC HLG+LD GKW H Y
Sbjct  205   IAWNAMIAGYSQCGRSKEALDLFHLMQMDGAKVNEATMVSVLSACTHLGALDQGKWAHAY  264

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E+  + + V LGTAL+DMY+KCG +  A  +F+ + ER+V  W++ + G AMNG GE  
Sbjct  265   IERNKLQMTVTLGTALIDMYSKCGNMSKAMDVFWGMKERNVYTWSSAMGGLAMNGAGEKC  324

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             + LF  M+ D G +P+ VTF+S+   C   G+  EG K  E +
Sbjct  325   LELFSLMKQD-GIQPNEVTFISVLRGCCVVGLVEEGRKHFESM  366



>ref|XP_004961943.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Setaria italica]
Length=549

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/354 (35%), Positives = 200/354 (56%), Gaps = 10/354 (3%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             +AHG  +   L  +++  ++++  C+    G   +  R++ ++  P + + N MIKA+  
Sbjct  30    RAHGHAVRLCLSQSSYVATQIVHLCN--AHGRAEHAARVFAQVPDPNLHLHNAMIKAYAQ  87

Query  858   KGELSRTMEMYKHMLKTGMCP--------DNYTLPYLLKACGNMESCNLGRSIHGQCLKF  703
                    +E+Y   L+    P        D +T P+LLKACG + +  LGR +H   ++ 
Sbjct  88    NHLHRDAVEVYVRTLRCLPLPSSGGFSGGDRFTYPFLLKACGGLAAVELGRQVHAHVVRS  147

Query  702   GFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVF  523
             G      V NS+I MY+   D+  A+ VFDEM ++  V+W  LIS ++R G +  AR +F
Sbjct  148   GCEAHDIVRNSMIEMYTRCGDLSLARRVFDEMRNKDAVSWNTLISAHARLGQMRRARALF  207

Query  522   DETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLD  343
             D  P K    W +++SGY     F   +++FRLMQM G + D+  +V++L ACA LG+L+
Sbjct  208   DSMPDKTVVSWTALVSGYTAVGDFAGAVEVFRLMQMEGFEPDDVSIVAVLPACAQLGALE  267

Query  342   IGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFA  163
             +G+W++ Y  K  M     +  AL++MYAKCGC+  A +LF  +PE+DVI W+  I G A
Sbjct  268   LGRWIYAYCNKHDMLRKTYICNALMEMYAKCGCIDQALQLFDGMPEKDVISWSTAIGGLA  327

Query  162   MNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGRA  1
              +G    A+ LF  M  +   RP+GVTFV L +ACS +G+  EGL+  +++  A
Sbjct  328   AHGRAREAVWLFEAMDREERVRPNGVTFVGLLSACSHAGLLDEGLRYFDRMKEA  381



>ref|XP_003631282.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g40405 [Vitis vinifera]
Length=615

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/347 (37%), Positives = 202/347 (58%), Gaps = 3/347 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q++  GL N+   + + +A  +  N  N  Y  ++ +  Q PT+   N+MI+A   
Sbjct  27    QIHTQLLINGLLNDPQLVGQFVASIALNNPNNLHYSNQVLDNSQNPTLFTFNSMIRAHSK  86

Query  858   KGELSRTMEMYKHMLKTG--MCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDS  685
                  R+   Y  +L +   + PDNYT  +L++    + +   G S+HG  +K+GF  D 
Sbjct  87    SSTPHRSFHFYSRILHSAGYLAPDNYTFTFLVRTSAQLLAHGTGSSVHGAAVKYGFEYDP  146

Query  684   YVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVK  505
             +V + LI MY+ L  +++   VF  +    +V  T ++S  ++ GDV  AR +FD+   K
Sbjct  147   HVQSGLIYMYAELGGLDACHRVFSSICEPDLVCQTAMVSACAKMGDVGFARKLFDKMSHK  206

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             D   W +MISGYVQ    +E L LF LMQ  GV+ +E  +VS+LSAC+HLG+LD G+W H
Sbjct  207   DPIAWNAMISGYVQCGQSREALSLFNLMQREGVKVNEVSMVSVLSACSHLGALDQGRWAH  266

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
              Y+E+  + + + LGTAL+DMYAKCG +  A ++F+ + E++V  W++ I G AMNG GE
Sbjct  267   AYIERNKLRMTLTLGTALIDMYAKCGNMNKAMEVFWGMKEKNVYTWSSAIGGLAMNGAGE  326

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
               + LF  M+ D+  +P+ +TFVS+   CS  G+  EG K  E + +
Sbjct  327   KCLELFSLMKQDS-VQPNEITFVSVLRGCSVVGLVEEGRKHFESMSK  372



>ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Cucumis sativus]
 ref|XP_004171920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Cucumis sativus]
 gb|KGN65308.1| hypothetical protein Csa_1G306800 [Cucumis sativus]
Length=734

 Score =   253 bits (646),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/331 (39%), Positives = 199/331 (60%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +I  GL N  FALS+L+ F +    G+ +Y   ++  I++P + I N+MI+   +
Sbjct  47    QIHAHIIKTGLHNTLFALSKLIEFSAVSRSGDISYAISLFNSIEEPNLFIWNSMIRGLSM  106

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 +  +  +  M+ +G+ P++YT P+LLK+C  + S + G+ IH   LK GF+ D ++
Sbjct  107   SLSPALALVFFVRMIYSGVEPNSYTFPFLLKSCAKLASAHEGKQIHAHVLKLGFVSDVFI  166

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   +M +AQ VFD+   R  +++T LI+ Y+  G +  AR +FDE PVKD 
Sbjct  167   HTSLINMYAQSGEMNNAQLVFDQSNFRDAISFTALIAGYALWGYMDRARQLFDEMPVKDV  226

