BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19618_g1_i2 len=1384 path=[307:0-325 250:326-451 758:452-959
1265:960-1383]

Length=1384
                                                                      Score     E

ref|XP_009762861.1|  PREDICTED: uncharacterized protein LOC104214...    528   0.0      
ref|XP_009600851.1|  PREDICTED: uncharacterized protein LOC104096...    526   0.0      
ref|XP_006350447.1|  PREDICTED: uncharacterized transporter YBR28...    503   1e-172   
ref|XP_004231634.1|  PREDICTED: uncharacterized protein LOC101264385    500   1e-171   
emb|CDP01746.1|  unnamed protein product                                476   8e-162   
ref|XP_010052720.1|  PREDICTED: uncharacterized transporter YBR28...    425   7e-142   
gb|KDO70033.1|  hypothetical protein CISIN_1g014841mg                   422   2e-140   
ref|XP_006437709.1|  hypothetical protein CICLE_v10031658mg             421   3e-140   
ref|XP_011004415.1|  PREDICTED: uncharacterized transporter YBR28...    420   6e-140   
ref|XP_011030712.1|  PREDICTED: uncharacterized transporter YBR28...    417   5e-139   
gb|KDO70034.1|  hypothetical protein CISIN_1g014841mg                   415   6e-138   
ref|XP_002528527.1|  auxin:hydrogen symporter, putative                 413   2e-137   Ricinus communis
ref|XP_006377867.1|  hypothetical protein POPTR_0011s14860g             410   2e-136   
gb|ABK92888.1|  unknown                                                 408   2e-135   Populus trichocarpa [western balsam poplar]
ref|XP_007010159.1|  Auxin efflux carrier family protein                407   3e-135   
ref|XP_010649328.1|  PREDICTED: uncharacterized protein LOC100249...    408   4e-135   
ref|XP_006370750.1|  hypothetical protein POPTR_0001s46060g             406   9e-135   
ref|XP_011038089.1|  PREDICTED: uncharacterized transporter YBR28...    406   1e-134   
ref|XP_002317029.1|  hypothetical protein POPTR_0011s14860g             405   2e-134   Populus trichocarpa [western balsam poplar]
ref|XP_006370747.1|  hypothetical protein POPTR_0001s46060g             406   2e-134   
ref|XP_011038091.1|  PREDICTED: uncharacterized transporter YBR28...    405   2e-134   
ref|XP_002526514.1|  auxin:hydrogen symporter, putative                 406   4e-134   Ricinus communis
gb|KHG24872.1|  putative transporter C5D6.04                            402   5e-133   
ref|XP_007010173.1|  Auxin efflux carrier family protein                402   7e-133   
ref|XP_007010160.1|  Auxin efflux carrier family protein isoform 1      398   2e-131   
ref|XP_007010169.1|  Auxin efflux carrier family protein                399   2e-131   
emb|CDP01747.1|  unnamed protein product                                397   3e-131   
ref|XP_009772486.1|  PREDICTED: uncharacterized transporter YBR28...    397   4e-131   
ref|XP_002264606.1|  PREDICTED: uncharacterized transporter C5D6....    397   6e-131   Vitis vinifera
ref|XP_007010166.1|  Auxin efflux carrier family protein                392   3e-129   
ref|XP_007046429.1|  Auxin:hydrogen symporter, putative isoform 1       392   9e-129   
ref|XP_009762862.1|  PREDICTED: uncharacterized protein LOC104214...    389   1e-128   
ref|XP_009600852.1|  PREDICTED: uncharacterized protein LOC104096...    388   2e-128   
ref|XP_006343315.1|  PREDICTED: uncharacterized transporter YBR28...    390   2e-128   
ref|XP_004234500.1|  PREDICTED: uncharacterized transporter YBR28...    390   3e-128   
ref|XP_007018644.1|  Auxin efflux carrier family protein, putative      390   8e-128   
ref|XP_009372647.1|  PREDICTED: uncharacterized transporter YBR28...    388   2e-127   
ref|XP_006435464.1|  hypothetical protein CICLE_v10001325mg             387   3e-127   
ref|XP_009798616.1|  PREDICTED: uncharacterized transporter YBR28...    387   5e-127   
ref|XP_009592191.1|  PREDICTED: uncharacterized transporter YBR28...    387   7e-127   
gb|KDO85258.1|  hypothetical protein CISIN_1g015164mg                   385   3e-126   
ref|XP_010033614.1|  PREDICTED: uncharacterized transporter C5D6....    385   3e-126   
ref|XP_006473865.1|  PREDICTED: uncharacterized transporter YBR28...    384   5e-126   
ref|XP_009372645.1|  PREDICTED: uncharacterized transporter YBR28...    384   9e-126   
ref|XP_008373331.1|  PREDICTED: uncharacterized transporter YBR28...    379   5e-124   
ref|XP_006342188.1|  PREDICTED: uncharacterized transporter YBR28...    378   1e-123   
ref|XP_008373350.1|  PREDICTED: uncharacterized transporter YBR28...    377   3e-123   
ref|XP_008364468.1|  PREDICTED: uncharacterized transporter YBR28...    377   3e-123   
ref|XP_004238466.1|  PREDICTED: uncharacterized transporter YBR28...    377   4e-123   
gb|KDP36734.1|  hypothetical protein JCGZ_08025                         375   2e-122   
ref|XP_006416347.1|  hypothetical protein EUTSA_v10009415mg             373   8e-122   
ref|XP_010266292.1|  PREDICTED: uncharacterized transporter YBR28...    373   2e-121   
ref|XP_010029548.1|  PREDICTED: uncharacterized transporter YBR28...    372   3e-121   
gb|KHG24871.1|  Transporter protein                                     371   4e-121   
ref|XP_010680488.1|  PREDICTED: uncharacterized transporter YBR28...    369   3e-120   
ref|XP_003534224.1|  PREDICTED: uncharacterized protein LOC100810...    369   5e-120   
ref|XP_010416572.1|  PREDICTED: uncharacterized transporter YBR28...    368   8e-120   
ref|XP_010094502.1|  Uncharacterized transporter                        369   8e-120   
ref|XP_007010163.1|  Auxin efflux carrier family protein isoform 6      367   2e-119   
gb|AET03524.2|  auxin efflux carrier family protein                     367   2e-119   
ref|XP_004509473.1|  PREDICTED: uncharacterized transporter YBR28...    366   3e-119   
ref|XP_002528528.1|  auxin:hydrogen symporter, putative                 367   3e-119   Ricinus communis
ref|XP_011034783.1|  PREDICTED: uncharacterized transporter YBR28...    366   4e-119   
gb|KHG29772.1|  SPAC5D6.04: Uncharacterized transporter C5D6.04         367   4e-119   
ref|XP_010471806.1|  PREDICTED: uncharacterized transporter YBR28...    365   5e-119   
ref|XP_010428716.1|  PREDICTED: uncharacterized transporter YBR28...    365   9e-119   
ref|XP_003612431.1|  Auxin efflux carrier protein                       365   1e-118   
ref|XP_008237902.1|  PREDICTED: uncharacterized transporter YBR28...    365   2e-118   
ref|XP_006599266.1|  PREDICTED: uncharacterized protein LOC100817...    364   3e-118   
ref|XP_007209188.1|  hypothetical protein PRUPE_ppa006413mg             364   4e-118   
ref|XP_002301894.1|  auxin efflux carrier family protein                363   6e-118   Populus trichocarpa [western balsam poplar]
ref|XP_010029545.1|  PREDICTED: uncharacterized transporter C5D6....    363   1e-117   
ref|XP_007156270.1|  hypothetical protein PHAVU_003G272300g             363   1e-117   
ref|XP_003629048.1|  Transporter, putative                              362   1e-117   
ref|XP_010270580.1|  PREDICTED: uncharacterized transporter C5D6....    362   3e-117   
ref|XP_011038092.1|  PREDICTED: uncharacterized transporter YBR28...    361   6e-117   
ref|XP_008237904.1|  PREDICTED: uncharacterized transporter YBR28...    361   7e-117   
ref|XP_004300092.1|  PREDICTED: uncharacterized transporter YBR28...    361   8e-117   
ref|XP_011099988.1|  PREDICTED: uncharacterized transporter YBR28...    360   2e-116   
gb|ACJ85428.1|  unknown                                                 360   2e-116   Medicago truncatula
ref|XP_004300096.1|  PREDICTED: uncharacterized transporter YBR28...    359   3e-116   
ref|XP_002528529.1|  auxin:hydrogen symporter, putative                 360   3e-116   Ricinus communis
ref|XP_002890416.1|  auxin efflux carrier family protein                358   5e-116   
ref|XP_011100000.1|  PREDICTED: uncharacterized transporter YBR28...    358   8e-116   
ref|XP_007010161.1|  Auxin efflux carrier family protein isoform 2      360   9e-116   
emb|CDP01745.1|  unnamed protein product                                358   1e-115   
ref|XP_010033618.1|  PREDICTED: uncharacterized transporter C5D6....    358   1e-115   
gb|KDP24916.1|  hypothetical protein JCGZ_24294                         358   1e-115   
ref|XP_011099968.1|  PREDICTED: uncharacterized transporter C5D6....    357   2e-115   
ref|XP_007211270.1|  hypothetical protein PRUPE_ppa017924mg             357   5e-115   
ref|NP_683316.2|  auxin efflux carrier-like protein                     358   6e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006370751.1|  hypothetical protein POPTR_0001s46060g             355   6e-115   
ref|XP_011027948.1|  PREDICTED: uncharacterized transporter C5D6....    355   9e-115   
ref|XP_007158042.1|  hypothetical protein PHAVU_002G119300g             355   1e-114   
ref|XP_010932122.1|  PREDICTED: uncharacterized transporter YBR28...    355   1e-114   
emb|CDX87589.1|  BnaA07g32840D                                          354   2e-114   
ref|XP_006432166.1|  hypothetical protein CICLE_v10001450mg             353   2e-114   
gb|KCW56460.1|  hypothetical protein EUGRSUZ_I02196                     352   3e-114   
ref|XP_009106321.1|  PREDICTED: uncharacterized transporter YBR28...    353   3e-114   
ref|XP_006304763.1|  hypothetical protein CARUB_v10012230mg             353   4e-114   
ref|XP_007209181.1|  hypothetical protein PRUPE_ppa006339mg             352   2e-113   
ref|XP_004253114.1|  PREDICTED: uncharacterized transporter C5D6....    352   2e-113   
gb|KGN55542.1|  hypothetical protein Csa_4G664490                       352   3e-113   
ref|XP_006589306.1|  PREDICTED: uncharacterized transporter YBR28...    351   4e-113   
ref|XP_006370746.1|  hypothetical protein POPTR_0001s46050g             351   6e-113   
ref|NP_565133.1|  auxin efflux carrier family protein                   350   6e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010649334.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    350   6e-113   
ref|XP_009390658.1|  PREDICTED: uncharacterized transporter YBR28...    351   7e-113   
ref|XP_002887644.1|  hypothetical protein ARALYDRAFT_895536             349   9e-113   
gb|KEH27639.1|  auxin efflux carrier family protein                     351   1e-112   
ref|XP_010649326.1|  PREDICTED: uncharacterized protein LOC100249...    350   2e-112   
gb|AAM62517.1|  unknown                                                 348   2e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010103231.1|  Uncharacterized transporter                        349   3e-112   
ref|XP_006451737.1|  hypothetical protein CICLE_v10010809mg             349   3e-112   
ref|XP_006485670.1|  PREDICTED: uncharacterized transporter YBR28...    349   4e-112   
ref|XP_008787017.1|  PREDICTED: uncharacterized transporter YBR28...    349   4e-112   
ref|XP_011027947.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    349   5e-112   
ref|XP_008453020.1|  PREDICTED: uncharacterized transporter YBR28...    348   5e-112   
emb|CBI37491.3|  unnamed protein product                                348   5e-112   
ref|NP_001242102.1|  uncharacterized protein LOC100791609               348   7e-112   
emb|CDY29492.1|  BnaA06g14780D                                          347   1e-111   
ref|XP_006590301.1|  PREDICTED: uncharacterized protein LOC100791...    347   2e-111   
ref|XP_002263531.1|  PREDICTED: uncharacterized transporter YBR28...    346   2e-111   Vitis vinifera
ref|XP_010029544.1|  PREDICTED: uncharacterized transporter C5D6....    348   2e-111   
emb|CDY31514.1|  BnaC05g16230D                                          348   3e-111   
ref|XP_003517114.1|  PREDICTED: uncharacterized protein LOC100785...    347   3e-111   
ref|XP_009149573.1|  PREDICTED: uncharacterized transporter YBR287W     345   5e-111   
ref|XP_007134484.1|  hypothetical protein PHAVU_010G051100g             344   5e-110   
ref|XP_010270583.1|  PREDICTED: uncharacterized transporter YBR28...    342   5e-110   
ref|XP_009128182.1|  PREDICTED: uncharacterized transporter YBR28...    341   1e-109   
gb|KHN28298.1|  Putative transporter C5D6.04                            342   2e-109   
ref|XP_006390184.1|  hypothetical protein EUTSA_v10018685mg             341   2e-109   
emb|CDY20402.1|  BnaC02g24140D                                          340   3e-109   
gb|KHN41796.1|  Putative transporter                                    341   5e-109   
ref|XP_010649335.1|  PREDICTED: uncharacterized transporter C5D6....    338   2e-108   
emb|CBI37493.3|  unnamed protein product                                338   3e-108   
emb|CDP01744.1|  unnamed protein product                                338   4e-108   
ref|XP_009104669.1|  PREDICTED: uncharacterized transporter YBR28...    336   2e-107   
ref|XP_010428718.1|  PREDICTED: uncharacterized transporter YBR28...    335   3e-107   
ref|XP_002317634.2|  hypothetical protein POPTR_0011s14870g             334   6e-107   Populus trichocarpa [western balsam poplar]
ref|XP_010679878.1|  PREDICTED: uncharacterized transporter YBR28...    335   7e-107   
ref|XP_010471808.1|  PREDICTED: uncharacterized transporter YBR28...    336   9e-107   
gb|KHG29771.1|  SPAC5D6.04: Uncharacterized transporter C5D6.04         333   4e-106   
emb|CBI37490.3|  unnamed protein product                                335   5e-106   
ref|XP_010679877.1|  PREDICTED: uncharacterized transporter YBR28...    332   7e-106   
ref|XP_010428717.1|  PREDICTED: uncharacterized transporter YBR28...    331   2e-105   
dbj|BAK04863.1|  predicted protein                                      331   3e-105   
ref|XP_010094503.1|  Uncharacterized transporter                        331   3e-105   
gb|KEH17832.1|  auxin efflux carrier family protein                     330   4e-105   
ref|XP_004145562.1|  PREDICTED: uncharacterized protein LOC101208244    330   6e-105   
ref|XP_003520432.1|  PREDICTED: uncharacterized transporter YBR28...    330   1e-104   
gb|KHN44555.1|  Putative transporter C5D6.04                            329   2e-104   
gb|EMT00616.1|  Putative transporter                                    327   7e-104   
ref|XP_010052724.1|  PREDICTED: uncharacterized transporter YBR28...    325   7e-104   
ref|XP_009592390.1|  PREDICTED: uncharacterized transporter YBR28...    326   7e-104   
ref|XP_009366044.1|  PREDICTED: uncharacterized transporter YBR28...    325   2e-103   
gb|EEC84799.1|  hypothetical protein OsI_31863                          327   2e-103   Oryza sativa Indica Group [Indian rice]
gb|KDO85259.1|  hypothetical protein CISIN_1g015164mg                   325   3e-103   
ref|XP_009600925.1|  PREDICTED: uncharacterized transporter C5D6....    324   4e-103   
ref|XP_006437710.1|  hypothetical protein CICLE_v10031658mg             323   4e-103   
gb|KDO70040.1|  hypothetical protein CISIN_1g014841mg                   323   5e-103   
gb|KEH17831.1|  auxin efflux carrier family protein                     325   5e-103   
ref|XP_011004410.1|  PREDICTED: uncharacterized transporter YBR28...    325   6e-103   
gb|EEE69960.1|  hypothetical protein OsJ_29847                          324   1e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007134485.1|  hypothetical protein PHAVU_010G051100g             323   3e-102   
ref|XP_011030710.1|  PREDICTED: uncharacterized transporter YBR28...    323   3e-102   
ref|XP_010649331.1|  PREDICTED: uncharacterized protein LOC100249...    318   2e-101   
ref|XP_003578336.1|  PREDICTED: uncharacterized protein LOC100826810    321   3e-101   
ref|XP_010270584.1|  PREDICTED: uncharacterized protein LOC104606...    319   6e-101   
ref|XP_002462579.1|  hypothetical protein SORBIDRAFT_02g028510          320   6e-101   Sorghum bicolor [broomcorn]
ref|XP_006485673.1|  PREDICTED: uncharacterized transporter YBR28...    317   5e-100   
ref|XP_004515364.1|  PREDICTED: uncharacterized protein LOC101492...    318   6e-100   
ref|XP_004957210.1|  PREDICTED: uncharacterized protein LOC101771023    317   6e-100   
ref|XP_010681116.1|  PREDICTED: uncharacterized transporter C5D6....    316   2e-99    
ref|XP_007134486.1|  hypothetical protein PHAVU_010G051200g             315   2e-99    
tpg|DAA62056.1|  TPA: hypothetical protein ZEAMMB73_195263              314   3e-98    
gb|AFW58767.1|  hypothetical protein ZEAMMB73_122963                    314   3e-98    
ref|XP_008652869.1|  PREDICTED: uncharacterized protein LOC103632939    313   3e-98    
ref|XP_008663364.1|  PREDICTED: uncharacterized protein LOC103641814    313   3e-98    
emb|CDP01772.1|  unnamed protein product                                311   3e-97    
emb|CDX85953.1|  BnaC06g21810D                                          308   4e-97    
ref|XP_007144117.1|  hypothetical protein PHAVU_007G130200g             308   2e-96    
ref|XP_002521739.1|  auxin:hydrogen symporter, putative                 308   2e-96    Ricinus communis
ref|XP_010029570.1|  PREDICTED: uncharacterized protein LOC104419566    308   2e-96    
ref|XP_010681117.1|  PREDICTED: uncharacterized transporter C5D6....    307   2e-96    
ref|XP_010680628.1|  PREDICTED: uncharacterized transporter YBR28...    307   5e-96    
ref|XP_007010168.1|  Auxin efflux carrier family protein, putative      304   6e-95    
ref|XP_011022138.1|  PREDICTED: uncharacterized transporter YBR28...    305   7e-95    
ref|XP_010550503.1|  PREDICTED: uncharacterized transporter YBR28...    303   9e-95    
gb|AES95390.2|  auxin efflux carrier family protein                     302   2e-94    
gb|KCW76787.1|  hypothetical protein EUGRSUZ_D01141                     300   2e-94    
ref|XP_006435463.1|  hypothetical protein CICLE_v10001325mg             299   6e-94    
ref|XP_002462580.1|  hypothetical protein SORBIDRAFT_02g028520          302   6e-94    Sorghum bicolor [broomcorn]
ref|XP_009112263.1|  PREDICTED: uncharacterized transporter YBR287W     301   8e-94    
emb|CDY18579.1|  BnaA09g08160D                                          301   9e-94    
ref|NP_177779.1|  auxin efflux carrier family protein                   301   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466350.1|  PREDICTED: uncharacterized transporter YBR28...    300   2e-93    
ref|XP_006282359.1|  hypothetical protein CARUB_v10028656mg             300   2e-93    
ref|XP_009798619.1|  PREDICTED: uncharacterized transporter YBR28...    298   2e-93    
ref|XP_009592449.1|  PREDICTED: uncharacterized transporter YBR28...    298   2e-93    
gb|KFK28259.1|  hypothetical protein AALP_AA8G493500                    300   2e-93    
ref|XP_010681118.1|  PREDICTED: uncharacterized protein LOC104896...    298   4e-93    
ref|XP_002306421.2|  auxin efflux carrier family protein                300   5e-93    Populus trichocarpa [western balsam poplar]
ref|XP_003548795.1|  PREDICTED: uncharacterized protein LOC100804...    299   6e-93    
emb|CDX81425.1|  BnaC09g08360D                                          298   7e-93    
emb|CDY57767.1|  BnaC02g45080D                                          298   1e-92    
ref|XP_006393787.1|  hypothetical protein EUTSA_v10005581mg             297   2e-92    
ref|XP_002866780.1|  predicted protein                                  297   2e-92    
emb|CDY55102.1|  BnaA02g34870D                                          296   4e-92    
ref|XP_006409300.1|  hypothetical protein EUTSA_v10022717mg             296   5e-92    
ref|XP_006302565.1|  hypothetical protein CARUB_v10020672mg             293   5e-92    
ref|XP_009759349.1|  PREDICTED: uncharacterized transporter C5D6....    297   5e-92    
ref|XP_009759350.1|  PREDICTED: uncharacterized transporter C5D6....    296   6e-92    
ref|XP_003612434.1|  Auxin efflux carrier protein                       294   8e-92    
ref|XP_009607642.1|  PREDICTED: uncharacterized transporter C5D6.04     296   8e-92    
ref|XP_007046465.1|  Auxin efflux carrier family protein isoform 1      296   1e-91    
ref|XP_006343325.1|  PREDICTED: uncharacterized transporter YBR28...    294   3e-91    
ref|XP_004512294.1|  PREDICTED: uncharacterized protein LOC101507...    293   3e-91    
ref|XP_007046466.1|  Auxin efflux carrier family protein isoform 2      294   6e-91    
ref|XP_011096969.1|  PREDICTED: uncharacterized transporter C5D6....    294   7e-91    
gb|ABR18184.1|  unknown                                                 295   1e-90    Picea sitchensis
ref|XP_007134489.1|  hypothetical protein PHAVU_010G051500g             293   1e-90    
gb|KHN01043.1|  Putative transporter C5D6.04                            293   3e-90    
ref|XP_009359620.1|  PREDICTED: uncharacterized transporter YBR287W     292   3e-90    
ref|XP_009418347.1|  PREDICTED: uncharacterized transporter YBR28...    293   3e-90    
ref|XP_008805481.1|  PREDICTED: uncharacterized transporter YBR28...    292   3e-90    
ref|XP_004232583.1|  PREDICTED: uncharacterized transporter C5D6....    292   3e-90    
ref|NP_001280772.1|  uncharacterized transporter YBR287W-like           292   3e-90    
ref|XP_010467522.1|  PREDICTED: uncharacterized transporter YBR28...    291   3e-90    
ref|XP_010270517.1|  PREDICTED: uncharacterized protein LOC104606827    292   5e-90    
ref|XP_006388075.1|  hypothetical protein POPTR_0365s00230g             292   7e-90    
emb|CDY26812.1|  BnaC09g09390D                                          290   8e-90    
ref|XP_010317676.1|  PREDICTED: uncharacterized protein LOC101262895    290   8e-90    
ref|XP_006661381.1|  PREDICTED: uncharacterized protein LOC102707339    292   1e-89    
ref|XP_009112433.1|  PREDICTED: uncharacterized transporter YBR28...    290   1e-89    
ref|XP_008242098.1|  PREDICTED: uncharacterized transporter YBR287W     290   3e-89    
ref|NP_201399.1|  auxin efflux carrier family protein                   289   3e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006467106.1|  PREDICTED: uncharacterized transporter YBR28...    290   4e-89    
gb|KDP43785.1|  hypothetical protein JCGZ_22412                         288   7e-89    
ref|XP_004512295.1|  PREDICTED: uncharacterized protein LOC101507...    286   9e-89    
gb|KHG10464.1|  Transporter protein                                     288   9e-89    
ref|XP_009614500.1|  PREDICTED: uncharacterized protein LOC104107...    288   1e-88    
ref|XP_009130575.1|  PREDICTED: uncharacterized transporter YBR28...    287   1e-88    
dbj|BAK01989.1|  predicted protein                                      288   1e-88    
ref|XP_010913879.1|  PREDICTED: uncharacterized transporter YBR28...    287   1e-88    
ref|XP_006587541.1|  PREDICTED: uncharacterized protein LOC100810...    285   2e-88    
ref|XP_009779996.1|  PREDICTED: uncharacterized protein LOC104229115    288   2e-88    
gb|ABR16386.1|  unknown                                                 288   2e-88    Picea sitchensis
ref|XP_009386671.1|  PREDICTED: uncharacterized transporter YBR28...    287   2e-88    
gb|AAM60930.1|  unknown                                                 286   3e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009369785.1|  PREDICTED: uncharacterized transporter YBR28...    287   3e-88    
ref|NP_565417.1|  auxin efflux carrier family protein                   286   3e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010649330.1|  PREDICTED: uncharacterized protein LOC100249...    287   3e-88    
ref|XP_008393334.1|  PREDICTED: uncharacterized transporter YBR28...    286   4e-88    
gb|KDO71532.1|  hypothetical protein CISIN_1g013221mg                   287   5e-88    
ref|XP_011038093.1|  PREDICTED: uncharacterized transporter YBR28...    284   7e-88    
ref|XP_010103240.1|  putative transporter                               286   8e-88    
ref|XP_006435465.1|  hypothetical protein CICLE_v10001325mg             282   9e-88    
ref|XP_006599270.1|  PREDICTED: uncharacterized protein LOC100817...    283   1e-87    
ref|XP_006425253.1|  hypothetical protein CICLE_v10025741mg             285   1e-87    
gb|KHG04809.1|  Transporter protein                                     285   2e-87    
ref|XP_002462581.1|  hypothetical protein SORBIDRAFT_02g028530          283   6e-87    Sorghum bicolor [broomcorn]
ref|XP_004287713.1|  PREDICTED: uncharacterized transporter YBR28...    283   8e-87    
gb|EMT16972.1|  Putative transporter                                    284   8e-87    
ref|XP_002276744.2|  PREDICTED: uncharacterized transporter YBR287W     283   1e-86    Vitis vinifera
ref|XP_010270520.1|  PREDICTED: uncharacterized protein LOC104606828    282   2e-86    
ref|XP_011099928.1|  PREDICTED: uncharacterized transporter YBR28...    281   4e-86    
gb|KDO70035.1|  hypothetical protein CISIN_1g014841mg                   277   5e-86    
ref|XP_006437713.1|  hypothetical protein CICLE_v10031658mg             277   6e-86    
ref|XP_004159743.1|  PREDICTED: uncharacterized transporter YBR28...    281   7e-86    
ref|XP_007010164.1|  Auxin efflux carrier family protein, putative      278   1e-85    
ref|XP_009420837.1|  PREDICTED: uncharacterized protein LOC104000492    280   1e-85    
ref|XP_008804451.1|  PREDICTED: uncharacterized transporter YBR28...    281   1e-85    
ref|XP_003555504.2|  PREDICTED: uncharacterized transporter YBR28...    281   2e-85    
ref|XP_003612402.1|  Transporter, putative                              280   3e-85    
ref|XP_010530989.1|  PREDICTED: uncharacterized transporter YBR287W     278   5e-85    
gb|EMS54288.1|  Uncharacterized transporter C5D6.04                     279   8e-85    
ref|XP_004957592.1|  PREDICTED: uncharacterized transporter YBR28...    278   1e-84    
gb|EYU30838.1|  hypothetical protein MIMGU_mgv1a007822mg                277   1e-84    
gb|KGN55596.1|  hypothetical protein Csa_3G000690                       278   1e-84    
ref|XP_010266240.1|  PREDICTED: uncharacterized transporter YBR287W     278   1e-84    
ref|XP_006855674.1|  hypothetical protein AMTR_s00044p00126910          278   2e-84    
ref|XP_009121108.1|  PREDICTED: uncharacterized transporter YBR287W     276   3e-84    
ref|XP_010548200.1|  PREDICTED: uncharacterized transporter YBR28...    276   3e-84    
emb|CDY24342.1|  BnaA07g02670D                                          276   3e-84    
ref|XP_007158024.1|  hypothetical protein PHAVU_002G117700g             276   4e-84    
ref|XP_006584228.1|  PREDICTED: uncharacterized protein LOC100807965    278   4e-84    
ref|XP_002884062.1|  auxin efflux carrier family protein                276   5e-84    
ref|XP_003537691.1|  PREDICTED: uncharacterized transporter YBR28...    275   2e-83    
ref|XP_010918345.1|  PREDICTED: uncharacterized protein LOC105042...    275   2e-83    
ref|XP_006299821.1|  hypothetical protein CARUB_v10016022mg             273   3e-83    
ref|XP_004146179.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    273   6e-83    
ref|XP_010489377.1|  PREDICTED: uncharacterized transporter YBR28...    272   7e-83    
gb|KDO71534.1|  hypothetical protein CISIN_1g013221mg                   274   1e-82    
ref|XP_003517128.1|  PREDICTED: uncharacterized transporter YBR28...    273   1e-82    
ref|XP_004172586.1|  PREDICTED: uncharacterized LOC101208244            271   1e-82    
ref|XP_010935349.1|  PREDICTED: uncharacterized transporter YBR28...    272   3e-82    
ref|XP_003612404.1|  Transporter, putative                              271   3e-82    
ref|XP_008448449.1|  PREDICTED: uncharacterized transporter YBR28...    271   9e-82    
ref|XP_006660957.1|  PREDICTED: uncharacterized transporter YBR28...    270   1e-81    
ref|XP_011018693.1|  PREDICTED: uncharacterized protein LOC105121661    276   1e-81    
ref|XP_010514952.1|  PREDICTED: uncharacterized transporter YBR28...    268   2e-81    
ref|NP_001063887.1|  Os09g0554300                                       269   4e-81    
gb|KDO71531.1|  hypothetical protein CISIN_1g013221mg                   267   6e-81    
ref|XP_004512284.1|  PREDICTED: uncharacterized transporter YBR28...    268   7e-81    
ref|XP_006390183.1|  hypothetical protein EUTSA_v10018685mg             265   7e-81    
ref|XP_006660956.1|  PREDICTED: uncharacterized transporter YBR28...    267   2e-80    
gb|KDP24915.1|  hypothetical protein JCGZ_24293                         264   2e-80    
ref|XP_006382981.1|  hypothetical protein POPTR_0005s10230g             265   3e-80    
ref|XP_003578612.1|  PREDICTED: uncharacterized protein LOC100833440    266   3e-80    
ref|NP_001241160.1|  uncharacterized protein LOC100807081               265   5e-80    
ref|NP_001175916.1|  Os09g0491740                                       264   9e-80    
ref|XP_007010162.1|  Auxin efflux carrier family protein isoform 5      263   1e-79    
ref|XP_010270585.1|  PREDICTED: uncharacterized protein LOC104606...    263   1e-79    
emb|CAN62432.1|  hypothetical protein VITISV_012649                     263   1e-78    
ref|XP_004159761.1|  PREDICTED: uncharacterized transporter YBR28...    261   2e-78    
ref|XP_004146216.1|  PREDICTED: uncharacterized transporter YBR28...    261   2e-78    
ref|XP_010029547.1|  PREDICTED: uncharacterized transporter YBR28...    260   3e-78    
gb|KDO70038.1|  hypothetical protein CISIN_1g014841mg                   257   3e-78    
ref|XP_003533405.1|  PREDICTED: uncharacterized transporter YBR28...    261   3e-78    
gb|KEH27638.1|  auxin efflux carrier family protein                     258   4e-78    
ref|XP_009420836.1|  PREDICTED: uncharacterized transporter YBR28...    260   7e-78    
dbj|BAJ99434.1|  predicted protein                                      259   9e-78    
ref|NP_001147841.1|  auxin Efflux Carrier family protein                260   1e-77    
ref|XP_006435462.1|  hypothetical protein CICLE_v10001325mg             256   1e-77    
ref|XP_007156259.1|  hypothetical protein PHAVU_003G271200g             259   2e-77    
gb|KDP24917.1|  hypothetical protein JCGZ_24295                         253   3e-77    
ref|XP_007046430.1|  Auxin:hydrogen symporter, putative isoform 2       255   3e-77    
ref|XP_004515379.1|  PREDICTED: uncharacterized protein LOC101498835    258   3e-77    
ref|XP_003562144.1|  PREDICTED: uncharacterized protein LOC100832109    258   4e-77    
gb|EEE70196.1|  hypothetical protein OsJ_30282                          258   5e-77    
gb|EEC85032.1|  hypothetical protein OsI_32336                          258   5e-77    
ref|XP_007046431.1|  CheY-like two-component responsive regulator...    255   5e-77    
gb|AFK32350.1|  putative auxin efflux carrier-like protein PINX         258   8e-77    
ref|XP_008448450.1|  PREDICTED: uncharacterized transporter YBR28...    256   9e-77    
gb|KDO85260.1|  hypothetical protein CISIN_1g015164mg                   253   1e-76    
ref|XP_009614501.1|  PREDICTED: uncharacterized protein LOC104107...    255   1e-76    
gb|EPS57973.1|  hypothetical protein M569_16844                         256   4e-76    
ref|XP_008448455.1|  PREDICTED: uncharacterized transporter C5D6....    255   1e-75    
ref|XP_004146180.1|  PREDICTED: uncharacterized transporter YBR28...    254   2e-75    
ref|XP_003570731.1|  PREDICTED: uncharacterized transporter YBR28...    254   3e-75    
gb|KEH17833.1|  auxin efflux carrier family protein                     251   3e-75    
ref|XP_003573172.1|  PREDICTED: uncharacterized transporter YBR28...    253   7e-75    
ref|XP_004509460.1|  PREDICTED: uncharacterized transporter YBR28...    251   2e-74    
ref|XP_009401008.1|  PREDICTED: uncharacterized transporter YBR28...    251   3e-74    
gb|KGN55594.1|  hypothetical protein Csa_3G000180                       248   1e-73    
ref|XP_010550502.1|  PREDICTED: uncharacterized transporter YBR28...    249   2e-73    
ref|XP_010550501.1|  PREDICTED: uncharacterized transporter YBR28...    248   8e-73    
ref|XP_006599263.1|  PREDICTED: uncharacterized protein LOC100804...    245   1e-72    
ref|XP_011096970.1|  PREDICTED: uncharacterized transporter C5D6....    244   3e-72    
ref|XP_006599264.1|  PREDICTED: uncharacterized protein LOC100804...    241   1e-71    
ref|XP_010680630.1|  PREDICTED: uncharacterized protein LOC104895...    239   5e-71    
ref|XP_006382976.1|  hypothetical protein POPTR_0005s10230g             240   5e-71    
ref|XP_006437711.1|  hypothetical protein CICLE_v10031658mg             236   1e-70    
gb|KDO70039.1|  hypothetical protein CISIN_1g014841mg                   235   1e-70    
dbj|BAJ86794.1|  predicted protein                                      241   3e-70    
ref|XP_003629101.1|  Transporter, putative                              239   9e-70    
ref|XP_008786677.1|  PREDICTED: uncharacterized transporter YBR28...    237   6e-69    
ref|XP_010498546.1|  PREDICTED: uncharacterized protein LOC104776216    230   4e-68    
gb|KDO71539.1|  hypothetical protein CISIN_1g013221mg                   234   4e-68    
ref|XP_006385719.1|  hypothetical protein POPTR_0003s10760g             230   1e-67    
ref|XP_004515365.1|  PREDICTED: uncharacterized protein LOC101492...    230   2e-67    
gb|KCW56462.1|  hypothetical protein EUGRSUZ_I02197                     228   5e-67    
gb|AES95391.2|  auxin efflux carrier family protein                     228   1e-66    
ref|XP_011100009.1|  PREDICTED: uncharacterized protein LOC105178...    228   1e-66    
gb|KDO70043.1|  hypothetical protein CISIN_1g014841mg                   225   5e-66    
gb|KDO71535.1|  hypothetical protein CISIN_1g013221mg                   227   5e-66    
ref|XP_006437712.1|  hypothetical protein CICLE_v10031658mg             225   6e-66    
dbj|BAG92093.1|  unnamed protein product                                226   2e-65    
ref|XP_008786672.1|  PREDICTED: uncharacterized transporter YBR28...    228   3e-65    
gb|KEH27633.1|  auxin efflux carrier family protein                     224   2e-64    
gb|EMS57690.1|  hypothetical protein TRIUR3_00891                       224   2e-64    
gb|AET03577.2|  auxin efflux carrier family protein                     223   6e-64    
ref|XP_010029546.1|  PREDICTED: uncharacterized protein LOC104419...    223   9e-64    
ref|XP_001766817.1|  predicted protein                                  220   4e-63    
gb|KDO71540.1|  hypothetical protein CISIN_1g013221mg                   221   1e-62    
ref|XP_010918350.1|  PREDICTED: uncharacterized protein LOC105042...    216   7e-62    
ref|XP_010446310.1|  PREDICTED: uncharacterized transporter YBR28...    214   7e-62    
ref|XP_009397962.1|  PREDICTED: uncharacterized transporter YBR28...    216   8e-62    
ref|XP_010913880.1|  PREDICTED: uncharacterized transporter YBR28...    215   1e-61    
ref|XP_003612391.1|  hypothetical protein MTR_5g024520                  215   5e-61    
ref|NP_001063888.2|  Os09g0555100                                       210   5e-59    
gb|EYU30841.1|  hypothetical protein MIMGU_mgv1a0088071mg               206   6e-59    
gb|AES95349.2|  auxin efflux carrier family protein                     207   1e-58    
gb|AAD30600.1|AC007369_10  Hypothetical protein                         207   6e-58    
ref|XP_003612433.1|  Auxin efflux carrier protein                       202   9e-58    
ref|XP_003612432.1|  Auxin efflux carrier protein                       202   2e-57    
gb|ACU18030.1|  unknown                                                 202   2e-57    
ref|XP_002981829.1|  hypothetical protein SELMODRAFT_115659             206   2e-57    
gb|EYU41206.1|  hypothetical protein MIMGU_mgv1a018588mg                203   5e-57    
emb|CAN63214.1|  hypothetical protein VITISV_002064                     203   4e-56    
ref|XP_008358580.1|  PREDICTED: uncharacterized protein LOC103422308    195   9e-56    
ref|XP_006849937.1|  hypothetical protein AMTR_s00022p00124760          195   9e-55    
gb|KDO71541.1|  hypothetical protein CISIN_1g013221mg                   194   7e-54    
ref|XP_003623663.1|  Auxin efflux carrier component auxin transpo...    196   1e-53    
ref|XP_006465068.1|  PREDICTED: uncharacterized protein LOC102630978    190   2e-53    
emb|CDY20805.1|  BnaC07g06540D                                          192   3e-53    
ref|XP_002982798.1|  hypothetical protein SELMODRAFT_117190             195   3e-53    
gb|EPS71464.1|  hypothetical protein M569_03295                         187   2e-52    
ref|XP_010550500.1|  PREDICTED: uncharacterized transporter YBR28...    195   2e-52    
ref|XP_007202341.1|  hypothetical protein PRUPE_ppa008223mg             191   2e-52    
emb|CDP07249.1|  unnamed protein product                                185   3e-52    
ref|XP_004492601.1|  PREDICTED: uncharacterized transporter YBR28...    192   4e-52    
ref|XP_002323690.1|  hypothetical protein POPTR_0016s14840g             190   2e-51    
dbj|BAH57041.1|  AT1G76520                                              183   2e-50    
ref|XP_010113048.1|  Uncharacterized transporter                        187   2e-50    
ref|XP_011018931.1|  PREDICTED: uncharacterized protein LOC105121...    187   3e-50    
ref|XP_009370868.1|  PREDICTED: uncharacterized protein LOC103960175    187   5e-50    
ref|XP_008370296.1|  PREDICTED: uncharacterized transporter YBR28...    186   1e-49    
ref|XP_002960250.1|  hypothetical protein SELMODRAFT_73552              186   1e-49    
ref|XP_011006245.1|  PREDICTED: uncharacterized protein LOC105112293    185   2e-49    
gb|KHN38844.1|  hypothetical protein glysoja_014836                     180   2e-49    
ref|XP_011018932.1|  PREDICTED: uncharacterized protein LOC105121...    185   2e-49    
ref|XP_008373348.1|  PREDICTED: uncharacterized protein LOC103436679    177   2e-49    
ref|XP_002967465.1|  hypothetical protein SELMODRAFT_87119              184   3e-49    
ref|XP_006381274.1|  hypothetical protein POPTR_0006s11290g             184   5e-49    
gb|KHN41807.1|  Putative transporter                                    181   6e-49    
ref|XP_004142666.1|  PREDICTED: uncharacterized transporter YBR28...    183   8e-49    
ref|XP_006654553.1|  PREDICTED: uncharacterized transporter YBR28...    183   9e-49    
gb|KDO71543.1|  hypothetical protein CISIN_1g013221mg                   181   1e-48    
gb|AFK47877.1|  unknown                                                 182   2e-48    
gb|AIC32551.1|  PH                                                      182   3e-48    
gb|KHN33198.1|  hypothetical protein glysoja_043233                     178   3e-48    
ref|XP_002531815.1|  auxin:hydrogen symporter, putative                 181   4e-48    
ref|XP_008346430.1|  PREDICTED: uncharacterized transporter YBR28...    175   5e-48    
ref|XP_001785659.1|  predicted protein                                  181   7e-48    
emb|CDY70057.1|  BnaA05g35770D                                          181   9e-48    
ref|XP_007033450.1|  Auxin efflux carrier family protein isoform 1      180   1e-47    
ref|XP_002267734.1|  PREDICTED: uncharacterized protein LOC100246780    179   2e-47    
ref|XP_009337818.1|  PREDICTED: uncharacterized protein LOC103930244    179   3e-47    
gb|KHN38858.1|  Putative transporter C5D6.04                            176   3e-47    
ref|XP_007207474.1|  hypothetical protein PRUPE_ppa006242mg             179   3e-47    
ref|XP_009144903.1|  PREDICTED: uncharacterized protein LOC103868570    179   3e-47    
ref|XP_002985541.1|  hypothetical protein SELMODRAFT_269010             179   3e-47    
ref|XP_010036032.1|  PREDICTED: uncharacterized protein LOC104425134    178   5e-47    
ref|XP_010938072.1|  PREDICTED: uncharacterized protein LOC105057236    178   7e-47    
ref|XP_010921215.1|  PREDICTED: uncharacterized protein LOC105044...    178   7e-47    
ref|XP_006481258.1|  PREDICTED: uncharacterized transporter YBR28...    177   9e-47    
ref|XP_011018933.1|  PREDICTED: uncharacterized protein LOC105121...    177   1e-46    
emb|CDY01222.1|  BnaC05g25100D                                          177   1e-46    
ref|XP_010683424.1|  PREDICTED: uncharacterized protein LOC104898109    177   1e-46    
emb|CDP06364.1|  unnamed protein product                                177   2e-46    
ref|XP_008793407.1|  PREDICTED: uncharacterized protein LOC103709705    177   2e-46    
ref|XP_004302505.1|  PREDICTED: uncharacterized transporter YBR28...    176   3e-46    
gb|KDO64196.1|  hypothetical protein CISIN_1g013452mg                   177   3e-46    
ref|XP_008244422.1|  PREDICTED: uncharacterized transporter YBR287W     176   4e-46    
ref|NP_195819.1|  auxin efflux carrier family protein                   176   4e-46    
ref|XP_008463302.1|  PREDICTED: uncharacterized transporter YBR28...    176   5e-46    
ref|XP_002870888.1|  auxin efflux carrier family protein                176   7e-46    
ref|XP_007033451.1|  Auxin efflux carrier family protein isoform 2      175   1e-45    
ref|XP_011095181.1|  PREDICTED: uncharacterized protein LOC105174696    175   1e-45    
gb|KFK24696.1|  hypothetical protein AALP_AA8G013000                    174   1e-45    
ref|XP_006398552.1|  hypothetical protein EUTSA_v10013614mg             174   2e-45    
emb|CBI31149.3|  unnamed protein product                                173   2e-45    
ref|XP_010496816.1|  PREDICTED: uncharacterized protein LOC104773846    174   2e-45    
ref|NP_001242551.1|  uncharacterized protein LOC100819622               172   3e-45    
ref|XP_008366824.1|  PREDICTED: uncharacterized transporter YBR28...    174   3e-45    
ref|XP_004302506.1|  PREDICTED: uncharacterized transporter YBR28...    173   3e-45    
ref|XP_008388393.1|  PREDICTED: uncharacterized transporter YBR28...    174   3e-45    
ref|XP_004249020.1|  PREDICTED: uncharacterized protein LOC101257...    173   4e-45    
ref|XP_009589511.1|  PREDICTED: uncharacterized protein LOC104086873    174   4e-45    
gb|KHN30729.1|  hypothetical protein glysoja_034072                     166   4e-45    
ref|XP_006429653.1|  hypothetical protein CICLE_v10011730mg             174   4e-45    
ref|XP_003533648.1|  PREDICTED: uncharacterized transporter YBR28...    173   4e-45    
gb|KEH27632.1|  auxin efflux carrier family protein                     170   4e-45    
ref|XP_009772093.1|  PREDICTED: uncharacterized protein LOC104222551    173   5e-45    
gb|EYU42061.1|  hypothetical protein MIMGU_mgv1a006990mg                173   5e-45    
ref|XP_001784737.1|  predicted protein                                  173   6e-45    
ref|XP_006300110.1|  hypothetical protein CARUB_v10016338mg             172   1e-44    
ref|XP_006382980.1|  hypothetical protein POPTR_0005s10230g             168   1e-44    
ref|XP_002987028.1|  hypothetical protein SELMODRAFT_235164             172   1e-44    
ref|XP_010931406.1|  PREDICTED: uncharacterized protein LOC105052332    172   1e-44    
ref|XP_006435466.1|  hypothetical protein CICLE_v10001325mg             166   2e-44    
gb|EPS68823.1|  auxin efflux carrier component, auxin transport p...    171   2e-44    
ref|XP_007008724.1|  Auxin efflux carrier family protein, putative      166   3e-44    
ref|XP_006362331.1|  PREDICTED: uncharacterized transporter YBR28...    171   3e-44    
ref|XP_010543136.1|  PREDICTED: uncharacterized protein LOC104816...    171   4e-44    
emb|CDY58937.1|  BnaAnng15560D                                          171   5e-44    
emb|CDY03621.1|  BnaC03g68800D                                          171   5e-44    
ref|XP_010922814.1|  PREDICTED: uncharacterized protein LOC105046029    170   6e-44    
ref|XP_009107207.1|  PREDICTED: uncharacterized protein LOC103832859    170   6e-44    
ref|XP_010278930.1|  PREDICTED: uncharacterized protein LOC104612960    169   1e-43    
ref|XP_006588038.1|  PREDICTED: uncharacterized protein LOC100788582    168   1e-43    
ref|XP_006390805.1|  hypothetical protein EUTSA_v10018516mg             170   1e-43    
gb|EYU44592.1|  hypothetical protein MIMGU_mgv1a026966mg                169   2e-43    
ref|XP_009417845.1|  PREDICTED: uncharacterized protein LOC103998178    168   4e-43    
ref|XP_006300471.1|  hypothetical protein CARUB_v10020273mg             169   4e-43    
gb|EMT06537.1|  hypothetical protein F775_14101                         167   6e-43    
ref|XP_006842607.1|  hypothetical protein AMTR_s00077p00171470          165   3e-42    
gb|KHN29468.1|  Putative transporter C5D6.04                            166   4e-42    
ref|XP_003564484.1|  PREDICTED: uncharacterized protein LOC100836625    165   6e-42    
ref|XP_007033114.1|  Auxin efflux carrier family protein isoform 1      165   7e-42    
gb|EMS45676.1|  Uncharacterized transporter C5D6.04                     164   8e-42    
ref|XP_009613524.1|  PREDICTED: uncharacterized protein LOC104106641    164   9e-42    
ref|XP_002456536.1|  hypothetical protein SORBIDRAFT_03g038030          164   1e-41    
ref|XP_008463303.1|  PREDICTED: uncharacterized transporter YBR28...    162   2e-41    
ref|XP_010543135.1|  PREDICTED: uncharacterized protein LOC104816...    164   2e-41    
gb|EMT23880.1|  Putative transporter                                    163   2e-41    
ref|XP_009391659.1|  PREDICTED: uncharacterized protein LOC103977...    163   2e-41    
ref|XP_010066648.1|  PREDICTED: uncharacterized transporter YBR287W     163   3e-41    



>ref|XP_009762861.1| PREDICTED: uncharacterized protein LOC104214838 isoform X1 [Nicotiana 
sylvestris]
Length=415

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/415 (74%), Positives = 351/415 (85%), Gaps = 12/415 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MAF+DLFVVAL+PVLKTLIITA+GL LA ERV++LG+++RHHLNNLVFY+FTPALVASSL
Sbjct  1     MAFVDLFVVALVPVLKTLIITAVGLFLALERVNLLGSTARHHLNNLVFYIFTPALVASSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ET+T+S+IV LWFMPVNILLTF IGSALGW+LVKITR P ELHGLVISCCAAGNLGNLL
Sbjct  61    AETVTSSNIVSLWFMPVNILLTFIIGSALGWLLVKITRTPIELHGLVISCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPAVC E+NSPFGD  TCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYG     S+ 
Sbjct  121   LIIIPAVCVEKNSPFGDSVTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGVQHNTSTV  180

Query  652   DIMGSGFL------DSCREALLSSHSLKYDQ-DEEAQ-----IVFEEEEKPSELKRLRQN  795
             +I  SG +      DSC + L S   L+ D  D EAQ     I +E   +   +++++Q+
Sbjct  181   NIEDSGEVPDLLLSDSCTKLLSSQDRLQSDHMDHEAQLAVPLIGYETTHEGHFVRKIKQH  240

Query  796   VKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIP  975
             +K+W  +IN KM+FAPSTIATIVGI+IGV S LRKL+I + APLHVIDSSA MLG+AAIP
Sbjct  241   IKIWTQRINFKMLFAPSTIATIVGIIIGVTSLLRKLMIGNEAPLHVIDSSASMLGEAAIP  300

Query  976   AMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHF  1155
             AMTLIVGANLLRGLKKSA+G WVVIG+QVVR+V +PL GI V+  ARHFG VGSDSLY F
Sbjct  301   AMTLIVGANLLRGLKKSAVGMWVVIGIQVVRYVAMPLSGICVVKAARHFGLVGSDSLYQF  360

Query  1156  VLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             VLLLQYALPSAM IGTITQLFEVGESECSVIMLWNY++AS+ALTLWTTY+MWILS
Sbjct  361   VLLLQYALPSAMTIGTITQLFEVGESECSVIMLWNYALASVALTLWTTYYMWILS  415



>ref|XP_009600851.1| PREDICTED: uncharacterized protein LOC104096217 isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/413 (73%), Positives = 350/413 (85%), Gaps = 10/413 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F+DLFVVAL+PVLKTLIITA+GL LA ERV++LG+++RH+LNNLVFY+FTPALVASSL
Sbjct  1     MGFVDLFVVALVPVLKTLIITAVGLFLALERVNLLGSAARHYLNNLVFYIFTPALVASSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ET+T+S+IV LWFMPVNILLTF IGSALGW+LVKIT  P +LHGLVISCCAAGNLGNLL
Sbjct  61    AETVTSSNIVSLWFMPVNILLTFIIGSALGWVLVKITTTPIQLHGLVISCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPAVC E+NSPFGD  TCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYG     S+ 
Sbjct  121   LIIIPAVCVEKNSPFGDSITCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGVQHNTSTA  180

Query  652   DIMGSGFL-----DSCREALLSSHSLKYDQDEEAQIV-----FEEEEKPSELKRLRQNVK  801
             +I  SG +     +SC + L S  SL+ D D EAQ+      +E   +   +++++Q++K
Sbjct  181   NIEDSGEVPELSSNSCTKLLSSQDSLQSDMDHEAQLAVPLIGYETTHEGHFVRKIKQHIK  240

Query  802   MWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAM  981
             +W ++INLKM+FAPSTIATIVGI+IGV S LRKL+I + APLHVIDSSA MLG+AAIPAM
Sbjct  241   IWTERINLKMLFAPSTIATIVGIIIGVTSLLRKLMIGNEAPLHVIDSSASMLGEAAIPAM  300

Query  982   TLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVL  1161
             TLIVGANLLRGLKKSA+G  VVIG+QVVR+V +PL GI V+  ARH G VGSDSLY FVL
Sbjct  301   TLIVGANLLRGLKKSAVGMRVVIGIQVVRYVAMPLSGICVVKAARHLGLVGSDSLYQFVL  360

Query  1162  LLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LLQYALPSAM IGTITQLFEVGESECSVIMLWNY++AS+ALTLWTTY+MWILS
Sbjct  361   LLQYALPSAMTIGTITQLFEVGESECSVIMLWNYALASVALTLWTTYYMWILS  413



>ref|XP_006350447.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
tuberosum]
Length=396

 Score =   503 bits (1295),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 287/403 (71%), Positives = 339/403 (84%), Gaps = 7/403 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MAF++LFVVAL+PVLKTLIITA+GL LA ER+++LG+++RHHLNNLVFY+FTPALVASSL
Sbjct  1     MAFVELFVVALVPVLKTLIITAVGLFLALERINLLGSTARHHLNNLVFYIFTPALVASSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ET+T+S+IV LWFMPVNILLTF IGS LGWILVKIT+ P  LHGLVISCC+AGNLGNLL
Sbjct  61    AETVTSSNIVSLWFMPVNILLTFIIGSVLGWILVKITKTPIHLHGLVISCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPAVCEE+NSPFGD  TCSTNGKAYASLSMA+GAVYIWTYIYN+IRA G+   N+ST
Sbjct  121   LIIIPAVCEEKNSPFGDSITCSTNGKAYASLSMAVGAVYIWTYIYNMIRASGSQHNNTST  180

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKM  831
              +     +D   E+ L+   + Y           +  +   +K+++Q++K W  +I  KM
Sbjct  181   QVPKLPPMDMDHESQLALPLIAYQTT-------HDHHQGHVVKKMKQHIKTWTQRIKFKM  233

Query  832   MFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLR  1011
             +FAPSTIATIVGI+IGV S LRKLII + APLHVIDSSA MLG+AAIPAMTLIVGANLL+
Sbjct  234   LFAPSTIATIVGILIGVSSLLRKLIIGNEAPLHVIDSSASMLGEAAIPAMTLIVGANLLK  293

Query  1012  GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAM  1191
             GLKKS +G W+VIG+QV+R+V LPL GI V+ +ARH+G VGSDSLY FVLLLQYALPSAM
Sbjct  294   GLKKSEVGVWIVIGIQVIRYVALPLSGICVVKVARHYGLVGSDSLYQFVLLLQYALPSAM  353

Query  1192  GIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              IGTITQLFEVGESECSVIMLWNY++AS+ALTLWTTY+MWILS
Sbjct  354   TIGTITQLFEVGESECSVIMLWNYALASVALTLWTTYYMWILS  396



>ref|XP_004231634.1| PREDICTED: uncharacterized protein LOC101264385 [Solanum lycopersicum]
Length=396

 Score =   500 bits (1288),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 286/403 (71%), Positives = 339/403 (84%), Gaps = 7/403 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MAF++LFVVALMPVLKTLIITA+GL+LA E V++LG+++RHHLNNLVFY+FTPALVASSL
Sbjct  1     MAFVELFVVALMPVLKTLIITAVGLLLALEPVNLLGSTARHHLNNLVFYIFTPALVASSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ET+T+S+IV LWFMPVNILLTF IGS LGWILVKIT+ P  LHGLVISCC+AGNLGNLL
Sbjct  61    AETVTSSNIVSLWFMPVNILLTFIIGSILGWILVKITKTPIHLHGLVISCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPAVCEE+NSPFGD  TCSTNGKAYASLSMA+GAVYIWTYIYN+IRA G+   N+ST
Sbjct  121   LIIIPAVCEEKNSPFGDSITCSTNGKAYASLSMAVGAVYIWTYIYNMIRASGSQHNNAST  180

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKM  831
              +      +   ++ L+   + Y           E  +   +K+++Q++K+W  +IN KM
Sbjct  181   HVPKLPPEEMDHQSQLALPLISYQ-------TIHEHHQGHVVKKMKQHIKIWTQRINFKM  233

Query  832   MFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLR  1011
             +FAPSTIATIVGI+IGV S LR L+I + APLHVIDSSA MLG+AAIPAMTLIVGANLL+
Sbjct  234   LFAPSTIATIVGILIGVSSLLRNLMIGNEAPLHVIDSSASMLGEAAIPAMTLIVGANLLK  293

Query  1012  GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAM  1191
             GLKKS +G W+VIG+QV+R++ LPL GI V+ +ARHFG VGSDSLY FVLLLQYALPSAM
Sbjct  294   GLKKSEVGVWIVIGIQVIRYIALPLSGICVVKVARHFGLVGSDSLYQFVLLLQYALPSAM  353

Query  1192  GIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              IGTITQLFEVGESECSVIMLWNY++AS+ALTLWTTY+MWILS
Sbjct  354   TIGTITQLFEVGESECSVIMLWNYALASVALTLWTTYYMWILS  396



>emb|CDP01746.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   476 bits (1224),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 272/414 (66%), Positives = 333/414 (80%), Gaps = 14/414 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL LF+VALMPVLKTLI+TA+GL LA E+VDILGA++RHHLNNLVF+VFTPALV+S+L
Sbjct  1     MGFLALFIVALMPVLKTLIVTAVGLFLALEKVDILGATARHHLNNLVFFVFTPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT SS++KLWFMPVNILLTF IGSALGW+LVK+ R P+ LHGLVI CCAAGNLGNLL
Sbjct  61    AETITMSSLIKLWFMPVNILLTFLIGSALGWVLVKVLRTPQHLHGLVIGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPAVCEE +SPFGD +TCSTNG+AYASLSMAIGAV+IWTY+YNI+RAYG     S+ 
Sbjct  121   LIIIPAVCEENDSPFGDSSTCSTNGEAYASLSMAIGAVFIWTYVYNIVRAYGIRSTGSTI  180

Query  652   DIMGSG-----------FLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNV  798
             +   S                  + + + HS    Q  ++    E +EK    K+++Q +
Sbjct  181   NRTNSANGGEIVTESSLEESLLSKDIETDHSHDTPQPIDS---IENDEKVPMRKKIKQQL  237

Query  799   KMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPA  978
             K+WA+++NLKMMFAPSTIATIVG+ IG  S LRKL+I D+APL VID+S  M+GDA+IPA
Sbjct  238   KIWAERMNLKMMFAPSTIATIVGLAIGATSPLRKLLIGDSAPLRVIDTSTSMIGDASIPA  297

Query  979   MTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFV  1158
             MTLIVGANLL+GL++S +G  ++IGVQVVR++ +PL GI V+  A HFG VGSDSLY FV
Sbjct  298   MTLIVGANLLKGLQRSEVGLGIIIGVQVVRYIAMPLLGILVVKAAVHFGLVGSDSLYQFV  357

Query  1159  LLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LLLQYALP+AM +GTITQLFEVGE +CSVIMLWNY+VA+LALTLW+TY++W +S
Sbjct  358   LLLQYALPTAMSMGTITQLFEVGERDCSVIMLWNYAVAALALTLWSTYYLWSVS  411



>ref|XP_010052720.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010052721.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010052722.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010052723.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Eucalyptus grandis]
 gb|KCW76786.1| hypothetical protein EUGRSUZ_D01141 [Eucalyptus grandis]
Length=420

 Score =   425 bits (1093),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 243/420 (58%), Positives = 313/420 (75%), Gaps = 17/420 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLFVVALMPVLK L++TA+G +LA ERV++LG  ++ H+NNLVFY+F+P+L+AS L
Sbjct  1     MGVLDLFVVALMPVLKVLLVTAVGSLLAMERVNLLGRDAKQHVNNLVFYIFSPSLIASKL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT SS+V LWFMPVNILLTF IGSAL W+L+K+TR PR L  LVI CCAAGNLGNLL
Sbjct  61    ADTITLSSLVTLWFMPVNILLTFIIGSALAWVLIKLTRTPRHLQSLVIGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMN---  642
             LII+PAVC E NSPFGD +TCST G+AYASLSMAIGAVYIW Y+Y ++R     R     
Sbjct  121   LIILPAVCTETNSPFGDSSTCSTYGEAYASLSMAIGAVYIWCYVYPLMRISAEKRAEETD  180

Query  643   --------SSTDIMGSGFLDSCREALLSSH------SLKYDQDEEAQIVFEEEEKPSELK  780
                     ++ +++  G  +   E LL+S            +DE  Q  FE + K   LK
Sbjct  181   PKDSTASLNADEVISGGLPEIITEPLLASEDSPSPMDCISQEDEICQTRFEGKTKILCLK  240

Query  781   RLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLG  960
             ++RQ++    + I++K +FAPSTIA I+G +IGV S +RKLII D+APL VI ++ D+LG
Sbjct  241   KIRQHITTITEHIDIKKLFAPSTIAVIIGFIIGVASPIRKLIIGDDAPLRVIYNATDLLG  300

Query  961   DAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSD  1140
             +AAIP +TLI+GANLLRGLK+S +   V+IGV  +R++ LPL GIGV+  A HFG VGSD
Sbjct  301   EAAIPCITLIIGANLLRGLKRSTVSPVVIIGVITIRYIALPLIGIGVVKAAHHFGMVGSD  360

Query  1141  SLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             +LY F L+LQ+ALP AM +GTITQL E GE+ECS+IMLW Y+VASL+LTLW+T+FMWI++
Sbjct  361   ALYQFTLMLQFALPPAMNVGTITQLLEAGENECSIIMLWTYAVASLSLTLWSTFFMWIVT  420



>gb|KDO70033.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
Length=417

 Score =   422 bits (1084),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 241/420 (57%), Positives = 316/420 (75%), Gaps = 20/420 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF VALMP+LK L++TA+GLVLA +R+D+LG S  H LNNLVFYVF PAL+ S+L
Sbjct  1     MEILDLFEVALMPILKVLLVTALGLVLAIDRIDLLGHSVTHSLNNLVFYVFNPALIGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  S++ LWFMPVNILL+F IGSAL WIL+KITR P  L GLVI CC+AGN+GNLL
Sbjct  61    AETITYQSLISLWFMPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY--------G  627
             LII+PAVCEE NSPFGD + CS+ GKAYASLSMA+GA+YIWTY+Y ++  Y        G
Sbjct  121   LIIVPAVCEESNSPFGDTSVCSSYGKAYASLSMAVGAIYIWTYVYYVMSLYLNKSVSDAG  180

Query  628   TPRMNSSTDIMGSG------FLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSE---LK  780
             T + +S   I+ SG      FL+S R+ LL  HS      +++QI  E     S    L 
Sbjct  181   TNK-DSRIHIISSGESSTNIFLESSRKPLL--HSSDRRSPDDSQIQAETRSTKSRFPFLD  237

Query  781   RLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLG  960
             ++RQ +  + +KI+LKM+FAPSTIA I+G VIG +S  RK+I+ ++APL V+DSSA ++G
Sbjct  238   KMRQRINKFTEKIDLKMIFAPSTIAAIIGFVIGTISPFRKVIVGESAPLRVLDSSAALVG  297

Query  961   DAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSD  1140
             +AAIPAMTL++GANLL GLK+S +G  +++G+  +R++LLPL GI ++  A  FG++GSD
Sbjct  298   EAAIPAMTLVIGANLLSGLKRSGVGVSLIMGIIAIRYILLPLLGIVIVKAAYRFGFIGSD  357

Query  1141  SLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             SLY F+LLLQYA+P A+ +GTI QLFE  ESECSVI+LW Y+VA+ ALTLW T+++W+L+
Sbjct  358   SLYQFILLLQYAVPPALAVGTIIQLFETSESECSVILLWTYAVAAFALTLWITFYIWLLT  417



>ref|XP_006437709.1| hypothetical protein CICLE_v10031658mg [Citrus clementina]
 ref|XP_006484431.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Citrus sinensis]
 gb|ESR50949.1| hypothetical protein CICLE_v10031658mg [Citrus clementina]
Length=417

 Score =   421 bits (1082),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 241/420 (57%), Positives = 316/420 (75%), Gaps = 20/420 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF VALMP+LK L++TA+GLVLA +R+D+LG S  H LNNLVFYVF PAL+ S+L
Sbjct  1     MEILDLFEVALMPILKVLLVTALGLVLAIDRIDLLGHSVTHSLNNLVFYVFNPALIGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  S++ LWFMPVNILL+F IGSAL WIL+KITR P  L GLVI CC+AGN+GNLL
Sbjct  61    AETITYQSLISLWFMPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY--------G  627
             LII+PAVCEE NSPFGD + CS+ GKAYASLSMA+GA+YIWTY+Y ++  Y        G
Sbjct  121   LIIVPAVCEESNSPFGDTSVCSSYGKAYASLSMAVGAIYIWTYVYYVMSLYLNKSVSDAG  180

Query  628   TPRMNSSTDIMGSG------FLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSE---LK  780
             T + +S   I+ SG      FL+S R+ LL  HS      +++QI  E     S    L 
Sbjct  181   TNK-DSRIHIISSGESSTDIFLESSRKPLL--HSSDRHSPDDSQIQAETRSTKSRFPFLD  237

Query  781   RLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLG  960
             ++RQ +  + +KI+LKM+FAPSTIA I+G VIG +S  RK+I+ ++APL V+DSSA ++G
Sbjct  238   KMRQRINKFTEKIDLKMIFAPSTIAAIIGFVIGTISPFRKVIVGESAPLRVLDSSAALVG  297

Query  961   DAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSD  1140
             +AAIPAMTL++GANLL GLK+S +G  +++G+  +R++LLPL GI ++  A  FG++GSD
Sbjct  298   EAAIPAMTLVIGANLLSGLKRSGVGVSLIMGIIAIRYILLPLLGIVIVKAAYRFGFIGSD  357

Query  1141  SLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             SLY F+LLLQYA+P A+ +GTI QLFE  ESECSVI+LW Y+VA+ ALTLW T+++W+L+
Sbjct  358   SLYQFILLLQYAVPPALAVGTIIQLFETSESECSVILLWTYAVAAFALTLWITFYIWLLT  417



>ref|XP_011004415.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
Length=405

 Score =   420 bits (1079),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 239/406 (59%), Positives = 304/406 (75%), Gaps = 4/406 (1%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLDLFVVALMPVLK L+IT +GL LA +R+D+LGA++RH++NNLVFY+F+PALV S L
Sbjct  1     MGFLDLFVVALMPVLKVLLITGLGLFLALDRIDLLGANARHYMNNLVFYLFSPALVVSQL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
             GETIT  S+  LWFMPVNILLTF IGS L WIL+KIT+ P  L GLVI CC+AGNLGNLL
Sbjct  61    GETITFQSLSTLWFMPVNILLTFIIGSILAWILIKITKTPPHLQGLVIGCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI++PAVC E NSPFGD T CSTNG  YASLSMA+GA+YIWTY+Y I+R Y       + 
Sbjct  121   LILVPAVCMESNSPFGDSTICSTNGTTYASLSMAVGAIYIWTYVYIIMRIYSEKSAEVTD  180

Query  652   DIMGSGFLDSCREALLS---SHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN  822
                     +S +  LLS   S S    +++E  +     EK + ++++ Q+VK +  KIN
Sbjct  181   TNQPISDSESYKALLLSRKNSGSSGCSKEDELPLTI-SGEKLTVMEKIFQSVKKFTAKIN  239

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
             LKM+FAP+TIA I G +IG VS +R L+I D+APL VIDSSA +LG+A IP MTLIVG+N
Sbjct  240   LKMVFAPATIAAICGFIIGTVSPIRILMIGDSAPLRVIDSSASLLGEATIPCMTLIVGSN  299

Query  1003  LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALP  1182
             LLRGL+K+ +   V+ G+  VR + LP+ GIG++  A H G V SDSLY F+LLLQYALP
Sbjct  300   LLRGLRKTGVSVSVIAGIVSVRNIFLPIIGIGIVKAAHHLGMVESDSLYQFILLLQYALP  359

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              AM +G I QLFE GE ECSVIMLW+Y++++L+LTLW+T++MW+L 
Sbjct  360   PAMTVGVIAQLFEAGEGECSVIMLWSYALSALSLTLWSTFYMWLLQ  405



>ref|XP_011030712.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
Length=405

 Score =   417 bits (1073),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 238/406 (59%), Positives = 303/406 (75%), Gaps = 4/406 (1%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLDLFVVALMPVLK L+IT +GL LA +R+D+LGA++RH++NNLVFY+F+PALV S L
Sbjct  1     MGFLDLFVVALMPVLKVLLITGLGLFLALDRIDLLGANARHYMNNLVFYLFSPALVVSQL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
             GETIT  S+  LWFMPVNILLTF IGS L WIL+KIT+ P  L GLVI CC+AGNLGNLL
Sbjct  61    GETITFQSLSTLWFMPVNILLTFIIGSILAWILIKITKTPPHLQGLVIGCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI++PAVC E NSPFGD T CSTNG  YASLSMA+GA+YIWTY+Y I+R Y       + 
Sbjct  121   LILVPAVCMESNSPFGDSTICSTNGTTYASLSMAVGAIYIWTYVYIIMRIYSEKSAEVTD  180

Query  652   DIMGSGFLDSCREALLS---SHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN  822
                     +S +  LLS   S S    +++E  +     EK + ++++ Q+VK +  KIN
Sbjct  181   TNQPISDSESYKALLLSRKNSGSSGCSKEDELPLTI-SGEKLTVMEKIFQSVKKFTAKIN  239

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
              KM+FAP+TIA I G +IG VS +R L+I D+APL VIDSSA +LG+A IP MTLIVG+N
Sbjct  240   PKMVFAPATIAAICGFIIGTVSPIRILMIGDSAPLRVIDSSASLLGEATIPCMTLIVGSN  299

Query  1003  LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALP  1182
             LLRGL+K+ +   V+ G+  VR + LP+ GIG++  A H G V SDSLY F+LLLQYALP
Sbjct  300   LLRGLRKTGVSVSVIAGIVSVRNIFLPIIGIGIVKAAHHLGMVESDSLYQFILLLQYALP  359

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              AM +G I QLFE GE ECSVIMLW+Y++++L+LTLW+T++MW+L 
Sbjct  360   PAMTVGVIAQLFEAGEGECSVIMLWSYALSALSLTLWSTFYMWLLQ  405



>gb|KDO70034.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
Length=416

 Score =   415 bits (1067),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 240/420 (57%), Positives = 315/420 (75%), Gaps = 21/420 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF VALMP+LK L++TA+GLVLA +R+D+LG S  H LNNLVFYVF PAL+ S+L
Sbjct  1     MEILDLFEVALMPILKVLLVTALGLVLAIDRIDLLGHSVTHSLNNLVFYVFNPALIGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  S++ LWFMPVNILL+F IGSAL WIL+KITR P  L GLVI CC+AGN+GNLL
Sbjct  61    AETITYQSLISLWFMPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY--------G  627
             LII+PAVCEE NSPFGD + CS+ GKAYASLSM +GA+YIWTY+Y ++  Y        G
Sbjct  121   LIIVPAVCEESNSPFGDTSVCSSYGKAYASLSM-VGAIYIWTYVYYVMSLYLNKSVSDAG  179

Query  628   TPRMNSSTDIMGSG------FLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSE---LK  780
             T + +S   I+ SG      FL+S R+ LL  HS      +++QI  E     S    L 
Sbjct  180   TNK-DSRIHIISSGESSTNIFLESSRKPLL--HSSDRRSPDDSQIQAETRSTKSRFPFLD  236

Query  781   RLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLG  960
             ++RQ +  + +KI+LKM+FAPSTIA I+G VIG +S  RK+I+ ++APL V+DSSA ++G
Sbjct  237   KMRQRINKFTEKIDLKMIFAPSTIAAIIGFVIGTISPFRKVIVGESAPLRVLDSSAALVG  296

Query  961   DAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSD  1140
             +AAIPAMTL++GANLL GLK+S +G  +++G+  +R++LLPL GI ++  A  FG++GSD
Sbjct  297   EAAIPAMTLVIGANLLSGLKRSGVGVSLIMGIIAIRYILLPLLGIVIVKAAYRFGFIGSD  356

Query  1141  SLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             SLY F+LLLQYA+P A+ +GTI QLFE  ESECSVI+LW Y+VA+ ALTLW T+++W+L+
Sbjct  357   SLYQFILLLQYAVPPALAVGTIIQLFETSESECSVILLWTYAVAAFALTLWITFYIWLLT  416



>ref|XP_002528527.1| auxin:hydrogen symporter, putative [Ricinus communis]
 gb|EEF33839.1| auxin:hydrogen symporter, putative [Ricinus communis]
Length=390

 Score =   413 bits (1061),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 243/387 (63%), Positives = 298/387 (77%), Gaps = 17/387 (4%)
 Frame = +1

Query  166   IITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSLGETITASSIVKLWFMPVN  345
             I+T IGL LA +R+D+LG ++RH+LNNLVFYVF+PALV S LGETIT SS+V LWFMPVN
Sbjct  19    IVTGIGLSLALDRIDLLGPNARHNLNNLVFYVFSPALVVSQLGETITFSSLVSLWFMPVN  78

Query  346   ILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiIPAVCEERNSPFGDP  525
             ILLTF IGSAL W+L+KIT+ P  L GLVI CC+AGNLGNLLLII+PAVCEE NSPFGD 
Sbjct  79    ILLTFIIGSALAWVLIKITKTPPHLQGLVIGCCSAGNLGNLLLIIVPAVCEESNSPFGDS  138

Query  526   TTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSSTDIMGSGFLDSCREALLSS  705
             TTCST G+AYASLSMA+GAVYIWTY+Y I+R Y   + N + D       +S RE+LL S
Sbjct  139   TTCSTYGEAYASLSMAVGAVYIWTYVYFIMRIYAD-KSNEAVDTN-----ESFRESLLPS  192

Query  706   HSLKYDQDE--EAQIVFEEEEKPSELKRLRQNVKMWADKINLKMMFAPStiativgivig  879
               +         AQ++          KR  Q +K +A K++LKM+FAPSTIA I+G  IG
Sbjct  193   RDIPASSSNSLHAQLL---------RKRTFQRIKNFAGKVDLKMVFAPSTIAAIIGFTIG  243

Query  880   vvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvq  1059
              VS +RKLII  +APL V+DSSA +LGDA IP+MTLIVGANLL+GLK+S +  WV++G+ 
Sbjct  244   SVSAIRKLIIGTSAPLRVLDSSAALLGDATIPSMTLIVGANLLKGLKRSGVSMWVIVGII  303

Query  1060  vvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESEC  1239
             +VR+VL+P+ GIGV+  A HFG VGSDSLY FVLLLQYALP AM +G I QLF+ GESEC
Sbjct  304   MVRYVLMPVMGIGVVKAAYHFGMVGSDSLYQFVLLLQYALPPAMTVGIIAQLFQAGESEC  363

Query  1240  SVIMLWNYSVASLALTLWTTYFMWILS  1320
             SVIMLW+Y+VA  ALTLW+T++MW+L 
Sbjct  364   SVIMLWSYAVAGFALTLWSTFYMWLLQ  390



>ref|XP_006377867.1| hypothetical protein POPTR_0011s14860g [Populus trichocarpa]
 gb|ERP55664.1| hypothetical protein POPTR_0011s14860g [Populus trichocarpa]
Length=405

 Score =   410 bits (1055),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 239/406 (59%), Positives = 302/406 (74%), Gaps = 4/406 (1%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLDLFV ALMPVLK L+IT +GL LA +R+D+LGA++RH++NNLVFY+F PALV S L
Sbjct  1     MGFLDLFVAALMPVLKVLLITGLGLFLALDRIDLLGANARHYMNNLVFYLFGPALVVSQL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
             GETIT  S+  LWFMPVNILLTF IGS L WIL+KIT+ P  L GLVI CC+AGNLGNLL
Sbjct  61    GETITFQSLNTLWFMPVNILLTFMIGSILAWILIKITKTPPHLQGLVIGCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PAVC E NSPFGD T CSTNG  YASLSMA+GA+YIWTY+Y I+R Y       + 
Sbjct  121   LIIVPAVCMESNSPFGDSTICSTNGTTYASLSMAVGAIYIWTYVYIIMRIYSDKSAEDTD  180

Query  652   DIMGSGFLDSCREALLS---SHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN  822
                     +S +  LLS   S S    +++E  +     EK + ++++ Q+VK +  KIN
Sbjct  181   TNQPISDSESYKALLLSRKNSGSSGCSKEDELPLTI-SGEKLTVMEKIFQSVKKFTAKIN  239

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
             LKM+FAP+TIA I G +IG VS +R L+I D+APL VID SA +LG+A IP MTLIVG+N
Sbjct  240   LKMVFAPATIAAICGFIIGTVSPIRILMIGDSAPLRVIDRSASLLGEATIPCMTLIVGSN  299

Query  1003  LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALP  1182
             LLRGL+KS +   V++G+  VR + LPL GIG++  A H G V SDSLY F+LLLQYALP
Sbjct  300   LLRGLRKSGVSVSVIVGIVAVRNIFLPLIGIGIVKAAHHLGMVESDSLYQFILLLQYALP  359

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              AM +G I QLF+ GE ECSVIMLW+Y++++L+LTLW+T++MW+L 
Sbjct  360   PAMTVGVIAQLFKAGEGECSVIMLWSYALSALSLTLWSTFYMWLLQ  405



>gb|ABK92888.1| unknown [Populus trichocarpa]
Length=405

 Score =   408 bits (1049),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 238/406 (59%), Positives = 301/406 (74%), Gaps = 4/406 (1%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLDLFV  LMPVLK L+IT +GL LA +R+D+LGA++RH++NNLVFY+F PALV S L
Sbjct  1     MGFLDLFVAPLMPVLKVLLITGLGLFLALDRIDLLGANARHYMNNLVFYLFGPALVVSQL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
             GETIT  S+  LWFMPVNILLTF IGS L WIL+KIT+ P  L GLVI CC+AGNLGNLL
Sbjct  61    GETITFQSLNTLWFMPVNILLTFMIGSILAWILIKITKTPPHLQGLVIGCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PAVC E NSPFGD T CSTNG  YASLSMA+GA+YIWTY+Y I+R Y       + 
Sbjct  121   LIIVPAVCMESNSPFGDSTICSTNGTTYASLSMAVGAIYIWTYVYIIMRIYSDKSAEDTD  180

Query  652   DIMGSGFLDSCREALLS---SHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN  822
                     +S +  LLS   S S    +++E  +     EK + ++++ Q+VK +  KIN
Sbjct  181   TNQPISDSESYKALLLSRKNSGSSGCSKEDELPLTI-SGEKLTVMEKIFQSVKKFTAKIN  239

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
             LKM+FAP+TIA I G +IG VS +R L+I D+APL VID SA +LG+A IP MTLIVG+N
Sbjct  240   LKMVFAPATIAAICGFIIGTVSPIRILMIGDSAPLRVIDRSASLLGEATIPCMTLIVGSN  299

Query  1003  LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALP  1182
             LLRGL+KS +   V++G+  VR + LPL GIG++  A H G V SDSLY F+LLLQYALP
Sbjct  300   LLRGLRKSGVSVSVIVGIVAVRNIFLPLIGIGIVKAAHHLGMVESDSLYQFILLLQYALP  359

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              AM +G I QLF+ GE ECSVIMLW+Y++++L+LTLW+T++MW+L 
Sbjct  360   PAMTVGVIAQLFKAGEGECSVIMLWSYALSALSLTLWSTFYMWLLQ  405



>ref|XP_007010159.1| Auxin efflux carrier family protein [Theobroma cacao]
 gb|EOY18969.1| Auxin efflux carrier family protein [Theobroma cacao]
Length=407

 Score =   407 bits (1047),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 230/409 (56%), Positives = 306/409 (75%), Gaps = 8/409 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLDLFVVA+MPVLK L++T +GL LA + +++LG  +R++LN +VFY+F P+LV S+L
Sbjct  1     MGFLDLFVVAVMPVLKVLLVTGVGLFLATDGINLLGPEARNYLNKIVFYLFGPSLVVSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ET+T  S+V +WFMPVNI LTF IGSALGWIL+KIT+ P  L G+VI CC+AGNLGNLL
Sbjct  61    AETVTLESLVTMWFMPVNIFLTFIIGSALGWILIKITKTPEHLRGMVIGCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRM-NSS  648
             LII+PAVC E N+PFGD  +CST  +AYASLSMA+GA++IW+Y Y  + AY +  M  +S
Sbjct  121   LIIVPAVCTESNTPFGD--SCSTYAEAYASLSMAVGAIFIWSYAYPFVYAYASKSMEQNS  178

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVF-----EEEEKPSELKRLRQNVKMWAD  813
             ++     F DSC EALL S      +D   Q V      ++  K S +K+  +++K+   
Sbjct  179   SEGAPQSFPDSCTEALLPSRDCSNSEDYSGQGVLPLTNSDKRIKMSVVKKTVESIKIIMG  238

Query  814   KINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIV  993
             KI+LK +FAPS IA +VG +IG +S +RK++I DNAPLHVID+S  ++ +AAIP MTLI+
Sbjct  239   KIDLKRVFAPSAIAAVVGFIIGTISPIRKVLIGDNAPLHVIDTSVSLIAEAAIPCMTLIM  298

Query  994   GANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQY  1173
             GANLL+GLK+S +   V+IG+  VR + LPL GIGV+  A HFG VGSDSLY FVL+LQY
Sbjct  299   GANLLKGLKRSEVSMLVIIGIVAVRNIFLPLSGIGVVKAAHHFGMVGSDSLYRFVLMLQY  358

Query  1174  ALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             A+P AM +GT+TQLF+ G+ E S+IMLW Y+VAS++LTLW+  FMW+LS
Sbjct  359   AVPPAMSVGTMTQLFQSGQGESSMIMLWTYAVASISLTLWSMLFMWLLS  407



>ref|XP_010649328.1| PREDICTED: uncharacterized protein LOC100249991 isoform X2 [Vitis 
vinifera]
 ref|XP_010649329.1| PREDICTED: uncharacterized protein LOC100249991 isoform X2 [Vitis 
vinifera]
 emb|CBI37492.3| unnamed protein product [Vitis vinifera]
Length=418