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI+GY Q    KE L LF  M+   V  +E+ +VS+LSACA   +LD+G  +  +
Sbjct  227   VSWNAMIAGYAQMGRSKEALLLFEDMRKANVPPNESTIVSVLSACAQSNALDLGNSMRSW  286

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E  G+  N++L  AL+DMY+KCG L  A++LF ++ ERDVI WN MI G+      + A
Sbjct  287   IEDRGLCSNLKLVNALIDMYSKCGDLQTARELFDDMLERDVISWNVMIGGYTHMCSYKEA  346

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + LFREM   +G  P  +TF+S+  +C+  G
Sbjct  347   LALFREMLA-SGVEPTEITFLSILPSCAHLG  376


 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/306 (30%), Positives = 154/306 (50%), Gaps = 32/306 (10%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ +    +   N MI  +   G     + +++ M K  + P+  T+  +L AC    
Sbjct  216  QLFDEMPVKDVVSWNAMIAGYAQMGRSKEALLLFEDMRKANVPPNESTIVSVLSACAQSN  275

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            + +LG S+       G   +  + N+LI MYS                 +C         
Sbjct  276  ALDLGNSMRSWIEDRGLCSNLKLVNALIDMYS-----------------KC---------  309

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                 GD+  AR +FD+   +D   W  MI GY     +KE L LFR M  +GV+  E  
Sbjct  310  -----GDLQTARELFDDMLERDVISWNVMIGGYTHMCSYKEALALFREMLASGVEPTEIT  364

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP  208
             +SIL +CAHLG++D+GKW+H Y+ K   +++  L T+L+D+YAKCG +  A+++F  + 
Sbjct  365  FLSILPSCAHLGAIDLGKWIHAYINKNFNSVSTSLSTSLIDLYAKCGNIVAARQVFDGMK  424

Query  207  ERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGL  28
             + +  WNAMI G AM+G  + A  LF +M +D G  P+ +TFV + +AC  +G+   G 
Sbjct  425  IKSLASWNAMICGLAMHGQADKAFELFSKMSSD-GIEPNEITFVGILSACKHAGLVDLGQ  483

Query  27   KLLEKI  10
            +    +
Sbjct  484  QFFSSM  489


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/282 (21%), Positives = 116/282 (41%), Gaps = 37/282 (13%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
             +++ + +  +   N MI  +         + +++ ML +G+ P   T   +L +C ++ 
Sbjct  317  ELFDDMLERDVISWNVMIGGYTHMCSYKEALALFREMLASGVEPTEITFLSILPSCAHLG  376

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            + +LG+ IH           +Y+  +                      S      T LI 
Sbjct  377  AIDLGKWIH-----------AYINKNF--------------------NSVSTSLSTSLID  405

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
             Y++ G++  AR VFD   +K    W +MI G   +    +  +LF  M   G++ +E  
Sbjct  406  LYAKCGNIVAARQVFDGMKIKSLASWNAMICGLAMHGQADKAFELFSKMSSDGIEPNEIT  465

Query  387  LVSILSACAHLGSLDIG-KWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYEL  211
             V ILSAC H G +D+G ++    V+   ++   +    ++D+  + G    A+ L   +
Sbjct  466  FVGILSACKHAGLVDLGQQFFSSMVQDYKISPKSQHYGCMIDLLGRAGLFEEAESLLQNM  525

Query  210  PER-DVICWNAMISGFAMNGDGE----NAMRLFREMQNDAGT  100
              + D   W +++     +G  E     A RLF    ++ G 
Sbjct  526  EVKPDGAIWGSLLGACRDHGRVELGELVAERLFELEPDNPGA  567



>ref|XP_009773356.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 
[Nicotiana sylvestris]
Length=737

 Score =   253 bits (646),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/331 (39%), Positives = 190/331 (57%), Gaps = 1/331 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H Q I  GL N  FALS+L+ FC+     + +Y   I+   + P   + N +I+ + L
Sbjct  49    KVHAQFIKFGLHNTQFALSKLVEFCAVNPHTDLSYALSIFNTTENPNHVMFNMIIRGYSL  108

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 +  +E Y+ +L +G  P++YT P++ K+C  +    +G+ IHG   K G + D YV
Sbjct  109   SENPNLAIEFYEKLLFSGNQPNSYTFPFVFKSCAKIMDTQIGKMIHGHVFKLGLMTDVYV  168

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
               SLI MY+   +++ A+ VFD+   R  V++T LI+ Y+ KG V +AR +FDE PV+D 
Sbjct  169   HASLINMYAQNGELDDARLVFDKSSERDAVSFTALINGYALKGRVDDARKLFDEMPVRDV  228

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MISGY Q   F+E L LF  M+   V    + L+S+LSACA  G L +G  V  +
Sbjct  229   VSWNAMISGYTQMGRFEEALMLFEEMRNVNVTPSVSTLLSVLSACARAGELKLGSRVRSW  288

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             +E  G+  N+RL  AL+DMYAKCG L  A+ LF  L E+D++ WN MI G+   G+   A
Sbjct  289   IEDHGLGSNIRLVNALIDMYAKCGNLDSARDLFEGLEEKDLVSWNVMIGGYTHTGNYREA  348

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
             + +F  MQ  A   P+ VT +S+  AC   G
Sbjct  349   LAVFHRMQQ-ANMAPNDVTLLSVLPACGHLG  378


 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 140/307 (46%), Gaps = 39/307 (13%)
 Frame = -2

Query  1011  GLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTME  832
             GLG+N   ++ L+   +    GN      ++E +++  +   N MI  +   G     + 
Sbjct  293   GLGSNIRLVNALIDMYA--KCGNLDSARDLFEGLEEKDLVSWNVMIGGYTHTGNYREALA  350

Query  831   MYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLK-FGFLMDSYVGNSLIVMY  655
             ++  M +  M P++ TL  +L ACG++ S +LG+ IH    K +  L ++ +  +LI MY
Sbjct  351   VFHRMQQANMAPNDVTLLSVLPACGHLGSLDLGKWIHAYINKHYQHLQNTSLWTTLINMY  410