 Score =   408 bits (1048),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 236/419 (56%), Positives = 317/419 (76%), Gaps = 17/419 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL LFVVAL+P+LK L++T +GL++A ER+D+LGA++R +LN +VFYVF PALV+S+L
Sbjct  1     MGFLSLFVVALVPILKVLLVTGVGLLIALERIDLLGANARRNLNAIVFYVFNPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT SS+V +WFMPVNILLTF IGSALGW+L+KITR P+ L GLV+ CC+AGNLGNLL
Sbjct  61    AKTITFSSLVTMWFMPVNILLTFVIGSALGWVLIKITRTPQHLQGLVLGCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRM----  639
             LIIIPA+CEE ++PFGD + CSTNG+AYASLS+AIGA+ IW+Y+Y I+R           
Sbjct  121   LIIIPAICEEEDNPFGD-SDCSTNGEAYASLSLAIGAIGIWSYVYTIMRISANKCKKEIN  179

Query  640   --NSSTDIMGSG-----FLDSCREALLSSHSLKY-----DQDEEAQIVFEEEEKPSELKR  783
               +S+  I  SG       + C EALL S          D+ E A    E ++K   L++
Sbjct  180   LDDSTISIRTSGETLEILSEGCTEALLPSKDCPSSRECSDEVELAHAGSEGKQKVPFLEK  239

Query  784   LRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGD  963
             ++Q V++  +KI+LK +FAPSTI  IVG  IG++S +RKLII D+APLHVI+SSA  +G+
Sbjct  240   IKQQVEILMEKIDLKKVFAPSTIGVIVGFFIGLISPIRKLIIGDSAPLHVIESSAYFVGE  299

Query  964   AAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDS  1143
             AA+P+ TLI+GANLL+GLK S +   V++G+  VR++ LPL G+ V+  A HFG VGS+S
Sbjct  300   AAVPSTTLIMGANLLKGLKGSDVSIVVILGIMAVRYIALPLLGVVVVKAAHHFGLVGSNS  359

Query  1144  LYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             L+ FVL+LQYALP AM  GT++QLFE G+SECSVIMLW Y+VA+ +LTLW+++FMW++S
Sbjct  360   LFQFVLMLQYALPPAMSTGTMSQLFEFGQSECSVIMLWTYAVAAFSLTLWSSFFMWLVS  418



>ref|XP_006370750.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 gb|ERP67319.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
Length=406

 Score =   406 bits (1044),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 238/408 (58%), Positives = 301/408 (74%), Gaps = 9/408 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLDLFVVA++PVLK L+IT +GL LA +R+D+LG+++R +LNNL+FYVF+PALV+S L
Sbjct  1     MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S+  LWFMPVNILLTF IGS L WIL+KITR P  L GLVI CC+AGNLGNLL
Sbjct  61    AGTITLQSLASLWFMPVNILLTFIIGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PAVC E NSPFGD T CS+ G AYASLSMA+GA+YIWTY+Y I+R Y     NS+ 
Sbjct  121   LIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAVGAIYIWTYVYIIMRIYAD---NSAE  177

Query  652   DIMGSGFLD--SCREALL--SSHSLKYDQDEEAQI--VFEEEEKPSELKRLRQNVKMWAD  813
             +       D  S  EALL  S  S  +D    A++     E +K + ++R   N K +A 
Sbjct  178   NTKNVSIADSESYTEALLPSSEKSSCHDHSVHAELPETMSEGKKVTFMERTFWNFKKFAA  237

Query  814   KINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIV  993
               NLK +FAP+TIA + G VIG +S +RK+II D+APL V++SSA +LG A+IP M LI+
Sbjct  238   NTNLKKVFAPATIAAMFGFVIGTISPIRKVIIGDSAPLRVLESSASLLGQASIPCMALIM  297

Query  994   GANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQY  1173
             G+NLL+GL++S I   V+ G+ VVR   LPL GIG++  A HFG VGSDSLY F+LLLQY
Sbjct  298   GSNLLKGLRRSEISVSVIAGIVVVRNFFLPLIGIGIVKAAHHFGLVGSDSLYQFILLLQY  357

Query  1174  ALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             ALP AM IG + QLF+ GESECSVIMLW Y +A+ +LTLW+T++MW+L
Sbjct  358   ALPPAMAIGVMAQLFKAGESECSVIMLWCYVLAAFSLTLWSTFYMWLL  405



>ref|XP_011038089.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Populus euphratica]
 ref|XP_011038090.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Populus euphratica]
Length=406

 Score =   406 bits (1044),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 299/406 (74%), Gaps = 5/406 (1%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLDLFVVA++PVLK L+IT +GL LA +R+D+LG+++R +LNNL+FYVF+PALV+S L
Sbjct  1     MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S+  LWFMPVNILLTF +GS L WIL+KITR P  L GLVI CC+AGNLGNLL
Sbjct  61    AGTITLQSLASLWFMPVNILLTFIVGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PAVC E NSPFGD T CS+ G AYASLSMA+GA+YIWTY+Y I+R Y      ++ 
Sbjct  121   LIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAVGAIYIWTYVYIIMRIYADNSAGNTE  180

Query  652   DIMGSGFLDSCREALL--SSHSLKYDQDEEAQI--VFEEEEKPSELKRLRQNVKMWADKI  819
             ++      +S  EALL  S  S  +D    A++     E +K + ++R   N K +A   
Sbjct  181   NV-SIAVSESYTEALLPSSEKSSCHDHSVHAELPETMTEGKKVTFMERTLWNFKKFAANT  239

Query  820   NLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGA  999
             NLK +FAP+TIA + G  IG +S +RK+II D+APL V++SSA +LG A+IP M LI+G+
Sbjct  240   NLKKVFAPATIAAMFGFTIGTISPIRKVIIGDSAPLRVLESSASLLGQASIPCMALIMGS  299

Query  1000  NLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYAL  1179
             NLL+GL++S I   V+ G+  VR   LPL GIG++  A HFG VGSDSLY F+LLLQYAL
Sbjct  300   NLLKGLRRSEISVSVIAGIVAVRTFFLPLIGIGIVKAAHHFGLVGSDSLYQFILLLQYAL  359

Query  1180  PSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             P AM IG + QLF+ GESECSVIMLW Y +A+ +LTLW+T++MW+L
Sbjct  360   PPAMAIGVMAQLFKAGESECSVIMLWCYVLAAFSLTLWSTFYMWLL  405



>ref|XP_002317029.1| hypothetical protein POPTR_0011s14860g [Populus trichocarpa]
 gb|EEE97641.1| hypothetical protein POPTR_0011s14860g [Populus trichocarpa]
Length=388

 Score =   405 bits (1041),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 234/404 (58%), Positives = 297/404 (74%), Gaps = 17/404 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLDLFV ALMPVLK L+IT +GL LA +R+D+LGA++RH++NNLVFY+F PALV S L
Sbjct  1     MGFLDLFVAALMPVLKVLLITGLGLFLALDRIDLLGANARHYMNNLVFYLFGPALVVSQL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
             GETIT  S+  LWFMPVNILLTF IGS L WIL+KIT+ P  L GLVI CC+AGNLGNLL
Sbjct  61    GETITFQSLNTLWFMPVNILLTFMIGSILAWILIKITKTPPHLQGLVIGCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PAVC E NSPFGD T CSTNG  YASLSMA+GA+YIWTY+Y I+R Y         
Sbjct  121   LIIVPAVCMESNSPFGDSTICSTNGTTYASLSMAVGAIYIWTYVYIIMRIYS--------  172

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSE-LKRLRQNVKMWADKINLK  828
                     D   E   ++  +   +  +A ++  +    S  ++++ Q+VK +  KINLK
Sbjct  173   --------DKSAEDTDTNQPISDSESYKALLLSRKNSGSSGFMEKIFQSVKKFTAKINLK  224

Query  829   MMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
             M+FAP+TIA I G +IG VS +R L+I D+APL VID SA +LG+A IP MTLIVG+NLL
Sbjct  225   MVFAPATIAAICGFIIGTVSPIRILMIGDSAPLRVIDRSASLLGEATIPCMTLIVGSNLL  284

Query  1009  RGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSA  1188
             RGL+KS +   V++G+  VR + LPL GIG++  A H G V SDSLY F+LLLQYALP A
Sbjct  285   RGLRKSGVSVSVIVGIVAVRNIFLPLIGIGIVKAAHHLGMVESDSLYQFILLLQYALPPA  344

Query  1189  MGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             M +G I QLF+ GE ECSVIMLW+Y++++L+LTLW+T++MW+L 
Sbjct  345   MTVGVIAQLFKAGEGECSVIMLWSYALSALSLTLWSTFYMWLLQ  388



>ref|XP_006370747.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 ref|XP_006370748.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 ref|XP_006370749.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 gb|ERP67316.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 gb|ERP67317.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 gb|ERP67318.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
Length=405

 Score =   406 bits (1043),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 237/407 (58%), Positives = 296/407 (73%), Gaps = 8/407 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLDLFVVA++PVLK L+IT +GL LA +R+D+LG+++R +LNNL+FYVF+PALV+S L
Sbjct  1     MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S+  LWFMPVNILLTF IGS L WIL+KITR P  L GLVI CC+AGNLGNLL
Sbjct  61    AGTITLQSLASLWFMPVNILLTFIIGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PAVC E NSPFGD T CS+ G AYASLSMA+GA+YIWTY+Y I+R Y     NS+ 
Sbjct  121   LIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAVGAIYIWTYVYIIMRIYAD---NSAE  177

Query  652   DIMGSGFLD--SCREALLSSHSLKYDQDEEAQIVFEE---EEKPSELKRLRQNVKMWADK  816
             +       D  S  EALL S       D        E   E K + ++R   N K +A  
Sbjct  178   NTKNVSIADSESYTEALLPSSEKSSCHDHSVHAELPETMSEGKVTFMERTFWNFKKFAAN  237

Query  817   INLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVG  996
              NLK +FAP+TIA + G VIG +S +RK+II D+APL V++SSA +LG A+IP M LI+G
Sbjct  238   TNLKKVFAPATIAAMFGFVIGTISPIRKVIIGDSAPLRVLESSASLLGQASIPCMALIMG  297

Query  997   ANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYA  1176
             +NLL+GL++S I   V+ G+ VVR   LPL GIG++  A HFG VGSDSLY F+LLLQYA
Sbjct  298   SNLLKGLRRSEISVSVIAGIVVVRNFFLPLIGIGIVKAAHHFGLVGSDSLYQFILLLQYA  357

Query  1177  LPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             LP AM IG + QLF+ GESECSVIMLW Y +A+ +LTLW+T++MW+L
Sbjct  358   LPPAMAIGVMAQLFKAGESECSVIMLWCYVLAAFSLTLWSTFYMWLL  404



>ref|XP_011038091.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Populus euphratica]
Length=405

 Score =   405 bits (1041),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 294/405 (73%), Gaps = 4/405 (1%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLDLFVVA++PVLK L+IT +GL LA +R+D+LG+++R +LNNL+FYVF+PALV+S L
Sbjct  1     MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S+  LWFMPVNILLTF +GS L WIL+KITR P  L GLVI CC+AGNLGNLL
Sbjct  61    AGTITLQSLASLWFMPVNILLTFIVGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PAVC E NSPFGD T CS+ G AYASLSMA+GA+YIWTY+Y I+R Y      ++ 
Sbjct  121   LIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAVGAIYIWTYVYIIMRIYADNSAGNTE  180

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEE---EEKPSELKRLRQNVKMWADKIN  822
             ++      +S  EALL S       D        E   E K + ++R   N K +A   N
Sbjct  181   NV-SIAVSESYTEALLPSSEKSSCHDHSVHAELPETMTEGKVTFMERTLWNFKKFAANTN  239

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
             LK +FAP+TIA + G  IG +S +RK+II D+APL V++SSA +LG A+IP M LI+G+N
Sbjct  240   LKKVFAPATIAAMFGFTIGTISPIRKVIIGDSAPLRVLESSASLLGQASIPCMALIMGSN  299

Query  1003  LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALP  1182
             LL+GL++S I   V+ G+  VR   LPL GIG++  A HFG VGSDSLY F+LLLQYALP
Sbjct  300   LLKGLRRSEISVSVIAGIVAVRTFFLPLIGIGIVKAAHHFGLVGSDSLYQFILLLQYALP  359

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
              AM IG + QLF+ GESECSVIMLW Y +A+ +LTLW+T++MW+L
Sbjct  360   PAMAIGVMAQLFKAGESECSVIMLWCYVLAAFSLTLWSTFYMWLL  404



>ref|XP_002526514.1| auxin:hydrogen symporter, putative [Ricinus communis]
 gb|EEF35905.1| auxin:hydrogen symporter, putative [Ricinus communis]
Length=434

 Score =   406 bits (1043),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 238/406 (59%), Positives = 304/406 (75%), Gaps = 7/406 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F DLFVVALMPVLK L++TAIGL LA + + +LGAS+R+HLNNLVFYVF+PAL+ SSL
Sbjct  33    MGFWDLFVVALMPVLKVLLVTAIGLFLATDGIHLLGASARNHLNNLVFYVFSPALIGSSL  92

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               T+T  S+V LWFMPVNILLTF IGSALGW LVKIT  P+ LHG +ISCC+AGNLGNLL
Sbjct  93    ANTVTLDSLVTLWFMPVNILLTFIIGSALGWALVKITHTPKHLHGTIISCCSAGNLGNLL  152

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PA+CEE NSPFGD T CS  G+AYASLSMA+ A+YIW+Y+Y I+RA  +   + S 
Sbjct  153   LIILPALCEENNSPFGDSTACSAYGQAYASLSMAVLAIYIWSYVYYIMRASAS---DESK  209

Query  652   DIMGSG---FLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN  822
             +I G+     +  C E    + +L   +D         E + S L+R+RQ +   A K+N
Sbjct  210   EINGNNTTIIISPCGETSDYTEAL-LSEDVPTTENLPAELQESILQRIRQCISRIAGKMN  268

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
             ++M+ APSTIA + G  IG++S +RK++I D+APL VI SSA++LG+AAIP++TLIVGAN
Sbjct  269   VRMVLAPSTIAAMAGFAIGIISPIRKIMIGDSAPLRVIYSSANLLGEAAIPSITLIVGAN  328

Query  1003  LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALP  1182
             LLRGLK+S      +IG+  VRFV+LP  GIGV+  A HFG V SD LY F L+LQ+A+P
Sbjct  329   LLRGLKRSGASISAMIGIIGVRFVVLPPIGIGVVKAAHHFGIVESDPLYQFTLMLQFAVP  388

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              AM IGTI QL   GESECSVIMLW Y+VAS+++TLW+ +FMW++S
Sbjct  389   PAMNIGTIAQLVNTGESECSVIMLWTYAVASVSVTLWSAFFMWLVS  434



>gb|KHG24872.1| putative transporter C5D6.04 [Gossypium arboreum]
Length=417

 Score =   402 bits (1034),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 229/416 (55%), Positives = 306/416 (74%), Gaps = 14/416 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLDL +VAL+PV+K L IT +GL LA +RV++LG  +R+HLN +VFYVF PALVA++L
Sbjct  1     MGFLDLLLVALIPVIKVLFITGVGLFLALDRVNLLGPDARNHLNKIVFYVFGPALVATNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+V LWFMPVNILLTF IGSAL W+L+KITR P+ L G+VI CC+AGNLGNL 
Sbjct  61    AQTITYESLVTLWFMPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYG--------  627
             LII+P+VCEE N+PFG+ +TC +N +AYASLSMA GA++IW+Y+Y I+R+Y         
Sbjct  121   LIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGL  180

Query  628   TPRMNSST-DIMGSGFLDSCREALLSSH-----SLKYDQDEEAQIVFEEEEKPSELKRLR  789
             T  +NSS  +      L++CRE LL S      S +Y   ++    FE +EK S L++  
Sbjct  181   TININSSQKNSYSESDLETCREPLLPSKDWIAASDEYSVQQQPHGNFETQEKISALRKRF  240

Query  790   QNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAA  969
             Q + M   KINLK +FAPS IA +VG  IG VS +R+++I  +APL VI++S ++LGD  
Sbjct  241   QCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQILIGADAPLRVIENSINLLGDPT  300

Query  970   IPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLY  1149
             +  MTL+VGANLL+GL +S I   ++IG+  VR V +PL GIGV+  A+H G VG+D+L+
Sbjct  301   VACMTLLVGANLLKGLTRSDIRPSIIIGIIAVRNVFMPLLGIGVVKAAQHLGLVGTDALF  360

Query  1150  HFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
              FVL+LQYALP AM +GT+TQLF++G+SE SVIMLW Y VA+ +LTLW+T FMW+L
Sbjct  361   QFVLMLQYALPPAMAVGTMTQLFQMGQSESSVIMLWTYVVAAFSLTLWSTVFMWLL  416



>ref|XP_007010173.1| Auxin efflux carrier family protein [Theobroma cacao]
 gb|EOY18983.1| Auxin efflux carrier family protein [Theobroma cacao]
Length=408

 Score =   402 bits (1032),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 223/409 (55%), Positives = 297/409 (73%), Gaps = 7/409 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+LF+VA+MPVLK ++ITAIGL+LA +R+ +LG  ++HHLNN+VFYVF+PAL ASSL
Sbjct  1     MGFLNLFIVAVMPVLKIILITAIGLLLALDRMKLLGPEAKHHLNNIVFYVFSPALAASSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ET+T  S   LWFMPVNIL+TF +GSAL W+++KITR P+ L G+VI CC+AGN+GNL 
Sbjct  61    AETMTFKSFTTLWFMPVNILITFVLGSALAWLIIKITRTPKHLQGIVIGCCSAGNMGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             L+++PA+CEE  +PFGDP+ CS N K YASLS++IG +++W+Y+Y I+R Y    + SST
Sbjct  121   LVMVPALCEEPRNPFGDPSVCSRNAKPYASLSLSIGVIFMWSYVYGIMRMYANKSIESST  180

Query  652   DIMGS------GFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWAD  813
               + S          SC +A L S            I  E   + S L ++   +KM + 
Sbjct  181   TGVNSPRDTSETVSGSCTQAALPSSDCNTSHLPR-TISSESSTRMSGLMKIMMRIKMISG  239

Query  814   KINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIV  993
             KI+LK MFAP+ IA IVG +IG  S +RKL+I ++APL VID  A +LG+A IP +TLI+
Sbjct  240   KIDLKKMFAPAAIAAIVGFIIGAASPIRKLMIGNSAPLRVIDGCAHILGEATIPCVTLIM  299

Query  994   GANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQY  1173
             GANLL GLK S +   V+IG+  VR + LPL GIGV+  A HFG VGSDSLY FVL+LQY
Sbjct  300   GANLLIGLKGSDVSRNVIIGIIAVRNIFLPLSGIGVVKAAHHFGLVGSDSLYQFVLMLQY  359

Query  1174  ALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             A+P AM IGT+TQ F++G+ E SVIMLW Y+VA++ LTLW+T+FMW+L+
Sbjct  360   AVPPAMSIGTMTQFFQLGQGETSVIMLWTYAVAAVTLTLWSTFFMWLLT  408



>ref|XP_007010160.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao]
 gb|EOY18970.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao]
Length=412

 Score =   398 bits (1023),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 230/408 (56%), Positives = 302/408 (74%), Gaps = 9/408 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLD+FVVALMPVLK L++TA+GL+LA E++D+LG  +R++LN +VFYV +P+L+ S+L
Sbjct  1     MGFLDMFVVALMPVLKVLLVTAVGLLLAMEKIDLLGPEARNYLNKIVFYVLSPSLLVSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT +S+V LWFMP+NILLTF IGSALG +L+K+T+ P  L G+VI CC+AGNLGNLL
Sbjct  61    ADTITYNSVVTLWFMPLNILLTFIIGSALGLVLIKVTKTPEHLRGIVIGCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYG--TPRMNS  645
             LI++PAVCE+ NSPFGD +TCSTN  AYASLSMA+ A+Y W+Y Y ++ AY   +P   S
Sbjct  121   LILVPAVCEQSNSPFGDSSTCSTNAVAYASLSMAVAAIYTWSYSYAVVSAYAIKSPEHKS  180

Query  646   --STDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFE-----EEEKPSELKRLRQNVKM  804
               S++       DSC EALL S   +  ++   Q+        E  K S  K + Q VK 
Sbjct  181   THSSEEAPDPSSDSCTEALLPSSYSQISEESSVQVELPLTNSGERTKMSFWKNIVQCVKS  240

Query  805   WADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMT  984
                KI+LKM+FAPSTIA I+G + G+VS +RK++I D+APLHVI +SA  +G+AAIP MT
Sbjct  241   IMSKIDLKMVFAPSTIAAIIGFIFGIVSPIRKVLIDDSAPLHVIYTSAAFIGEAAIPCMT  300

Query  985   LIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLL  1164
             LI+GANLL+GLK+S +   V+IGV  VR + LPL GIGV   A HFG  GSDSLY FVL+
Sbjct  301   LIMGANLLKGLKRSEVNLLVIIGVVAVRNIFLPLLGIGVTKAAYHFGMAGSDSLYQFVLM  360

Query  1165  LQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFM  1308
             LQYA+P A  +G +TQLF+ G+ E S+IMLW Y+VAS++LTLW+T FM
Sbjct  361   LQYAVPPAFNVGVMTQLFQRGQGETSIIMLWTYAVASISLTLWSTLFM  408



>ref|XP_007010169.1| Auxin efflux carrier family protein [Theobroma cacao]
 gb|EOY18979.1| Auxin efflux carrier family protein [Theobroma cacao]
Length=446

 Score =   399 bits (1026),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 227/409 (56%), Positives = 299/409 (73%), Gaps = 7/409 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+LF+VA+MPVLK ++ITAIGL+LA +RV +LG  ++HHLN +VFYVF+PAL ASSL
Sbjct  39    MGFLNLFIVAVMPVLKIILITAIGLLLALDRVKLLGPEAKHHLNKIVFYVFSPALAASSL  98

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ET+T  S   LWFMPVNIL+TF +GSAL W+L+K TR P+ L G+VI CC+AGNL NL 
Sbjct  99    AETMTFKSFTTLWFMPVNILITFVLGSALAWLLIKFTRTPKHLQGIVIGCCSAGNLANLP  158

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI++PAVCEE ++PFGD + CSTN K YASLS++IGA+++W+Y+Y I+R Y    + SST
Sbjct  159   LIMVPAVCEEPSNPFGDQSVCSTNAKPYASLSLSIGAIFMWSYVYGIMRMYANKSIESST  218

Query  652   DIMGS------GFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWAD  813
               + S          S  +A L S     + D    I  +   K S LK++   +KM + 
Sbjct  219   TGINSPRDTSETVSGSRTQAALPSSDCN-NSDLPRTISRQRSTKTSGLKKIIPCIKMISR  277

Query  814   KINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIV  993
             KI+LK +FAP+ +A IVG +IG VS +RKL+I  +APL VIDSSA +LG+A+IP MTLI+
Sbjct  278   KIDLKKVFAPTAVAAIVGFIIGAVSPIRKLMIGSSAPLRVIDSSAYILGEASIPCMTLIM  337

Query  994   GANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQY  1173
             GANLL GLK S +   V+IG+  VR + LPL GIGV+  A HFG VGSDSLY FVL+LQY
Sbjct  338   GANLLTGLKGSDVSRNVIIGIIAVRNIFLPLSGIGVVKAAHHFGLVGSDSLYQFVLMLQY  397

Query  1174  ALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             A+P AM IGT+TQ F++G+ E S+IMLW Y  A++ LTLW+T+FMW+L+
Sbjct  398   AVPPAMSIGTMTQFFQLGQGETSMIMLWAYVTAAVTLTLWSTFFMWLLA  446



>emb|CDP01747.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   397 bits (1021),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 225/411 (55%), Positives = 303/411 (74%), Gaps = 11/411 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M   +L +VALMPVLKTL+I  +GL LA + + IL A++RHHLNNLV+YVF P+L+ASSL
Sbjct  1     MGIDELLMVALMPVLKTLLIAVVGLFLAVDHISILSATARHHLNNLVYYVFFPSLLASSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ++I+A++I+ LWF PV+ILLTF IGSALGWILV+IT+ P++LHGLVI  CAAGN+GNL 
Sbjct  61    VDSISATNIISLWFTPVSILLTFIIGSALGWILVRITKTPQQLHGLVIGSCAAGNMGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP-----R  636
             +IIIPA+C E+N+PFGD  +CS NG AY SLSM+IGAV++W+Y+YNIIR  GT      +
Sbjct  121   VIIIPAICAEKNNPFGDSFSCSRNGMAYVSLSMSIGAVFVWSYVYNIIRICGTESDGNVQ  180

Query  637   MNSSTDIMGSGFL---DSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELK-RLRQNVKM  804
             ++S+     SG +   DS RE LL        QD   Q  F  +     +K   +Q++K 
Sbjct  181   ISSTISKNQSGEINSSDSSREELL-LKGCPSSQDYHVQPTFVLKRSEDRVKVPFKQHLKS  239

Query  805   WADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMT  984
                KI+L+M+  P      V  ++  VS LR++I+   APL V++SS  +LG+AAIP+MT
Sbjct  240   LLGKIDLRMLLTPP-TVATVVGLLIGVSPLREVIVGGTAPLRVVESSVLLLGEAAIPSMT  298

Query  985   LIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLL  1164
             LI+GANLLRGLK+S +  W+++G+ ++RF  LP+ G+ +I  AR FG VGSD LYHFVLL
Sbjct  299   LIMGANLLRGLKRSGVNLWMILGIILIRFAALPVLGVVIIKAARDFGMVGSDPLYHFVLL  358

Query  1165  LQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             LQY++P AM IGTITQLFEVGE+ECSV+M WNY+VA++A+TLW TY+MW+L
Sbjct  359   LQYSVPPAMAIGTITQLFEVGETECSVLMFWNYAVAAIAMTLWATYYMWLL  409



>ref|XP_009772486.1| PREDICTED: uncharacterized transporter YBR287W-like [Nicotiana 
sylvestris]
 ref|XP_009772487.1| PREDICTED: uncharacterized transporter YBR287W-like [Nicotiana 
sylvestris]
Length=410

 Score =   397 bits (1021),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 236/414 (57%), Positives = 305/414 (74%), Gaps = 15/414 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M+  +LF++ALMPVLKTL+I  +GL LA +R+ IL A +RHHLNNLVFY+F PA+ AS +
Sbjct  1     MSIEELFLLALMPVLKTLLIAVVGLFLALDRISILTAEARHHLNNLVFYIFFPAICASGV  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               + T + I  LWF+PV+IL+TF +GSALGWILVKITRAPR LHGLVI CCA GN+GNL 
Sbjct  61    IGSSTETGIFSLWFIPVSILITFLVGSALGWILVKITRAPRHLHGLVIGCCAGGNMGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP------  633
             +IIIPA+C E+N+PFGDP+TCS NG  Y +LSM IGA+ IW+++Y II AYG        
Sbjct  121   VIIIPAICAEKNNPFGDPSTCSKNGMGYVTLSMGIGAIGIWSFVYKIIWAYGKRDDRDVS  180

Query  634   -----RMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNV  798
                  R N   +      LDS   ALL + +     DE + +V   E K S    + + V
Sbjct  181   VYSKLRENQHGETSKES-LDSITRALLPNSNSNSKYDEASAMV---ETKVSIPIIIEKKV  236

Query  799   KMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPA  978
             K   + ++L ++F P TIATIVGI+I  VS ++ +++ D APL  ++SS  +LGDAAIP+
Sbjct  237   KSLLEYVDLSVVFRPPTIATIVGIIIASVSPIQNIMVGDRAPLRFVESSVVLLGDAAIPS  296

Query  979   MTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFV  1158
             MT+I+GANLLRG K+S +G W++IG+ VVRFV LP+ G+GVIT+A++ G VGSD LYHFV
Sbjct  297   MTIIMGANLLRGFKRSGVGIWLLIGIIVVRFVFLPIIGVGVITVAKNLGIVGSDPLYHFV  356

Query  1159  LLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             +LLQYA+P AM IGTITQLFE+GE+ECSVIM WNY+VAS+ALTLW TYFMWILS
Sbjct  357   ILLQYAVPPAMAIGTITQLFEIGETECSVIMFWNYAVASIALTLWCTYFMWILS  410



>ref|XP_002264606.1| PREDICTED: uncharacterized transporter C5D6.04 isoform X1 [Vitis 
vinifera]
 ref|XP_003631924.1| PREDICTED: uncharacterized transporter C5D6.04 isoform X1 [Vitis 
vinifera]
Length=418

 Score =   397 bits (1020),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 231/421 (55%), Positives = 305/421 (72%), Gaps = 21/421 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LFV ALMP+LK L++T IGL +A ER+D+LG ++RHHLN LVFY+F PALVAS+L
Sbjct  1     MGFWSLFVTALMPILKVLVVTGIGLFIALERIDLLGPTARHHLNTLVFYIFYPALVASNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+TASS+  +WFMPVNILLTF IGSALGWIL+KITR P+ LH L++ CC+AGN+GNL 
Sbjct  61    ADTVTASSLATMWFMPVNILLTFIIGSALGWILIKITRPPQHLHALILGCCSAGNMGNLF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP------  633
              IIIPA+CEE ++PFG  + CST+G AYASLS A+GA+ +WTY+Y I+R   T       
Sbjct  121   FIIIPAICEESDNPFGS-SDCSTDGDAYASLSSALGAIGVWTYVYMIMRMSATKCKGEIN  179

Query  634   RMNSSTDIMGSGFL-----DSCREALL----SSHSLKYDQDEEAQIVFEEEEKPSEL---  777
               NS+T +  S        D C EALL    S  S  +  +EE  +  +  E+ SE+   
Sbjct  180   LCNSTTSVRTSREALEISSDCCTEALLPPRDSPRSGNWSDEEE--LPHDGSEEKSEVPFS  237

Query  778   KRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADML  957
             ++++Q VK++ +K N K +F PSTI  I G  IG++  +RKLII D+APL VI+SSA +L
Sbjct  238   EKIKQKVKIFMEKTNFKQVFTPSTIGVIFGFFIGLIPPIRKLIIGDSAPLRVIESSATLL  297

Query  958   GDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGS  1137
             G+AAIP+ TLI+GANLL GLK S +   V++G+  VR++ LPL G+ V+  A HFG VGS
Sbjct  298   GEAAIPSTTLIMGANLLSGLKGSDVSIVVILGIVAVRYIFLPLLGVVVVKAATHFGLVGS  357

Query  1138  DSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             + L+ FVL+LQYA+P AMG G I QLF+ G+SECSVIMLW Y+VA  ALTLW+T+FMW++
Sbjct  358   NLLFQFVLMLQYAVPPAMGTGVICQLFQFGQSECSVIMLWTYAVAGFALTLWSTFFMWLV  417

Query  1318  S  1320
             S
Sbjct  418   S  418



>ref|XP_007010166.1| Auxin efflux carrier family protein [Theobroma cacao]
 gb|EOY18976.1| Auxin efflux carrier family protein [Theobroma cacao]
Length=408

 Score =   392 bits (1008),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 231/409 (56%), Positives = 301/409 (74%), Gaps = 7/409 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+L +VA+MPVLK ++ITAIGL+LA +R+ +LG  + HH+NN+VFYVF+PAL ASSL
Sbjct  1     MGFLNLLIVAVMPVLKIILITAIGLLLALDRLKLLGPEANHHMNNIVFYVFSPALAASSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ET+T  S+  LWFMPVN+LLTF +GSAL W+L+KITR P+ L G+VI CC+AGNLGNL 
Sbjct  61    AETVTFKSLTTLWFMPVNLLLTFVLGSALAWLLIKITRTPKHLQGIVIGCCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI++PAVCEE ++PFGDP+ CSTN K YASLS++IGA++IW+Y+Y I+R Y      SST
Sbjct  121   LIMVPAVCEEPSNPFGDPSVCSTNAKPYASLSLSIGAIFIWSYVYGIMRMYANKSNESST  180

Query  652   DIMGSGFLDS------CREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWAD  813
               + S    S      C +A+L S +          I  E   K S LK++   VKM + 
Sbjct  181   TGINSPIDTSETVPGGCTQAVLPSSNCNTSYLPR-TISGERSTKMSGLKKIMPRVKMISG  239

Query  814   KINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIV  993
             KI+LK +FAP+ +A IVG +IG VS +RKL+I  +APL VIDSSA +LG+A IP MTLI+
Sbjct  240   KIDLKKVFAPTAVAAIVGFIIGAVSPIRKLMIGKSAPLRVIDSSAYILGEATIPCMTLIM  299

Query  994   GANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQY  1173
             GANLL GLK S +   V+IG+  VR + LPL GIGV+  A HFG VGSDSLY FVL+LQY
Sbjct  300   GANLLIGLKGSDVSRTVIIGIIAVRNIFLPLSGIGVVKAAHHFGLVGSDSLYQFVLMLQY  359

Query  1174  ALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             A+P AM IGT+TQ F++G+ E S+IMLW Y +A++ LTLW+T FMW+L+
Sbjct  360   AVPPAMAIGTMTQFFQLGQGETSMIMLWTYVIAAVTLTLWSTLFMWLLA  408



>ref|XP_007046429.1| Auxin:hydrogen symporter, putative isoform 1 [Theobroma cacao]
 gb|EOX90586.1| Auxin:hydrogen symporter, putative isoform 1 [Theobroma cacao]
Length=419

 Score =   392 bits (1006),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 233/418 (56%), Positives = 294/418 (70%), Gaps = 16/418 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLDLFVVA MPVLK L++TA+G  LA +R+D++G  +R  LNN+VFYVF PA+V+S+L
Sbjct  1     MRFLDLFVVASMPVLKVLLLTALGSFLALDRIDVMGEDARKQLNNVVFYVFNPAVVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  SIV LWFMP NIL TF IGSA+GW+LVKIT+AP+ L GL++SCCAAGN+G+L 
Sbjct  61    AKTITFESIVLLWFMPFNILNTFIIGSAMGWVLVKITKAPQHLRGLILSCCAAGNMGHLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY---------  624
             LI++PA+C E+ SPFG P  C   G AYASLSMAIGA+Y+W+Y+YNI+R           
Sbjct  121   LIVVPAICTEKGSPFGTPDICHKYGMAYASLSMAIGAIYLWSYVYNIVRVSSSKVNKDVN  180

Query  625   --GTPRMNSSTDIMGSGFLDSCREALLSSH----SLKYDQDEEAQIVFEEEE-KPSELKR  783
               G+ R+  ST+ M +   +   E LL S+    SLKY  +            K S+  +
Sbjct  181   GDGSTRILKSTEGMPALLEEDYSEFLLPSNDCSISLKYTHELTFPCTKPNGTVKVSDFDK  240

Query  784   LRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGD  963
               Q ++M + K+NLK +FAPST    +G  IGVV  +R LII  NAPLHV+  SA +LGD
Sbjct  241   TWQYLRMISQKLNLKALFAPSTTGAFIGFTIGVVPQIRNLIIGGNAPLHVVQDSASLLGD  300

Query  964   AAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDS  1143
             AAIP +TLIVG NLLRGLK   I   +V+GV  VR+V LPL GI +I  A  FG V SD 
Sbjct  301   AAIPIITLIVGGNLLRGLKGPGICLSLVVGVIAVRYVFLPLLGIVIIKTAVRFGLVHSDP  360

Query  1144  LYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             LY F+LLLQYALP AM IGTITQLF+ GESECSVIMLW Y +AS++LTLW+T FMW++
Sbjct  361   LYQFILLLQYALPPAMNIGTITQLFKAGESECSVIMLWTYGLASISLTLWSTVFMWLV  418



>ref|XP_009762862.1| PREDICTED: uncharacterized protein LOC104214838 isoform X2 [Nicotiana 
sylvestris]
Length=353

 Score =   389 bits (999),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 245/415 (59%), Positives = 288/415 (69%), Gaps = 74/415 (18%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MAF+DLFVVAL+PVLKTLIITA+GL LA ERV++LG+++RHHLNNLVFY+FTPALVASSL
Sbjct  1     MAFVDLFVVALVPVLKTLIITAVGLFLALERVNLLGSTARHHLNNLVFYIFTPALVASSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ET+T+S+IV LWFMPVNILLTF IGSALGW+LVKITR P ELHGLVISCCAAGNLGNLL
Sbjct  61    AETVTSSNIVSLWFMPVNILLTFIIGSALGWLLVKITRTPIELHGLVISCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPAVC E+NSPFGD  TCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYG     S+ 
Sbjct  121   LIIIPAVCVEKNSPFGDSVTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGVQHNTSTV  180

Query  652   DIMGSGFL------DSCREALLSSHSLKYDQ-DEEAQIV-----FEEEEKPSELKRLRQN  795
             +I  SG +      DSC + L S   L+ D  D EAQ+      +E   +   +++++Q+
Sbjct  181   NIEDSGEVPDLLLSDSCTKLLSSQDRLQSDHMDHEAQLAVPLIGYETTHEGHFVRKIKQH  240

Query  796   VKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIP  975
             +K+W  +IN KM+FAPSTIATIVGI+IGV S LRKL+I + APLHVIDSSA MLG+AAIP
Sbjct  241   IKIWTQRINFKMLFAPSTIATIVGIIIGVTSLLRKLMIGNEAPLHVIDSSASMLGEAAIP  300

Query  976   AMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHF  1155
             AMTLIVGANLLRG                              T+ + F  VG +S    
Sbjct  301   AMTLIVGANLLRG------------------------------TITQLFE-VG-ESECSV  328

Query  1156  VLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             ++L  YAL S                              +ALTLWTTY+MWILS
Sbjct  329   IMLWNYALAS------------------------------VALTLWTTYYMWILS  353



>ref|XP_009600852.1| PREDICTED: uncharacterized protein LOC104096217 isoform X2 [Nicotiana 
tomentosiformis]
Length=351

 Score =   388 bits (997),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 242/413 (59%), Positives = 289/413 (70%), Gaps = 72/413 (17%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F+DLFVVAL+PVLKTLIITA+GL LA ERV++LG+++RH+LNNLVFY+FTPALVASSL
Sbjct  1     MGFVDLFVVALVPVLKTLIITAVGLFLALERVNLLGSAARHYLNNLVFYIFTPALVASSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ET+T+S+IV LWFMPVNILLTF IGSALGW+LVKIT  P +LHGLVISCCAAGNLGNLL
Sbjct  61    AETVTSSNIVSLWFMPVNILLTFIIGSALGWVLVKITTTPIQLHGLVISCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPAVC E+NSPFGD  TCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYG     S+ 
Sbjct  121   LIIIPAVCVEKNSPFGDSITCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGVQHNTSTA  180

Query  652   DIMGSGFL-----DSCREALLSSHSLKYDQDEEAQIV-----FEEEEKPSELKRLRQNVK  801
             +I  SG +     +SC + L S  SL+ D D EAQ+      +E   +   +++++Q++K
Sbjct  181   NIEDSGEVPELSSNSCTKLLSSQDSLQSDMDHEAQLAVPLIGYETTHEGHFVRKIKQHIK  240

Query  802   MWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAM  981
             +W ++INLKM+FAPSTIATIVGI+IGV S LRKL+I + APLHVIDSSA MLG+AAIPAM
Sbjct  241   IWTERINLKMLFAPSTIATIVGIIIGVTSLLRKLMIGNEAPLHVIDSSASMLGEAAIPAM  300

Query  982   TLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVL  1161
             TLIVGANLLRG                              T+ + F  VG +S    ++
Sbjct  301   TLIVGANLLRG------------------------------TITQLFE-VG-ESECSVIM  328

Query  1162  LLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             L  YAL S                              +ALTLWTTY+MWILS
Sbjct  329   LWNYALAS------------------------------VALTLWTTYYMWILS  351



>ref|XP_006343315.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
tuberosum]
Length=415

 Score =   390 bits (1003),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 227/417 (54%), Positives = 306/417 (73%), Gaps = 16/417 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M   +LF++ALMPVLKTL+I  +GL LA + V IL A  RHHLNNLVFYVF P+L AS L
Sbjct  1     MNIQELFLLALMPVLKTLLIAVVGLYLALDHVSILTAEGRHHLNNLVFYVFFPSLCASGL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               + T + +  LWF+PV+IL+TF +GSALGWILVKITR P+ LHGLVI CCA GN+GNL 
Sbjct  61    ISSSTETGLFSLWFVPVSILITFLVGSALGWILVKITRTPQHLHGLVIGCCAGGNMGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP------  633
             +IIIPA+C E+N+PFGD +TCS NG  Y SLSM IGA+ IW+Y+YNIIRAYG        
Sbjct  121   VIIIPAICAEKNNPFGDSSTCSINGMGYVSLSMGIGAIGIWSYVYNIIRAYGKRDDGDVS  180

Query  634   -----RMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFE---EEEKPSELKRLR  789
                  R N+ ++      LDS  + LL S + K D+   A+++++   +E K S    + 
Sbjct  181   AYSKLRENNHSETSKRA-LDSTTQTLLPSSNSKGDE-VSAELIYQGSMDETKVSIPTIIE  238