Query  654   SSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMIS  475
             +    + +A+ VF  M ++ + ++ V+I   +  GD +EA                    
Sbjct  411   AKCGAITAAKQVFQGMKTKTLASYNVMILGLAMHGDAYEA--------------------  450

Query  474   GYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK-WVHRYVEKLGMA  298
                        L+LFR M   G++ D+   VSIL+AC+H G +D+G+ + +  ++     
Sbjct  451   -----------LELFRKMTEEGMKPDDITFVSILTACSHAGLVDLGQEYFNTMIQSYNYT  499

Query  297   INVRLGTALVDMYAKCGCLGLAQKLFYELPER-DVICWNAMISGFAMNGD---GENAMRL  130
               ++    ++D+  + G    A  +   +  + D   W +++    ++ +   GE A + 
Sbjct  500   PKLQHYGCMIDLLGRAGKFDEAMAMIERMDVKPDGAIWGSLLGACRIHKNLELGEYAAKN  559

Query  129   FREMQND  109
               E++ D
Sbjct  560   LFELEPD  566



>ref|XP_008229311.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305 
[Prunus mume]
Length=543

 Score =   249 bits (635),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/347 (37%), Positives = 202/347 (58%), Gaps = 3/347 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  ++TCGL       S++L+F +  +LGN  Y +R+  ++  PTI   NT+I+ +  
Sbjct  33    QMHALLLTCGLSQEQSLTSKILSFSALSDLGNIDYSYRVLSQLPNPTIFYWNTVIRGYSK  92

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 +R++ ++  ML+ G+ PD  T P+L KA   +    LG ++H    K GF  D ++
Sbjct  93    SKNPNRSISVFVKMLRDGVSPDYLTYPFLAKASARLLKRELGVAVHAHIAKNGFEFDRFI  152

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSLI MY++  D+  A+ VFD +  +  V+W  ++  Y++ GDV  AR VFD  P +D 
Sbjct  153   SNSLIHMYAACGDITYARKVFDGIFVKNSVSWNSMLDGYAKCGDVISAREVFDLMPKRDV  212

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W S+I GYV+   ++E L +F  M++ G +A+E  +VS+L AC HLG+L+ GK +HRY
Sbjct  213   VSWSSLIDGYVKAGDYREALVVFERMRVVGPKANEVTMVSVLCACTHLGALEEGKVMHRY  272

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFY--ELPERDVICWNAMISGFAMNGDGE  145
             +    + + + L T+LVDMYAKCG +  A  +F    L   DV+ WNAMI G A++G  +
Sbjct  273   MVDNKLPLTLVLQTSLVDMYAKCGAIEDALGVFRGGSLHRSDVLIWNAMIGGLAIHGLVQ  332

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
              A+  F EMQ   G  PD +T++ L +AC+  G+  E     E +G+
Sbjct  333   QALEFFSEMQI-IGIVPDEITYLCLLSACAHGGLVKEAWHFFECLGK  378


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 54/266 (20%), Positives = 109/266 (41%), Gaps = 30/266 (11%)
 Frame = -2

Query  948  GNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLL  769
            G+      +++ + +  +   +++I  ++  G+    + +++ M   G   +  T+  +L
Sbjct  195  GDVISAREVFDLMPKRDVVSWSSLIDGYVKAGDYREALVVFERMRVVGPKANEVTMVSVL  254

Query  768  KACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVV  589
             AC ++ +   G+ +H   +     +   +  SL+ MY+    +E A  VF         
Sbjct  255  CACTHLGALEEGKVMHRYMVDNKLPLTLVLQTSLVDMYAKCGAIEDALGVF---------  305

Query  588  AWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTG  409
                      R G +  +          D  +W +MI G   +   ++ L+ F  MQ+ G
Sbjct  306  ----------RGGSLHRS----------DVLIWNAMIGGLAIHGLVQQALEFFSEMQIIG  345

Query  408  VQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQ  229
            +  DE   + +LSACAH G +         + K GM         +VD+ A+ G +  A 
Sbjct  346  IVPDEITYLCLLSACAHGGLVKEAWHFFECLGKHGMKPKCEHYACMVDVLARGGQVTEAH  405

Query  228  KLFYELP-ERDVICWNAMISGFAMNG  154
            +   ++P E       A++SG   +G
Sbjct  406  QFICQMPREPTASMLGALLSGCVNHG  431



>ref|XP_003568364.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Brachypodium distachyon]
Length=554

 Score =   249 bits (635),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/350 (35%), Positives = 204/350 (58%), Gaps = 9/350 (3%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H   +   L  +++  ++++  C+    G   +  R++ ++++P + + N MIKA+  
Sbjct  31    RVHAHAVRLSLSQSSYLATQIVHLCNAH--GRVAHATRVFSQVREPNLHLHNAMIKAYAQ  88

Query  858   KGELSRTMEMYKHMLKTGMCP-------DNYTLPYLLKACGNMESCNLGRSIHGQCLKFG  700
                    + +Y  ML+    P       D +T P+LLKACG + + +LG+ +HG  ++ G
Sbjct  89    NHRHLDAITVYIRMLRRRPFPWISCTGGDRFTYPFLLKACGGLMALDLGKQVHGHVVRSG  148

Query  699   FLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFD  520
                ++ V NSLI MY+   D+  A+ VFD M  R VV+W  +IS ++R G + +AR VF+
Sbjct  149   CESNAIVQNSLIEMYTRAGDLVLARKVFDGMQERDVVSWNTVISAHARLGQMRKARAVFN  208

Query  519   ETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDI  340
               P K    W +++SGY     F   ++ FRLMQM G + D+  +V++L ACA LG+L++
Sbjct  209   SMPDKTVVSWTALVSGYTAAGDFSGAVEAFRLMQMEGFEPDDVSIVAVLPACAQLGALEL  268

Query  339   GKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAM  160
             G+W++ Y  +  M     +  ALV+MYAKCGC+  A +LF  + E+DVI W+ M+ G A 
Sbjct  269   GRWIYAYCNRHQMLRETYVCNALVEMYAKCGCIDQALQLFNGMAEKDVISWSTMVGGLAA  328

Query  159   NGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             +G  + A++LF EM+     +P+G+TFV L +ACS +G+  EGL   +++
Sbjct  329   HGRAQEAVQLFTEMERQGTVKPNGITFVGLLSACSHAGLLDEGLDYFDRM  378



>ref|XP_010525501.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic [Tarenaya hassleriana]
 ref|XP_010525509.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic [Tarenaya hassleriana]
Length=547

 Score =   248 bits (634),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/341 (38%), Positives = 201/341 (59%), Gaps = 2/341 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  +I  G   +T A SR+LAFC+ P++G+  Y + ++ RI      + NT+I+ F  
Sbjct  47    QVHANLIKTGSIADTVAASRVLAFCASPHVGDMNYAYLVFTRISDKNPFVWNTIIRGFSR  106

Query  858   KGELSRTMEMYKHMLK-TGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
                  R +  +  ML  + + P   T P + KAC ++     G+ +HG+ +K G   D +
Sbjct  107   SSSPERAISKFLDMLSCSTVQPQKLTYPSVFKACASLGHARDGKQLHGRVIKEGLDTDPF  166

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKD  502
             + N+++ MY+S   +E A   F  M    VVAW  +I   ++ G + +++ +FDE P ++
Sbjct  167   IRNTMLHMYASCGYLEEAWRFFLGMTEFDVVAWNSMIMGLAKHGRIGQSKKLFDEMPQRN  226

Query  501   RRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
                W SMISGYV+N  F   L+LFR MQ+ G++ DE  +VS+L+ACA LG+   GKW+H 
Sbjct  227   GVSWNSMISGYVRNGRFMAALELFREMQVKGIKPDEFTMVSLLNACACLGASKQGKWIHD  286

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             Y+ + G+ +N  + TALVDMY K GC+    ++F   P + + CWN+MI G A NG  E 
Sbjct  287   YLVRNGIELNSIVITALVDMYCKSGCIEEGFQVFRNAPNKQLSCWNSMILGLANNGFEEK  346

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLL  19
             A+ LF E+++ +G +PD V+FV + TAC+ SGM H+  + L
Sbjct  347   ALDLFMELEH-SGFQPDSVSFVCVLTACAHSGMVHKADEFL  386



>ref|XP_010266378.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Nelumbo nucifera]
Length=651

 Score =   251 bits (641),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 129/338 (38%), Positives = 200/338 (59%), Gaps = 4/338 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  ++  GL  N   +  LL+  +     +  Y   I+ RI  P I   N MI+  L 
Sbjct  62    QVHAHIVAAGLAGNHTIMGHLLSALALSPSTSSDYPCEIFRRIGNPNIFAANNMIRC-LA  120

Query  858   KGELSR-TMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSY  682
             KG+L R ++ +Y  M+++ + P+NYT P++L+AC    +   G  IH   +K GF  D Y
Sbjct  121   KGKLPRDSLLLYADMMRSNLLPNNYTFPFVLQACSKALAIAEGTQIHAHVVKLGFTEDIY  180

Query  681   VGNSLIVMYSSLDDMESAQCVFDEMPSRC-VVAWTVLISRYSRKGDVFEARLVFDETPVK  505
             + N+LI  YS+    ES++ VFDE P  C +V W  +++ ++R G +  A  +F E P +
Sbjct  181   IRNALIHFYSACHKTESSRQVFDENPQCCDLVTWNAILATHARGGQIDIAEKLFGEMPDR  240

Query  504   DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVH  325
             D   W +MI GYVQ    ++GL+ FR M+  G+  +EAILV++LSA A LG L+ G+ +H
Sbjct  241   DVISWSTMIVGYVQGGYLEKGLECFREMREKGLFPNEAILVTVLSASAQLGLLEHGQLIH  300

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGE  145
               +E L   ++V L TAL+DMYAKCGC+  ++++F ++P+RDV  WN MI G A +G G 
Sbjct  301   STIESLNFPMSVSLSTALIDMYAKCGCIEQSRQIFSKMPQRDVWTWNVMICGLASHGLGN  360

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG  31
              A+ +F  ++ + G +P  VTFV +  ACS +G+  +G
Sbjct  361   EALAMFENLRGE-GLQPVNVTFVGVLNACSRAGLVDKG  397


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/246 (23%), Positives = 104/246 (42%), Gaps = 33/246 (13%)
 Frame = -2

Query  885  NTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLK  706
            +TMI  ++  G L + +E ++ M + G+ P+   L  +L A   +     G+ IH     
Sbjct  246  STMIVGYVQGGYLEKGLECFREMREKGLFPNEAILVTVLSASAQLGLLEHGQLIHSTIES  305

Query  705  FGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLV  526
              F M   +  +LI MY        A+C                       G + ++R +
Sbjct  306  LNFPMSVSLSTALIDMY--------AKC-----------------------GCIEQSRQI  334

Query  525  FDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSL  346
            F + P +D   W  MI G   +    E L +F  ++  G+Q      V +L+AC+  G +
Sbjct  335  FSKMPQRDVWTWNVMICGLASHGLGNEALAMFENLRGEGLQPVNVTFVGVLNACSRAGLV  394

Query  345  DIGKWVHRYV-EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP-ERDVICWNAMIS  172
            D GK   R + E  G+   +     +VD+  + G +  A +L  ++  + D + W  +++
Sbjct  395  DKGKHYFRLMTEDYGITPEMEHYGCMVDLLGRAGYVADALELIEKMTIQPDPVLWGTLLA  454