Query  790   QNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAA  969
             + VK   + I+L ++F P T+AT++GI+I  +S ++  ++   APL  ++SS  +LG+AA
Sbjct  239   KKVKSLVEYIDLSVLFRPPTVATVIGIIIASISPIQNFMVGSGAPLRFVESSVVLLGEAA  298

Query  970   IPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLY  1149
             IP+MT+I+GANLL+G K+S +G W++ G+ VVRFV+LP+ G+ VIT+A++ G VG+D LY
Sbjct  299   IPSMTIIMGANLLKGFKRSGVGIWLLFGIIVVRFVILPIIGVAVITVAKNLGMVGTDPLY  358

Query  1150  HFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             HFVLLLQYA+P AM IGTITQLFE+GE+ECSVIM WNY+VA++ALT W+TYFM+ILS
Sbjct  359   HFVLLLQYAVPPAMAIGTITQLFEIGETECSVIMFWNYAVAAVALTFWSTYFMYILS  415



>ref|XP_004234500.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
lycopersicum]
 ref|XP_010317673.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
lycopersicum]
Length=415

 Score =   390 bits (1002),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 231/417 (55%), Positives = 305/417 (73%), Gaps = 16/417 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M   +LF +ALMPVLKTL+I  +GL LA + V IL A  RHHLNNLVFYVF P+L AS L
Sbjct  1     MNIEELFFLALMPVLKTLLIAVVGLYLAMDHVSILTAEGRHHLNNLVFYVFFPSLCASGL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               + TA+ +  LWF+PV+IL+TF +GSALGWILVKITR P+ LHGLVI CCA GN+GNL 
Sbjct  61    ISSSTATGLFSLWFVPVSILITFLVGSALGWILVKITRTPQHLHGLVIGCCAGGNMGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP------  633
             +IIIPA+C E+N+PFGD +TCS NG  Y SLSM IGA+ IW+Y+YNIIRAYG        
Sbjct  121   VIIIPAICAEKNNPFGDSSTCSINGMGYVSLSMGIGAIGIWSYVYNIIRAYGKRDDGDVS  180

Query  634   -----RMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFE---EEEKPSELKRLR  789
                  R NS ++      LDS  + LL S + K   +  A+++ +   +E K S    + 
Sbjct  181   AYSKLRENSHSETSRRA-LDSTTQTLLPSSNSK-GAEVSAELISQGSIDETKVSVPAIIE  238

Query  790   QNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAA  969
             + VK   + I+L ++F P TIAT++GI+I  +S ++  ++   APL  ++SS  +LG+AA
Sbjct  239   KKVKSLVEYIDLSVLFRPPTIATVIGIIIASISPIQNFMVGSGAPLRFVESSVVLLGEAA  298

Query  970   IPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLY  1149
             IP+MT+I+GANLLRG K+S +G W++ G+ VVRFV+LP+ G+ VIT+A++ G VG+D LY
Sbjct  299   IPSMTIIMGANLLRGFKRSGVGIWLLFGIIVVRFVILPIIGVAVITVAKNLGMVGTDPLY  358

Query  1150  HFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             HFVLLLQYA+P AM IGTITQLFE+GE+ECSVIM WNY+VA++ALTLW+TYFM+ILS
Sbjct  359   HFVLLLQYAVPPAMAIGTITQLFEIGETECSVIMFWNYAVAAVALTLWSTYFMYILS  415



>ref|XP_007018644.1| Auxin efflux carrier family protein, putative [Theobroma cacao]
 gb|EOY15869.1| Auxin efflux carrier family protein, putative [Theobroma cacao]
Length=436

 Score =   390 bits (1001),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 227/435 (52%), Positives = 300/435 (69%), Gaps = 23/435 (5%)
 Frame = +1

Query  61    WFTEEECEP*DSSKKILMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHL  240
             WF E+  E         M  LDLF+ A +PVLK L+ITA+GL LA + V+ILG  +R H+
Sbjct  10    WFIEDSDEN--------MVLLDLFIAATIPVLKVLLITALGLYLALDHVNILGEDTRKHM  61

Query  241   NNLVFYVFTPALVASSLGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPREL  420
             NN+VFYVF PALVAS+L ETIT  S+VKLWFMP N+LLTF IGS LGWI+++ TR P  L
Sbjct  62    NNVVFYVFNPALVASNLAETITYESMVKLWFMPFNVLLTFVIGSILGWIVIQFTRPPSHL  121

Query  421   HGLVISccaagnlgnllliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTY  600
              GL++ CCAAGN+GN+LLIIIPAVC+E+ SPFG P  C + G  Y SLSMAIGA+Y+W+Y
Sbjct  122   RGLILGCCAAGNMGNMLLIIIPAVCKEKGSPFGSPEVCHSYGMGYVSLSMAIGAIYLWSY  181

Query  601   IYNIIRAYGTPRMNSST--DIMGSGFL--------DSCREALLSSHSLKYDQDEEAQIVF  750
             ++NI+R Y    +N ST  D   S +          SC E LLSS  L   ++ E   + 
Sbjct  182   VFNIVRIYSITSINESTVNDSSTSKYFREASTSDQGSCTEPLLSSKDLLVSEENENGYIL  241

Query  751   --EEEEKPSELK---RLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVD  915
                  +  +E +   +++Q + M   KIN++ +FAPST   IVG VIG+V  +RK +I D
Sbjct  242   PCTSSKGKAEARFSSKIKQQLNMMIAKINMRSVFAPSTTGAIVGFVIGLVPQIRKSMIGD  301

Query  916   NAPLHVIDSSADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGI  1095
              APL  I  SA ++GD AIPA+TLIVG NLL+GL+ S I   ++ G+ V R++ LPL GI
Sbjct  302   GAPLRAIQDSASLVGDGAIPALTLIVGGNLLKGLRGSGIRKSIIFGIIVARYIALPLIGI  361

Query  1096  GVITLARHFGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVAS  1275
              ++  A   G+V +D+LY FVLLLQ+A+P AM IGTITQLF  GESECSVIMLW Y++AS
Sbjct  362   VIVKGASRIGFVQADALYQFVLLLQFAVPPAMNIGTITQLFGAGESECSVIMLWTYALAS  421

Query  1276  LALTLWTTYFMWILS  1320
             ++LTLW+T+FMW+++
Sbjct  422   ISLTLWSTFFMWLVA  436



>ref|XP_009372647.1| PREDICTED: uncharacterized transporter YBR287W-like [Pyrus x 
bretschneideri]
 ref|XP_009372648.1| PREDICTED: uncharacterized transporter YBR287W-like [Pyrus x 
bretschneideri]
Length=414

 Score =   388 bits (996),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 238/412 (58%), Positives = 295/412 (72%), Gaps = 9/412 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L LFV A +PVLK L+ITA+G  LA +RVDILG  +R +LN +VFYVF+PALV S+L
Sbjct  1     MELLQLFVTASIPVLKVLLITALGSYLALDRVDILGEVTRKNLNTVVFYVFSPALVGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+VK+WFMPVNIL+TF IGS LGWIL+++TR P  L GLV+ CCAAGNLGNLL
Sbjct  61    AKTITYESMVKMWFMPVNILITFIIGSVLGWILIQLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR---AYGTPRMN  642
             LII+PAVC+E+ SPFG P  C T   AYASLSMAIGAVY+W+Y+YNI+R     GT   N
Sbjct  121   LIIVPAVCKEKGSPFGAPDVCHTYAMAYASLSMAIGAVYLWSYVYNIVRISSTRGTQDSN  180

Query  643   SSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQI------VFEEEEKPSELKRLRQNVKM  804
              ST+   +    SC E LLSS      ++   Q       V EE+ K +   +L+Q + M
Sbjct  181   QSTERSPTSDQVSCTEPLLSSKEYVIVEESGDQYSLPYTAVPEEKPKVTTSGKLKQRIVM  240

Query  805   WADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMT  984
               +KINLK +FAPSTI  IVG  IGV+  +RKL+I D APL VI  +A +LGD AIPA+T
Sbjct  241   VFEKINLKTIFAPSTIGAIVGFAIGVIPQIRKLLIGDGAPLRVIQDTAYLLGDGAIPALT  300

Query  985   LIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLL  1164
             LI+G NLL+GL+ S I   +V+G+ VVR+V LPL GI VI  A  FG V SD LY FVLL
Sbjct  301   LIIGGNLLKGLRGSGIQKSLVVGIIVVRYVALPLIGILVIKGALKFGLVHSDPLYLFVLL  360

Query  1165  LQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LQ++LP AM IGT+TQLF  GE+ECSVIMLW Y+ ASL+LT W+  FMWI++
Sbjct  361   LQFSLPPAMNIGTMTQLFGAGENECSVIMLWTYAFASLSLTFWSAAFMWIVT  412



>ref|XP_006435464.1| hypothetical protein CICLE_v10001325mg [Citrus clementina]
 gb|ESR48704.1| hypothetical protein CICLE_v10001325mg [Citrus clementina]
Length=412

 Score =   387 bits (995),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 231/417 (55%), Positives = 294/417 (71%), Gaps = 19/417 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ + +PVLK L+ITA+G  LA + V+ILG  +R H+NNLVFYVF PALVAS+L
Sbjct  1     MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S++KLWFMP N+L+TF +GS LGWI+V+ TR P  L GL++ CCAAGNLGN+ 
Sbjct  61    ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHLRGLIVGCCAAGNLGNMP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT-------  630
             LIIIPAVC+E+ SPFG P TC T G AYASLSMA+GA+Y+W+Y+YNI+RA  T       
Sbjct  121   LIIIPAVCKEKGSPFGSPDTCQTYGLAYASLSMAVGAIYLWSYVYNIVRASSTGISRESR  180

Query  631   ----PRMNSSTD--IMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQ  792
                 P   S  D  I G+G   SC E LLSS       D+ A      E K S    ++Q
Sbjct  181   TIDEPFSKSVADGSISGTG---SCSEPLLSSKEFLTPADQLALPCTISEVKGSY--SMKQ  235

Query  793   NVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAI  972
              VK++  KINLK MFAPSTI  + G +IG+V   RK +I D+APL VI  SA ++GD AI
Sbjct  236   QVKLFFAKINLKSMFAPSTIGALAGFIIGLVPLFRKSMIGDSAPLRVIQDSASLIGDGAI  295

Query  973   PAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDS-LY  1149
             P +TL+VG NLLRGL+ S I   +V G+ V R+V LPL GI ++  A  FG+V SD  LY
Sbjct  296   PTVTLVVGGNLLRGLRGSGIQKSIVFGIVVARYVALPLVGIVIVKGAVRFGFVCSDDLLY  355

Query  1150  HFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              F+LLLQ+A+P AM IGTITQLF  GESECSVIMLW Y++AS+++TLW+T+F+W++S
Sbjct  356   QFILLLQFAMPPAMNIGTITQLFGAGESECSVIMLWTYALASVSITLWSTFFLWLVS  412



>ref|XP_009798616.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009798617.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009798618.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana sylvestris]
Length=418

 Score =   387 bits (994),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 221/424 (52%), Positives = 297/424 (70%), Gaps = 27/424 (6%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ A MPVLK L+ITA+GLVLA +R+D+LG  +R HLNN+VF+VF PALV+S+L
Sbjct  1     MGLLDLFIAASMPVLKVLLITALGLVLALDRIDLLGEDARKHLNNIVFFVFNPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT+ S+ KLWFMP+NIL TF IGS LGW +++ITR P+ L GLV+ CCAAGNLGN+L
Sbjct  61    AKTITSESMKKLWFMPINILFTFIIGSILGWAVIQITRPPQHLRGLVVGCCAAGNLGNML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR-----------  618
             LIIIPAVC+E+ SPFGDP  C T G  YASLSMA+GA+Y+W+Y+YNI+R           
Sbjct  121   LIIIPAVCKEKGSPFGDPGICHTYGMGYASLSMAVGAIYLWSYVYNIVRISSSKSSKEVE  180

Query  619   -----AYGTPRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQI-----VFEEEEKP  768
                  A  +PR +S +       L +  E+LL S +    +    Q+      F+ + + 
Sbjct  181   INDSSASRSPRESSISQ------LGTSTESLLPSKAFNGSESPPEQLELPSTRFDHKTQM  234

Query  769   SELKRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSA  948
                 + +Q +++ + KINLK + APST   + G ++G++  +RKL+I D APLHVI+ +A
Sbjct  235   QPGTKFKQYMEIISRKINLKRLLAPSTTGALAGFIVGLIPQIRKLMIGDVAPLHVIEDTA  294

Query  949   DMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGW  1128
              +LGD AIP +TLI+G NLL+GL  S I   +++G+  VR++ LPL GI V+  A H G 
Sbjct  295   ILLGDGAIPLLTLIMGGNLLKGLTGSGIQKSLLVGIIGVRYIALPLIGIAVVKGAIHLGL  354

Query  1129  VGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFM  1308
             V  D LY FVLLLQ+ALP AM IGTITQLF  GESECSVIM W Y++AS++LTLWTT+FM
Sbjct  355   VQHDPLYQFVLLLQFALPPAMNIGTITQLFGAGESECSVIMFWAYALASVSLTLWTTFFM  414

Query  1309  WILS  1320
             W+++
Sbjct  415   WLVA  418



>ref|XP_009592191.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009592265.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009592327.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana tomentosiformis]
Length=418

 Score =   387 bits (993),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 221/424 (52%), Positives = 297/424 (70%), Gaps = 27/424 (6%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ A MPVLK L+ITA+GLVLA +R+D+LG  +R HLNN+VF+VF PALV+S+L
Sbjct  1     MGLLDLFIAASMPVLKVLLITALGLVLALDRIDLLGEDARKHLNNIVFFVFNPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT+ S+ KLWFMP+NIL TF IGS LGW +++ITR P+ L GLV+ CCAAGNLGN+L
Sbjct  61    AKTITSESMKKLWFMPLNILFTFIIGSILGWAVIQITRPPQHLRGLVVGCCAAGNLGNML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR-----------  618
             LIIIPAVC+E+ SPFGDP  C T G  YASLSMA+GA+Y+W+Y+YNI+R           
Sbjct  121   LIIIPAVCKEKGSPFGDPGVCHTYGMGYASLSMAVGAIYLWSYVYNIVRISSSKSSKEVE  180

Query  619   -----AYGTPRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQI-----VFEEEEKP  768
                  A  +PR +S +       L +  E+LL S +    +    Q+      F+ + + 
Sbjct  181   INDSSASRSPRESSISQ------LGTSTESLLPSKAFNGSESPPEQLELPSTRFDHKTQM  234

Query  769   SELKRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSA  948
                 + +Q +++ + KINLK + APST   + G ++G++  +RKL+I D APLHVI+ +A
Sbjct  235   QPGTKFKQYMEIISRKINLKRLLAPSTTGALAGFIVGLIPQIRKLMIGDVAPLHVIEDTA  294

Query  949   DMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGW  1128
              +LGD AIP +TLI+G NLL+GL  S I   +++G+  VR++ LPL GI V+  A H G 
Sbjct  295   ILLGDGAIPLLTLIMGGNLLKGLTGSGIQKSLLVGIIGVRYIALPLIGIAVVKGAIHLGL  354

Query  1129  VGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFM  1308
             V  D LY FVLLLQ+ALP AM IGTITQLF  GESECSVIM W Y++AS++LTLWTT+FM
Sbjct  355   VQHDPLYQFVLLLQFALPPAMNIGTITQLFGAGESECSVIMFWAYALASVSLTLWTTFFM  414

Query  1309  WILS  1320
             W+++
Sbjct  415   WLVA  418



>gb|KDO85258.1| hypothetical protein CISIN_1g015164mg [Citrus sinensis]
Length=412

 Score =   385 bits (988),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 229/417 (55%), Positives = 293/417 (70%), Gaps = 19/417 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ + +PVLK L+ITA+G  LA + V+ILG  +R H+NNLVFYVF PALVAS+L
Sbjct  1     MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S++KLWFMP N+L+TF +GS LGWI+V+ TR P    GL++ CCAAGNLGN+ 
Sbjct  61    ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHFRGLIVGCCAAGNLGNMP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT-------  630
             LIIIPAVC+E+ SPFG P TC T G AY SLSMA+GA+Y+W+Y+YNI+RA  T       
Sbjct  121   LIIIPAVCKEKGSPFGSPDTCQTYGLAYVSLSMAVGAIYLWSYVYNIVRASSTGISRESR  180

Query  631   ----PRMNSSTD--IMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQ  792
                 P   S  D  I G+G   SC E LLSS       D+ A      E K S    ++Q
Sbjct  181   TIDEPFSKSVADGSISGTG---SCSEPLLSSKEFLTPADQLALPCTISEVKGSY--SMKQ  235

Query  793   NVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAI  972
              VK++  KINLK MFAPSTI  + G +IG+V  +RK +I D+APL VI  SA ++GD AI
Sbjct  236   QVKLFFAKINLKSMFAPSTIGALAGFIIGLVPLIRKSMIGDSAPLRVIQDSASLIGDGAI  295

Query  973   PAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDS-LY  1149
             P +TL+VG NLLRGL+ S I   +V G+ V R+V LPL GI ++  A  FG+V SD  LY
Sbjct  296   PTVTLVVGGNLLRGLRGSGIQKSIVFGIVVARYVALPLVGIVIVKGAVRFGFVCSDDLLY  355

Query  1150  HFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              F+LLLQ+A+P AM IGTITQLF  GESECSVIMLW Y++AS+++TLW+T+F+W++S
Sbjct  356   QFILLLQFAMPPAMNIGTITQLFGAGESECSVIMLWTYALASVSITLWSTFFLWLVS  412



>ref|XP_010033614.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus 
grandis]
 ref|XP_010033615.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus 
grandis]
 ref|XP_010033616.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus 
grandis]
 ref|XP_010033617.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus 
grandis]
 gb|KCW53315.1| hypothetical protein EUGRSUZ_J02568 [Eucalyptus grandis]
Length=418

 Score =   385 bits (988),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 225/420 (54%), Positives = 305/420 (73%), Gaps = 19/420 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MAFLDLF+VA MPVLK L++TA+GL LA E VDI+G S+R  +N + F+VF PALV S+L
Sbjct  1     MAFLDLFLVASMPVLKVLLVTALGLYLALESVDIMGESTRRQMNRVAFFVFNPALVGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               T+T+ +IV+LWFMP+NIL+TF IGSALGWILVK+TRAP+ + GL++ CCA+GNLGNL 
Sbjct  61    ARTVTSENIVQLWFMPINILITFIIGSALGWILVKVTRAPQHVKGLILGCCASGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR------AYGTP  633
             LIIIPAVC+E+ SPFG+P  C   G AYAS+SMAIGAVY+W+Y++NI+R        G  
Sbjct  121   LIIIPAVCKEQGSPFGEPDVCYKYGMAYASISMAIGAVYLWSYVFNIVRVSASKITRGEE  180

Query  634   RMN-------SSTDIMGSGFLDSCREALL-SSHSLKYDQDEEAQIVFEEEEKPSELK---  780
             ++N       S+TD      +  C EAL+ S+     D  +E  +   + E  S++    
Sbjct  181   KINESVKNPRSTTDT--KKLVQECPEALVPSTKCASTDNLDELTLPLVKPEVNSQVSTWG  238

Query  781   RLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLG  960
             +L+ ++   + KINL+ + APSTI  IVG ++GVV  +R L+I   APL VI+ SA +LG
Sbjct  239   KLKHSLTKISKKINLQTLLAPSTIGAIVGFIVGVVPHIRGLLIGTGAPLRVIEDSASLLG  298

Query  961   DAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSD  1140
             DAAIPA+TLI+G NLLRGL+ S +   ++ GV V+R+++LP+ GI ++  A +FG V  D
Sbjct  299   DAAIPAVTLIMGGNLLRGLRGSGVQLSLIAGVVVIRYIVLPIVGIFIVKGALYFGLVHED  358

Query  1141  SLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              LY FVLLLQYALP AM IGT+TQLF  GESECSV+MLW Y++AS+ALT+W+T+FMW+++
Sbjct  359   PLYLFVLLLQYALPPAMNIGTMTQLFGAGESECSVVMLWTYALASIALTVWSTFFMWLVA  418



>ref|XP_006473865.1| PREDICTED: uncharacterized transporter YBR287W-like [Citrus sinensis]
Length=412

 Score =   384 bits (987),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 229/417 (55%), Positives = 293/417 (70%), Gaps = 19/417 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ + +PVLK L+ITA+G  LA + V+ILG  +R H+NNLVFYVF PALVAS+L
Sbjct  1     MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S++KLWFMP N+L+TF +GS LGWI+V+ TR P    GL++ CCAAGNLGN+ 
Sbjct  61    ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHFRGLIVGCCAAGNLGNMP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT-------  630
             LIIIPAVC+E+ SPFG P TC T G AY SLSMA+GA+Y+W+Y+YNI+RA  T       
Sbjct  121   LIIIPAVCKEKGSPFGSPDTCQTYGLAYVSLSMAVGAIYLWSYVYNIVRASSTAISRESR  180

Query  631   ----PRMNSSTD--IMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQ  792
                 P   S  D  I G+G   SC E LLSS       D+ A      E K S    ++Q
Sbjct  181   TIDEPFGKSVADGSISGTG---SCSEPLLSSKEFLTPADQLALPCTISEVKGSY--SMKQ  235

Query  793   NVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAI  972
              VK++  KINLK MFAPSTI  + G +IG+V  +RK +I D+APL VI  SA ++GD AI
Sbjct  236   QVKLFFAKINLKSMFAPSTIGALAGFIIGLVPLIRKSMIGDSAPLRVIQDSASLIGDGAI  295

Query  973   PAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDS-LY  1149
             P +TL+VG NLLRGL+ S I   +V G+ V R+V LPL GI ++  A  FG+V SD  LY
Sbjct  296   PTVTLVVGGNLLRGLRGSGIQKSIVFGIVVARYVALPLVGIVIVKGAVRFGFVCSDDLLY  355

Query  1150  HFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              F+LLLQ+A+P AM IGTITQLF  GESECSVIMLW Y++AS+++TLW+T+F+W++S
Sbjct  356   QFILLLQFAMPPAMNIGTITQLFGAGESECSVIMLWTYALASVSITLWSTFFLWLVS  412



>ref|XP_009372645.1| PREDICTED: uncharacterized transporter YBR287W-like [Pyrus x 
bretschneideri]
 ref|XP_009372646.1| PREDICTED: uncharacterized transporter YBR287W-like [Pyrus x 
bretschneideri]
Length=414

 Score =   384 bits (985),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 232/412 (56%), Positives = 294/412 (71%), Gaps = 9/412 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L LFV A +PVLK L+ITA+G  LA +RVD+LG  +R ++N +VFYVF PALV S+L
Sbjct  1     MELLQLFVTASIPVLKVLLITALGSYLALDRVDVLGEVTRKNVNTVVFYVFNPALVGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S+VKLWFMPVNIL+TF IGS LGWIL+++TR P  L GLV+ CCAAGNLGNLL
Sbjct  61    ARTITYQSMVKLWFMPVNILITFIIGSVLGWILLQLTRPPARLRGLVLGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR---AYGTPRMN  642
             LII+PAVC+E+ SPFG P  C T   AYASLSMA GAVY+W+Y+YNI+R     GT   N
Sbjct  121   LIIVPAVCKEKGSPFGAPDVCHTYAMAYASLSMATGAVYLWSYVYNIVRISSIRGTQDSN  180

Query  643   SSTDIMGSGFLDSCREALLSSH---SLKYDQDEEA---QIVFEEEEKPSELKRLRQNVKM  804
              S +   +    SC E LLSS    ++  ++D+ A     V EEE K +   +L++++ M
Sbjct  181   QSAEKYSTSDQASCTEPLLSSKERVTVGENRDQYALPYTAVAEEEAKATTSSKLKKHIVM  240

Query  805   WADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMT  984
                KINLK +FAPST   +VG  IGV+  +R L+I D+APL VI  +A +LGD AIPA+T
Sbjct  241   VFKKINLKAIFAPSTTGAVVGFAIGVIPQIRNLLIGDDAPLRVIQDTAYLLGDGAIPALT  300

Query  985   LIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLL  1164
             LI+G NLL+GL+ S I   +V+G+ VVR+V LPL GI VI  A  FG V SD LY FVLL
Sbjct  301   LIIGGNLLKGLRGSGIQKSLVVGIIVVRYVALPLIGILVIKGALKFGLVHSDPLYLFVLL  360

Query  1165  LQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LQ++LP AM IGT+TQLF  GE+ECSVIMLW Y+ ASL+LT W+  FMW+++
Sbjct  361   LQFSLPPAMNIGTMTQLFGAGENECSVIMLWTYAFASLSLTFWSAVFMWLVT  412



>ref|XP_008373331.1| PREDICTED: uncharacterized transporter YBR287W-like [Malus domestica]
Length=414

 Score =   379 bits (974),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 234/412 (57%), Positives = 290/412 (70%), Gaps = 9/412 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L LFV A +PVLK L+ITA+G  LA +RVDILG  +R +LN +VFYVF+PALV S+L
Sbjct  1     MELLQLFVTASIPVLKVLLITALGSYLALDRVDILGEVTRKNLNTVVFYVFSPALVGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+VK+WFMPVNIL+TF IGS LGWIL+++TR P  L GLV+ CCAAGNLGNLL
Sbjct  61    AKTITYESMVKMWFMPVNILITFIIGSVLGWILIQLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR---AYGTPRMN  642
             LII+PAVC+E+ SPFG P  C T   AYASLSMAIGAVY+W+Y+YNI+R     GT   N
Sbjct  121   LIIVPAVCKEKGSPFGAPDVCHTYAMAYASLSMAIGAVYLWSYVYNIVRISSTRGTQDSN  180

Query  643   SSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVF------EEEEKPSELKRLRQNVKM  804
              S +   +    SC E LLSS      ++   Q         EE+ K     +L+Q + M
Sbjct  181   QSAERSPTSDQVSCTEPLLSSKEYVIVEENGDQYSLPYTAXPEEKPKXXTSGKLKQRIVM  240

Query  805   WADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMT  984
               +KINLK +FAPSTI  IVG  IGV+  +RKL+I D APL VI  +A +LGD AIPA+T
Sbjct  241   VFEKINLKTIFAPSTIGAIVGFAIGVIPQIRKLLIGDGAPLRVIQDTAYLLGDGAIPALT  300

Query  985   LIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLL  1164
             LI+G NLL+GL+ S I   +V+G+ VVR+V LPL GI VI  A  FG V SD LY FVLL
Sbjct  301   LIIGGNLLKGLRGSGIQKSLVVGIIVVRYVALPLIGILVIKGALKFGLVHSDPLYLFVLL  360

Query  1165  LQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LQ++LP AM IGT+TQLF  GE+ECSVIML  Y+ ASL+LT W+  FMW ++
Sbjct  361   LQFSLPPAMNIGTMTQLFGAGENECSVIMLXTYAFASLSLTFWSAAFMWXVT  412



>ref|XP_006342188.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Solanum tuberosum]
 ref|XP_006342189.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Solanum tuberosum]
Length=407

 Score =   378 bits (971),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 223/408 (55%), Positives = 291/408 (71%), Gaps = 6/408 (1%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ A MPVLK L+ITA+GL+LA +R+D+LG  +R HLNN+VF+V  PALV+S+L
Sbjct  1     MGLLDLFITASMPVLKVLLITALGLILALDRIDLLGQDARKHLNNIVFFVLNPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+ KLWFMP NIL TF +GS LGW +++ITR P+ L GLV+ CCAAGNLGN+L
Sbjct  61    AKTITYESLKKLWFMPFNILFTFIVGSILGWAVLQITRPPQHLRGLVVGCCAAGNLGNML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPAVC+E+ SPFGDP  C T G +YASLSMA+GA+Y+W+Y+YNI+R   + R +   
Sbjct  121   LIIIPAVCKEKGSPFGDPGVCHTYGMSYASLSMAVGAIYLWSYVYNIVRISSS-RSSKEV  179

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQI-----VFEEEEKPSELKRLRQNVKMWADK  816
              I  S      RE  +S+ SL   +    Q+      F+ + +     RL+Q ++  + K
Sbjct  180   GINDSSASICSREGSISTESLLPAKAPPEQLGIPSTRFDHKTQAHHGARLKQFMENVSRK  239

Query  817   INLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVG  996
             INLK + APST   I G  +G+V  +RKL+I D APL VI++SA +LGD AIP +TLI+G
Sbjct  240   INLKRLLAPSTTGAIAGFTVGLVPQIRKLMIGDVAPLRVIENSAILLGDGAIPLLTLIMG  299

Query  997   ANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYA  1176
              NLL+GL  S I   +++G+ VVR++ LPL GI V+  A   G V  D LY FVLLLQ+A
Sbjct  300   GNLLKGLTGSGIQKSLLLGIIVVRYIALPLIGIVVVKGAIRLGLVQHDPLYQFVLLLQFA  359

Query  1177  LPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LP AM IGTITQLF  GESECSVIM W Y++AS+ALTLWTT+FMW++S
Sbjct  360   LPPAMNIGTITQLFGAGESECSVIMFWAYALASIALTLWTTFFMWLVS  407



>ref|XP_008373350.1| PREDICTED: uncharacterized transporter YBR287W-like [Malus domestica]
 ref|XP_008373351.1| PREDICTED: uncharacterized transporter YBR287W-like [Malus domestica]
Length=414

 Score =   377 bits (969),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 230/412 (56%), Positives = 289/412 (70%), Gaps = 9/412 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L LFV A +PVLK L+ITA+G  LA +RVDILG  +R ++N +VFYVF PALV S+L
Sbjct  1     MELLQLFVTASIPVLKVLLITALGSYLALDRVDILGEVTRKNVNTVVFYVFNPALVGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S+ KLWFMPVNIL+TF IGS LGWIL+++TR P  L GLV+ CCAAGNLGNLL
Sbjct  61    ARTITYQSMAKLWFMPVNILITFIIGSVLGWILIQLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PAVC+E+ SPFG P  C T   AYASLSMAIGAVY+W+Y+YNI+R   T  +  S 
Sbjct  121   LIIVPAVCKEKGSPFGAPDVCHTYAMAYASLSMAIGAVYLWSYVYNIVRISSTRGIQDSN  180

Query  652   DIMGSGFLD---SCREALLSSH---SLKYDQDEEA---QIVFEEEEKPSELKRLRQNVKM  804
                   F     SC E LLSS    ++  +QD+ A     V EE  K +   +L++++ M
Sbjct  181   QSAEKSFTSDQASCTEPLLSSKECVTVGENQDQYALPYTAVPEEAAKATTSSKLKKHIVM  240

Query  805   WADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMT  984
                KINLK +FAPST   +VG  IGV+  +R L+I D APL VI  +A +LG+ AIPA+T
Sbjct  241   VFKKINLKAIFAPSTTGAVVGFAIGVIPQIRNLLIGDGAPLRVIQDTAYLLGNGAIPALT  300

Query  985   LIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLL  1164
             LI+G NLL+GL+ S I   +V+G+ VVR+V LPL GI VI  A  FG V  D LY FVLL
Sbjct  301   LIIGGNLLKGLRGSGIQKSLVVGIIVVRYVALPLIGILVIKGALKFGLVHXDPLYLFVLL  360

Query  1165  LQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LQ++LP AM IGT+TQLF  GE+ECSVIMLW Y+ ASL+LT W+  FMW+++
Sbjct  361   LQFSLPPAMNIGTMTQLFGAGENECSVIMLWTYAFASLSLTFWSAAFMWLVT  412



>ref|XP_008364468.1| PREDICTED: uncharacterized transporter YBR287W-like [Malus domestica]
Length=414

 Score =   377 bits (969),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 231/412 (56%), Positives = 289/412 (70%), Gaps = 9/412 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L LFV A +PVLK L+ITA+G  LA +RVDILG  +R +LN +VFYVF+PALV S+L
Sbjct  1     MELLQLFVTASIPVLKVLLITALGSYLALDRVDILGEVTRKNLNTVVFYVFSPALVGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+VK+WFMPVNIL+TF IGS LGWIL+++TR P  L GLV+ CCAAGNLGNLL
Sbjct  61    AKTITYESMVKMWFMPVNILITFIIGSVLGWILIQLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR---AYGTPRMN  642
             LII+PAVC+E+ SPFG P  C T   AYASLSMAIGAVY+W+Y+YNI+R     GT   N
Sbjct  121   LIIVPAVCKEKGSPFGAPDVCHTYAMAYASLSMAIGAVYLWSYVYNIVRISSTRGTQDSN  180

Query  643   SSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVF------EEEEKPSELKRLRQNVKM  804
              S +   +    SC E LLSS      ++   Q         EE+ K     +L+Q + M
Sbjct  181   QSAERSPTSDQVSCTEPLLSSKEYVIVEENGDQYSLPYTAXPEEKPKXXTSGKLKQRIVM  240

Query  805   WADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMT  984
               +KINLK +FAPSTI   VG  IGV+  +R L+I D APL VI  +A +LG+ AIPA+T
Sbjct  241   VFEKINLKTIFAPSTIGAXVGFAIGVIPQIRXLLIGDGAPLRVIQDTAYLLGNGAIPALT  300

Query  985   LIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLL  1164
             LI+G NLL+GL+ S I   +V+G+ VVR+V LPL GI VI  A  FG V  D LY FVLL
Sbjct  301   LIIGGNLLKGLRGSGIQKSLVVGIIVVRYVALPLIGILVIKGALKFGLVHXDPLYLFVLL  360

Query  1165  LQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LQ++LP AM IGT+TQLF  GE+ECSVIMLW Y+ ASL+LT W+  FMW+++
Sbjct  361   LQFSLPPAMNIGTMTQLFGAGENECSVIMLWTYAFASLSLTFWSAAFMWLVT  412



>ref|XP_004238466.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
lycopersicum]
 ref|XP_010320486.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
lycopersicum]
 ref|XP_010320487.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
lycopersicum]
Length=407

 Score =   377 bits (967),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 221/408 (54%), Positives = 293/408 (72%), Gaps = 6/408 (1%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ A MPVLK L+ITA+GL+LA +R+D+LG  +R HLNN+VF+V  PALV+S+L
Sbjct  1     MGLLDLFITASMPVLKVLLITALGLILALDRIDLLGQDARKHLNNIVFFVLNPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T  S+ KLWFMP NIL TF  GS LGW ++++TR P+ L GLV+ CCAAGNLGN+L
Sbjct  61    AKTVTYESLKKLWFMPFNILFTFVAGSILGWAVLQVTRPPQHLRGLVVGCCAAGNLGNML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPAVC+E+ SPFGDP  C T G +YASLSMA+GA+Y+W+Y+YNI+R   + R +   
Sbjct  121   LIIIPAVCKEKGSPFGDPGVCHTYGMSYASLSMAVGAIYLWSYVYNIVRISSS-RSSKEV  179

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQI-----VFEEEEKPSELKRLRQNVKMWADK  816
             +I  S    S RE  +S+ SL   +    Q+      F+ + +     RL+Q ++  + K
Sbjct  180   EINDSSTSISSREGSISTESLLPAKAPPEQLGLPSTRFDHKTQAHLATRLKQLMENVSRK  239

Query  817   INLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVG  996
             INLK + APST   I G ++G+V  +RKL+I D APL VI++SA +LGD AIP +TLI+G
Sbjct  240   INLKRLLAPSTTGAIAGFIVGLVPQMRKLMIGDVAPLRVIENSAILLGDGAIPLLTLIMG  299

Query  997   ANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYA  1176
              NLL+GL  S I   +++G+ VVR++ LPL GI V+  A   G V  D LY FVLLLQ+A
Sbjct  300   GNLLKGLTGSGIQKSLLLGIIVVRYIALPLIGIVVVKGAIRLGLVQHDPLYQFVLLLQFA  359

Query  1177  LPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LP AM IGTITQLF  GESECSVIM W Y++AS++LTLWTT+FMW++S
Sbjct  360   LPPAMNIGTITQLFGAGESECSVIMFWAYALASISLTLWTTFFMWLVS  407



>gb|KDP36734.1| hypothetical protein JCGZ_08025 [Jatropha curcas]
Length=402

 Score =   375 bits (962),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 224/409 (55%), Positives = 291/409 (71%), Gaps = 13/409 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MA LDLF+ + +PVLK L+IT +G  LA +RVDIL   +R H+NN+VFYVF+PALV + L
Sbjct  1     MALLDLFIASSIPVLKVLMITGLGTFLALDRVDILKGDARKHVNNVVFYVFSPALVGTKL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  SIVK+WFMP+NIL+TF IGS LGWILV++TR P  L GL++ CCAAGNLGN+L
Sbjct  61    AETITYESIVKMWFMPLNILITFIIGSMLGWILVQLTRPPSHLRGLIVGCCAAGNLGNML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI+IPA+C+E+ SPFG P  C + G AY SLSMAIGAVY+WTY+YNI+R     +  + T
Sbjct  121   LIMIPAICKEKGSPFGAPDVCQSYGLAYVSLSMAIGAVYLWTYVYNIVR-----KSTAGT  175

Query  652   DIMGSGFLDSCREALL-SSHSLKYDQ--DEEAQIVFEEEEKPSEL---KRLRQNVKMWAD  813
                  G  ++C E LL S  SL Y+    E A  V + + +P +    KRL + V     
Sbjct  176   GKESPG--ETCTEPLLPSKESLPYENHIHEYALPVSKSDGQPEDFPSYKRLIRTVLGSIG  233

Query  814   KINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIV  993
              IN K +FAPSTI  IVG VIG+V ++RKL+I   APLHVI  +  +LG+AAIP +TLI+
Sbjct  234   SINWKTVFAPSTIGAIVGFVIGLVPYIRKLLIGVEAPLHVIRDTTSLLGEAAIPTLTLIL  293

Query  994   GANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQY  1173
             G NLL+GLK   I   V+ G+ V R++ LPL GI ++  A  FG++ SD LY FVLLLQ+
Sbjct  294   GGNLLKGLKGQGIQKSVLFGIIVARYIALPLIGIVIVKGALRFGFIPSDPLYQFVLLLQF  353

Query  1174  ALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             A+P AM IG ITQLF  GE+ECSVIM W Y++AS++LTLW+T FMW+++
Sbjct  354   AVPPAMNIGVITQLFGAGETECSVIMFWAYALASVSLTLWSTIFMWLVA  402



>ref|XP_006416347.1| hypothetical protein EUTSA_v10009415mg, partial [Eutrema salsugineum]
 gb|ESQ34700.1| hypothetical protein EUTSA_v10009415mg, partial [Eutrema salsugineum]
Length=401

 Score =   373 bits (958),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 212/403 (53%), Positives = 285/403 (71%), Gaps = 20/403 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ + +PV+K L+ITAIG  LA +RV+IL   +R HLNN+VFYVF+P+LV SSL
Sbjct  19    MKLLDLFITSSIPVVKILVITAIGFYLALDRVNILNQDARKHLNNIVFYVFSPSLVGSSL  78

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  S+VK+WFMP+N+LLTF IGS LGWI++KIT+ P  LHG+++ CCAAGNLGN+ 
Sbjct  79    SETITYESMVKMWFMPINVLLTFIIGSFLGWIVIKITKPPSHLHGIIVGCCAAGNLGNMP  138

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPA+C E+ SPFGDP TC   G  Y +LSMA+GA+YIWTY+YN++R    P  +  T
Sbjct  139   LIIIPAICNEKGSPFGDPETCEKYGLGYIALSMAVGAIYIWTYVYNLMRMLANP--DRET  196

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKM  831
              I+G+    S    +   H                EE+     +++Q V   A+KINL+ 
Sbjct  197   PILGT---SSTMPLIPPKHV---------------EEQFGTWSKIKQRVCSAAEKINLRT  238

Query  832   MFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLR  1011
             +FAPSTIA ++ + IG+V  LRKL++ + APL V+  S  +LG+ AIP +TLIVG NLLR
Sbjct  239   IFAPSTIAALIALAIGLVPTLRKLLVGNTAPLRVLGESVSLLGEGAIPLLTLIVGGNLLR  298

Query  1012  GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAM  1191
             GL+ S I   V++GV V R+VLLP+ G+ ++  A H G V S+ LY FVLLLQY +P AM
Sbjct  299   GLRGSGIQRSVILGVVVARYVLLPITGVLIVQGAHHLGLVTSEPLYQFVLLLQYVVPPAM  358

Query  1192  GIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              +GTITQLF  GESECSVI+ W Y++AS++LT+W T+FMW+++
Sbjct  359   NLGTITQLFGSGESECSVILFWTYALASVSLTVWPTFFMWLVA  401



>ref|XP_010266292.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
 ref|XP_010266293.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
 ref|XP_010266294.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
 ref|XP_010266295.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
 ref|XP_010266296.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
 ref|XP_010266297.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
Length=418