Query  171  GFAMNG  154
               ++G
Sbjct  455  ACKIHG  460



>ref|XP_010095259.1| hypothetical protein L484_014600 [Morus notabilis]
 gb|EXB59105.1| hypothetical protein L484_014600 [Morus notabilis]
Length=592

 Score =   249 bits (637),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 128/343 (37%), Positives = 198/343 (58%), Gaps = 1/343 (0%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q+   GL ++    S+LL+FC  PN GN  Y   I++R  +P   + NTMIK +  
Sbjct  6     QIHAQMFKRGLVSDVIPASKLLSFCVLPNSGNLAYARMIFDRFSKPNTFMWNTMIKGYAN  65

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               E    + +Y  M+   +  +NYT P LLKAC  + +    + IH   +K GF  + Y 
Sbjct  66    SNEPEEALHLYHQMVCHSVPHNNYTFPSLLKACSCLSALKETQQIHACIIKMGFSSEVYA  125

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSL+ +Y+  D   SA  +F+ +P R +V+   +I+ Y++ G++ +A  +F   P ++ 
Sbjct  126   INSLLHVYAVTDSFHSANLLFNRIPERDIVSTNSMINAYAKCGEMGKANALFRNMPERNV  185

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W +MI G+V     KE L LF  MQ+ GV+ D   L S LSACA LG+LD G W+H Y
Sbjct  186   ISWTTMIYGFVNAGLDKEALYLFHEMQVAGVKPDSVTLASTLSACACLGALDQGSWIHSY  245

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENA  139
             + +  + I+  LG  L+DMYAKCG +  A K+F  L ++DV  W A+I+GFA+ G G  A
Sbjct  246   IGRNQIHIDPILGCVLIDMYAKCGNMEQALKVFGNLKKKDVSTWTAIIAGFAIYGRGRKA  305

Query  138   MRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
             +  F++MQ+    +P+ +TF ++ TACS +G+ +EG  L + +
Sbjct  306   LDWFKQMQSQ-NVKPNLITFTAILTACSYAGLVNEGKSLFQSM  347


 Score =   113 bits (283),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 75/237 (32%), Positives = 113/237 (48%), Gaps = 36/237 (15%)
 Frame = -2

Query  621  VFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEG  442
            V D +P+  ++++ VL       G++  AR++FD     +  +W +MI GY  +N  +E 
Sbjct  17   VSDVIPASKLLSFCVL----PNSGNLAYARMIFDRFSKPNTFMWNTMIKGYANSNEPEEA  72

Query  441  LQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGM-----AINVRLGT  277
            L L+  M    V  +     S+L AC+ L +L   + +H  + K+G      AIN  L  
Sbjct  73   LHLYHQMVCHSVPHNNYTFPSLLKACSCLSALKETQQIHACIIKMGFSSEVYAINSLLHV  132

Query  276  --------------------------ALVDMYAKCGCLGLAQKLFYELPERDVICWNAMI  175
                                      ++++ YAKCG +G A  LF  +PER+VI W  MI
Sbjct  133  YAVTDSFHSANLLFNRIPERDIVSTNSMINAYAKCGEMGKANALFRNMPERNVISWTTMI  192

Query  174  SGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
             GF   G  + A+ LF EMQ  AG +PD VT  S  +AC+C G   +G  +   IGR
Sbjct  193  YGFVNAGLDKEALYLFHEMQ-VAGVKPDSVTLASTLSACACLGALDQGSWIHSYIGR  248



>ref|XP_008220011.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Prunus mume]
Length=544

 Score =   248 bits (633),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/348 (36%), Positives = 204/348 (59%), Gaps = 8/348 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H Q++   L  + F +++++  C   N GN  Y   +++++ +P + + N MI+A+  
Sbjct  32    KIHAQIVKFSLSQSNFLVTKMVDVCD--NSGNLGYASLLFKQVLEPNVFLFNAMIRAYTH  89

Query  858   KGELSRTMEMYKHMLKTGMC-----PDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFL  694
                    + +YK M +         PD +T P+++K+C  +    LG  IH Q  KFG  
Sbjct  90    HQMYDLAVTLYKQMPRHSQAENPIFPDKFTFPFVIKSCAGLFCEGLGTQIHAQICKFGPK  149

Query  693   MDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDET  514
                 + N+L+ +Y+  +++  A  VFD M    VV+W  L+S Y+R G + +AR VF+E 
Sbjct  150   SHLLIENALLDLYTKCENLTDAHKVFDGMTEMDVVSWNSLLSGYARLGQMRKARGVFEEI  209

Query  513   PVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGK  334
             P K    W +MISGY +  C+ E L +FR MQ+ G++ADE  +VS+L ACA LG+L++GK
Sbjct  210   PNKTIVSWTTMISGYTRIGCYAEALDIFRQMQVLGIEADEISIVSVLPACAQLGALEVGK  269

Query  333   WVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNG  154
             W+H Y +K  +  +  +  AL++MY KCGC+  A  LF ++ ERDVI W+ MI+G A  G
Sbjct  270   WIHIYSDKKRLLQSTCVCNALIEMYVKCGCIDQAWHLFDKMLERDVISWSTMIAGLANYG  329

Query  153   DGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKI  10
                 A+ LF+ M   A  +P+G+TF+ L +AC+ +G+ +EG+K  + +
Sbjct  330   KAREAIELFQGMLR-AKVKPNGITFLGLLSACTHAGLWNEGVKYFDSM  376


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/269 (22%), Positives = 112/269 (42%), Gaps = 44/269 (16%)
 Frame = -2

Query  795  DNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVF  616
            +++ +P LL  C N       + IH Q +KF     +++                     
Sbjct  14   EDFFVPTLLN-CKNTSGL---KKIHAQIVKFSLSQSNFLV--------------------  49

Query  615  DEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQ  436
                       T ++      G++  A L+F +    +  ++ +MI  Y  +  +   + 
Sbjct  50   -----------TKMVDVCDNSGNLGYASLLFKQVLEPNVFLFNAMIRAYTHHQMYDLAVT  98