 Score =   373 bits (958),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 218/418 (52%), Positives = 299/418 (72%), Gaps = 15/418 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLFVVA +PVLK LI+T +G  LA +R+DILG  +R HLN +VF+VF PALVA +L
Sbjct  1     MELLDLFVVATIPVLKVLIVTGVGSFLAIDRIDILGEDARKHLNRVVFFVFNPALVAINL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S+V LWFMP NILLTF IGSALGW++++IT+AP  L GL++ CC+AGNLGN+L
Sbjct  61    ARTITFESMVMLWFMPFNILLTFIIGSALGWMVIQITKAPSNLRGLILGCCSAGNLGNML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY--GTPRMNS  645
             LIIIPAVC E+ SPFG    C   G AY+SLSMAIGAVY+W+Y++NI+R Y   +  +  
Sbjct  121   LIIIPAVCREKGSPFGANDVCYKYGMAYSSLSMAIGAVYLWSYVFNIVRIYSRSSRGVEV  180

Query  646   STDIMGSGF--------LDSCREALLSSHSLKYDQDEEAQ--IVFEEEEKPSELK---RL  786
             +  I+ S F        + S  EALL S       + E Q  + F   E+ +E+    ++
Sbjct  181   NESIITSEFPQESSKIPVGSSTEALLPSKDYLISDNYEDQFSLHFTTYERNTEVPISVKI  240

Query  787   RQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDA  966
             ++++K    KI+LK +FAPST   +VG V+G++  +R+ +I + APLHVI  SA +L D 
Sbjct  241   KKHLKNLCGKISLKALFAPSTAGAVVGFVVGIIPQIRRAMIGETAPLHVIGDSASLLSDG  300

Query  967   AIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSL  1146
             AIP+++L++GANLL+GL+KS +   ++ G+ +VR++ LPL GI ++  A HFGWV SD L
Sbjct  301   AIPSVSLVMGANLLKGLQKSEVQLSIIFGIIIVRYIALPLLGIVIVKGAIHFGWVHSDPL  360

Query  1147  YHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             Y F+LLLQ+ALP AM IGT+TQLF  G+SECSVIMLW Y++AS++LTLW+T FMW+++
Sbjct  361   YQFILLLQFALPPAMNIGTMTQLFGEGQSECSVIMLWTYALASISLTLWSTLFMWLVA  418



>ref|XP_010029548.1| PREDICTED: uncharacterized transporter YBR287W-like [Eucalyptus 
grandis]
 gb|KCW56461.1| hypothetical protein EUGRSUZ_I02197 [Eucalyptus grandis]
Length=395

 Score =   372 bits (954),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 225/412 (55%), Positives = 292/412 (71%), Gaps = 26/412 (6%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MAF DLFVVALMPVLK LIIT IGLVLA ERV++LG ++RH+LN LVFYVF PALV S L
Sbjct  1     MAFWDLFVVALMPVLKVLIITGIGLVLALERVNLLGQNARHYLNELVFYVFGPALVCSYL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ET+T  S+ +LWFMPVNILLTF IGS                 GLV+ CCAAGNLGNLL
Sbjct  61    AETVTLESLEELWFMPVNILLTFIIGS-----------------GLVMGCCAAGNLGNLL  103

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR--AYGTPRM--  639
             LIIIPA+C+E +SPFGD TTC+TNG  Y SLSM+IGA+YIW+Y+Y IIR  A   P    
Sbjct  104   LIIIPAICDESDSPFGDSTTCTTNGDTYTSLSMSIGAIYIWSYVYVIIRISANKAPSTLG  163

Query  640   NSSTDIMGSG-----FLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKM  804
              + + I   G       +S  E  L S +L+         + E E K + L+R+R+  KM
Sbjct  164   ENGSRIKSPGQTSETHAESTTEPFLQSITLEESSAPVDSSIVESEGKETFLQRIRKTAKM  223

Query  805   WADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMT  984
                 I+LKM+  P TI  I+G +IG+VS +R ++I D+APL  I+SS  +LG+A +P+ T
Sbjct  224   LTCGIDLKMLLTPITIGAIIGFIIGIVSPIRDVLIGDDAPLRFIESSILLLGEALVPSQT  283

Query  985   LIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLL  1164
             LIVGANLLRGL++S +   V++GV +V+++ +P+ G+GV+  A HFG VGSD L+ FVL+
Sbjct  284   LIVGANLLRGLQRSEVNIVVILGVILVKYIAMPIIGVGVVKAAAHFGLVGSDPLFQFVLM  343

Query  1165  LQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LQ+ALP AM +GTITQLF  GE ECSV+MLW Y+VA+L+LTLW+T+FMW+++
Sbjct  344   LQFALPPAMSVGTITQLFGAGEGECSVVMLWTYAVAALSLTLWSTFFMWLVA  395



>gb|KHG24871.1| Transporter protein [Gossypium arboreum]
Length=402

 Score =   371 bits (953),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 216/411 (53%), Positives = 295/411 (72%), Gaps = 17/411 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL++F+VALMPVLK +++T IGL +A + + +LG  + HHLNN+VFYV +PA+ ASSL
Sbjct  1     MGFLNIFIVALMPVLKVILMTGIGLFIALDHIKLLGPEANHHLNNIVFYVLSPAIAASSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  S + LWFMP+NILLTF  GS L W+L+KIT+ P+ L G+VI CC+AGNLGNL 
Sbjct  61    AETITFQSFITLWFMPLNILLTFVFGSILAWLLIKITKTPKHLRGIVIGCCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY---GTPRMN  642
             LI++PAVCEE N+PFGDP+ CS   + YASLS+A+G + IW+Y++ ++R Y   GT    
Sbjct  121   LIMVPAVCEEANNPFGDPSVCSLLARPYASLSLAMGGILIWSYVFGMMRLYTNEGTENDT  180

Query  643   SSTDIMGS----GFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWA  810
              S  +  S      L S     +S H   +D    A+IV     K S  K++ Q +K  +
Sbjct  181   PSETVAVSSTELAVLPSTNAHTISMHPTPFD----AKIV-----KMSAWKKIMQQMKTIS  231

Query  811   DKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLI  990
              K++LK +FAP+ +A IVG +IG+VS +RKL+I + APL VIDS+A M G+AAIP MTLI
Sbjct  232   KKVDLKKVFAPTAVAAIVGFIIGIVSPIRKLMIGNKAPLRVIDSTAYMFGEAAIPCMTLI  291

Query  991   VGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDS-LYHFVLLL  1167
             +GANLLRGLK S +   V+IG+  VR +LLP  GIGV+  AR++G +GS++ LY FVL+L
Sbjct  292   MGANLLRGLKGSEVSRSVIIGIIAVRSILLPALGIGVVMAARNWGLIGSENKLYQFVLML  351

Query  1168  QYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             Q+A+P AM +GT+TQ F++G+ E SVIMLW Y VA+ +LTLW+ +FMWIL+
Sbjct  352   QFAVPPAMAVGTMTQFFQLGQCETSVIMLWTYVVAAFSLTLWSAFFMWILA  402



>ref|XP_010680488.1| PREDICTED: uncharacterized transporter YBR287W-like [Beta vulgaris 
subsp. vulgaris]
Length=399

 Score =   369 bits (947),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 217/415 (52%), Positives = 296/415 (71%), Gaps = 30/415 (7%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL LF+VALMPVLKTL++TA+G+VLA +R+++LG ++RH+LNN+VFYVF+P L+ + L
Sbjct  1     MGFLALFMVALMPVLKTLMLTAVGVVLAMDRINLLGPTARHNLNNMVFYVFSPCLMGAYL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               T+T   ++ +WFMPVNIL+TF IGSALGWIL+KIT+AP  LHGLVI CCAAGNLGNLL
Sbjct  61    ARTVTVDVMIDMWFMPVNILITFVIGSALGWILIKITKAPHNLHGLVIGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI+IPA+C E  +PFG+ + C  +G AY S+SMA+GAVYIW+Y+Y I++           
Sbjct  121   LIVIPAICNEPKNPFGEYSVCMADGAAYVSVSMAVGAVYIWSYVYVIMKI----------  170

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWAD------  813
                 S    S  E L + HS+   +   A+    E  +P  + ++   V M         
Sbjct  171   ----SAEKTSPGERLDTHHSVVSIRSSNAR---SENTEPLLISKVGGTVPMLEKMKKGAF  223

Query  814   -------KINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAI  972
                     INL+M+ AP+TI +++G VIGVV  L+KL++ + APL VI SS+++LG A +
Sbjct  224   GIVRRIRTINLQMLLAPTTIGSVIGFVIGVVPLLKKLLVGNGAPLRVIYSSSEILGGATV  283

Query  973   PAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYH  1152
             P +TLIVGANLLRGL++S +   V+IG+ VVR++ LPL GI ++  A HFG VGS+ LY 
Sbjct  284   PCVTLIVGANLLRGLRRSGVSASVIIGIIVVRYIALPLLGIVIVRGAHHFGMVGSNPLYQ  343

Query  1153  FVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             FVL+LQ+ALP AM IGTI+QLFE GE ECSV+MLW Y++++LALTLW+T FMW++
Sbjct  344   FVLMLQFALPPAMSIGTISQLFEAGEGECSVVMLWTYAMSALALTLWSTLFMWLV  398



>ref|XP_003534224.1| PREDICTED: uncharacterized protein LOC100810166 isoform X1 [Glycine 
max]
Length=414

 Score =   369 bits (947),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 217/414 (52%), Positives = 290/414 (70%), Gaps = 11/414 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F+ LF VA  PV+K L+ITA+GL LA + + ILG  +R  +N LVFYVF P+LV S+L
Sbjct  1     MGFIKLFSVASFPVIKVLLITALGLFLALDNISILGEDARKKVNQLVFYVFNPSLVGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+VKLWFMPVNIL TF +GSALGWIL+K+TR P+ + GL++ CC+AGNLGNL 
Sbjct  61    AKTITFESVVKLWFMPVNILGTFILGSALGWILIKMTRPPKRMEGLILGCCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +III A+C++  SPFG+P  C+  G AYA+LSMAIGAV++W+Y+YN++R   +   N   
Sbjct  121   MIIIAAICKQEGSPFGEPDLCNQYGMAYAALSMAIGAVFLWSYVYNLMRISSSRIQNEDR  180

Query  652   DIMGSGFLDSCREALLSS--------HSLKYDQDEEAQIVFEE---EEKPSELKRLRQNV  798
                 S  L +  +  +S         ++ K   D    I+  E   EEK S   +++  V
Sbjct  181   TSNDSSMLKASADISVSHPHNFSKTLNTTKGTVDNAYTILLPETNSEEKVSFPSKIKHYV  240

Query  799   KMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPA  978
             +M +  +N K MFAPST+  I G +IGVV  +R  +I +NAPLHV++ SA MLG+AAIP 
Sbjct  241   RMISSHLNFKSMFAPSTLGAIAGFIIGVVPQIRNFMIGNNAPLHVVEDSASMLGEAAIPT  300

Query  979   MTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFV  1158
             +TLI+GANLL+GLK +    W ++G+ VVR++ LPL GI V+  A H   V SD+LY FV
Sbjct  301   VTLIMGANLLKGLKGTTAPVWTIVGIVVVRYIFLPLLGIAVVKGAMHLSLVHSDALYQFV  360

Query  1159  LLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LLLQYALP AM IGTI QLF  GESECSVIMLW Y++AS+A+TLW+T+FMW++S
Sbjct  361   LLLQYALPPAMNIGTIAQLFGSGESECSVIMLWTYALASIAVTLWSTFFMWLVS  414



>ref|XP_010416572.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=393

 Score =   368 bits (944),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 205/404 (51%), Positives = 290/404 (72%), Gaps = 11/404 (3%)
 Frame = +1

Query  109   LMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASS  288
             +M  LDLF+ +L PV++ L+IT++G  LA + V++LG  +R HLNN+VFYVF+P L+ S 
Sbjct  1     MMKILDLFITSLKPVVEILLITSVGFYLALDGVNLLGQDARKHLNNIVFYVFSPTLIGSR  60

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L +++T  S+VK+WFMP+NIL TF IGS LGW++V IT+ PR L GLV+ CCAAGNLGNL
Sbjct  61    LADSVTYESLVKMWFMPINILFTFMIGSFLGWLVVVITKPPRHLRGLVVGCCAAGNLGNL  120

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSS  648
              LII+PAVC+E+  PFGDP +C   G  Y SLSMAIGAVYIWTY+YN++R      +   
Sbjct  121   PLIIVPAVCKEKGGPFGDPESCQKYGLGYVSLSMAIGAVYIWTYVYNLMRVLSNSPVEIP  180

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLK  828
              D + S + DSC+  L+SS      ++EE     E+  K    +++++ V   ++K+NL 
Sbjct  181   HDSVESNY-DSCKVPLISS-----PEEEE-----EDYHKVGRWEKVKRRVVSLSEKVNLG  229

Query  829   MMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
              +FAPSTIA ++ +VIG+++ +RKL+I   APL V+  S  ++GD AIPA+TLI+G NLL
Sbjct  230   TIFAPSTIAAMIALVIGIITPIRKLVIGTEAPLRVLQDSVTLVGDGAIPAITLIIGGNLL  289

Query  1009  RGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSA  1188
             +G++ S +    +IGV V R+VLLP+CG+ ++  A     +  + LY FVLLLQYA+P A
Sbjct  290   KGMRSSGMKMSSIIGVLVARYVLLPICGVLIVRGAYKLDLITKEPLYQFVLLLQYAVPPA  349

Query  1189  MGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             M +GTITQLF  GESECSV+MLW YS+AS++LT+W T+FMW+++
Sbjct  350   MNLGTITQLFGTGESECSVMMLWTYSLASVSLTVWPTFFMWLVA  393



>ref|XP_010094502.1| Uncharacterized transporter [Morus notabilis]
 gb|EXB56256.1| Uncharacterized transporter [Morus notabilis]
Length=420

 Score =   369 bits (946),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 221/420 (53%), Positives = 281/420 (67%), Gaps = 17/420 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L L V A +PVLK L+ITA+G  LA +RV I    +  HLN +VFYVF PALVAS+L
Sbjct  1     MEILGLLVTASIPVLKVLLITALGSYLALDRVGIFPEDAIKHLNTIVFYVFNPALVASNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S++KLWFMPVNIL+TF +GS LGWI+++ TR P+ LHGL++ C AAGNLGN+L
Sbjct  61    ASTITYQSMIKLWFMPVNILITFIVGSILGWIVIQFTRPPQHLHGLILGCSAAGNLGNML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             L+IIPA+C+ER SPFGDP  C T G AY+SLSMAIGA+Y+W+Y+YNI+R   T   NS T
Sbjct  121   LVIIPALCKERGSPFGDPDVCYTYGMAYSSLSMAIGAIYLWSYVYNIVRISATSSKNSIT  180

Query  652   DIM---------GSGFLDSCREALLSSHSLKYDQDEEAQIVFE--------EEEKPSELK  780
                             L+  RE LLSS  L   +D                E   P    
Sbjct  181   KDFPVSKASKESSQSDLEGSREPLLSSTKLAEPEDNSDHYALPLTVSEGKTEAAVPESRL  240

Query  781   RLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLG  960
              +   + M   K+NLK +FAPST   +VG VIG++  +RK +I  +APL V+  SA  LG
Sbjct  241   GIMHRLGMLFRKLNLKALFAPSTTGAVVGFVIGLIPQIRKTLIGSDAPLRVLQDSASFLG  300

Query  961   DAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSD  1140
             D AIPA+TL++G NLL+GLK + +   +V+G+ VVR+V LPL GI V+  A HFG V SD
Sbjct  301   DGAIPALTLVIGGNLLKGLKGTGMKKSLVVGIIVVRYVALPLIGILVVKGAIHFGMVQSD  360

Query  1141  SLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              LY FVLLLQ+ALP AM IGTITQLF  GESECSVIMLW Y++AS++LT W+T FM +++
Sbjct  361   PLYQFVLLLQFALPPAMNIGTITQLFGAGESECSVIMLWTYALASISLTFWSTIFMLLVA  420



>ref|XP_007010163.1| Auxin efflux carrier family protein isoform 6 [Theobroma cacao]
 gb|EOY18973.1| Auxin efflux carrier family protein isoform 6 [Theobroma cacao]
Length=381

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 212/403 (53%), Positives = 282/403 (70%), Gaps = 30/403 (7%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLD+FVVALMPVLK L++TA+GL+LA E++D+LG  +R++LN +VFYV +P+L+ S+L
Sbjct  1     MGFLDMFVVALMPVLKVLLVTAVGLLLAMEKIDLLGPEARNYLNKIVFYVLSPSLLVSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT +S+V LWFMP+NILLTF IGSALG +L+K+T+ P  L G+VI CC+AGNLGNLL
Sbjct  61    ADTITYNSVVTLWFMPLNILLTFIIGSALGLVLIKVTKTPEHLRGIVIGCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYG--TPRMNS  645
             LI++PAVCE+ NSPFGD +TCSTN  AYASLSMA+ A+Y W+Y Y ++ AY   +P   S
Sbjct  121   LILVPAVCEQSNSPFGDSSTCSTNAVAYASLSMAVAAIYTWSYSYAVVSAYAIKSPEHKS  180

Query  646   --STDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKI  819
               S++       DSC EALL S   +  ++   Q+     E P      R  +       
Sbjct  181   THSSEEAPDPSSDSCTEALLPSSYSQISEESSVQV-----ELPLTNSGERTKI-------  228

Query  820   NLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGA  999
              +  +F              +VS +RK++I D+APLHVI +SA  +G+AAIP MTLI+GA
Sbjct  229   -IGFIFG-------------IVSPIRKVLIDDSAPLHVIYTSAAFIGEAAIPCMTLIMGA  274

Query  1000  NLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYAL  1179
             NLL+GLK+S +   V+IGV  VR + LPL GIGV   A HFG  GSDSLY FVL+LQYA+
Sbjct  275   NLLKGLKRSEVNLLVIIGVVAVRNIFLPLLGIGVTKAAYHFGMAGSDSLYQFVLMLQYAV  334

Query  1180  PSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFM  1308
             P A  +G +TQLF+ G+ E S+IMLW Y+VAS++LTLW+T FM
Sbjct  335   PPAFNVGVMTQLFQRGQGETSIIMLWTYAVASISLTLWSTLFM  377



>gb|AET03524.2| auxin efflux carrier family protein [Medicago truncatula]
Length=404

 Score =   367 bits (942),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 212/408 (52%), Positives = 299/408 (73%), Gaps = 11/408 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F+ L  VA +PV+K L+I+A+GL LA ++VD+LGA +R  +NNLVFYVF P+LV S+L
Sbjct  1     MGFMQLLYVASLPVMKVLLISALGLFLAIDQVDVLGADARKRVNNLVFYVFNPSLVGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ET+T+ +++ LWFMPVN+L TF +GSAL WI++KITR P+ L GL++ CC+AGNLGNL 
Sbjct  61    AETLTSDNVLTLWFMPVNVLATFILGSALAWIVIKITRPPKHLEGLILGCCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +IIIPA+C+E+ SPFGDP  C   G AY SLSMAIGAV +WTY+YNI+R        S  
Sbjct  121   IIIIPAICKEKGSPFGDPVLCHKYGMAYVSLSMAIGAVLLWTYVYNIMRIS-----TSRA  175

Query  652   DIMGSGFLDSCREALLS-SHSLKYDQDEEAQIVF----EEEEKPSELKRLRQNVKMWADK  816
              +M SG +   ++  +S +++   D  ++A  +     + EEK S   +++ +++  ++ 
Sbjct  176   KLMTSGVISESQQYNISVTNNPAKDALDDAYTLLLPNTDFEEKVSFSDKVKCHLRNISNN  235

Query  817   INLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVG  996
             IN K +FAPSTI  I+G  IGV++ +RKL++ +NAPLHV++ SA MLG+AAIP +TLI+G
Sbjct  236   INFKTIFAPSTIGAIIGFCIGVINPIRKLMVGNNAPLHVVEDSASMLGEAAIPTVTLILG  295

Query  997   ANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYA  1176
             ANLL+GLK ++   W ++G+  VR++ LP+ G+ V+  A  FG V  D LY FVLLLQYA
Sbjct  296   ANLLKGLKGTSTPVWTIVGIIAVRYIFLPIIGVVVVQGAIKFGLVQPDPLYQFVLLLQYA  355

Query  1177  LPSAMGIGTITQLF-EVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             LP AM IGT+ QLF   GESECSVIMLW+Y++AS+A+TLW+T+FMW++
Sbjct  356   LPPAMNIGTMAQLFGSGGESECSVIMLWSYALASIAVTLWSTFFMWLV  403



>ref|XP_004509473.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Cicer arietinum]
 ref|XP_004509474.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Cicer arietinum]
Length=392

 Score =   366 bits (940),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 214/410 (52%), Positives = 291/410 (71%), Gaps = 25/410 (6%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F++L  VA +PV+K L+ITA+GL LA ++VD+LGA +R  +NNLVFYVF P+LV S+L
Sbjct  1     MGFIELLYVASLPVIKVLLITALGLFLAIDQVDVLGADARKRMNNLVFYVFNPSLVGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ET+T+ +++ LWFMPVNIL TF +GSAL WI++KITR P+ L GL++ CC+AGNLGNL 
Sbjct  61    AETLTSENVLTLWFMPVNILSTFILGSALAWIVIKITRPPKHLQGLILGCCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +IIIPA+C+E+ SPFGDP  C   G AY SLSMAIGAV++WTY+YNI+R           
Sbjct  121   IIIIPAICKEKGSPFGDPDLCHKYGMAYVSLSMAIGAVFLWTYVYNIMR-----------  169

Query  652   DIMGSGFLDSCREALL---SSHSLKYDQDEEAQIVF----EEEEKPSELKRLRQNVKMWA  810
                    + S R  L+    S     D  ++A  +     E EEK S   +++  ++   
Sbjct  170   -------ISSSRAKLMEISESQPETIDSAKDAYTLLLPNTEFEEKVSFSDKIKLQLRKIL  222

Query  811   DKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLI  990
               +N K +FAPSTI  I G  IGV+S +RKL+I ++AP HVI+ SA MLG+A+IPA+TLI
Sbjct  223   RNLNFKTIFAPSTIGAITGFCIGVISPIRKLMIGNSAPFHVIEDSASMLGEASIPAVTLI  282

Query  991   VGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQ  1170
             +GANLL+GLK ++   W ++G+ VVR++ LP+ G+ V+  A + G V  D LY FVLLLQ
Sbjct  283   LGANLLKGLKGTSTPVWTIVGIVVVRYIFLPILGVVVVQSAINLGLVQKDPLYQFVLLLQ  342

Query  1171  YALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             YA+P AM IGT+ QLF  GESECSVIMLW+Y +AS+A+TLW+TYFMW+++
Sbjct  343   YAVPPAMNIGTMAQLFGSGESECSVIMLWSYGLASIAVTLWSTYFMWLVA  392



>ref|XP_002528528.1| auxin:hydrogen symporter, putative [Ricinus communis]
 gb|EEF33840.1| auxin:hydrogen symporter, putative [Ricinus communis]
Length=417

 Score =   367 bits (942),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 216/423 (51%), Positives = 292/423 (69%), Gaps = 26/423 (6%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF +A MPVLK L+ITA+G  LAF+ V+ILG  +R  +N +VFYVF PALV  +L
Sbjct  1     MRLLDLFAIASMPVLKVLLITALGSFLAFDNVNILGEEARKQINRVVFYVFNPALVGGNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlg---  462
              +TIT  SI+ LWFMPVNIL+TF IGSALGWIL+KIT  P+ L  ++        +    
Sbjct  61    AKTITFESILLLWFMPVNILITFIIGSALGWILIKITAPPKHLXAVLQVVDVVVVVTGNM  120

Query  463   -nllliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR-------  618
              NL+LII+PA+C E+ SPFG P  C   G +YASLSMAIGA+Y+W+Y+YN++R       
Sbjct  121   GNLVLIIVPAMCREKGSPFGPPDVCHAYGISYASLSMAIGAIYMWSYVYNMMRISASEIN  180

Query  619   -------AYGTPRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIV--FEEEEKPS  771
                      GTP   +S +++ S  L    E    ++ L +   E  +IV  F   +  +
Sbjct  181   KEVRRKDTEGTPESMNSGNLLPSKELPISAEL---TYGLLHPGTESDKIVKTFTWTQVSN  237

Query  772   ELKRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSAD  951
             ++K   Q+++M ++K+NLK +FAPSTI  IVG ++G V  +RKL+I  NAPLHVI+ SA 
Sbjct  238   KIK---QHLRMISEKLNLKAIFAPSTIGAIVGFIVGAVPQIRKLLIGTNAPLHVIEDSAS  294

Query  952   MLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWV  1131
             ++GDAAIPA+TLIVG NLLRGLK S I   +V G+  VR+V+LPL GI ++  A HFG V
Sbjct  295   LVGDAAIPAVTLIVGGNLLRGLKGSGIQLSLVFGILGVRYVILPLLGIVIVRGAVHFGLV  354

Query  1132  GSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMW  1311
             GSD LY F+LL+Q+A+P AM IGT+TQLF  G+SECSVIMLW Y++AS++LTLW+T F+W
Sbjct  355   GSDPLYQFILLVQFAVPPAMNIGTMTQLFGTGQSECSVIMLWTYAMASISLTLWSTLFLW  414

Query  1312  ILS  1320
             +++
Sbjct  415   MVT  417



>ref|XP_011034783.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
Length=407

 Score =   366 bits (940),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 212/411 (52%), Positives = 287/411 (70%), Gaps = 12/411 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MA LDL + + +PVLK L+ITAIG  LA + VD+LG  +R H+NN+VFYVF PALV+S+L
Sbjct  1     MALLDLLIASSIPVLKVLLITAIGSYLALDHVDVLGEDARKHVNNVVFYVFNPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  S+ K+WFMP NIL+TF IGS LGW +V+ TR P  LHGL++ CCAAGNLGN+ 
Sbjct  61    AETITYDSMKKMWFMPFNILITFVIGSLLGWFVVQFTRPPSHLHGLIVGCCAAGNLGNMF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP------  633
             LI+IPA+C+E+ SPFG P  C T G  Y SLSMAIGAVY+W+Y++NI+RA   P      
Sbjct  121   LIMIPAICKEKGSPFGSPDMCETFGLGYVSLSMAIGAVYLWSYVFNIVRASSFPSVKHFN  180

Query  634   --RMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMW  807
                ++ S+       L SC+E LL+S     +Q +   +     ++      L+Q + + 
Sbjct  181   KIHVDESSIQTPKSELGSCKEPLLASE----NQADRYALRSSASDEMVVRSGLKQKIVVV  236

Query  808   ADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTL  987
                IN K +FAPSTI  IVG VIGV+   RKL++ ++APL VI  SA +LGD AIP + L
Sbjct  237   FGNINWKSLFAPSTIGAIVGFVIGVIPLTRKLMVGNDAPLRVIQDSASLLGDGAIPTLNL  296

Query  988   IVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLL  1167
             I+GANLL+GL+ S I   V+ G+ V R++ LPL GI ++  A  FG++  D LY F+LLL
Sbjct  297   IMGANLLKGLRGSGIQKSVIFGIIVARYIALPLIGIFIVRGALRFGFIPQDPLYQFILLL  356

Query  1168  QYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             Q+A+P AM +GTITQLF  GE+ECSVI+LW Y++AS++LTLW+T+FMW+++
Sbjct  357   QFAVPPAMNMGTITQLFGAGETECSVIILWAYALASISLTLWSTFFMWLVA  407



>gb|KHG29772.1| SPAC5D6.04: Uncharacterized transporter C5D6.04 [Gossypium arboreum]
Length=415

 Score =   367 bits (941),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 216/413 (52%), Positives = 296/413 (72%), Gaps = 13/413 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLDL VVAL+P+LK L++T +GL L  E++++LG  +R +LN +VFYV +P L+ S+L
Sbjct  1     MGFLDLLVVALVPILKVLLVTGVGLFLGIEKINLLGPEARDYLNKIVFYVLSPCLLLSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  S+V LWFMPVN+LLTF +GSALGWIL K+T+ PR L G+VI CC+ GNLGNLL
Sbjct  61    AETITYKSLVTLWFMPVNVLLTFLVGSALGWILAKLTKTPRHLQGIVIGCCSTGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI+ P +C+E NSPF   +TCST+ +AYASLSMA+GA++ W Y Y ++ +Y       S+
Sbjct  121   LIVFPDICDESNSPFSKLSTCSTDAEAYASLSMAVGAIFTWAYAYPLVSSYVIKNTEHSS  180

Query  652   DIMGSGFLDSCREALLSSHSLKYDQ-DEEAQIVFE------EEEKPSELK-RLRQNVKMW  807
                     DSC E LLS     Y Q  E+  +V E      ++ K    K ++ + +K  
Sbjct  181   IQSSEPSPDSCTEPLLSP---SYSQISEDNSVVLELPLTNMQDGKKMPFKEKIVRCIKCI  237

Query  808   ADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGD--AAIPAM  981
               KI+L+ +F PSTIA+I G++IG+VS  RK++I DNAPL VI+SSA ++G   AAIP+M
Sbjct  238   TSKIDLEKVFVPSTIASIAGLIIGIVSPFRKVLIADNAPLRVINSSAALIGHVLAAIPSM  297

Query  982   TLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVL  1161
             TLI+GANLL+GLK+S +   V++GV  VR + LPL GIGV+  A H G VGSD+LY FVL
Sbjct  298   TLIMGANLLKGLKRSEMSLVVILGVVAVRNICLPLLGIGVVQAAHHLGVVGSDALYRFVL  357

Query  1162  LLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             + QYA+P A+ +GT+TQLF+ G+ E SVI+LW+YSVAS++LTLW+T +M ++S
Sbjct  358   MFQYAVPPAINVGTMTQLFKSGQGETSVILLWSYSVASISLTLWSTLYMSLVS  410



>ref|XP_010471806.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=393

 Score =   365 bits (938),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 203/404 (50%), Positives = 291/404 (72%), Gaps = 11/404 (3%)
 Frame = +1

Query  109   LMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASS  288
             +M  LDLF+ +L PV++ L+IT++G  LA + V++LG  +R HLNN+VFYVF+P L+ S 
Sbjct  1     MMKILDLFITSLKPVVEILLITSVGFYLALDGVNLLGQDARKHLNNIVFYVFSPTLIGSR  60

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L +++T  S+VK+WFMP+N+L TF IGS LGW++V IT+ PR L GLV+ CCAAGNLGNL
Sbjct  61    LVDSVTYESLVKMWFMPINVLFTFMIGSFLGWLVVVITKPPRHLRGLVVGCCAAGNLGNL  120

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSS  648
              LII+PAVC+E+  PFGDP +C   G  Y SLSMAIGAVYIWTY+YN++R      +   
Sbjct  121   PLIIVPAVCKEKGGPFGDPESCQKYGLGYVSLSMAIGAVYIWTYVYNLMRVLSNSPVEIP  180

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLK  828
              D + S + DSC+  L+SS      ++EE     E+  K    +++++ +   ++K+NL+
Sbjct  181   HDSVESNY-DSCKVPLISS-----TEEEE-----EDYHKVGRWEKVKRRLVSLSEKVNLR  229

Query  829   MMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
              +FAPSTIA ++ +VIG+++ +RKL+I   APL V+  S  ++GD AIPA+TLI+G NLL
Sbjct  230   TIFAPSTIAAMIALVIGIITPIRKLVIGTEAPLRVLQDSVTLVGDGAIPAITLIIGGNLL  289

Query  1009  RGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSA  1188
             +G++ S +    +IGV V R+VLLP+CG+ ++  A     +  + LY FVLLLQYA+P A
Sbjct  290   KGMRSSGMKMSSIIGVLVARYVLLPICGVLIVRGAYKLDLITKEPLYQFVLLLQYAVPPA  349

Query  1189  MGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             M +GTITQLF  GESECSV+MLW YS+AS++LT+W T+FMW+++
Sbjct  350   MNLGTITQLFGTGESECSVMMLWTYSLASVSLTVWPTFFMWLVA  393



>ref|XP_010428716.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=393

 Score =   365 bits (937),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 200/404 (50%), Positives = 290/404 (72%), Gaps = 11/404 (3%)
 Frame = +1

Query  109   LMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASS  288
             +M  LDLF+ +L PV++ L+IT++G  LA + V++LG  +R HLNN+VFYVF+P L+ S 
Sbjct  1     MMKILDLFITSLKPVVEILLITSVGFYLALDGVNLLGQDARKHLNNIVFYVFSPTLIGSR  60

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L +++T  S+VK+WFMPVN+L TF IGS LGW++V IT+ P+ L GL++ C AAGNLGNL
Sbjct  61    LADSVTYESLVKMWFMPVNVLFTFMIGSFLGWLVVVITKPPQHLRGLIVGCSAAGNLGNL  120

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSS  648
              LII+PAVC+E+  PFGDP +C   G  Y SLSMAIGAVYIWTY+YN++R      +   
Sbjct  121   PLIIVPAVCKEKGGPFGDPESCQKYGLGYVSLSMAIGAVYIWTYVYNLMRVLSNSPVEIP  180

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLK  828
              D + S + DSC+  L+SS      ++EE     E+  K    +++++ +   ++K+NL+
Sbjct  181   HDSVESNY-DSCKVPLISS-----TEEEE-----EDNHKVGRWEKVKRRLVSLSEKVNLQ  229

Query  829   MMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
              +FAPSTIA ++ +VIG+++ +RK++I   APL V+  S  ++GD AIPA+TLI+G NLL
Sbjct  230   TIFAPSTIAAMIALVIGIITPIRKVVIGTEAPLRVLQDSVTLVGDGAIPAITLIIGGNLL  289

Query  1009  RGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSA  1188
             +G++ S +    +IGV V R+VLLP+CG+ ++  A     +  + LY FVLLLQYA+P A
Sbjct  290   KGMRSSGMKMSSIIGVLVARYVLLPICGVLIVRGAYKLDLITKEPLYQFVLLLQYAVPPA  349

Query  1189  MGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             M +GTITQLF  GESECSV+MLW YS+AS++LT+W T+FMW+++
Sbjct  350   MNLGTITQLFGTGESECSVMMLWTYSLASVSLTVWPTFFMWLVA  393



>ref|XP_003612431.1| Auxin efflux carrier protein [Medicago truncatula]
 gb|AES95389.1| auxin efflux carrier family protein [Medicago truncatula]
Length=417

 Score =   365 bits (938),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 211/417 (51%), Positives = 292/417 (70%), Gaps = 14/417 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+LF VA  PV+K L++T IGL+LA + +++LG  +R+  N+LV YVF P L+  +L
Sbjct  1     MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARNQTNHLVHYVFNPGLIGGNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  ++V LWFMPVNIL+TF +GSALGWI++K+T+ PR + GL++  C+AGNLGNL 
Sbjct  61    AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT---PRMN  642
             +IIIPA+C+++ SPFGDP  C   G AYASLSMAIGAV+IWTY+YNI+R          N
Sbjct  121   IIIIPAICKDKGSPFGDPDVCYQFGMAYASLSMAIGAVFIWTYVYNIMRISSRNVHKECN  180

Query  643   SSTDIMGSGFLDSCREALLSSHSLKY------DQDEEAQIVFEEEEKPSELK-----RLR  789
              S+D +         ++++   S  Y      + D+   ++  + E   ++K     +++
Sbjct  181   KSSDSITLEDSRDVSQSIIEEGSENYTSPTKGNVDDAYTLLLSKNESEQKIKVPVFDKIK  240

Query  790   QNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAA  969
                 M     N + +F+P+T+  IVG ++GVV +LR+L+I  NAPLHVI+ SA MLGDAA
Sbjct  241   HKFGMILGNPNFRGIFSPATLGAIVGFIVGVVPWLRRLMIGSNAPLHVIEDSASMLGDAA  300

Query  970   IPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLY  1149
             IP +TLI+GANLLRGLK ++   W +IG+ VVR++LLP+ G+ +I  A H G V  D LY
Sbjct  301   IPTITLIMGANLLRGLKGASTPFWTIIGIIVVRYILLPIFGVLIIKGATHLGLVQIDPLY  360

Query  1150  HFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              FVLLLQYALP AM IGTI QLF  GESECSV+MLW Y++AS+A+TLW+TYFMW++S
Sbjct  361   QFVLLLQYALPPAMNIGTIAQLFGAGESECSVMMLWTYALASIAVTLWSTYFMWLVS  417



>ref|XP_008237902.1| PREDICTED: uncharacterized transporter YBR287W-like [Prunus mume]
 ref|XP_008237903.1| PREDICTED: uncharacterized transporter YBR287W-like [Prunus mume]
Length=413

 Score =   365 bits (936),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 218/411 (53%), Positives = 282/411 (69%), Gaps = 8/411 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L LF+ A +PVLK L+ITA+G  LA + V+ILG  +R HLN +VFYV  PALV+S+L
Sbjct  1     MEVLQLFITASIPVLKVLLITALGSYLALDSVNILGEDTRKHLNTVVFYVLNPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  SIVKLWFMPVNIL+TF +GS LGWIL+ +TR P  L GLV+ CCAAGNLGNLL
Sbjct  61    ARTITYESIVKLWFMPVNILITFIVGSILGWILLLLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PAVC+E+ SPFG P  C T G AYASLSMAIGA+Y+W+Y+YNI+R         ST
Sbjct  121   LIIVPAVCKEKGSPFGAPDVCRTYGLAYASLSMAIGAIYLWSYVYNIVRISAKRGTQDST  180

Query  652   DIMGSGFLD---SCREALLSSHSLKYDQDEEAQ-----IVFEEEEKPSELKRLRQNVKMW  807
               +   F     SC E LLSS   +  +D          + EE  K +   +++Q + + 
Sbjct  181   QSLVRSFTPNEISCTEPLLSSKESEVVEDNANHYALPCTISEENAKMTTSGKIKQRIMIV  240

Query  808   ADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTL  987
               K+NLK +FAPST   IVG  IG++  +RK +I D APL V+  +A +LGD AIP +TL
Sbjct  241   FGKLNLKTIFAPSTTGAIVGFSIGLIPQIRKALIGDGAPLRVVQDTAALLGDGAIPTLTL  300

Query  988   IVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLL  1167
             I+G NLL+GL+   +   +V+G+ +VR+V LPL GI V+  A   G V SD LY FVLLL
Sbjct  301   IIGGNLLKGLRGPGMQKSLVVGIIIVRYVALPLIGILVVKGALKLGLVHSDPLYLFVLLL  360

Query  1168  QYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             Q++LP AM IGT+TQLF  GE ECSVIMLW Y+ AS++LT W+ +FMW+++
Sbjct  361   QFSLPPAMNIGTMTQLFGAGEKECSVIMLWTYAFASVSLTFWSAFFMWLVA  411



>ref|XP_006599266.1| PREDICTED: uncharacterized protein LOC100817605 isoform X1 [Glycine 
max]
 ref|XP_006599267.1| PREDICTED: uncharacterized protein LOC100817605 isoform X2 [Glycine 
max]
 ref|XP_006599268.1| PREDICTED: uncharacterized protein LOC100817605 isoform X3 [Glycine 
max]
 ref|XP_006599269.1| PREDICTED: uncharacterized protein LOC100817605 isoform X4 [Glycine 
max]
 gb|KHN39763.1| Putative transporter C5D6.04 [Glycine soja]
Length=414

 Score =   364 bits (935),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 216/413 (52%), Positives = 289/413 (70%), Gaps = 11/413 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F+ L  VA  PV+K L++TAIGL LA + + ILG  SR  +N LVFYVF P+LV S+L
Sbjct  1     MGFIQLLSVASFPVIKVLLVTAIGLFLALDDISILGEDSRKKVNQLVFYVFNPSLVGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  SIV+LWFMP+NIL TF +GSALGWIL+K+TR P+ + GL++ CC+AGNLGNLL
Sbjct  61    AKTITFESIVQLWFMPLNILCTFILGSALGWILIKMTRPPKHMEGLILGCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             ++IIPA+C+E  +PFGD   C   G AYA+LSMAIGAV+IW+Y+YNI+R   +       
Sbjct  121   IVIIPAICKESGNPFGDSDVCYQYGMAYAALSMAIGAVFIWSYVYNIMRISSSRIQKEDN  180

Query  652   DIMGSGFLDSCREALLS-----SHSLKYDQD--EEAQIVF----EEEEKPSELKRLRQNV  798
                G   L +  EA  S     S +L   +D  ++A  +     + EEK S  ++++ ++
Sbjct  181   TGNGINILKASAEASESRTDNFSETLNPTKDATDDAYTLLLPHAKPEEKVSISRKIKHHL  240

Query  799   KMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPA  978
              + +  +N K MFAPST+  I G +IGV+S +R  II  +APLHV++ S  MLGDAA+P 
Sbjct  241   GVISSNLNFKAMFAPSTLGAIAGFIIGVISPMRNFIIGSSAPLHVVEESVFMLGDAAVPT  300

Query  979   MTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFV  1158
             +TLI+GANLL+GLK S    W V+G+  VR++ LPL G+ V+  A HF  V SD+LY FV
Sbjct  301   LTLIMGANLLKGLKGSTTPVWTVVGIVAVRYIFLPLLGVAVVKGAIHFSLVHSDALYQFV  360

Query  1159  LLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             LLLQYALP AM IGTI QLF  GESECSVIMLW Y +A++A+TLW+T+FMW++
Sbjct  361   LLLQYALPPAMNIGTIAQLFGAGESECSVIMLWTYILAAVAVTLWSTFFMWLV  413



>ref|XP_007209188.1| hypothetical protein PRUPE_ppa006413mg [Prunus persica]
 gb|EMJ10387.1| hypothetical protein PRUPE_ppa006413mg [Prunus persica]
Length=413

 Score =   364 bits (934),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 220/411 (54%), Positives = 282/411 (69%), Gaps = 8/411 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L LF+ A +PVLK L+ITA+G  LA + V+ILG  SR HLN +VFYV  PALV+S+L
Sbjct  1     MEVLQLFITASIPVLKVLLITALGSYLALDSVNILGEDSRKHLNTVVFYVLNPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S+VKLWFMPVNIL+TF +GS LGWIL+ +TR P  L GLV+ CCAAGNLGNLL
Sbjct  61    ARTITYESMVKLWFMPVNILITFIVGSILGWILLLLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR---AYGTPRMN  642
             LII+PAVC+E+ SPFG P  C T G AYASLSMAIGA+Y+W+Y+YNI+R     GT    
Sbjct  121   LIIVPAVCKEKGSPFGAPDVCRTYGLAYASLSMAIGAIYLWSYVYNIVRISAKRGTQDST  180

Query  643   SSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQ-----IVFEEEEKPSELKRLRQNVKMW  807
              S     +    SC E LLSS   +  +D          + EE  K +   +++Q + M 
Sbjct  181   QSPVRSSTPNEISCTEPLLSSKESEVVEDNANHYALPCTISEENAKMTTSGKIKQRIMMV  240

Query  808   ADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTL  987
               K+NLK +FAPST   IVG  IG++  +RK +I D APL V+  +A +LGD AIP +TL
Sbjct  241   FGKLNLKTIFAPSTTGAIVGFSIGLIPQIRKALIGDGAPLRVVQDTASLLGDGAIPTLTL  300

Query  988   IVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLL  1167
             I+G NLL+GL+   +   +V+G+ +VR+V LPL GI VI  A   G V SD LY FVLLL
Sbjct  301   IIGGNLLKGLRGPGMQKSLVVGIIIVRYVALPLIGILVIKGALKLGLVHSDPLYLFVLLL  360

Query  1168  QYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             Q++LP AM IGT+TQLF  GE ECSVIMLW Y+ AS++LT W+ +FMW+++
Sbjct  361   QFSLPPAMNIGTMTQLFGAGEKECSVIMLWTYAFASVSLTFWSAFFMWLVA  411



>ref|XP_002301894.1| auxin efflux carrier family protein [Populus trichocarpa]
 gb|EEE81167.1| auxin efflux carrier family protein [Populus trichocarpa]
Length=407

 Score =   363 bits (932),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 211/411 (51%), Positives = 287/411 (70%), Gaps = 12/411 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDL + + +PVLK L+ITAIG  LA + VD+LG  +R H+NN+VFYVF PALV+S+L
Sbjct  1     MGLLDLLIASSIPVLKVLLITAIGSYLALDHVDVLGEDARKHVNNVVFYVFNPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  S+ K+WFMP NIL+TF I S LGW +V+ TR P  LHGL++ CCAAGNLGN+ 
Sbjct  61    AETITYDSMKKMWFMPFNILITFVISSLLGWFVVQFTRPPSHLHGLIVGCCAAGNLGNMF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP------  633
             LI+IPA+C+E+ SPFG P  C T G  Y SLSMAIGAVY+W+Y++NI+RA   P      
Sbjct  121   LIMIPAICKEKGSPFGSPDICETFGLGYVSLSMAIGAVYLWSYVFNIVRASSFPSVKQFD  180

Query  634   --RMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMW  807
                ++ S+       L SC+E LL+S     +Q ++  +     ++      L+Q + + 
Sbjct  181   KIHVDESSIETPKSELGSCKEPLLASE----NQADQYALRSSASDEMVVRSGLKQKIVVV  236

Query  808   ADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTL  987
                IN K +FAPSTIA IVG VIGV+   RKL++ ++APL VI  SA +LGD AIP + L
Sbjct  237   FGNINWKSLFAPSTIAAIVGFVIGVIPLTRKLMVGNDAPLRVIQDSASLLGDGAIPTLNL  296

Query  988   IVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLL  1167
             I+GANLL+GL+ S I   V+ G+ V R++ LPL GI ++  A  FG++  D LY F+LLL
Sbjct  297   IMGANLLKGLRGSGIQKSVIFGIIVARYIALPLIGIFIVRGALRFGFIPQDPLYQFILLL  356

Query  1168  QYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             Q+A+P AM +GTITQLF  GE+ECSVI+LW Y++AS++LTLW+T+FMW+++
Sbjct  357   QFAVPPAMNMGTITQLFGAGETECSVIILWAYALASISLTLWSTFFMWLVA  407



>ref|XP_010029545.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X2 
[Eucalyptus grandis]
Length=415

 Score =   363 bits (932),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 219/415 (53%), Positives = 288/415 (69%), Gaps = 12/415 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MA LDLFVVALMPVLK L+ITA+G +LA  RVDILG  +R HLNN+VF+VF+PALV S L
Sbjct  1     MALLDLFVVALMPVLKVLLITALGSLLAIARVDILGEEARKHLNNIVFFVFSPALVFSCL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ++IT  S+  LWFMP NILLTF +GSALGW+L++ +RAP  L GLV+ CCAAGN GN+L
Sbjct  61    AKSITYKSMASLWFMPCNILLTFIVGSALGWLLIRFSRAPDHLRGLVLGCCAAGNQGNML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT-------  630
             LIIIPAVC E+ SPFGDP +C+T+G  +ASLS+AIGA+Y+W+Y+YNI+R   +       
Sbjct  121   LIIIPAVCREKGSPFGDPESCNTHGMTFASLSLAIGAIYLWSYVYNIMRISSSRNSQGSE  180

Query  631   -----PRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQN  795
                  P ++S  +      +       L   S   D  E     +E  +K     ++   
Sbjct  181   PDVSMPCVHSVGENRNPSEIQKLELLPLQQFSSVEDHVEVDVSTYEGTQKVLVPAKIMIF  240

Query  796   VKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIP  975
             ++M    IN + +FAPSTI  I+G ++G    LRK  + D+APLHV+  SA +LG+AAIP
Sbjct  241   LRMVWTNINPRTLFAPSTIGAIIGFIVGTTPPLRKATVGDSAPLHVVLDSASLLGNAAIP  300

Query  976   AMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHF  1155
             ++TLI+GANLLRGLK S+I   V+IG+  VR++ LPL G+ ++  A + G V SD LY F
Sbjct  301   SVTLILGANLLRGLKGSSIHPPVIIGILAVRYIALPLLGMMIVRGAVYLGLVQSDPLYQF  360

Query  1156  VLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             VLLLQ+ALP AM IGTITQLF   E+ECSVIMLW Y VA+++LTLW+  FMW++S
Sbjct  361   VLLLQFALPPAMNIGTITQLFGAVEAECSVIMLWTYVVAAVSLTLWSALFMWLVS  415



>ref|XP_007156270.1| hypothetical protein PHAVU_003G272300g [Phaseolus vulgaris]
 gb|ESW28264.1| hypothetical protein PHAVU_003G272300g [Phaseolus vulgaris]
Length=414

 Score =   363 bits (932),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 218/414 (53%), Positives = 294/414 (71%), Gaps = 11/414 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL L  VA  PV+K L+ITA+GL LA + + IL   +R  +N LVFYVF P+LV ++L
Sbjct  1     MGFLQLLSVASFPVIKVLLITAVGLFLALDDISILAEDARKKVNQLVFYVFNPSLVGTNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+V+LWFMP NIL+TF +GSALGWIL+KITR P++L GL++ CC+AGNLGNL 
Sbjct  61    AKTITLESVVQLWFMPFNILITFVLGSALGWILIKITRPPKQLEGLILGCCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT---PRMN  642
             +IIIPA+C +  SPFGD   C   G AYASLSMAIGAVYIW+Y+YNI+R   +       
Sbjct  121   IIIIPAMCTQSGSPFGDSDVCYEYGMAYASLSMAIGAVYIWSYVYNIMRISSSRIQKEDG  180

Query  643   SSTD--IMGSGFLDSCREALLSSHSLKYDQD--EEAQIVF----EEEEKPSELKRLRQNV  798
             SS D  I+ + +  S  ++   S +L   +D  ++A  +     E E+K S   +++  V
Sbjct  181   SSNDNSIVKASWGTSESQSHHFSQTLNPTKDTMDDACTLLLPEAESEKKVSISSKIKNRV  240

Query  799   KMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPA  978
             ++ +  +N K MFAPSTI  I G +IGV+S LR LII  +A LHV+  S  MLG+AAIP 
Sbjct  241   RVISINLNFKAMFAPSTIGAIAGFLIGVISPLRNLIIGSSAKLHVVQESISMLGEAAIPT  300

Query  979   MTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFV  1158
             +TLI+GANLL+GLK S+   W ++G+  VR++ LP+ G+GV+  A +F +V SD+LY FV
Sbjct  301   VTLIMGANLLKGLKGSSTPVWTLVGIVAVRYIFLPVLGVGVVKAAIYFNFVQSDALYQFV  360

Query  1159  LLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LLLQ+ALP AM IGTI QLF  GESECSVIMLW Y++A++A+TLW+T+FMW++S
Sbjct  361   LLLQHALPPAMNIGTIAQLFGAGESECSVIMLWTYALAAIAVTLWSTFFMWLVS  414



>ref|XP_003629048.1| Transporter, putative [Medicago truncatula]
Length=403

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 208/408 (51%), Positives = 294/408 (72%), Gaps = 12/408 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F+ L  VA +PV+K L+I+A+GL LA ++VD+LGA +R  +NNLVFYVF P+LV S+L
Sbjct  1     MGFMQLLYVASLPVMKVLLISALGLFLAIDQVDVLGADARKRVNNLVFYVFNPSLVGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ET+T+ +++ LWFMPVN+L TF +GSAL WI++KITR P+ L GL++ CC+AGNLGNL 
Sbjct  61    AETLTSDNVLTLWFMPVNVLATFILGSALAWIVIKITRPPKHLEGLILGCCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +IIIPA+C+E+ SPFGDP  C   G AY SLSMAIGAV +WTY+YNI+R        S  
Sbjct  121   IIIIPAICKEKGSPFGDPVLCHKYGMAYVSLSMAIGAVLLWTYVYNIMRIS-----TSRA  175

Query  652   DIMGSGFLDSCREALLS-SHSLKYDQDEEAQIVF----EEEEKPSELKRLRQNVKMWADK  816
              +M SG +   ++  +S +++   D  ++A  +     + EEK S   +++ +++  ++ 
Sbjct  176   KLMTSGVISESQQYNISVTNNPAKDALDDAYTLLLPNTDFEEKVSFSDKVKCHLRNISNN  235

Query  817   INLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVG  996
             IN K +FAPSTI  I   +  +   +RKL++ +NAPLHV++ SA MLG+AAIP +TLI+G
Sbjct  236   INFKTIFAPSTIGIIGFCIGVINP-IRKLMVGNNAPLHVVEDSASMLGEAAIPTVTLILG  294

Query  997   ANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYA  1176
             ANLL+GLK ++   W ++G+  VR++ LP+ G+ V+  A  FG V  D LY FVLLLQYA
Sbjct  295   ANLLKGLKGTSTPVWTIVGIIAVRYIFLPIIGVVVVQGAIKFGLVQPDPLYQFVLLLQYA  354

Query  1177  LPSAMGIGTITQLF-EVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             LP AM IGT+ QLF   GESECSVIMLW+Y++AS+A+TLW+T+FMW++
Sbjct  355   LPPAMNIGTMAQLFGSGGESECSVIMLWSYALASIAVTLWSTFFMWLV  402



>ref|XP_010270580.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010270581.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X1 
[Nelumbo nucifera]
Length=416

 Score =   362 bits (929),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 209/416 (50%), Positives = 286/416 (69%), Gaps = 13/416 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ A MPVLK L++T IG +LA +++DILG  +R HLN +V++VFTPALV S L
Sbjct  1     MGLLDLFITASMPVLKVLLVTLIGSLLALDQIDILGEDARKHLNQIVYFVFTPALVGSYL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT   +  LWFMPVNIL+T+ IGS LGWI+++ITR P  L GL++ CC+AGN+GN+ 
Sbjct  61    AKTITLERMAMLWFMPVNILITYIIGSILGWIVIRITRPPSHLKGLILGCCSAGNMGNMF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR---AYGTPRMN  642
             +I IPAVC+E+ +PFG    C T G AYASLSMAIGAVY+W Y+YN++R      + ++N
Sbjct  121   IIFIPAVCKEKGNPFGAHEICHTYGLAYASLSMAIGAVYLWAYVYNLVRVSSCTSSVQVN  180

Query  643   SST---DIMG--SGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELK-----RLRQ  792
              ST    + G  S +  SC EALL+S       D   Q      E   ELK     + R 
Sbjct  181   GSTICSKLSGETSEYKGSCTEALLNSQDCSISSDFSDQYKLPCIEPQGELKGPISVKFRH  240

Query  793   NVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAI  972
              +++  + IN K + +PS I   VG ++G+V  +R+ +I +NAPL VI  SA ++GD A+
Sbjct  241   QLEILLENINWKALVSPSIIGAFVGFLVGIVPQMRRSVIGENAPLRVIQDSASLVGDGAV  300

Query  973   PAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYH  1152
             PA+TLI+G NL++GL+ S I   ++ G+ +VR++ LPL GI +I  A  +G V SD LY 
Sbjct  301   PALTLIMGGNLMKGLQGSQIKLSLIFGIIIVRYITLPLLGILIIKGAIRYGLVHSDPLYQ  360

Query  1153  FVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             FVLLLQ+A+P AM IGTITQLF  GE ECSVIMLW Y +AS+++TLW+T+FMW+L+
Sbjct  361   FVLLLQFAVPPAMNIGTITQLFGTGERECSVIMLWTYILASVSITLWSTFFMWLLA  416



>ref|XP_011038092.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Populus euphratica]
Length=420

 Score =   361 bits (927),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 214/421 (51%), Positives = 284/421 (67%), Gaps = 19/421 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDL  +A +P+LK LI+TA+G +LA + + +LG S+R  LN +VF VF+PALV SSL
Sbjct  1     MRLLDLLYIASVPILKVLILTALGSLLALDNIHVLGESTRKELNRVVFLVFSPALVVSSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  +IV LWFMPVNIL  F +GS LGWIL+KITR  ++L GL++ CCAAGN G+LL
Sbjct  61    AKTITYENIVTLWFMPVNILCAFIVGSELGWILIKITRPAKQLKGLILGCCAAGNNGSLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
              IIIPAVC E+ SPFG P  CST G AY SLS+A+ A+Y+W+Y+YN++R   +  +N   
Sbjct  121   FIIIPAVCSEKGSPFGSPDVCSTYGMAYVSLSLAVSAIYMWSYVYNVVRV-SSRDVNKEA  179

Query  652   DIMGSGFLDSC---------------REALLSSHSLKYDQDEEAQIVFEEEEKPSEL---  777
             D  G G   S                 EA L S       + E  + F   E   ++   
Sbjct  180   DSDGHGGSTSTVKDAGETPEPIQGNYSEAFLPSKEFPVSDEYELLLPFTNSEGIVKVHLS  239

Query  778   KRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADML  957
              +++Q  +M + K+NLK +FAPST A I G +IGV+  +R  +I   APLHV+++SA ++
Sbjct  240   DKIKQCFRMISRKLNLKAVFAPSTTAAIAGFIIGVIPQIRNSLIGSGAPLHVVEASASLI  299

Query  958   GDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGS  1137
             GDAAIP +TLIVG NLLRGL+ S I   +++G+  VRFV LPL G  ++  A HFG V S
Sbjct  300   GDAAIPTITLIVGGNLLRGLRGSGIQSSLIVGIVAVRFVFLPLIGTAIVKGAVHFGLVHS  359

Query  1138  DSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             D LY FVLLLQ+A+P A+ IGTITQLF  GESECSVIMLW Y++AS+ LTLW+T FMW++
Sbjct  360   DPLYQFVLLLQFAVPPALNIGTITQLFGAGESECSVIMLWTYALASIFLTLWSTLFMWLV  419

Query  1318  S  1320
             +
Sbjct  420   A  420



>ref|XP_008237904.1| PREDICTED: uncharacterized transporter YBR287W-like [Prunus mume]
Length=416

 Score =   361 bits (926),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 218/414 (53%), Positives = 284/414 (69%), Gaps = 11/414 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L LF+ AL+PVLK L IT +G  LA +RV+ILG  +R HLN +VFYVF+PALV+S+L
Sbjct  1     MELLQLFITALIPVLKILFITVLGSYLALDRVNILGEDARKHLNTVVFYVFSPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  SIVKLWFMPVNIL+TF +GS LGWIL+++TR P  L G+V+ CCA GNLG +L
Sbjct  61    ARTITPKSIVKLWFMPVNILITFIVGSILGWILLQLTRPPAYLRGIVVGCCAGGNLGFML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR---AYGTPRMN  642
             LII+PAVC+E+ SPFG P  C T   AYASLSMAIGA+Y+W+Y+YNI+R     GT   +
Sbjct  121   LIIVPAVCKEKGSPFGAPDVCHTFALAYASLSMAIGAMYLWSYVYNIVRISAKRGTQNAH  180

Query  643   SSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQ-------IVFEEEEKPSEL-KRLRQNV  798
              S +   +    SC E  LSS   +  +D+ A         + EE  K + L K ++Q +
Sbjct  181   QSPERSSTPNQVSCTEPPLSSKESEEVEDKAADQYALPCTAISEENAKMTSLGKVIKQRI  240

Query  799   KMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPA  978
              M   K+NLK +F+PST   +VG VIG++  +RKL+I D APL V+  +A +LGDAAIP+
Sbjct  241   MMVFGKLNLKTIFSPSTTGAMVGFVIGLIPPIRKLLIGDGAPLRVVQDTASLLGDAAIPS  300

Query  979   MTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFV  1158
             +TLI+G NLL G +   I   +V+G+ VVR+V LPL GI V+  A  FG V  D LY FV
Sbjct  301   LTLIIGGNLLAGSRGPGIQKSLVVGIIVVRYVALPLVGILVVKGALKFGLVHYDPLYLFV  360

Query  1159  LLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LLLQ++LP AM IG + QLF  GE ECSVIMLW Y  AS+ LT W+ +FMW+++
Sbjct  361   LLLQFSLPPAMNIGIMAQLFGAGEKECSVIMLWAYVFASVTLTFWSAFFMWLVA  414



>ref|XP_004300092.1| PREDICTED: uncharacterized transporter YBR287W-like [Fragaria 
vesca subsp. vesca]
Length=413

 Score =   361 bits (926),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 219/411 (53%), Positives = 281/411 (68%), Gaps = 8/411 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MA L LF+ A +PVLK L ITA+G  LA ER++ILG  +R +LN +VFYVF+PALV ++L
Sbjct  1     MAVLQLFITASIPVLKVLFITALGSYLALERINILGEETRKNLNTVVFYVFSPALVGTNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S++KLWFMPVNIL+TF +GS LGWIL+++ R P  L GL++ CCAAGNLGNLL
Sbjct  61    AQTITYDSMIKLWFMPVNILVTFLVGSLLGWILIQLARPPPHLRGLILGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR---AYGTPRMN  642
             LIIIPAVC+E+ SPFG P  C T G AYASLSMA GA+YIW+Y+YNI+R      T  + 
Sbjct  121   LIIIPAVCKEKGSPFGAPDVCHTYGMAYASLSMATGAIYIWSYVYNIVRISSKRTTQDLP  180

Query  643   SSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQ-----IVFEEEEKPSELKRLRQNVKMW  807
              S +        S  E LLSS      +D   Q      + +++ K     + +  +   
Sbjct  181   QSLEEPSESNQASFTEPLLSSKEYGILEDNADQYALPCTISQQDSKIEPPSKSKNCIVRM  240

Query  808   ADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTL  987
                +NLK +FAPSTI  IVG  IGV+  +R L+I D APL VI  + ++LGD AIPA+TL
Sbjct  241   CQMLNLKTIFAPSTIGAIVGFAIGVIPQIRNLMIGDGAPLRVIQDTTNLLGDGAIPALTL  300

Query  988   IVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLL  1167
             I+G NLL+GL+ S I   +V+G+  VR+V LPL GI +I  A  FG V SD LY FVLL+
Sbjct  301   IIGGNLLKGLRGSGIQKSIVVGIIFVRYVFLPLTGILIIKGALKFGLVHSDPLYLFVLLI  360

Query  1168  QYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             QY LP AM IGTITQLF  GESECSVI+LW Y  AS++LTLW+ +FMW ++
Sbjct  361   QYTLPPAMNIGTITQLFGAGESECSVILLWTYVFASVSLTLWSAFFMWFVA  411



>ref|XP_011099988.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Sesamum indicum]
Length=417

 Score =   360 bits (924),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 218/420 (52%), Positives = 297/420 (71%), Gaps = 20/420 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M+ LDLF  + +PVLK L++T +G  LA +R+DILG  +R HLNN+VF+VF+PALV+S+L
Sbjct  1     MSLLDLFRASSIPVLKVLLVTGLGSYLARDRIDILGDDARKHLNNIVFFVFSPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+VKLWFMP+NILLTF IG+ LGW +++ITR P  L GLVI CCAAGNLGNLL
Sbjct  61    AKTITYDSMVKLWFMPINILLTFIIGTILGWGVIQITRTPFHLRGLVIGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPAVC+ER SPFG+   C  +G AYASLSMAIGA+Y+W+Y+YNI+R   +    SS 
Sbjct  121   LIIIPAVCKERASPFGNADVCYEHGMAYASLSMAIGAIYLWSYVYNIVRVSSS---KSSN  177

Query  652   DIMGSGF---LDSCREAL------LSSHSLKYDQDEEAQIVFEEEE--------KPSELK  780
             ++  S      + C   L      + +   + ++ E ++   EE E        K S   
Sbjct  178   EVKASDLSVRAEDCESGLSQPQEKIENEPYQLNKTELSERNAEETEEATRGSPVKVSGSD  237

Query  781   RLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLG  960
             +++Q ++    +++LK +FAPSTI  IVG V+G+   +RKL+I D APL VI  +A +LG
Sbjct  238   KIKQRLETLFKQMHLKRLFAPSTIGAIVGFVVGLEPQIRKLMIGDAAPLRVIQDTALLLG  297

Query  961   DAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSD  1140
             D AIPA+TL++G NLL+GLK S I   +++G+ +VR+V LPL GIGV+  A+  G V  +
Sbjct  298   DGAIPAVTLVMGGNLLKGLKGSGIQKSIILGILIVRYVALPLIGIGVVKGAQKLGLVHDN  357

Query  1141  SLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              LY FVLLLQ++LP AM IGT+TQLF +GESECSVIMLW Y++AS+ LTLW+  F+W++S
Sbjct  358   PLYRFVLLLQFSLPPAMNIGTMTQLFGLGESECSVIMLWCYALASVFLTLWSMLFLWLVS  417



>gb|ACJ85428.1| unknown [Medicago truncatula]
 gb|AFK36849.1| unknown [Medicago truncatula]
 gb|AFK46985.1| unknown [Medicago truncatula]
Length=417

 Score =   360 bits (924),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 210/417 (50%), Positives = 290/417 (70%), Gaps = 14/417 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+LF VA  PV+K L++T IGL+LA + +++LG  +R   N+LV YVF P L+  +L
Sbjct  1     MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARSQTNHLVHYVFNPGLIGGNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  ++V LWFMPVNIL+TF +GSALGWI++K+T+ PR + GL++  C+AGNLGNL 
Sbjct  61    AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT---PRMN  642
             +IIIPA+ +++ SPFGDP  C   G AYASLSMAIGAV+IWTY+YNI+R          N
Sbjct  121   IIIIPAIRKDKGSPFGDPDVCYQFGMAYASLSMAIGAVFIWTYVYNIMRISSRNVHKECN  180

Query  643   SSTDIMGSGFLDSCREALLSSHSLKY------DQDEEAQIVFEEEEKPSELK-----RLR  789
              S+D +         ++++   S  Y      + D+   ++  + E   ++K     +++
Sbjct  181   KSSDSITLEDSRDVSQSIIEEGSENYTSPTKGNVDDAYTLLLSKNESEQKIKVPVFDKIK  240

Query  790   QNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAA  969
                 M     N + +F+P+T+  IVG ++GVV +LR+L+I  NAPLHVI+ SA MLGDAA
Sbjct  241   HKFGMILGNPNFRGIFSPATLGAIVGFIVGVVPWLRRLMIGSNAPLHVIEDSASMLGDAA  300

Query  970   IPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLY  1149
             IP +TLI+GANLLRGLK ++   W +IG+ VVR++LLP+ G+ +I  A H G V  D LY
Sbjct  301   IPTITLIMGANLLRGLKGASTPFWTIIGIIVVRYILLPIFGVLIIKGATHLGLVQIDPLY  360

Query  1150  HFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              FVLLLQYALP AM IGTI QLF  GESECSV+MLW Y++AS+A+TLW+TYFMW++S
Sbjct  361   QFVLLLQYALPPAMNIGTIAQLFGAGESECSVMMLWTYALASIAVTLWSTYFMWLVS  417



>ref|XP_004300096.1| PREDICTED: uncharacterized transporter YBR287W-like [Fragaria 
vesca subsp. vesca]
Length=406

 Score =   359 bits (921),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 217/407 (53%), Positives = 287/407 (71%), Gaps = 7/407 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M    LFV A +PVL++ +ITA+G  LA +RV++LG  SR+HLN ++FYV TPAL+ ++L
Sbjct  1     MNLWTLFVTASIPVLESFLITALGSYLALDRVNLLGPDSRNHLNTILFYVCTPALIGANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  S+VKLWFMPVNI LTF +GS  GWIL+K+TR P  L GLV+ CCAAGNLGNLL
Sbjct  61    AETITYESLVKLWFMPVNIFLTFMVGSIFGWILMKLTRTPPHLRGLVLGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR-----AYGTPR  636
             LIIIPAVCEE  SPFGD  TC T G  YASLSMAIGA+Y+WTY+YNI+R     +   P 
Sbjct  121   LIIIPAVCEESGSPFGDADTCDTTGTTYASLSMAIGAIYLWTYVYNIVRISSKTSIQDPT  180

Query  637   MNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADK  816
               + +    SG + S  E LLS      DQ E    V + E K + L ++++ +     K
Sbjct  181   QTTESSSSTSGHI-SYNEPLLSIED-NVDQSELPSNVSQGEVKMTRLGKIKEWMVKMNKK  238

Query  817   INLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVG  996
             +NLK +F+PSTIA I+G  +G++S +R L+I D+APL VID +  +LGDAAIP +TLI+G
Sbjct  239   LNLKTVFSPSTIAVIIGFAVGIISPIRNLLIGDDAPLAVIDDATSLLGDAAIPLLTLIIG  298

Query  997   ANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYA  1176
              NL++GL+   I   ++IG+ +V++V  PL G+ ++  A  FG+V +D LY FVLLLQ+A
Sbjct  299   GNLVKGLRVGGIQKSILIGIIIVKYVAAPLTGVLIVKGAVKFGFVSNDPLYLFVLLLQFA  358

Query  1177  LPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             +P AM +GTITQLF  GESECSVIMLW Y  AS+ALT W  +F+W++
Sbjct  359   VPPAMNMGTITQLFRQGESECSVIMLWTYIFASVALTFWCAFFLWLV  405



>ref|XP_002528529.1| auxin:hydrogen symporter, putative [Ricinus communis]
 gb|EEF33841.1| auxin:hydrogen symporter, putative [Ricinus communis]
Length=447

 Score =   360 bits (925),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 222/449 (49%), Positives = 296/449 (66%), Gaps = 50/449 (11%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LD+F+ +++PV+K L+ITA+G  LA + VDILG  +R HLNN+VF+VF PALV S++
Sbjct  1     MGLLDIFIASVIPVVKVLLITAVGSFLAIDYVDILGVDARKHLNNIVFFVFNPALVGSNI  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              + IT  S+  LWFMP+NIL+TF IGS LGW+L+K T+AP EL GLV+ CC+AGNLGNL 
Sbjct  61    AKYITLRSMGVLWFMPLNILITFIIGSMLGWLLIKSTKAPHELWGLVLGCCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +IIIP VC+ER SPFGD   C T+G AYASLSMAIG++Y+W+Y+YNI+R Y       + 
Sbjct  121   MIIIPTVCKERGSPFGDVDVCYTHGLAYASLSMAIGSIYMWSYVYNIVRLYSNKDCGGTK  180

Query  652   -DIMGSGFLDS----------CREALLSSHSLKYDQDEEAQIVFE-------EEEKPSEL  777
              D +  G   S          C   LL   +    +DEE    FE       E+E+ S L
Sbjct  181   LDAITKGAKSSGETPKNLSRCCTGPLLPLEN--SSRDEEHMDCFELECTLSKEKEEVSIL  238

Query  778   KRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADML  957
              R++Q ++M   +  LK +FAPST   ++G +IG    LR+ +I DNAPLHVI  SA +L
Sbjct  239   DRIKQGLQM-VTEFKLKRLFAPSTTGAVIGFIIGTTPQLREALIGDNAPLHVIPDSASLL  297

Query  958   GDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGS  1137
             GDAAIP++TL VGANLL GLK SA+   V++G+ VVR+++LP+CG+ ++  A H G V S
Sbjct  298   GDAAIPSITLGVGANLLTGLKGSAVQLPVIVGIMVVRYIILPICGVVIVKSAVHLGLVQS  357

Query  1138  DSLYHFVLLLQYALPSAMGI-----------------------------GTITQLFEVGE  1230
             D LY FVLLLQ+ALP AM I                             G +TQLF  GE
Sbjct  358   DPLYQFVLLLQFALPPAMNIGLSDKLKCLGQVEHELVIDVLVRPHNARAGMMTQLFGAGE  417

Query  1231  SECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             SECSVI+LW+Y+VAS++LTLW+T+FMW++
Sbjct  418   SECSVILLWSYAVASVSLTLWSTFFMWLV  446



>ref|XP_002890416.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66675.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score =   358 bits (918),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 206/407 (51%), Positives = 282/407 (69%), Gaps = 27/407 (7%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ + +PV K L+IT IG  LA ++V+IL   +R  LNN+VFYVF+P+LVASSL
Sbjct  3     MRLLDLFITSSIPVAKILLITGIGFYLALDQVNILNQDARKQLNNIVFYVFSPSLVASSL  62

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  S+VK+WFMP+N+LLTF IGS LGWI++KIT+ P  L G+++ CCAAGNLGN+ 
Sbjct  63    SETITYESMVKMWFMPLNVLLTFIIGSFLGWIVIKITKPPSHLRGIIVGCCAAGNLGNMP  122

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP----RM  639
             LIIIPA+C E+ SPFGDP +C   G  Y +LSMAIGA+YIWTY+YN++R    P     +
Sbjct  123   LIIIPAICNEKGSPFGDPESCEKYGLGYIALSMAIGAIYIWTYVYNLMRMLANPGGETAI  182

Query  640   NSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKI  819
             NS++  M           L+S                E  E+     +++Q V   A+KI
Sbjct  183   NSTSSTM----------PLISPK-------------VEVGEQVGTWSKVKQRVSSVAEKI  219

Query  820   NLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGA  999
             NL+ +FAPSTIA ++ + +G+   LRKL++ + APL VI+ S  +LGD AIP +TLIVG 
Sbjct  220   NLRTIFAPSTIAALIALAVGLNPLLRKLLVGNTAPLRVIEDSVSLLGDGAIPVLTLIVGG  279

Query  1000  NLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYAL  1179
             NLL GL+ S +   V++GV VVR++LLP+ G+ ++  A + G V S+ LY FVLLLQY +
Sbjct  280   NLLNGLRGSGMNKSVIMGVVVVRYLLLPILGVFIVRGAHYLGLVTSEPLYQFVLLLQYVV  339

Query  1180  PSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             P AM +GTITQLF  GESECSVI+ W+Y +AS++LT+W T+FMW+++
Sbjct  340   PPAMNLGTITQLFGSGESECSVILFWSYVLASVSLTVWPTFFMWLVA  386



>ref|XP_011100000.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Sesamum indicum]
Length=416

 Score =   358 bits (919),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 220/423 (52%), Positives = 295/423 (70%), Gaps = 27/423 (6%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M+ LDLF  + +PVLK L++T +G  LA +R+DILG  +R HLNN+VF+VF+PALV+S+L
Sbjct  1     MSLLDLFRASSIPVLKVLLVTGLGSYLARDRIDILGDDARKHLNNIVFFVFSPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+VKLWFMP+NILLTF IG+ LGW +++ITR P  L GLVI CCAAGNLGNLL
Sbjct  61    AKTITYDSMVKLWFMPINILLTFIIGTILGWGVIQITRTPFHLRGLVIGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPAVC+ER SPFG+   C  +G AYASLSMAIGA+Y+W+Y+YNI+R   +    SS 
Sbjct  121   LIIIPAVCKERASPFGNADVCYEHGMAYASLSMAIGAIYLWSYVYNIVRVSSS---KSSN  177

Query  652   DIMGSGF---LDSCREAL------------LSSHSLKYDQDEEAQIVFEEEEKPSELK--  780
             ++  S      + C   L            L+   L     EE     EE  + S +K  
Sbjct  178   EVKASDLSVRAEDCESGLSQPQEKIENEPYLNKTELSERNAEET----EEATRGSPVKVS  233

Query  781   ---RLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSAD  951
                +++Q ++    +++LK +FAPSTI  IVG V+G+   +RKL+I D APL VI  +A 
Sbjct  234   GSDKIKQRLETLFKQMHLKRLFAPSTIGAIVGFVVGLEPQIRKLMIGDAAPLRVIQDTAL  293

Query  952   MLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWV  1131
             +LGD AIPA+TL++G NLL+GLK S I   +++G+ +VR+V LPL GIGV+  A+  G V
Sbjct  294   LLGDGAIPAVTLVMGGNLLKGLKGSGIQKSIILGILIVRYVALPLIGIGVVKGAQKLGLV  353

Query  1132  GSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMW  1311
               + LY FVLLLQ++LP AM IGT+TQLF +GESECSVIMLW Y++AS+ LTLW+  F+W
Sbjct  354   HDNPLYRFVLLLQFSLPPAMNIGTMTQLFGLGESECSVIMLWCYALASVFLTLWSMLFLW  413

Query  1312  ILS  1320
             ++S
Sbjct  414   LVS  416



>ref|XP_007010161.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao]
 gb|EOY18971.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao]
Length=486

 Score =   360 bits (925),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 233/482 (48%), Positives = 304/482 (63%), Gaps = 83/482 (17%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLD+FVVALMPVLK L++TA+GL+LA E++D+LG  +R++LN +VFYV +P+L+ S+L
Sbjct  1     MGFLDMFVVALMPVLKVLLVTAVGLLLAMEKIDLLGPEARNYLNKIVFYVLSPSLLVSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT +S+V LWFMP+NILLTF IGSALG +L+K+T+ P  L G+VI CC+AGNLGNLL
Sbjct  61    ADTITYNSVVTLWFMPLNILLTFIIGSALGLVLIKVTKTPEHLRGIVIGCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYG--TPRMNS  645
             LI++PAVCE+ NSPFGD +TCSTN  AYASLSMA+ A+Y W+Y Y ++ AY   +P   S
Sbjct  121   LILVPAVCEQSNSPFGDSSTCSTNAVAYASLSMAVAAIYTWSYSYAVVSAYAIKSPEHKS  180

Query  646   --STDIMGSGFLDSCREALLSSHSLKYDQDEEAQI------------------------V  747
               S++       DSC EALL S   +  ++   Q+                         
Sbjct  181   THSSEEAPDPSSDSCTEALLPSSYSQISEESSVQVELPLTNSGERTKVLVKPCFIAVYAS  240

Query  748   FEEE----------------------EKP-------SELKRLRQNVKMWADKINLKMMFA  840
             F E                        KP       S  K + Q VK    KI+LKM+FA
Sbjct  241   FAESLISLVFMCLDLSASMRNPVFAFRKPFVNLHKMSFWKNIVQCVKSIMSKIDLKMVFA  300

Query  841   PStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLR---  1011
             PSTIA I+G + G+VS +RK++I D+APLHVI +SA  +G+AAIP MTLI+GANLL+   
Sbjct  301   PSTIAAIIGFIFGIVSPIRKVLIDDSAPLHVIYTSAAFIGEAAIPCMTLIMGANLLKGCY  360

Query  1012  -----GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYA  1176
                  GLK+S +   V+IGV  VR + LPL GIGV   A HFG  GSDSLY FVL+LQYA
Sbjct  361   KLVLAGLKRSEVNLLVIIGVVAVRNIFLPLLGIGVTKAAYHFGMAGSDSLYQFVLMLQYA  420

Query  1177  LPSAMGIGTI------------------TQLFEVGESECSVIMLWNYSVASLALTLWTTY  1302
             +P A  +G I                  TQLF+ G+ E S+IMLW Y+VAS++LTLW+T 
Sbjct  421   VPPAFNVGMISLYHILYMHTYYQRQSVMTQLFQRGQGETSIIMLWTYAVASISLTLWSTL  480

Query  1303  FM  1308
             FM
Sbjct  481   FM  482



>emb|CDP01745.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   358 bits (918),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 215/416 (52%), Positives = 290/416 (70%), Gaps = 16/416 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+VA +PV+K L+I  +G  LA + +DILG S+R  +NN+VF+VF PALV+S+L
Sbjct  1     MGLLDLFMVASVPVMKVLLICGLGSFLALDHIDILGESARKQINNVVFFVFNPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  +IV LWFMPVNILLTF +G   GW+L KIT+AP+ L GLVI  CAAGNLGNL 
Sbjct  61    AQTITLENIVSLWFMPVNILLTFILGLFFGWVLGKITKAPQHLKGLVIGSCAAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRM----  639
             LI++PA+C E+ SPFG P +C   G AY SLSMAIGA+Y+W+ +YNI+R   T       
Sbjct  121   LILVPAICREKGSPFGAPDSCHMYGMAYVSLSMAIGAIYLWSIVYNIVRVSSTKSYEVIN  180

Query  640   --NSSTDIMGSGFLDSCREALLSSHSLKYDQD-EEAQIVF------EEEEKPSELKRLRQ  792
               N S+D   S    S  E L+    L+     ++A +        +E+ K   + ++++
Sbjct  181   VKNKSSDEETS---KSLLEQLIDELDLEGTSAMDDANVSLLSCAKTDEQGKVFIMDKIKK  237

Query  793   NVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAI  972
              +  +   INL  + APST A IVG ++G+V  +++L+I  +APLHV+  SA +LG+AAI
Sbjct  238   QIYSFFRNINLTAILAPSTTAAIVGFIVGLVPPIQRLMIGASAPLHVVQDSALLLGEAAI  297

Query  973   PAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYH  1152
             P +TLIVGANLLRGL+ S +   V++G+  +R+V LPL G+ VI  A H G+V +D LY 
Sbjct  298   PIVTLIVGANLLRGLRGSGVQLTVILGIIAIRYVFLPLIGVLVIRGAIHLGFVHADPLYQ  357

Query  1153  FVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             FVLLLQYALP AM IGTITQLF  G+SECSVI+LW YSVAS++LTLW+TYFMW+++
Sbjct  358   FVLLLQYALPPAMNIGTITQLFGSGQSECSVILLWTYSVASVSLTLWSTYFMWLVA  413



>ref|XP_010033618.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus 
grandis]
 gb|KCW53316.1| hypothetical protein EUGRSUZ_J02569 [Eucalyptus grandis]
Length=418

 Score =   358 bits (918),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 213/418 (51%), Positives = 293/418 (70%), Gaps = 15/418 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLDL ++A MPVLKTL++TA+GL LA E VD++G S+R  LN + ++VF+PALV S+L
Sbjct  1     MGFLDLLMIASMPVLKTLLVTALGLYLALESVDVMGESARKQLNRVGYFVFSPALVGSTL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               T+T+ +I +LWFMPVNIL+TF IGSALGWILVK TRAP  + GL++ CCAAGNLG+L 
Sbjct  61    ARTVTSENIAQLWFMPVNILITFIIGSALGWILVKFTRAPHHVKGLILGCCAAGNLGHLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR------AYGTP  633
             LIIIPA+C+E+ SPFG P  C   G AYAS++MA+GAVY+W+Y++N++R        G  
Sbjct  121   LIIIPALCKEQGSPFGVPDVCQKYGMAYASITMAVGAVYLWSYVFNLVRVSASNITRGDE  180