Query  435  LFRLMQMTGVQADEAILVS------ILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTA  274
            L++ M     QA+  I         ++ +CA L    +G  +H  + K G   ++ +  A
Sbjct  99   LYKQMPRHS-QAENPIFPDKFTFPFVIKSCAGLFCEGLGTQIHAQICKFGPKSHLLIENA  157

Query  273  LVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRP  94
            L+D+Y KC  L  A K+F  + E DV+ WN+++SG+A  G    A  +F E+ N   T  
Sbjct  158  LLDLYTKCENLTDAHKVFDGMTEMDVVSWNSLLSGYARLGQMRKARGVFEEIPNK--TIV  215

Query  93   DGVTFVSLFTACSCSGMAHEGLKLLEKIG  7
               T +S +T   C   A +  + ++ +G
Sbjct  216  SWTTMISGYTRIGCYAEALDIFRQMQVLG  244



>ref|XP_007043264.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
 gb|EOX99095.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
Length=530

 Score =   248 bits (632),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/347 (37%), Positives = 208/347 (60%), Gaps = 3/347 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H  VIT GL ++    ++LL+F +  + GN  Y +R++ R+  P +   N++I+ +  
Sbjct  20    QIHALVITFGLSHHDPISTKLLSFAAFSDTGNVDYAYRVFSRLPTPRVFNWNSIIRGYSN  79

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 ++++  + +ML+ G+ PD+ T P+L+K    +    LG +IH   LK GF +D ++
Sbjct  80    SKNPNKSISAFINMLRAGVFPDHLTYPFLVKTSARLLKPELGGAIHCHALKNGFELDKFI  139

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NSLI MY+S  D+  A+ VFDE+P + +V+W  ++  Y++ GD+  AR VFD  P +D 
Sbjct  140   NNSLIHMYASCHDIVYARRVFDELPMKNIVSWNAMLDGYAKCGDMALARQVFDWMPQRDV  199

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRY  319
               W  +I GY ++  +KE L +F  M++ G +A+E  +VS+L ACAHLG+L +G+ +H Y
Sbjct  200   VSWSCLIDGYAKSGDYKEALAVFEGMRVWGPKANEVTMVSVLCACAHLGALHLGRLMHCY  259

Query  318   VEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP--ERDVICWNAMISGFAMNGDGE  145
             V   G+ + + L T+LVDMYAKCG +  A  +F  +   + DV+ WNAMI G A +G  +
Sbjct  260   VMDNGLPMTLVLRTSLVDMYAKCGAIEEALDVFRGVSNCKSDVLLWNAMIGGLATHGLVK  319

Query  144   NAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
              ++ LF EMQ   G  PD +T++ L +AC+  G   E     E +G+
Sbjct  320   ESLELFAEMQV-VGIVPDEITYLCLLSACAHGGSVKEAWYFFECLGK  365


 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 75/303 (25%), Positives = 126/303 (42%), Gaps = 38/303 (13%)
 Frame = -2

Query  972  AFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPD  793
            A C D  L    + W     + Q  +   + +I  +   G+    + +++ M   G   +
Sbjct  179  AKCGDMALARQVFDW-----MPQRDVVSWSCLIDGYAKSGDYKEALAVFEGMRVWGPKAN  233

Query  792  NYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFD  613
              T+  +L AC ++ + +LGR +H   +  G  M   +  SL+ MY+    +E A  VF 
Sbjct  234  EVTMVSVLCACAHLGALHLGRLMHCYVMDNGLPMTLVLRTSLVDMYAKCGAIEEALDVFR  293

Query  612  EMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQL  433
             + S C             K DV                +W +MI G   +   KE L+L
Sbjct  294  GV-SNC-------------KSDVL---------------LWNAMIGGLATHGLVKESLEL  324

Query  432  FRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAK  253
            F  MQ+ G+  DE   + +LSACAH GS+    +    + K GM         +VD+ A+
Sbjct  325  FAEMQVVGIVPDEITYLCLLSACAHGGSVKEAWYFFECLGKHGMTPKSEHYACMVDVLAR  384

Query  252  CGCLGLAQKLFYELP-ERDVICWNAMISGFAMNGDGENAM---RLFREMQNDAGTRPDGV  85
             G +  A +   ++P E       A+++G  + G  + A    R   E+  D   R  G+
Sbjct  385  AGQVAEAYQFLCKMPMEPTASLLGALLNGCLIYGKSDLAEIVGRKLIELDPDHDGRYIGL  444

Query  84   TFV  76
            + V
Sbjct  445  SNV  447



>ref|XP_006306854.1| hypothetical protein CARUB_v10008399mg [Capsella rubella]
 gb|EOA39752.1| hypothetical protein CARUB_v10008399mg [Capsella rubella]
Length=740

 Score =   252 bits (644),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/330 (39%), Positives = 193/330 (58%), Gaps = 2/330 (1%)
 Frame = -2

Query  1032  HGQVITCGLGNNTFALSRLLAFCS-DPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLLK  856
             H Q+I  GL N  +ALS+L+ FC   P+    TY   ++E IQ+P + I NTM +   L 
Sbjct  52    HAQMIKTGLHNTNYALSKLIEFCVLSPHFDGLTYAISVFESIQEPNLLIWNTMFRGHALS  111

Query  855   GELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYVG  676
              +    + +Y  M+  G+ P++YT P+LLK+C    +   G+ IHG  LK G  +D YV 
Sbjct  112   SDPVSALYLYVCMISLGLVPNSYTFPFLLKSCAKSRAFREGQQIHGHVLKLGCDLDLYVH  171

Query  675   NSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDRR  496
              SLI MY     +E A+ VFD+   R VV++T LI  Y+  G +  A+ +FDE PVKD  
Sbjct  172   TSLIAMYVKNGRLEDARKVFDQSSHRDVVSYTALIKGYASNGYIESAQKMFDEIPVKDVV  231