Query  634   RMNSSTDIMGS-----GFLDSCREALLSSHSLKYDQD-EEAQIVFEEEEKPSELK---RL  786
             + ++S +   S       +  C EALL S       + +E+ +   + E  S++    R+
Sbjct  181   KSDASVENTESTTDTKKCIQECPEALLPSTKCTSTGNLDESMLPLVKPEVNSQVSTWGRI  240

Query  787   RQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDA  966
             +  +   +  INL+ +  PSTIA IVG  +GVV  +R L+I   APL V++ SA +LGDA
Sbjct  241   KNCLTKISKNINLQTLLVPSTIAAIVGFTVGVVPRIRGLLIGAGAPLRVVEDSASLLGDA  300

Query  967   AIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSL  1146
             AIPA+TLI+G NLLRGL+ S +   ++ GV V+R++LLP+ GI ++  A +FG V  D L
Sbjct  301   AIPAVTLIMGGNLLRGLRGSGVQLSLIAGVVVIRYILLPVIGIVIVKGALYFGLVHEDPL  360

Query  1147  YHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             Y FVLLL YALP A  IGT+TQLF  GESECSV+MLW Y++AS+ALT+W T FMW+++
Sbjct  361   YLFVLLLHYALPPATNIGTMTQLFGAGESECSVVMLWTYALASVALTVWLTIFMWLVT  418



>gb|KDP24916.1| hypothetical protein JCGZ_24294 [Jatropha curcas]
Length=447

 Score =   358 bits (920),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 221/430 (51%), Positives = 301/430 (70%), Gaps = 23/430 (5%)
 Frame = +1

Query  94    SSKKILMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPA  273
             ++   +M  L+LFV+A MPVLK L+ITA+G  LA E V++LG  +R  +N++VFYVF PA
Sbjct  20    NTATFIMQLLNLFVIASMPVLKVLLITALGSFLALEYVNVLGEEARKQINSVVFYVFNPA  79

Query  274   LVASSLGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaag  453
             L+ S+L +TIT  SI  LWFMPVNIL+TF IGS LGW+L+K+T  P+ L GL++ CCAAG
Sbjct  80    LIGSNLAKTITFESISLLWFMPVNILVTFIIGSILGWLLIKVTATPQHLRGLILGCCAAG  139

Query  454   nlgnllliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP  633
             NLGNL LIII A+C+E+ SPFG P  C T G AYASLSMAIGAV++W+Y+YNI+R   + 
Sbjct  140   NLGNLPLIIIAAICKEKGSPFGAPDVCYTYGIAYASLSMAIGAVFLWSYVYNIMR-ISSS  198

Query  634   RMNSSTD-------------------IMGSGF-LD-SCREALLSSHSLKYDQDEEAQIVF  750
              MN   D                   I G+ + +D S +E+L+S+  L      E Q + 
Sbjct  199   EMNQQVDNADSDTETNIKTTVGAPKCIQGNYYSVDLSSKESLISAE-LASPLLPENQEIV  257

Query  751   EEEEKPSELKRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLH  930
             +       + ++++  +  ++K+NLK +FAPSTI  IVG  IGVV  +RKL+I  +APL 
Sbjct  258   KNLSWTQFIDKIKERSRKISEKLNLKALFAPSTIGAIVGFAIGVVPQIRKLLIGASAPLR  317

Query  931   VIDSSADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITL  1110
             VI+ SA +LGDAAIP +TLIVG NLL+GLK S I   +++G+ +VR+VLLP+ G+  +  
Sbjct  318   VIEDSAYLLGDAAIPIVTLIVGGNLLKGLKGSGIRWSLIVGILIVRYVLLPVMGVVTVKT  377

Query  1111  ARHFGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTL  1290
             A HFG V SD LY F+LLLQ+A+P AM IGT+TQLF  G+SECSVIMLW Y+ AS++LTL
Sbjct  378   AVHFGLVHSDKLYQFILLLQFAVPPAMNIGTMTQLFGRGQSECSVIMLWTYAFASVSLTL  437

Query  1291  WTTYFMWILS  1320
             W+T+F+W+L+
Sbjct  438   WSTFFLWMLA  447



>ref|XP_011099968.1| PREDICTED: uncharacterized transporter C5D6.04-like [Sesamum 
indicum]
 ref|XP_011099976.1| PREDICTED: uncharacterized transporter C5D6.04-like [Sesamum 
indicum]
Length=393

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 221/403 (55%), Positives = 285/403 (71%), Gaps = 10/403 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MAFLDLF+ + +PVLK L++T +G  LA +R+ ILG  +R HLNN++F+VF PALV+S+L
Sbjct  1     MAFLDLFITSSIPVLKVLLVTGLGSYLALDRIGILGDDARKHLNNIIFFVFNPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              + IT  S+VK+WFMP NIL+TF IGS LG ++V+IT+AP  L GLVI CCAAGNLGNLL
Sbjct  61    AKEITYESMVKMWFMPFNILITFVIGSILGLVIVRITKAPPHLQGLVIGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
              IIIP   +ER S FGD   C  NG AYASLS+AIGA+Y+W Y+YNI+R         S 
Sbjct  121   FIIIPTARKERTSTFGDADVCHENGMAYASLSLAIGAIYLWAYVYNIVRVS---SSMFSR  177

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKM  831
             +   S    S  E LLSS +   D+       FE +   S   ++ + +++  +K+NLK 
Sbjct  178   ESSSSPSGGSWTEPLLSSSNSPQDR-------FENKPPVSVAAKMMKKLEILVEKMNLKR  230

Query  832   MFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLR  1011
             +FAPST A I G V+G+V  +RKL+I D APL VI  +A  LGD AIPA+TLI+G NL++
Sbjct  231   LFAPSTTAAIAGFVVGLVPQIRKLLIGDAAPLRVIQDTALFLGDGAIPAVTLIMGGNLIK  290

Query  1012  GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAM  1191
             GLK S I   V+IGV  VR+V LPL GI V+  A  FG + +D LY FVLLLQ++LP AM
Sbjct  291   GLKGSGIQKSVIIGVLAVRYVALPLTGIAVVKGALRFGLIHNDPLYLFVLLLQFSLPPAM  350

Query  1192  GIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              IGTITQLF VGESECSVIMLW Y++ASL+LTLW+T F+W++S
Sbjct  351   NIGTITQLFGVGESECSVIMLWCYTLASLSLTLWSTVFLWLVS  393



>ref|XP_007211270.1| hypothetical protein PRUPE_ppa017924mg [Prunus persica]
 gb|EMJ12469.1| hypothetical protein PRUPE_ppa017924mg [Prunus persica]
Length=423

 Score =   357 bits (915),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 220/421 (52%), Positives = 283/421 (67%), Gaps = 18/421 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L LF+ A +PVLK L+ITA+G  LA + V+ILG  +R HLN +VFYV +PALV+S+L
Sbjct  1     MEVLQLFITASIPVLKVLLITALGSYLALDSVNILGEDTRKHLNTVVFYVLSPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S+VKLWFMPVNIL+TF +GS LGWIL+ +TR P  L GLV+ CCAAGNLGNLL
Sbjct  61    ARTITYESMVKLWFMPVNILITFIVGSILGWILLLLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR---AYGTPRMN  642
             LII+PAVC+E+ SPFG P  C T G AYASLSMAIGA+Y+W+Y+YNI+R     GT    
Sbjct  121   LIIVPAVCKEKGSPFGAPDVCRTYGLAYASLSMAIGAIYLWSYVYNIVRISAKRGTQDST  180

Query  643   SSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQ-----IVFEEEEKPSELKRLRQNVKMW  807
              S     +    SC E LLSS   +  +D          + EE  K +   +++Q + M 
Sbjct  181   QSPVRSSTPNEISCTEPLLSSKESEVVEDNANHYALPCTISEENAKMTTSGKIKQRIMMV  240

Query  808   ADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTL  987
               K+NLK +FAPST   IVG  IG++  +RK +I D APL V+  +A +LGD AIP +TL
Sbjct  241   FGKLNLKTIFAPSTTGAIVGFSIGLIPQIRKALIGDGAPLRVVQDTASLLGDGAIPTLTL  300

Query  988   IVGANLLR----------GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGS  1137
             I+G NLL+          GL+   +   +V+G+ +VR+V LPL GI VI  A   G V S
Sbjct  301   IIGGNLLKVFTDFHFVLSGLRGPGMQKSLVVGIIIVRYVALPLIGILVIKGALKLGLVHS  360

Query  1138  DSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             D LY FVLLLQ++LP AM IGTITQLF  GE ECSVIMLW Y+ AS++LT W+ +FMW++
Sbjct  361   DPLYLFVLLLQFSLPPAMNIGTITQLFGAGEKECSVIMLWTYAFASVSLTFWSAFFMWLV  420

Query  1318  S  1320
             +
Sbjct  421   A  421



>ref|NP_683316.2| auxin efflux carrier-like protein [Arabidopsis thaliana]
 gb|AEE30042.1| auxin efflux carrier-like protein [Arabidopsis thaliana]
Length=472

 Score =   358 bits (919),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 207/407 (51%), Positives = 283/407 (70%), Gaps = 27/407 (7%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ + +PV K L+IT IG  LA ++V+IL   +R  LNN+VFYVF+P+LVASSL
Sbjct  89    MRLLDLFITSSIPVAKILLITGIGFYLALDQVNILNHDARKQLNNIVFYVFSPSLVASSL  148

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  S+VK+WFMP+N+LLTF IGS LGWI++KIT+ P  L G+++ CCAAGNLGN+ 
Sbjct  149   SETITYESMVKMWFMPLNVLLTFIIGSFLGWIVIKITKPPSHLRGIIVGCCAAGNLGNMP  208

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPR----M  639
             LIIIPA+C E+ SPFGDP +C   G  Y +LSMAIGA+YIWTY+YN++R    P     +
Sbjct  209   LIIIPAICNEKGSPFGDPESCEKFGLGYIALSMAIGAIYIWTYVYNLMRMLANPAGETAI  268

Query  640   NSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKI  819
             NS++  M           L+S                E  E+     +++Q V   A+KI
Sbjct  269   NSTSSTM----------PLISPK-------------VEVAEQVGTWGKVKQRVCSVAEKI  305

Query  820   NLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGA  999
             NL+ +FAPSTIA ++ + +G+   LRKL++ + APL VI+ S  +LGD AIP +TLIVG 
Sbjct  306   NLRTIFAPSTIAALIALAVGLNPLLRKLLVGNTAPLRVIEDSVSLLGDGAIPVLTLIVGG  365

Query  1000  NLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYAL  1179
             NLL GL+ S I   V++GV VVR++LLP+ G+ ++  A + G V S+ LY FVLLLQY +
Sbjct  366   NLLNGLRGSGINKSVIMGVVVVRYLLLPILGVFIVRGAHYLGLVTSEPLYQFVLLLQYVV  425

Query  1180  PSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             P AM +GTITQLF  GESECSVI+ W+Y++AS++LT+W T+FMW+++
Sbjct  426   PPAMNLGTITQLFGSGESECSVILFWSYALASVSLTVWPTFFMWLVA  472



>ref|XP_006370751.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 gb|ERP67320.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
Length=376

 Score =   355 bits (910),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 217/374 (58%), Positives = 271/374 (72%), Gaps = 9/374 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLDLFVVA++PVLK L+IT +GL LA +R+D+LG+++R +LNNL+FYVF+PALV+S L
Sbjct  1     MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S+  LWFMPVNILLTF IGS L WIL+KITR P  L GLVI CC+AGNLGNLL
Sbjct  61    AGTITLQSLASLWFMPVNILLTFIIGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PAVC E NSPFGD T CS+ G AYASLSMA+GA+YIWTY+Y I+R Y     NS+ 
Sbjct  121   LIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAVGAIYIWTYVYIIMRIYAD---NSAE  177

Query  652   DIMGSGFLD--SCREALL--SSHSLKYDQDEEAQI--VFEEEEKPSELKRLRQNVKMWAD  813
             +       D  S  EALL  S  S  +D    A++     E +K + ++R   N K +A 
Sbjct  178   NTKNVSIADSESYTEALLPSSEKSSCHDHSVHAELPETMSEGKKVTFMERTFWNFKKFAA  237

Query  814   KINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIV  993
               NLK +FAP+TIA + G VIG +S +RK+II D+APL V++SSA +LG A+IP M LI+
Sbjct  238   NTNLKKVFAPATIAAMFGFVIGTISPIRKVIIGDSAPLRVLESSASLLGQASIPCMALIM  297

Query  994   GANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQY  1173
             G+NLL+GL++S I   V+ G+ VVR   LPL GIG++  A HFG VGSDSLY F+LLLQY
Sbjct  298   GSNLLKGLRRSEISVSVIAGIVVVRNFFLPLIGIGIVKAAHHFGLVGSDSLYQFILLLQY  357

Query  1174  ALPSAMGIGTITQL  1215
             ALP AM IGT T L
Sbjct  358   ALPPAMAIGTRTSL  371



>ref|XP_011027948.1| PREDICTED: uncharacterized transporter C5D6.04-like [Populus 
euphratica]
Length=420

 Score =   355 bits (912),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 209/421 (50%), Positives = 287/421 (68%), Gaps = 27/421 (6%)
 Frame = +1

Query  124   DLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSLGETI  303
              LF VALMPVLK L++TA+G+ LA ERV ILGA +R+HLNNLVFYV  PALV SSL + +
Sbjct  5     KLFFVALMPVLKVLLLTAVGVFLAIERVGILGADARNHLNNLVFYVLGPALVGSSLAKFV  64

Query  304   TASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiI  483
             T  S+++LWFMP+N+L+TF IGS LGW+LVKIT AP+ + G+++  CAAGNLG + LI+I
Sbjct  65    TLKSLLELWFMPLNVLMTFIIGSVLGWLLVKITNAPKRMRGMILGFCAAGNLGAIPLILI  124

Query  484   PAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY-------------  624
             PAVC+E+ SPFGD   C+T G AYASLSMAIGA+Y+W+Y+Y+I+R Y             
Sbjct  125   PAVCKEKGSPFGDSNACNTRGLAYASLSMAIGAIYLWSYVYHIVRVYSSSKDSDESKLDE  184

Query  625   ---GTPRMNSSTDIMGSGFLDSCREA---LLSSHSLKYDQDEEAQ---IVFEEEEKPSEL  777
                G      +T+      L  CR      L   SL+    E  +   +V +E+ K    
Sbjct  185   LPEGAESAGETTE-----NLPKCRTGPLLPLKEPSLEEGHMEHLELDCVVPQEKAKEPFP  239

Query  778   KRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADML  957
               +RQ  +    K+NL+ +F+P     IVG +IGVV   +K +I D APLHV++ SA  L
Sbjct  240   SNVRQGFQKVIKKLNLRRLFSPIINGAIVGFIIGVVPPFQKALIGDTAPLHVVEDSAYFL  299

Query  958   GDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGS  1137
             G+AA+P++TLI+GANLL GLK S +   V+IG+  VR+++LP+ G  +I  A  FG + S
Sbjct  300   GEAALPSVTLIMGANLLEGLKGSKVPLMVIIGIVAVRYIILPISGALIIKYAVRFGLLHS  359

Query  1138  DSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             D LY FVLLLQ+ALP A+GIGT+TQLF  G++ECSVIML+ Y++A+++LTLW+ +F+W +
Sbjct  360   DPLYQFVLLLQFALPPAIGIGTMTQLFGAGQTECSVIMLYTYALATISLTLWSAFFIWFV  419

Query  1318  S  1320
              
Sbjct  420   K  420



>ref|XP_007158042.1| hypothetical protein PHAVU_002G119300g [Phaseolus vulgaris]
 ref|XP_007158043.1| hypothetical protein PHAVU_002G119300g [Phaseolus vulgaris]
 gb|ESW30036.1| hypothetical protein PHAVU_002G119300g [Phaseolus vulgaris]
 gb|ESW30037.1| hypothetical protein PHAVU_002G119300g [Phaseolus vulgaris]
Length=412

 Score =   355 bits (911),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 215/412 (52%), Positives = 283/412 (69%), Gaps = 9/412 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MA ++L  VA MPV+K L+ITA+GLVLA   +++LG  +R  +NNLV YV  PALV  +L
Sbjct  1     MALMELLWVASMPVIKVLLITAVGLVLALGNINLLGKDARIQVNNLVHYVLYPALVGGNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT+ ++V LWFMPVNILLTF IGSALGWILVK+TRAP+ L GL++  C+AGNLGNL 
Sbjct  61    ADTITSENVVSLWFMPVNILLTFIIGSALGWILVKLTRAPKHLEGLIVGVCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR--AYGTPRMNS  645
             +IIIPA+C+++ SPFGD   C   G AYASLSMA+GAVYIW Y+YNI+R  A   P+   
Sbjct  121   IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAVGAVYIWIYVYNIMRISASIVPKEEY  180

Query  646   STDIMGSGFLDSCREALLSSHSLKYDQ-DEEAQIVF------EEEEKPSELKRLRQNVKM  804
              T           ++ L      K D  D++A  +       EE+ K S   +++  +  
Sbjct  181   RTSSFTQEASGEIQDFLSEEEDPKKDNMDDDAYTLLLSSNESEEKVKVSISAKIKDLLGK  240

Query  805   WADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMT  984
                  N K +F+P+T+ +IVG ++GVV  +RKL+I  +APLHVI  S  MLG+AAIP +T
Sbjct  241   LLVNSNFKAVFSPTTLGSIVGFMVGVVPLIRKLMIGSDAPLHVIQDSVTMLGEAAIPVIT  300

Query  985   LIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLL  1164
             LI+GANLL+GLK +      +IG+ VVR+++LP+ GI VI  A   G V  D LY FVLL
Sbjct  301   LIMGANLLKGLKGANTSFCTIIGILVVRYIILPILGILVIKGATELGLVQPDPLYQFVLL  360

Query  1165  LQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             L+YALP AM IGTI QLF  GE ECSVIMLW Y +AS+A+TLW+TYFMW+++
Sbjct  361   LEYALPPAMAIGTIAQLFGAGEGECSVIMLWTYVLASVAVTLWSTYFMWLVA  412



>ref|XP_010932122.1| PREDICTED: uncharacterized transporter YBR287W-like [Elaeis guineensis]
Length=418

 Score =   355 bits (912),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 213/418 (51%), Positives = 294/418 (70%), Gaps = 15/418 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+LF+ A +PV+  L++TA+G  LA   V IL  ++R HLNN+VF+VF PALV+++L
Sbjct  1     MGFLELFITATVPVMNVLLVTAVGSFLATSYVGILSEAARKHLNNVVFFVFNPALVSTNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+V LWFMP+NILLTF IGS  GW++++ITRAP  L GL++ CCAAGNLGN+L
Sbjct  61    AQTITMESMVLLWFMPINILLTFIIGSLFGWLVIQITRAPTNLRGLILGCCAAGNLGNML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PA+C+E+ SPFG P  C T G AYASLSMAIGA+++W+Y+YNI+R     +M+++ 
Sbjct  121   LIIVPAICKEKGSPFGAPVVCHTYGLAYASLSMAIGAIFLWSYVYNIVRISAKGKMDTNF  180

Query  652   DIMGSGFLD--------SCREALLSSH--SLKYDQDEEAQIVFEEEEKPSELK-----RL  786
                   F +        SC    +++H  S+     +E+ +     ++ S  K     + 
Sbjct  181   HPRTMEFPEGSTSLIPGSCTIGAVTTHNCSISDHYADESTLPLSRSDESSAKKVPFSVKA  240

Query  787   RQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDA  966
             R+ +   +  I+LK +FAPSTI  IVG +IGV+  +RK +I + APL VI  SA +LGD 
Sbjct  241   RKLLSTLSGVIDLKKLFAPSTIGVIVGFIIGVIPQIRKAMIGEGAPLRVIQESAALLGDG  300

Query  967   AIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSL  1146
             AIP +TLI+G NL++GL+ S+I   ++IGV VVR+++LPL GI V+  A   G V SD L
Sbjct  301   AIPTLTLIMGGNLIKGLRGSSIRLSIIIGVVVVRYIMLPLVGIIVVKGAIRLGLVHSDPL  360

Query  1147  YHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             Y F+LL+QYALP AM IGTITQLF  GESECSVI LW Y++ASL+LTLW+T+FMW++S
Sbjct  361   YQFILLVQYALPPAMNIGTITQLFGAGESECSVIFLWAYALASLSLTLWSTFFMWLVS  418



>emb|CDX87589.1| BnaA07g32840D [Brassica napus]
Length=389

 Score =   354 bits (908),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 195/404 (48%), Positives = 287/404 (71%), Gaps = 15/404 (4%)
 Frame = +1

Query  109   LMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASS  288
             +M  L+LF+ +  PV++ L+IT +G  LA + V++LG  +R +LNN+VFYVF+P+L+ S 
Sbjct  1     MMKLLNLFITSSKPVVEILLITIVGFYLALDGVNLLGQDARKYLNNIVFYVFSPSLIGSR  60

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L +++T  S+VK+WFMPVN+LLTF IGS LGWI++ IT+ P  L GL++ CCAAGNLGN+
Sbjct  61    LADSVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLIVGCCAAGNLGNM  120

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSS  648
              LII+PA+C+ER  PFGDP  C   G  Y +LSMA+G+VYIWTY+YN++R   +P + + 
Sbjct  121   PLIIVPAICKERGGPFGDPENCQKYGMGYVALSMAMGSVYIWTYVYNLMRVLNSP-IETQ  179

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLK  828
               I  +   D+C+  L+ S        EE     E+ +K     R+++ +   ++K+NL+
Sbjct  180   PSIESN--YDTCKVPLIPSK-------EE-----EDNQKAGRWDRIKRRIVSLSEKVNLR  225

Query  829   MMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
              +FAPSTIA ++ +VIG+++ LRKLII + APL V+  S  ++GD AIPAMTLI+G NLL
Sbjct  226   TIFAPSTIAAMIALVIGLITPLRKLIIGNGAPLGVLQDSVTLVGDGAIPAMTLIIGGNLL  285

Query  1009  RGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSA  1188
             +G++ S +    ++GV V R++LLP+ G+ ++  A     + S+ LY FVLL+QYA+P A
Sbjct  286   KGMRSSGMKKSTIVGVLVARYILLPISGVLIVRGAYKLDMIPSEPLYQFVLLIQYAVPPA  345

Query  1189  MGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             M +GTITQLF  GESECSVIMLW Y++AS++LT W T+FMW+++
Sbjct  346   MNLGTITQLFGAGESECSVIMLWTYALASVSLTAWPTFFMWLVA  389



>ref|XP_006432166.1| hypothetical protein CICLE_v10001450mg [Citrus clementina]
 gb|ESR45406.1| hypothetical protein CICLE_v10001450mg [Citrus clementina]
Length=389

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 217/407 (53%), Positives = 286/407 (70%), Gaps = 22/407 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M   DLF VA MPVLKTL++T +G  LA +RV ++G ++R  LN++VF+VF+PA+V S+L
Sbjct  1     MQISDLFFVASMPVLKTLLLTTLGSFLALDRVGVMGENARKQLNSVVFFVFSPAIVGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  SIV +WFMP+NIL TF IGS L WIL+K+TRAPR L GLV+ CCAAGNLGNL 
Sbjct  61    AKTITLESIVLMWFMPINILCTFIIGSVLAWILIKVTRAPRHLKGLVLGCCAAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPA+C E+NSPFGDP  C   G  Y SLSMA G VY WTYIYNI+R        SS+
Sbjct  121   LIIIPAICREKNSPFGDPEICHKYGMTYVSLSMATGVVYFWTYIYNIVRV-------SSS  173

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEE---EKPSELKRLRQNVKMWADKIN  822
              I    F+ S           K   ++EA ++ E+    +K S L++  + +K    K+N
Sbjct  174   KINNEEFISS-----------KTYSNQEAPLLCEKTDGIDKISVLQKTIRCLKTIPRKLN  222

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
             LK +FAPST A IVG+ IG+V  +  L+I D APLHV++ SA +LGDA IP +TLIVG N
Sbjct  223   LKALFAPSTTAAIVGLTIGMVPRIHNLMIGDAAPLHVVEDSASLLGDATIPTVTLIVGGN  282

Query  1003  LLRGLK-KSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYAL  1179
             LLRGLK  SA+   ++ G+  +R + +PL GI ++  A + G++ SD LY FVLLLQYAL
Sbjct  283   LLRGLKGSSAVPLSLIAGIIAIRHLFMPLLGIVIVKAAVNAGFIHSDPLYQFVLLLQYAL  342

Query  1180  PSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             P AM IGT+TQLF  GESECS+++ W Y++AS++LTLWTT+FMW+++
Sbjct  343   PPAMNIGTLTQLFGAGESECSIVLFWAYALASVSLTLWTTFFMWLVA  389



>gb|KCW56460.1| hypothetical protein EUGRSUZ_I02196 [Eucalyptus grandis]
Length=353

 Score =   352 bits (903),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 217/403 (54%), Positives = 278/403 (69%), Gaps = 50/403 (12%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MA LDLFVVALMPVLK L+ITA+G +LA  RVDILG  +R HLNN+VF+VF+PALV S L
Sbjct  1     MALLDLFVVALMPVLKVLLITALGSLLAIARVDILGEEARKHLNNIVFFVFSPALVFSCL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ++IT  S+  LWFMP NILLTF +GSALGW+L++ +RAP  L GLV+ CCAAGN GN+L
Sbjct  61    AKSITYKSMASLWFMPCNILLTFIVGSALGWLLIRFSRAPDHLRGLVLGCCAAGNQGNML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPAVC E+ SPFGDP +C+T+G  +ASLS+AIGA+Y+W+Y+YNI+R        SST
Sbjct  121   LIIIPAVCREKGSPFGDPESCNTHGMTFASLSLAIGAIYLWSYVYNIMRI-------SST  173

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKM  831
              IM                            +F               ++M    IN + 
Sbjct  174   KIM----------------------------IF---------------LRMVWTNINPRT  190

Query  832   MFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLR  1011
             +FAPSTI  I+G ++G    LRK  + D+APLHV+  SA +LG+AAIP++TLI+GANLLR
Sbjct  191   LFAPSTIGAIIGFIVGTTPPLRKATVGDSAPLHVVLDSASLLGNAAIPSVTLILGANLLR  250

Query  1012  GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAM  1191
             GLK S+I   V+IG+  VR++ LPL G+ ++  A + G V SD LY FVLLLQ+ALP AM
Sbjct  251   GLKGSSIHPPVIIGILAVRYIALPLLGMMIVRGAVYLGLVQSDPLYQFVLLLQFALPPAM  310

Query  1192  GIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              IGTITQLF   E+ECSVIMLW Y VA+++LTLW+  FMW++S
Sbjct  311   NIGTITQLFGAVEAECSVIMLWTYVVAAVSLTLWSALFMWLVS  353



>ref|XP_009106321.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
Length=389

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 196/404 (49%), Positives = 287/404 (71%), Gaps = 15/404 (4%)
 Frame = +1

Query  109   LMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASS  288
             +M  L+LF+ +  PV++ L+IT +G  LA + V++LG  +R +LNN+VFYVF+P+L+ S 
Sbjct  1     MMKLLNLFITSSKPVVEILLITIVGFYLALDGVNLLGQDARKYLNNIVFYVFSPSLIGSR  60

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L +++T  S+VK+WFMPVN+LLTF IGS LGWI++ IT+ P  L GL++ CCAAGNLGN+
Sbjct  61    LADSVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLIVGCCAAGNLGNM  120

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSS  648
              LII+PA+C+ER  PFGDP  C   G  Y +LSMA+G+VYIWTY+YN++R   +P + + 
Sbjct  121   PLIIVPAICKERGGPFGDPENCQKYGMGYVALSMAMGSVYIWTYVYNLMRVLNSP-IETQ  179

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLK  828
               I  +   D+C+  L+ S        EE     E+ +K     R+++ +   ++K+NL+
Sbjct  180   PSIESN--YDTCKVPLIPSK-------EE-----EDNQKAGRWDRIKRRIVSLSEKVNLR  225

Query  829   MMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
              +FAPSTIA ++ +VIG+++ LRKLII + APL V+  S  ++GD AIPAMTLI+G NLL
Sbjct  226   TIFAPSTIAAMIALVIGLITPLRKLIIGNGAPLGVLQDSVTLVGDGAIPAMTLIIGGNLL  285

Query  1009  RGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSA  1188
             +G++ S +    +IGV V R++LLP+ G+ ++  A     + S+ LY FVLL+QYA+P A
Sbjct  286   KGMRSSGMKKSSIIGVLVARYILLPISGVLIVRGAYKLDLITSEPLYQFVLLIQYAVPPA  345

Query  1189  MGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             M +GTITQLF  GESECSVIMLW Y++AS++LT W T+FMW+++
Sbjct  346   MNLGTITQLFGAGESECSVIMLWTYALASVSLTAWPTFFMWLVA  389



>ref|XP_006304763.1| hypothetical protein CARUB_v10012230mg [Capsella rubella]
 gb|EOA37661.1| hypothetical protein CARUB_v10012230mg [Capsella rubella]
Length=384

 Score =   353 bits (905),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 203/407 (50%), Positives = 282/407 (69%), Gaps = 27/407 (7%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ + +PV K L+IT IG  LA +RV+IL   +R  LNN+VFYVF+P+LVASSL
Sbjct  1     MRLLDLFITSSIPVAKILMITGIGFYLAMDRVNILNQDARKQLNNIVFYVFSPSLVASSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S+VK+WFMP+N+LLTF IGS LGW+++KIT+ P  L G+++ CCAAGNLGN+ 
Sbjct  61    AATITYESMVKMWFMPINVLLTFIIGSFLGWVVIKITKPPPHLRGIIVGCCAAGNLGNMP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP----RM  639
             LIIIPA+C E+ SPFGD  +C   G  Y +LSMAIGA+YIWTY+YN++R    P     +
Sbjct  121   LIIIPAICNEKGSPFGDSESCQKFGLGYVALSMAIGAIYIWTYVYNLMRMLAHPAGEIAV  180

Query  640   NSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKI  819
             NS++  M           L++                E  E+     +++Q V   A+KI
Sbjct  181   NSTSSTM----------PLIAPK-------------VEVGEQVGTWSKVKQRVCSAAEKI  217

Query  820   NLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGA  999
             NL+ +FAPSTIA ++ + +G+   LRKL++ + APL VI+ S  +LGD  IP +TL+VG 
Sbjct  218   NLRTIFAPSTIAALIALAVGLNPILRKLLVGNTAPLRVIEDSVSLLGDGTIPVLTLVVGG  277

Query  1000  NLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYAL  1179
             NLL+GL+ S +   V++GV VVR+VLLP+ G+ ++  A HFG V S+ LY F+LLLQY +
Sbjct  278   NLLKGLRGSGMHKSVIVGVVVVRYVLLPISGVLIVQGAHHFGLVTSEPLYKFILLLQYVV  337

Query  1180  PSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             P AM +GTITQLF  GESECSVI+ W+Y++AS++LT+W T+FMW+++
Sbjct  338   PPAMNLGTITQLFGSGESECSVILFWSYALASVSLTVWPTFFMWLVA  384



>ref|XP_007209181.1| hypothetical protein PRUPE_ppa006339mg [Prunus persica]
 gb|EMJ10380.1| hypothetical protein PRUPE_ppa006339mg [Prunus persica]
Length=416

 Score =   352 bits (904),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 214/414 (52%), Positives = 279/414 (67%), Gaps = 11/414 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L LF+ AL+P LK L  T +G  LA +RV+ILG  +R HLN +VFYVF+PALV+S+L
Sbjct  1     MELLQLFITALIPALKILFTTLLGSYLALDRVNILGEDARKHLNTVVFYVFSPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  SIV+LWFMPVNIL+TF +GS LGWIL+++TR P  L G+V+ CCA GNLG +L
Sbjct  61    ARTITDKSIVQLWFMPVNILITFIVGSILGWILLQLTRPPAYLRGIVVGCCAGGNLGFML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR---AYGTPRMN  642
             LII+PAVC+E+ SPFG P  C T   AYASLSMAIGA+Y+W+Y+YNI+R     GT   +
Sbjct  121   LIIVPAVCKEKGSPFGAPDVCHTYALAYASLSMAIGAMYLWSYVYNIVRISAKKGTQNAH  180

Query  643   SSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQ-------IVFEEEEKPSEL-KRLRQNV  798
              S +   +    SC E  LSS   +   D  A         + EE  K + L K ++Q +
Sbjct  181   QSPERSSTPNQVSCTEPPLSSKESEVVDDNAADQYALPCTAIPEENAKMTSLGKVIKQRI  240

Query  799   KMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPA  978
                  K+NLK +F+PST   +VG VIG++  +RKL+I D APL VI  +A  LGDAAIP+
Sbjct  241   MTVFGKLNLKTIFSPSTTGAMVGFVIGLIPQIRKLLIGDGAPLRVIQDTASFLGDAAIPS  300

Query  979   MTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFV  1158
             +TLI+G NLL G +   I   +++G+ VVR+V+LPL GI V+  A  FG V  D LY FV
Sbjct  301   LTLIIGGNLLTGSRGPGIQKSLIVGIIVVRYVVLPLAGILVVKGALKFGLVHYDPLYLFV  360

Query  1159  LLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LLLQ++LP AM IG + QLF  GE ECSVIMLW Y  AS+ LT W+ +FMW+++
Sbjct  361   LLLQFSLPPAMNIGIMAQLFGAGEKECSVIMLWAYLFASVTLTFWSAFFMWLVA  414



>ref|XP_004253114.1| PREDICTED: uncharacterized transporter C5D6.04-like [Solanum 
lycopersicum]
 ref|XP_010314834.1| PREDICTED: uncharacterized transporter C5D6.04-like [Solanum 
lycopersicum]
Length=419

 Score =   352 bits (903),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 204/419 (49%), Positives = 283/419 (68%), Gaps = 16/419 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDL V A MPV++ L+ITA+GLVLA +R  ILG  +R HLNN+VFY+  P+L++S+L
Sbjct  1     MGLLDLLVAASMPVIQILLITALGLVLALDRFAILGEDARKHLNNIVFYICNPSLISSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+ +LWFMP+NI +TF +GS L WI+ +ITR P+ L GLVI CCAAGN+GN+L
Sbjct  61    SKTITYESMKRLWFMPLNIFVTFIVGSILAWIVNQITRPPKHLRGLVIGCCAAGNMGNML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PAVC+E+ SPFG P  C T G  YASLSMA+ AV++W+Y+YNI+R   +       
Sbjct  121   LIIVPAVCKEKGSPFGAPDICHTYGMGYASLSMAVCAVFLWSYVYNIVRISSSKSPEEVE  180

Query  652   DIMGSGFLDSCREA-----------LLSSHSLKYDQDEEAQIV-----FEEEEKPSELKR  783
             ++  S    S RE+           LL  H L   + +  Q+      F+++ +     +
Sbjct  181   EVNNSSISKSVRESSIAALGVSTEPLLQRHDLALSEHQSEQLALPSNRFDDKSQVPLWTK  240

Query  784   LRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGD  963
              RQ + + + K+NLK + APST   I G V+G++  +R  II D APLHVI  +A +LGD
Sbjct  241   SRQYMGVLSKKMNLKKLLAPSTCGAIAGFVVGLIPQIRNSIIGDAAPLHVIQDTALILGD  300

Query  964   AAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDS  1143
              A+P +TLI+G NLL+GL+ + +   ++ G+ VV+++ +P+ GIGV+  A   G V  D 
Sbjct  301   GAVPLLTLIMGGNLLKGLRVTVVPKSILAGIIVVKYIAMPVIGIGVVKGASWLGLVHDDP  360

Query  1144  LYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LY F+LLL +ALP AM I TITQLF  GESECSVIMLW+Y++AS ALTLWT +FMW++S
Sbjct  361   LYKFMLLLHFALPPAMNIATITQLFGAGESECSVIMLWSYALASAALTLWTAFFMWLVS  419



>gb|KGN55542.1| hypothetical protein Csa_4G664490 [Cucumis sativus]
Length=421

 Score =   352 bits (903),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 213/420 (51%), Positives = 292/420 (70%), Gaps = 16/420 (4%)
 Frame = +1

Query  106   ILMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVAS  285
             ++M FL L ++A +PVLK L+IT +G  LA   +DILG  +R HLN +VFYVF PALV+S
Sbjct  1     MMMKFLSLLILASIPVLKVLLITGLGSFLALPSIDILGQEARKHLNGVVFYVFNPALVSS  60

Query  286   SLGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgn  465
             +L ETIT S++VK+WFMP NIL+TF +GS  GWI+++ T+ P  L GL++ CC+AGNLGN
Sbjct  61    NLAETITYSNMVKMWFMPFNILITFIVGSLFGWIVIQWTKPPPHLRGLILGCCSAGNLGN  120

Query  466   llliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRM--  639
             +LLII+PAVC+E+ SPFGD   C+T G AY SLSMAIGA+++W+Y+YNI+R      +  
Sbjct  121   ILLIIVPAVCQEKGSPFGDSDKCTTYGMAYVSLSMAIGAIFLWSYVYNIVRVSSMSHITA  180

Query  640   NSSTDIMGSGFLDSCREALLSSHSL-KYD------QDEEAQIVFEEEEKPSELKRLRQ--  792
             + +++ +      S  E L+ +  L  Y+       + +  +V EE    S  K  R+  
Sbjct  181   DPASNNLPITNTSSIEEPLIHNQPLVVYNDDDDDVSNSKKLLVLEENAVISSSKSKREAS  240

Query  793   ---NVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGD  963
                 +  +   +NLK +FAPSTI  I G VIG++  LR L+I  +APL VID SA +LG+
Sbjct  241   AAVRITTFIKSLNLKALFAPSTIGAIAGFVIGLIPQLRNLLIGADAPLRVIDDSAALLGN  300

Query  964   AAIPAMTLIVGANLLRGLK--KSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGS  1137
              AIP +TLIVG NLLRGL+  +S +   +V+G+ +VR+V LPL GI ++  A  FGWVGS
Sbjct  301   GAIPTVTLIVGGNLLRGLRGSESELKKSIVVGIVLVRYVALPLTGILIVRGAAKFGWVGS  360

Query  1138  DSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             D LY FVLLLQ+A+P AM IGTITQLF  GE+ECSVI+LW Y +AS++LTLW+T FMW++
Sbjct  361   DPLYLFVLLLQFAVPPAMNIGTITQLFGAGEAECSVILLWTYVLASISLTLWSTLFMWLV  420



>ref|XP_006589306.1| PREDICTED: uncharacterized transporter YBR287W-like [Glycine 
max]
Length=400

 Score =   351 bits (900),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 209/402 (52%), Positives = 286/402 (71%), Gaps = 3/402 (1%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M    LFV ALMPVLK L+ITA+G  LA  R +IL  S+R HLN +V++VFTPALV S L
Sbjct  1     MELWKLFVTALMPVLKVLLITAVGTFLALHRFNILRESARKHLNTIVYFVFTPALVCSIL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T T  S+V +WFMP+NILLTF IG+ LGW+ +KIT+AP ++ GLV+ CCAAGNLGNL 
Sbjct  61    AKTTTFKSLVAVWFMPLNILLTFIIGTTLGWLFMKITKAPPDMQGLVLGCCAAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PAVC+E +SPFG    C+  G AYASLSMA+G +YIWT++YNIIR Y   R+ +  
Sbjct  121   LIIVPAVCKESSSPFGAVDVCNKKGMAYASLSMAVGHIYIWTFVYNIIRVYSC-RIFNVN  179

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKM  831
              +  S    +  E  L ++S +     E  +    + +P + K+    +K    K+NLK+
Sbjct  180   KVDDSTVGPAAIETDLENYSTRPVVTAE-DLSQTNDHEPKQ-KQTTNPLKTLVQKLNLKV  237

Query  832   MFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLR  1011
             + AP+TI +I+G++IGVV   +K+ + D+APL VI+ SA MLGDA+IPA+TL+VGANLL 
Sbjct  238   LLAPATIGSILGLIIGVVPPFQKMFVGDDAPLRVIEDSASMLGDASIPAITLLVGANLLD  297

Query  1012  GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAM  1191
             GLK+S +   +V+G+ VVR++ LP+ G+G++  A HFG +  D LY F+LLLQYALP A+
Sbjct  298   GLKRSGMKLSLVVGIIVVRYIALPILGVGIVKGAIHFGLIHHDPLYQFILLLQYALPPAI  357

Query  1192  GIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
              I TITQLF  GE+ECS++ML  Y  AS +LTLW+T+FMW++
Sbjct  358   SISTITQLFGAGETECSIVMLATYVCASFSLTLWSTFFMWLV  399



>ref|XP_006370746.1| hypothetical protein POPTR_0001s46050g [Populus trichocarpa]
 gb|ERP67315.1| hypothetical protein POPTR_0001s46050g [Populus trichocarpa]
Length=428