Query  495   VWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAHLGSLDIGKWVHRYV  316
              W ++ISGY +   +KE L+LF+ M  T V+ DE+ +V++LSAC    S+++G+ VH ++
Sbjct  232   SWNALISGYAETGNYKEALELFKEMMQTNVKPDESTMVTVLSACGQSASIELGRQVHSWI  291

Query  315   EKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGENAM  136
             +  G   N+++  AL+D+Y KCG +  A  LF  L  +DVI WN +I G+      + A+
Sbjct  292   DDHGFGSNLKIVNALIDLYIKCGEVETASGLFEGLSYKDVISWNTLIGGYTHMNLYKEAL  351

Query  135   RLFREMQNDAGTRPDGVTFVSLFTACSCSG  46
              LF+EM    G  P+ VT +S+  AC+  G
Sbjct  352   LLFQEMLR-LGEIPNEVTMLSILPACAHLG  380


 Score =   180 bits (456),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 154/297 (52%), Gaps = 34/297 (11%)
 Frame = -2

Query  927  RIYERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNME  748
            ++++ I    +   N +I  +   G     +E++K M++T + PD  T+  +L ACG   
Sbjct  220  KMFDEIPVKDVVSWNALISGYAETGNYKEALELFKEMMQTNVKPDESTMVTVLSACGQSA  279

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            S  LGR +H      GF  +  + N+LI +Y    ++E+A  +F+ +             
Sbjct  280  SIELGRQVHSWIDDHGFGSNLKIVNALIDLYIKCGEVETASGLFEGLS------------  327

Query  567  RYSRKGDVFEARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAI  388
                                KD   W ++I GY   N +KE L LF+ M   G   +E  
Sbjct  328  -------------------YKDVISWNTLIGGYTHMNLYKEALLLFQEMLRLGEIPNEVT  368

Query  387  LVSILSACAHLGSLDIGKWVHRYVEKL--GMAINVRLGTALVDMYAKCGCLGLAQKLFYE  214
            ++SIL ACAHLG++DIG+W+H Y++K   G++    L T+L+DMYAKCG +  AQ++F  
Sbjct  369  MLSILPACAHLGAIDIGRWIHVYIDKRLKGVSNPSSLRTSLIDMYAKCGDIEAAQQVFDS  428

Query  213  LPERDVICWNAMISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGM  43
            +  R +  WNAMI GFAM+G    A  +F  M  + G  PD +TFV L +ACS SGM
Sbjct  429  MLNRSLSSWNAMIFGFAMHGRANAAFDIFSRMGKN-GIEPDDITFVGLLSACSHSGM  484



>ref|XP_009383039.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305 
[Musa acuminata subsp. malaccensis]
Length=542

 Score =   248 bits (632),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 133/351 (38%), Positives = 213/351 (61%), Gaps = 8/351 (2%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             Q H Q  T GL N+ F LS+LL F +  + G+  Y +R+++ + +P+    N +I+ F  
Sbjct  36    QIHAQFTTSGLSNDDFLLSKLLLFSAVSDAGDVDYSYRLFQTLPRPSAFSYNALIRGFSK  95

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
                 +R++ +Y  ML+  + PD+ T P+L K+C  + S  L  S+H    K G   D +V
Sbjct  96    SKSPNRSLSLYVRMLRADVPPDHLTFPFLAKSCARLSSITLAASVHCHAAKHGLESDRFV  155

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              NS+I MY+S  D+ SA  VFD M    VV+W  L+  Y++ GD+  AR  FD  P +D 
Sbjct  156   SNSMIHMYASCGDVASACRVFDGMSHPNVVSWNSLVDGYAKCGDLAAAREAFDRMPERDV  215

Query  498   RVWGSMISGYVQNNCFKEGLQLFRLMQMTGV--QADEAILVSILSACAHLGSLDIGKWVH  325
               W +MI GYV+   ++E L LF +M+      +A+E  +VS+L ACAHLG+LD G+ +H
Sbjct  216   VSWSAMIDGYVKGGEYREALMLFDMMRAHPARPRANEVTMVSVLGACAHLGALDRGRVMH  275

Query  324   RYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELP--ERDVICWNAMISGFAMNGD  151
              Y+++ G+ +++ L T+LVDMYAKCG +  A  +F ++P  + DV+ WNA I G AM+G 
Sbjct  276   AYLKEKGLRLSLALATSLVDMYAKCGSIHEALGVFRDVPVEQTDVLIWNATIGGLAMHGL  335

Query  150   GENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEG---LKLLEKIG  7
             G+ ++++F EM++ AG  PD +T+++L +AC+  G+  +     + LE+ G
Sbjct  336   GKESVQMFEEMRS-AGVAPDEITYLALLSACAHGGLVEDARGFFRSLEEPG  385


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 125/290 (43%), Gaps = 39/290 (13%)
 Frame = -2

Query  921  YERIQQPTICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCP--DNYTLPYLLKACGNME  748
            ++R+ +  +   + MI  ++  GE    + ++  M      P  +  T+  +L AC ++ 
Sbjct  207  FDRMPERDVVSWSAMIDGYVKGGEYREALMLFDMMRAHPARPRANEVTMVSVLGACAHLG  266

Query  747  SCNLGRSIHGQCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLIS  568
            + + GR +H    + G  +   +  SL+ MY        A+C                  
Sbjct  267  ALDRGRVMHAYLKEKGLRLSLALATSLVDMY--------AKC------------------  300

Query  567  RYSRKGDVFEARLVFDETPVK--DRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADE  394
                 G + EA  VF + PV+  D  +W + I G   +   KE +Q+F  M+  GV  DE
Sbjct  301  -----GSIHEALGVFRDVPVEQTDVLIWNATIGGLAMHGLGKESVQMFEEMRSAGVAPDE  355

Query  393  AILVSILSACAHLGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYE  214
               +++LSACAH G ++  +   R +E+ GM  ++     +VD+  + G +  A      
Sbjct  356  ITYLALLSACAHGGLVEDARGFFRSLEEPGMTPHIEHYACMVDVLCRAGEVREAYGFVRT  415

Query  213  LP-ERDVICWNAMISGFAMNG---DGENAMRLFREMQNDAGTRPDGVTFV  76
            +P E       A++SG   +G    GE   +   EM+ D   R  G++ V
Sbjct  416  MPVEPSASVLGALLSGCRTHGWVELGEAVGKRLIEMEPDHDGRYIGLSNV  465



>ref|XP_009336183.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Pyrus x bretschneideri]
 ref|XP_009336184.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Pyrus x bretschneideri]
Length=530

 Score =   247 bits (631),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 133/346 (38%), Positives = 204/346 (59%), Gaps = 5/346 (1%)
 Frame = -2

Query  1038  QAHGQVITCGLGNNTFALSRLLAFCSDPNLGNPTYGWRIYERIQQPTICIVNTMIKAFLL  859
             + H   +T GL    +  S+LLAF +    GN  Y   +  +I +P +   N+MI  FL 
Sbjct  30    KIHAHAVTTGLARFAYTASKLLAFSALSEHGNMHYAETLLHQIPRPNVFDYNSMIMGFLK  89

Query  858   KGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHGQCLKFGFLMDSYV  679
               E  + + +Y  M + G  P+  T  +++KAC  ++   LG+ +HG+ +KFG   D YV
Sbjct  90    SSESEKGLSIYTRMRRIGTEPNARTFTFVVKAC--LDVSLLGQ-VHGEIMKFGHGCDVYV  146

Query  678   GNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFEARLVFDETPVKDR  499
              +SLI      + +E A+ VF+E   + VV WT LIS Y   G V EAR +F+  P  + 
Sbjct  147   ISSLIRASCRCEAVEFARRVFEESLDKNVVCWTSLISGYCSNGLVHEARDLFEAMPDIND  206

Query  498   RVWGSMISGYVQNNCFKEGLQLFR-LMQMTGVQADEAILVSILSACAHLGSLDIGKWVHR  322
               + +M+SGYV N CF E + LFR L   T V+ +E++LVS L+ACA +G+ + GKW+H 
Sbjct  207   VSYSAMVSGYVGNACFNEAIDLFRQLKSHTQVRLNESLLVSTLNACASVGAFEEGKWIHS  266

Query  321   YVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAMISGFAMNGDGEN  142
             ++E+ G    + LGTALVD YAKCG +  AQ +F  +P +DV  W+AMI GFA+NG+ + 
Sbjct  267   FLEENGFEYGLELGTALVDFYAKCGFIKDAQDVFSRMPRKDVTTWSAMIMGFAINGENDM  326

Query  141   AMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLLEKIGR  4
              + LF EM+   G +P+ VTFV + TAC+   + +E  +L+ ++ +
Sbjct  327   GLELFAEMEKK-GPKPNAVTFVGVLTACNHKILVNEAWRLIGRMSK  371



>ref|XP_009604837.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800 
[Nicotiana tomentosiformis]
Length=539

 Score =   247 bits (631),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 134/353 (38%), Positives = 208/353 (59%), Gaps = 14/353 (4%)
 Frame = -2

Query  1038  QAHGQVITCGL---GNNTFALSRLL-AFCS-------DPNLGN--PTYGWRIYERIQQPT  898
             Q H Q IT G     ++T  L+++L +F S        PN  +    Y   I+ RI+ P+
Sbjct  28    QVHAQAITNGHLSSFHSTLILTQILHSFTSLLSSLPLQPNTHHYATRYFTSIFSRIENPS  87

Query  897   ICIVNTMIKAFLLKGELSRTMEMYKHMLKTGMCPDNYTLPYLLKACGNMESCNLGRSIHG  718
                 NT+I+A  L    + +   +  M +  + PD++T P++LKAC  + S +LG+++H 
Sbjct  88    TFCYNTIIRAHTLLFSPNTSFLYFLKMHRNSVPPDSHTFPFVLKACALLNSLSLGKTLHS  147

Query  717   QCLKFGFLMDSYVGNSLIVMYSSLDDMESAQCVFDEMPSRCVVAWTVLISRYSRKGDVFE  538
             Q LKFGFL D +V N+L+ +Y+   +   A  VFDE   R VV + ++I  Y + G++ +
Sbjct  148   QALKFGFLADVFVCNNLVRVYTVSGNTSDAHKVFDESCCRDVVTYNLIIDGYVKAGEMDK  207

Query  537   ARLVFDETPVKDRRVWGSMISGYVQNNCFKEGLQLFRLMQMTGVQADEAILVSILSACAH  358
             AR+VFDE P +D   WG++++GY + N  KE ++LF  M    V+ D   LVS+LSACA 
Sbjct  208   ARVVFDEMPERDAVSWGTLLAGYAKLNQCKEAIELFDQMVSLNVKFDNVALVSVLSACAQ  267

Query  357   LGSLDIGKWVHRYVEKLGMAINVRLGTALVDMYAKCGCLGLAQKLFYELPERDVICWNAM  178
             LG L+ GK +H Y++K G+ I+  L T LVD+YAKCGC+ +A+++F    E+ +  WNAM
Sbjct  268   LGELEKGKTIHDYIKKKGIHIDSYLCTGLVDLYAKCGCIEIAREIFETSWEKKMFTWNAM  327

Query  177   ISGFAMNGDGENAMRLFREMQNDAGTRPDGVTFVSLFTACSCSGMAHEGLKLL  19
             + G AM+G G+     F  M  + G RPDGVTF++L   C+ +G+  E  +  
Sbjct  328   LVGLAMHGHGQLLFDYFSRMV-EGGVRPDGVTFLALLVGCNHAGLVQEARRFF  379



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2641654646496