 Score =   351 bits (901),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 214/429 (50%), Positives = 284/429 (66%), Gaps = 27/429 (6%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDL  +A +P+LK LI+TA+G +LA + + +LG S+R  LN +VF VF+PALV SSL
Sbjct  1     MRLLDLLYIASVPILKVLILTALGSLLALDNIHVLGESTRKELNRVVFLVFSPALVVSSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  +IV LWFMPVNIL  F +GSALGWIL+KITR  ++L GL++ CCAAGN G+LL
Sbjct  61    AKTITYENIVTLWFMPVNILCAFIVGSALGWILIKITRPAKQLKGLILGCCAAGNNGSLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
              IIIPAVC E+ SPFG P  CST G AY SLS+A+ A+Y+W+Y+YN++R   +  +N   
Sbjct  121   FIIIPAVCSEKGSPFGSPDVCSTYGMAYVSLSLAVSAIYMWSYVYNVVRV-SSRDVNKEA  179

Query  652   DIMGSGFLDSC---------------REALLSSHSLKYDQDEEAQIVFEEEEKPSEL---  777
             D  G G   S                 EA L S       + E  +     E   ++   
Sbjct  180   DSDGHGGSTSTVKDAGETPELIQGNYSEAFLPSKEFPVSDEYELLLPCTNSEGIVKVHLS  239

Query  778   KRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADML  957
              +++Q  +M + K+NLK +FAPST A I G +IGV+  +R  +I  +APLHV++ SA ++
Sbjct  240   DKIKQCFRMISRKLNLKAVFAPSTTAAIAGFIIGVIPQIRNSLIGASAPLHVVEDSASLI  299

Query  958   GDAAIPAMTLIVGANLLR--------GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLA  1113
             GDAAIP +TLIVG NLLR        GL+ S I   +++G+  VRFV LPL G  ++  A
Sbjct  300   GDAAIPTVTLIVGGNLLRADSDYCDAGLRGSGIQSSLIVGIVAVRFVFLPLIGTAIVKGA  359

Query  1114  RHFGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLW  1293
              HFG V SD LY FVLLLQ+A+P A+ IGTITQLF  GESECSVIMLW Y++AS+ LTLW
Sbjct  360   VHFGLVHSDPLYQFVLLLQFAVPPALNIGTITQLFGAGESECSVIMLWTYALASIFLTLW  419

Query  1294  TTYFMWILS  1320
             +T FMW+++
Sbjct  420   STLFMWLVA  428



>ref|NP_565133.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 ref|NP_849892.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 gb|AAG51955.1|AC015450_16 unknown protein; 51686-53591 [Arabidopsis thaliana]
 gb|AAM20576.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15614.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE98969.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35854.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 gb|AEE35855.1| auxin efflux carrier family protein [Arabidopsis thaliana]
Length=390

 Score =   350 bits (898),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 197/404 (49%), Positives = 286/404 (71%), Gaps = 14/404 (3%)
 Frame = +1

Query  109   LMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASS  288
             ++  L+LF+ +  PV++ L+IT++G  +A + V++LG  +R +LNN+VFYVF+P+L+ S 
Sbjct  1     MVKLLELFITSSKPVVEILLITSVGFYMALDGVNLLGHDARKYLNNIVFYVFSPSLIGSR  60

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L +++T  S+VK+WFMPVN+LLTF IGS LGWI++ IT+ P  L GL++ CCAAGNLGN+
Sbjct  61    LADSVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLILGCCAAGNLGNM  120

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSS  648
              LIIIPAVC+E+  PFGDP +C   G  Y +LSMA+G++YIWTY+YN++R      + + 
Sbjct  121   PLIIIPAVCKEKGGPFGDPESCQKYGMGYVALSMAMGSIYIWTYVYNLMRVLSNSPVETP  180

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLK  828
               +  +   DS +  L+SS        EE     E  +K    +++++ +   + K+NLK
Sbjct  181   PSVESN--YDSYKVPLISSK-------EE-----ENNQKAGRWEKVKRRLVSLSQKVNLK  226

Query  829   MMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
              +FAPSTIA ++ +VIG+++ LRKLII   APL V+  S  ++GD A+PAMT+I+G NLL
Sbjct  227   TIFAPSTIAAMIALVIGLITPLRKLIIGTEAPLRVLQDSVTLVGDGAVPAMTMIIGGNLL  286

Query  1009  RGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSA  1188
             +GL+ S +    +IGV V R+VLLP+ G+ ++  A     V S+ LY FVLLLQYA+P A
Sbjct  287   KGLRSSGMKMSSIIGVLVARYVLLPMSGVLIVRGAYKLDLVTSEPLYQFVLLLQYAVPPA  346

Query  1189  MGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             M +GTITQLF  GESECSVIMLW YS+AS+ALT+W T+FMW+++
Sbjct  347   MNLGTITQLFGTGESECSVIMLWTYSLASIALTVWPTFFMWLVA  390



>ref|XP_010649334.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized transporter YBR287W-like 
[Vitis vinifera]
Length=410

 Score =   350 bits (899),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 217/417 (52%), Positives = 281/417 (67%), Gaps = 21/417 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPAL----V  279
             M  LDLF VA MPV+K L++TA+G  +A +R DI G + R  LN +  + F P      V
Sbjct  1     MGLLDLFFVASMPVIKVLLVTAVGSFIALDRFDIFGENVRKQLNTVSCFFFLPPCLXFQV  60

Query  280   ASSLGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnl  459
               +L   +  + +V+LWFMP NIL+TF IGSALGW+LVK+TRAP+ L GLV+ CCAAGNL
Sbjct  61    FCALIXFLLLNFVVRLWFMPFNILITFVIGSALGWLLVKLTRAPQHLRGLVLGCCAAGNL  120

Query  460   gnllliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR--AYGTP  633
             GNL LII+PAVC E+ SPFG P  C T G AYASLSMAIGA+Y+W+Y+YNI+R  + GT 
Sbjct  121   GNLPLIIVPAVCREKGSPFGAPDVCHTYGMAYASLSMAIGAIYLWSYVYNIVRVSSVGTT  180

Query  634   RMNSSTDIMGSGFLDS---CREALLSSHSLKYDQDEEAQIVF-----EEEEKPSELKRLR  789
              + +  D       DS    RE LL S       D   Q+       EE  K +   +++
Sbjct  181   EVINIED-------DSPAKMREPLLDSKDCSISVDYADQLTLPYTQSEENLKVTTADKVK  233

Query  790   QNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAA  969
             + ++M + +IN++ + APST   I+G +IG+V  LRKL+I   APL V+  S  MLGDAA
Sbjct  234   RFLRMLSREINIQALLAPSTTGAILGFIIGMVPQLRKLLIGSTAPLRVLQDSTSMLGDAA  293

Query  970   IPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLY  1149
             IPA+TLI+G NLL+GLK S I   ++IG+ VVR++ LPL GI ++  A   G V  D LY
Sbjct  294   IPALTLIMGGNLLKGLKGSGIRASLLIGIIVVRYIFLPLLGIAIVKGAVQLGLVNPDPLY  353

Query  1150  HFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              FVLLLQYALP AM IGTITQLF  GESECSVIMLW Y++AS+ALTLW+T FMW+++
Sbjct  354   QFVLLLQYALPPAMNIGTITQLFGAGESECSVIMLWTYALASVALTLWSTLFMWLVA  410



>ref|XP_009390658.1| PREDICTED: uncharacterized transporter YBR287W-like [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   351 bits (900),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 217/424 (51%), Positives = 290/424 (68%), Gaps = 26/424 (6%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L LFV A +PVLK L++T +G  LA  +V IL   +R HLNN+VFYVF PALV+++L
Sbjct  1     MGLLKLFVTASVPVLKVLLVTGVGSFLATGQVGILCHEARKHLNNVVFYVFNPALVSTNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S+V LWFMP+NILLTF IG A GW++++IT AP  L GLV+ CCAAGNLGN+L
Sbjct  61    SRTITMESLVLLWFMPINILLTFIIGFAFGWVVIQITNAPSHLKGLVLGCCAAGNLGNML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PA+C+ER SPFG    C+T G AYASLSMAIGA+++W+++YNI+R       + +T
Sbjct  121   LIIVPAICKERGSPFGASDVCTTYGLAYASLSMAIGAIFLWSFVYNIVRIS-----SGAT  175

Query  652   DIMGSGFLDSCR-------EALLSSHSLK--------YDQDEEAQIVFEEEEKP-SELK-  780
             +   + + D+         E L+S   L         Y   +E  +     E P +ELK 
Sbjct  176   EGKATAYSDTQEQQIIQETEKLVSQSCLDRTLPIEHTYLPGDECVLTLSASEIPQNELKV  235

Query  781   ----RLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSA  948
                 + RQ +      I+LK +FAPST+  I+G +IGVV  +RK +I + APL VI  SA
Sbjct  236   SFSDKARQLLSNILKIIDLKKLFAPSTVGVIIGFIIGVVPQIRKAVIGETAPLRVIQDSA  295

Query  949   DMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGW  1128
             D+LG+ AIP +TLI+G NL++GL+ S I   +++GV +VR+++LPL GI V+  A + G 
Sbjct  296   DLLGEGAIPTLTLIMGGNLIKGLRGSGIRFSLILGVVIVRYIMLPLVGILVVKGAINLGL  355

Query  1129  VGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFM  1308
             +  D LYHF+LLLQYALP AM IGTITQLF  GESECSVI LW YS+AS++LTLW+TYFM
Sbjct  356   LHQDPLYHFILLLQYALPPAMNIGTITQLFGAGESECSVIFLWTYSLASVSLTLWSTYFM  415

Query  1309  WILS  1320
             W++S
Sbjct  416   WLVS  419



>ref|XP_002887644.1| hypothetical protein ARALYDRAFT_895536 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63903.1| hypothetical protein ARALYDRAFT_895536 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   349 bits (896),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 195/404 (48%), Positives = 288/404 (71%), Gaps = 13/404 (3%)
 Frame = +1

Query  109   LMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASS  288
             ++  L+LF+ +  PV++ L+IT++G  +A + V++LG  +R +LNN+VFYVF P+L+ S 
Sbjct  1     MVKLLELFITSSKPVVEILLITSVGFYMALDGVNLLGQDARKYLNNIVFYVFGPSLIGSR  60

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L +++T  S+VK+WFMPVN+LLTF IGS LGWI++ IT+ P  L GL++ CCAAGNLGN+
Sbjct  61    LADSVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLILGCCAAGNLGNM  120

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSS  648
              LIIIPAVC+E+  PFGDP +C   G  Y +LSMA+G++YIWTY+YN++R      + + 
Sbjct  121   PLIIIPAVCKEKGGPFGDPESCQKYGMGYVALSMAMGSIYIWTYVYNLMRVLSNSPVETP  180

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLK  828
               +  +   DS +  L+SS      ++EE     E+ +K    + +++ +   ++K+NLK
Sbjct  181   PSVESN--YDSYKVPLISS------KEEE-----EDNQKAGRWEIVKRRLVSLSEKVNLK  227

Query  829   MMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
              +FAPS+IA ++ +VIG+++ LRKLII   APL V+  S  ++GD A+PAMT+I+G NLL
Sbjct  228   TIFAPSSIAAMIALVIGLITPLRKLIIGTEAPLRVLQDSVTLVGDGAVPAMTMIIGGNLL  287

Query  1009  RGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSA  1188
             +GL+ S +    +IGV V R+VLLP+ G+ ++  A     V S+ LY FVLLLQYA+P A
Sbjct  288   KGLRSSGMKMSSIIGVLVARYVLLPMSGVLIVRGAYKLDLVTSEPLYQFVLLLQYAVPPA  347

Query  1189  MGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             M +GTITQLF  GESECSVIMLW YS+AS++LT+W T+FMW+++
Sbjct  348   MNLGTITQLFGTGESECSVIMLWTYSLASISLTVWPTFFMWLVA  391



>gb|KEH27639.1| auxin efflux carrier family protein [Medicago truncatula]
Length=444

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 205/444 (46%), Positives = 286/444 (64%), Gaps = 41/444 (9%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+LF VA  PV+K L++T IGL+LA + +++LG  +R+  N+LV YVF P L+  +L
Sbjct  1     MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARNQTNHLVHYVFNPGLIGGNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  ++V LWFMPVNIL+TF +GSALGWI++K+T+ PR + GL++  C+AG   + L
Sbjct  61    AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGRYISSL  120

Query  472   lii---------------------------IPAVCEERNSPFGDPTTCSTNGKAYASLSM  570
                                           IPA+C+++ SPFGDP  C   G AYASLSM
Sbjct  121   HKKNMSMNIEPGSMSLLKVSGNLGNLPIIIIPAICKDKGSPFGDPDVCYQFGMAYASLSM  180

Query  571   AIGAVYIWTYIYNIIRAYGT---PRMNSSTDIMGSGFLDSCREALLSSHSLKY------D  723
             AIGAV+IWTY+YNI+R          N S+D +         ++++   S  Y      +
Sbjct  181   AIGAVFIWTYVYNIMRISSRNVHKECNKSSDSITLEDSRDVSQSIIEEGSENYTSPTKGN  240

Query  724   QDEEAQIVFEEEEKPSELK-----RLRQNVKMWADKINLKMMFAPStiativgivigvvS  888
              D+   ++  + E   ++K     +++    M     N + +F+P+T+  IVG ++GVV 
Sbjct  241   VDDAYTLLLSKNESEQKIKVPVFDKIKHKFGMILGNPNFRGIFSPATLGAIVGFIVGVVP  300

Query  889   FLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvr  1068
             +LR+L+I  NAPLHVI+ SA MLGDAAIP +TLI+GANLLRGLK ++   W +IG+ VVR
Sbjct  301   WLRRLMIGSNAPLHVIEDSASMLGDAAIPTITLIMGANLLRGLKGASTPFWTIIGIIVVR  360

Query  1069  fvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVI  1248
             ++LLP+ G+ +I  A H G V  D LY FVLLLQYALP AM IGTI QLF  GESECSV+
Sbjct  361   YILLPIFGVLIIKGATHLGLVQIDPLYQFVLLLQYALPPAMNIGTIAQLFGAGESECSVM  420

Query  1249  MLWNYSVASLALTLWTTYFMWILS  1320
             MLW Y++AS+A+TLW+TYFMW++S
Sbjct  421   MLWTYALASIAVTLWSTYFMWLVS  444



>ref|XP_010649326.1| PREDICTED: uncharacterized protein LOC100249991 isoform X1 [Vitis 
vinifera]
Length=431

 Score =   350 bits (899),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 210/376 (56%), Positives = 280/376 (74%), Gaps = 17/376 (5%)
 Frame = +1

Query  241   NNLVFYVFTPALVASSLGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPREL  420
             + +VFYVF PALV+S+L +TIT SS+V +WFMPVNILLTF IGSALGW+L+KITR P+ L
Sbjct  57    HQIVFYVFNPALVSSNLAKTITFSSLVTMWFMPVNILLTFVIGSALGWVLIKITRTPQHL  116

Query  421   HGLVISccaagnlgnllliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTY  600
              GLV+ CC+AGNLGNLLLIIIPA+CEE ++PFGD + CSTNG+AYASLS+AIGA+ IW+Y
Sbjct  117   QGLVLGCCSAGNLGNLLLIIIPAICEEEDNPFGD-SDCSTNGEAYASLSLAIGAIGIWSY  175

Query  601   IYNIIRAYGTPRM------NSSTDIMGSG-----FLDSCREALLSSHSLKY-----DQDE  732
             +Y I+R             +S+  I  SG       + C EALL S          D+ E
Sbjct  176   VYTIMRISANKCKKEINLDDSTISIRTSGETLEILSEGCTEALLPSKDCPSSRECSDEVE  235

Query  733   EAQIVFEEEEKPSELKRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIV  912
              A    E ++K   L++++Q V++  +KI+LK +FAPSTI  IVG  IG++S +RKLII 
Sbjct  236   LAHAGSEGKQKVPFLEKIKQQVEILMEKIDLKKVFAPSTIGVIVGFFIGLISPIRKLIIG  295

Query  913   DNAPLHVIDSSADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCG  1092
             D+APLHVI+SSA  +G+AA+P+ TLI+GANLL+GLK S +   V++G+  VR++ LPL G
Sbjct  296   DSAPLHVIESSAYFVGEAAVPSTTLIMGANLLKGLKGSDVSIVVILGIMAVRYIALPLLG  355

Query  1093  IGVITLARHFGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVA  1272
             + V+  A HFG VGS+SL+ FVL+LQYALP AM  GT++QLFE G+SECSVIMLW Y+VA
Sbjct  356   VVVVKAAHHFGLVGSNSLFQFVLMLQYALPPAMSTGTMSQLFEFGQSECSVIMLWTYAVA  415

Query  1273  SLALTLWTTYFMWILS  1320
             + +LTLW+++FMW++S
Sbjct  416   AFSLTLWSSFFMWLVS  431



>gb|AAM62517.1| unknown [Arabidopsis thaliana]
Length=390

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 196/404 (49%), Positives = 286/404 (71%), Gaps = 14/404 (3%)
 Frame = +1

Query  109   LMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASS  288
             ++  L+LF+ +  PV++ L+IT++G  +A + V++LG  +R +LNN+VFYVF+P+L+ S 
Sbjct  1     MVKLLELFITSSKPVVEILLITSVGFYMALDGVNLLGHDARKYLNNIVFYVFSPSLIGSR  60

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L +++T  S+VK+WFMPVN+LLTF IGS LGWI++ IT+ P  L GL++ CCAAGNLGN+
Sbjct  61    LADSVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLILGCCAAGNLGNM  120

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSS  648
              LIIIPAVC+E+  PFGDP +C   G  Y +LSMA+G++YIWTY+YN++R      + + 
Sbjct  121   PLIIIPAVCKEKGGPFGDPESCQKYGMGYVALSMAMGSIYIWTYVYNLMRVLSNSPVETP  180

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLK  828
               +  +   DS +  L+SS        EE     E  +K    +++++ +   + K+NLK
Sbjct  181   PSVESN--YDSYKVPLISSK-------EE-----ENNQKAGRWEKVKRRLVSLSQKVNLK  226

Query  829   MMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
              +FAPSTIA ++ +VIG+++ LRKLII   APL V+  S  ++GD A+PAMT+I+G NLL
Sbjct  227   TIFAPSTIAAMIALVIGLITPLRKLIIGTEAPLRVLQDSVTLVGDGAVPAMTMIIGGNLL  286

Query  1009  RGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSA  1188
             +GL+ S +    +IGV V R+VLLP+ G+ ++  A     V S+ LY FVLLLQYA+P A
Sbjct  287   KGLRSSGMKMSSIIGVLVARYVLLPMSGVLIVRGAYKLDLVTSEPLYQFVLLLQYAVPPA  346

Query  1189  MGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             M +GTITQLF  GESECSVIMLW YS+AS++LT+W T+FMW+++
Sbjct  347   MNLGTITQLFGTGESECSVIMLWTYSLASISLTVWPTFFMWLVA  390



>ref|XP_010103231.1| Uncharacterized transporter [Morus notabilis]
 gb|EXB95102.1| Uncharacterized transporter [Morus notabilis]
Length=417

 Score =   349 bits (896),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 207/416 (50%), Positives = 282/416 (68%), Gaps = 16/416 (4%)
 Frame = +1

Query  115   AFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSLG  294
               +DLF+VA +PVLK LI+TA+G  LAF   DILG ++R  LN+LVF+VF PA V+S+L 
Sbjct  4     GLIDLFLVASIPVLKLLILTALGSFLAFTASDILGDNARKRLNSLVFFVFNPAFVSSNLA  63

Query  295   ETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnlll  474
             +TIT   I+ LWFMPVNI+ TF IGS LGW++VKIT+ P+ L GLV+ CC+AGNLGNL +
Sbjct  64    KTITLERIISLWFMPVNIMSTFVIGSGLGWLVVKITKPPQHLKGLVLGCCSAGNLGNLPI  123

Query  475   iiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR-----------A  621
             +II AVC ER SPFG P  C ++G  YASLSMAIGA+ +W+Y+YNI+R            
Sbjct  124   VIILAVCRERGSPFGAPHLCHSSGMTYASLSMAIGAISLWSYVYNIVRISSSMGNADDPK  183

Query  622   YGTPRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVK  801
              GT     ++D++   F +S  EAL+         D      ++ E K     +++  + 
Sbjct  184   RGTRPTKGTSDLVDGNFSNS--EALVLGKDNSVSADHACHAKYKGESKVPICNQIKHYLT  241

Query  802   MWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAM  981
               +  INL+ +FAPST+  +VG ++G+V   RKLI+ D APL V+  +A ++ DAAIP +
Sbjct  242   TLSSDINLRALFAPSTVGAVVGFIVGMVPQTRKLIVDDGAPLLVLYDAASLVSDAAIPTV  301

Query  982   TLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVG---SDSLYH  1152
              LI+GANLL+GLK+S     V+ G+  VR+V+ P  G+ ++T A+H+G +     D LY 
Sbjct  302   ALIMGANLLKGLKRSGSLARVICGIIGVRYVVQPAIGVAIVTAAKHYGALQLRLKDPLYE  361

Query  1153  FVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             FVL LQYALP AM IGTITQLF  GESECSVIMLW Y+ ASL+LTLW+T+FMW+++
Sbjct  362   FVLHLQYALPPAMNIGTITQLFGAGESECSVIMLWTYAFASLSLTLWSTFFMWLVT  417



>ref|XP_006451737.1| hypothetical protein CICLE_v10010809mg [Citrus clementina]
 gb|ESR64977.1| hypothetical protein CICLE_v10010809mg [Citrus clementina]
Length=420

 Score =   349 bits (895),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 216/420 (51%), Positives = 298/420 (71%), Gaps = 17/420 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ A +PVLK L++TA+GL LA +R+DILG  +R HLN +VF+VF PALV SSL
Sbjct  1     MKILDLFIAAFIPVLKVLLLTALGLFLALDRIDILGDLARQHLNKVVFFVFNPALVGSSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              + ITA  I  LWFMP+NIL+T+ +GS+LGWI++K T+AP +L GLV+ CCAAGNLGN+L
Sbjct  61    ADHITAEGIGMLWFMPLNILITYIVGSSLGWIVLKTTKAPYDLWGLVLGCCAAGNLGNML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT------P  633
              IIIPA+C+ER SPFGD   C   G  Y++LSMAIGA+Y+W+Y+YNI+R Y +       
Sbjct  121   FIIIPAICKERGSPFGDADACYRQGMVYSALSMAIGAIYMWSYVYNIVRIYSSCTNSEGE  180

Query  634   RMNSSTDIM------GSGFLDSCREALLSSHSLKYDQDEEAQIVFE---EEEKPSE--LK  780
             ++++ST+ +           +S    LL  +     +D       +      KP    L+
Sbjct  181   KLDNSTENITPMEETTEKLSNSRMRPLLPLNGCSAVKDHLNHFELDCSITARKPQVQLLE  240

Query  781   RLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLG  960
             +++Q  + +A K NL+ +FAPSTIA IVG ++G++   RKL+I ++APL V++ SA +LG
Sbjct  241   KIKQCFQTFATKFNLRKLFAPSTIAAIVGFMVGIIPEFRKLLIGEHAPLRVVEGSASLLG  300

Query  961   DAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSD  1140
             +A+IP +TLIVGANLLRGLK + I   ++IGV V+R++ LPL G+G++  A HFG+V SD
Sbjct  301   EASIPTVTLIVGANLLRGLKGTRIQLSLIIGVIVIRYIALPLLGVGIVKGAIHFGFVKSD  360

Query  1141  SLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              LY FVLLLQ+ALP A+ IGT+TQLF  GESE SVIMLW Y++AS +LT WTT+FMW++ 
Sbjct  361   PLYQFVLLLQFALPPAVNIGTMTQLFRAGESEYSVIMLWTYALASFSLTFWTTFFMWLVK  420



>ref|XP_006485670.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Citrus sinensis]
 ref|XP_006485671.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Citrus sinensis]
 ref|XP_006485672.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X3 
[Citrus sinensis]
 gb|KDO48347.1| hypothetical protein CISIN_1g014701mg [Citrus sinensis]
Length=420

 Score =   349 bits (895),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 215/420 (51%), Positives = 298/420 (71%), Gaps = 17/420 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ A +PVLK L++TA+GL LA +R+DILG  +R HLN +VF+VF PALV SSL
Sbjct  1     MKILDLFIAAFIPVLKVLLLTALGLFLALDRIDILGDLARQHLNKVVFFVFNPALVGSSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              + ITA  I  LWFMP+NIL+T+ +GS+LGWI++K T+AP +L GLV+ CCAAGNLGN+L
Sbjct  61    ADHITAEGIGMLWFMPLNILITYIVGSSLGWIVLKTTKAPYDLWGLVLGCCAAGNLGNML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT------P  633
              IIIPA+C+ER SPFGD   C   G  Y++LSMAIGA+Y+W+Y+YNI+R Y +       
Sbjct  121   FIIIPAICKERGSPFGDADACYRQGMVYSALSMAIGAIYMWSYVYNIVRIYSSCTNSEGE  180

Query  634   RMNSSTDIM------GSGFLDSCREALLSSHSLKYDQDEEAQIVFE---EEEKPSE--LK  780
             ++++ST+ +           +S    LL  +     +D       +      KP    L+
Sbjct  181   KLDNSTENITPMEETTEKLSNSRMRPLLPLNGCSAVKDHLNHFELDCSITARKPQVQLLE  240

Query  781   RLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLG  960
             +++Q  + +A K NL+ +FAPSTIA I+G ++G++   RKL+I ++APL V++ SA +LG
Sbjct  241   KIKQCFQTFATKFNLRKLFAPSTIAAIIGFMVGIIPEFRKLLIGEHAPLRVVEGSASLLG  300

Query  961   DAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSD  1140
             +A+IP +TLIVGANLLRGLK + I   ++IGV V+R++ LPL G+G++  A HFG+V SD
Sbjct  301   EASIPTVTLIVGANLLRGLKGTRIQLSLIIGVIVIRYIALPLLGVGIVKGAIHFGFVKSD  360

Query  1141  SLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              LY FVLLLQ+ALP A+ IGT+TQLF  GESE SVIMLW Y++AS +LT WTT+FMW++ 
Sbjct  361   PLYQFVLLLQFALPPAVNIGTMTQLFRAGESEYSVIMLWTYALASFSLTFWTTFFMWLVK  420



>ref|XP_008787017.1| PREDICTED: uncharacterized transporter YBR287W-like [Phoenix 
dactylifera]
 ref|XP_008787018.1| PREDICTED: uncharacterized transporter YBR287W-like [Phoenix 
dactylifera]
Length=421

 Score =   349 bits (895),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 212/421 (50%), Positives = 291/421 (69%), Gaps = 18/421 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+LF+ A +PV+  L++T +G  LA   V IL   +R HLNN+VF+VF PALV+++L
Sbjct  1     MGFLELFITATVPVMNVLLVTGVGSFLATSNVGILSEDARKHLNNVVFFVFNPALVSTNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S+V LWFMP+NILLTF +GS  GW++++ITRAP  L GL++ CCAAGNLGN+L
Sbjct  61    ARTITMESMVLLWFMPINILLTFIVGSLFGWLVIQITRAPTNLRGLILGCCAAGNLGNML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR-AYGTPRMNSS  648
             LII+PA+C+E+ SPFG    C T G AYASLSMAIGA+++W+Y+YNI+R + G  +   +
Sbjct  121   LIIVPAICKEKGSPFGASDVCHTYGLAYASLSMAIGAIFLWSYVYNIVRVSSGAAKGKMN  180

Query  649   TDIM--------GSG--FLDSCREALLSSHSLKYDQD--EEAQIVFEEEEKPSELK----  780
             T+          GS   F  SC +  +++++        +E+ +      + S +K    
Sbjct  181   TNFHPHRMEFPEGSTRLFPGSCTDGAITTYNCSTSSHYADESTLPLSRSNESSTMKVPFS  240

Query  781   -RLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADML  957
              + R+ +   +  I+LK +FAPSTI  IVG VIGV+  +RK +I + APL VI  SA +L
Sbjct  241   VKARKLLSTLSGVIDLKKLFAPSTIGVIVGFVIGVIPQIRKAMIGEGAPLRVIQESAALL  300

Query  958   GDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGS  1137
             GD AIP +TLI+G NL++GL+ S I   ++IGV VVR+++LPL GI VI +A   G V S
Sbjct  301   GDGAIPTLTLIMGGNLIKGLRSSGIRLSIIIGVIVVRYIMLPLVGIVVIKVAIRLGLVHS  360

Query  1138  DSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             D LY F+LL+QYALP AM IGTITQLF  GESECSVI LW Y++AS +LTLW+T+FMW++
Sbjct  361   DPLYQFILLVQYALPPAMNIGTITQLFGAGESECSVIFLWAYALASFSLTLWSTFFMWLV  420

Query  1318  S  1320
             S
Sbjct  421   S  421



>ref|XP_011027947.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized transporter C5D6.04-like 
[Populus euphratica]
Length=420

 Score =   349 bits (895),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 209/418 (50%), Positives = 284/418 (68%), Gaps = 27/418 (6%)
 Frame = +1

Query  124   DLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSLGETI  303
              LF VALMPVLK L++TA+G+ LA ERV ILGA +R+HLNNLVFYV +PALV SSL + +
Sbjct  5     KLFFVALMPVLKVLLLTAVGVFLAIERVGILGAEARNHLNNLVFYVLSPALVGSSLAKFV  64

Query  304   TASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiI  483
             T  S+++LWFMP+N+L+TF IGS LGW+LVKIT AP+ + G+++  CAAGNLG + LI+I
Sbjct  65    TLRSLLELWFMPLNVLMTFIIGSVLGWLLVKITNAPKRMRGMILGSCAAGNLGAIPLILI  124

Query  484   PAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY-------------  624
             PAVC+E+ SPFGD   C+T G AYASLSMAIGA+Y+W+Y+Y+I+R Y             
Sbjct  125   PAVCKEKGSPFGDSNACNTRGLAYASLSMAIGAIYLWSYVYHIVRVYSSSKDSDESKLDE  184

Query  625   ---GTPRMNSSTDIMGSGFLDSCREA---LLSSHSLKYDQDEEAQ---IVFEEEEKPSEL  777
                G      +T+      L  CR      L   SL+    E  +   +V +E+ K    
Sbjct  185   LPEGAESAGETTE-----NLPKCRTGPLLPLKEPSLEEGHMEHLELDCVVPQEKAKEPFP  239

Query  778   KRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADML  957
               +    +    K+NL+ +F+P     IVG +IGVV   +K +I D APLHV + SA  L
Sbjct  240   SNVTPGFQKVIKKLNLRRLFSPIINGAIVGFIIGVVPPFQKALIGDTAPLHVWEDSAYFL  299

Query  958   GDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGS  1137
             G+AAIP++TLI+GANLL GLK S +   V+IG+  VR+++LP+ G  +I  A  FG + S
Sbjct  300   GEAAIPSVTLIMGANLLEGLKGSKVPLMVIIGIVAVRYIILPISGALIIKYAIRFGLLHS  359

Query  1138  DSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMW  1311
             D LY FVLLLQ+ALP A+GIGT+TQLF VG++ECSVIML  Y++A+++LTLW+ +F+W
Sbjct  360   DPLYQFVLLLQFALPPAIGIGTMTQLFGVGQTECSVIMLCTYALATISLTLWSAFFIW  417



>ref|XP_008453020.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis 
melo]
Length=421

 Score =   348 bits (894),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 211/420 (50%), Positives = 289/420 (69%), Gaps = 16/420 (4%)
 Frame = +1

Query  106   ILMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVAS  285
             ++M FL L ++A +PVLK L+IT +G  LA   +DILG  +R HLN +VFYVF PALVAS
Sbjct  1     MMMKFLSLLILASIPVLKVLLITGLGSFLALPYIDILGQEARKHLNGVVFYVFNPALVAS  60

Query  286   SLGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgn  465
             +L ETIT +++VK+WFMP NIL+TF +GS  GWI+++ T+ P  L GL++ C +AGNLGN
Sbjct  61    NLAETITYNNMVKMWFMPFNILITFIVGSLFGWIVIQWTKPPPHLRGLILGCSSAGNLGN  120

Query  466   llliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRM--  639
             +LLIIIPAVC+E+ SPFGD   C+T G AY SLSMAIGA+++W+Y+YNI+R      +  
Sbjct  121   ILLIIIPAVCKEKGSPFGDSDNCTTYGMAYVSLSMAIGAIFLWSYVYNIVRVSSMSHITA  180

Query  640   NSSTDIMGSGFLDSCREALLSSHSL-KYD------QDEEAQIVFEEEEKPSELKRLRQ--  792
             + +++ +      S  E L+ +  L  Y+       + +  +V EE    S  K   +  
Sbjct  181   DPTSNNLPITNTSSIEEPLIHNQPLVVYNDDDDDVSNSKKLLVLEENAVISSSKSKHEAS  240

Query  793   ---NVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGD  963
                 +  +   +NLK +FAPSTI  I G VIG++  LR L+I  +APL VID SA +LG+
Sbjct  241   VAVRITTFIKSLNLKALFAPSTIGAIAGFVIGLIPQLRNLLIGADAPLRVIDDSAALLGN  300

Query  964   AAIPAMTLIVGANLLRGLK--KSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGS  1137
              AIP +TLIVG NLLRGL+  +S +   +V+G+ +VR+V LPL GI ++  A  FGWVGS
Sbjct  301   GAIPTVTLIVGGNLLRGLRGSESELKKSIVVGIVLVRYVALPLTGILIVRGAAKFGWVGS  360

Query  1138  DSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             D LY FVLLLQ+A+P AM IGTITQLF  GE+ECSVI+LW Y +AS++LT W+T FMW++
Sbjct  361   DPLYLFVLLLQFAVPPAMNIGTITQLFGAGEAECSVILLWTYVLASISLTFWSTLFMWLV  420



>emb|CBI37491.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   348 bits (892),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 213/403 (53%), Positives = 271/403 (67%), Gaps = 12/403 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF VA MPV++ L++TA+G  LA +R+DILG   R  LN +VF+VF PALV S+L
Sbjct  1     MGLLDLFFVASMPVIRVLLLTALGSFLALDRIDILGDVVRKQLNTVVFFVFNPALVYSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT   +V LWFMP+NIL    IGSALG +LVK TRAP+ L GL++  CAAGN+GN+ 
Sbjct  61    ANTITLDRMVLLWFMPLNILTVCIIGSALGLLLVKTTRAPQHLKGLILGSCAAGNMGNMP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPAVC E+ SPFG P  C T   AYASLSMAIGA+ +W+Y+YNI+R +      SS 
Sbjct  121   LIIIPAVCREKGSPFGAPDVCHTFAMAYASLSMAIGAICLWSYVYNIVRIF------SSN  174

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKM  831
                G     S  E      +L +   EE   V     K      ++Q ++ ++ KINLK 
Sbjct  175   AREGINLHCSISEEYPHQFTLPHPLSEENLQVVAISGK------MKQLLRKFSRKINLKE  228

Query  832   MFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLR  1011
             + APST   IVG +IG+V  LRKLII   APLHV+  SA +LGDAAIP++ LI+G NLL+
Sbjct  229   LLAPSTTGAIVGFIIGMVPHLRKLIIGGTAPLHVVQDSASLLGDAAIPSIILIMGGNLLK  288

Query  1012  GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAM  1191
             GLK S I    ++G+  VRF+ LPL GI ++  A  FG V  D L+ FVLLLQYA+P A+
Sbjct  289   GLKGSGIQLSFIVGILAVRFIFLPLLGIIIVKGALRFGLVHPDPLFQFVLLLQYAVPPAI  348

Query  1192  GIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              +GTI QLF  GESECSVIMLW Y +AS++LTLW+T FMW++S
Sbjct  349   NLGTIIQLFGAGESECSVIMLWTYGLASVSLTLWSTLFMWLVS  391



>ref|NP_001242102.1| uncharacterized protein LOC100791609 [Glycine max]
 gb|ACU17889.1| unknown [Glycine max]
Length=415

 Score =   348 bits (893),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 219/415 (53%), Positives = 287/415 (69%), Gaps = 12/415 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  ++LF VA MPV+K LIITAIGL+LA + V++LG  +R  +N+LV YVF PALV  +L
Sbjct  1     MGLVELFGVASMPVIKVLIITAIGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  ++V LWFMPVNILLTF IGSALGWIL+K+TRAP+ L GL++  C+AGNLGNL 
Sbjct  61    ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLILGVCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT--PRMN-  642
             +IIIPA+C+++ SPFGD   C   G AYASLSMA+GAVYIWTY+YNI+R   +  P+ + 
Sbjct  121   IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAVGAVYIWTYVYNIMRVSASVVPKDDY  180

Query  643   --SSTDIMGSG-FLD--SCREALLSSHSLKYDQDEE----AQIVFEEEEKPSELKRLRQN  795
               SS  +  SG FL+     E+    +  K + D+     + I  EE  K     +++Q 
Sbjct  181   RTSSFRLEASGEFLEFIPEEESSEPENPPKDNMDDYTLLLSSIESEENVKLPISAKIKQQ  240

Query  796   VKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIP  975
                     N + +F+P+T+  IVG ++GVV  +RKL+I  +A LHVI  S  M+G+AA+P
Sbjct  241   FGNLLVNSNFRAIFSPATLGAIVGFIVGVVPQIRKLMIGGDASLHVIQDSVTMVGEAAVP  300

Query  976   AMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHF  1155
              +TLI+GANLL+GLK +    W VIG+ VVR++ LP+ GI VI  A   G V  D LY F
Sbjct  301   IITLIMGANLLKGLKGANTSIWTVIGIMVVRYIFLPILGILVIKEATQLGLVQPDPLYQF  360

Query  1156  VLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             VLLLQYALP AM IGTI QLF  GE ECSVIMLW Y +AS+A+T WTTYFMW+++
Sbjct  361   VLLLQYALPPAMAIGTIAQLFGAGEGECSVIMLWTYVLASVAVTFWTTYFMWLVA  415



>emb|CDY29492.1| BnaA06g14780D [Brassica napus]
Length=383

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 199/403 (49%), Positives = 281/403 (70%), Gaps = 20/403 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ + +PV K L+IT IG  LA +RV+IL   +R  LNN+VFYVF+P+LVASSL
Sbjct  1     MKLLDLFITSSIPVGKILVITGIGFYLALDRVNILNQDARKQLNNIVFYVFSPSLVASSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  S+VK+WFMP+N++LTF IGS LGW+++K+T+ P  L G+++ CCAAGNLGN+ 
Sbjct  61    AETITYESLVKMWFMPLNVVLTFIIGSFLGWLVIKVTKPPSHLRGIIVGCCAAGNLGNMP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPA+C E+ SPFGDP TC   G  Y +LSMAIG++ IWTY+YN++R         + 
Sbjct  121   LIIIPAICNEKGSPFGDPETCEKYGLGYVALSMAIGSICIWTYVYNLMRVLA----RETP  176

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKM  831
              I+G            +S ++     +  Q+    EE+     +++Q V   A+ INL  
Sbjct  177   IIIG------------TSSTVPLIPTKVVQV----EEQFGTWSKIKQRVCSAAENINLGT  220

Query  832   MFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLR  1011
             +FAPSTIA ++ + +G++  LRKL+I + APL VI+ S  +LG+  IP +TLI+G NLL+
Sbjct  221   IFAPSTIAALIALGVGLIPTLRKLLIGNTAPLRVIEDSVSLLGEGTIPLLTLIIGGNLLK  280

Query  1012  GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAM  1191
             GL+ S +   V++GV VVR+VLLP+ G+ ++  A + G + S+ LY FVLLLQY +P AM
Sbjct  281   GLRGSGMHKSVILGVVVVRYVLLPIIGVLIVQGAHYLGLITSEPLYQFVLLLQYVVPPAM  340

Query  1192  GIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              +GTITQLF  GESECSVI+ W Y++AS++LTLW T+FMW+++
Sbjct  341   NLGTITQLFGSGESECSVILFWTYALASVSLTLWPTFFMWLVA  383



>ref|XP_006590301.1| PREDICTED: uncharacterized protein LOC100791609 isoform X1 [Glycine 
max]
 ref|XP_006590302.1| PREDICTED: uncharacterized protein LOC100791609 isoform X2 [Glycine 
max]
Length=415

 Score =   347 bits (891),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 218/415 (53%), Positives = 287/415 (69%), Gaps = 12/415 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  ++LF VA MPV+K LIITA+GL+LA + V++LG  +R  +N+LV YVF PALV  +L
Sbjct  1     MGLVELFGVASMPVIKVLIITAVGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  ++V LWFMPVNILLTF IGSALGWIL+K+TRAP+ L GL++  C+AGNLGNL 
Sbjct  61    ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLILGVCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT--PRMN-  642
             +IIIPA+C+++ SPFGD   C   G AYASLSMA+GAVYIWTY+YNI+R   +  P+ + 
Sbjct  121   IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAVGAVYIWTYVYNIMRVSASVVPKDDY  180

Query  643   --SSTDIMGSG-FLD--SCREALLSSHSLKYDQDEE----AQIVFEEEEKPSELKRLRQN  795
               SS  +  SG FL+     E+    +  K + D+     + I  EE  K     +++Q 
Sbjct  181   RTSSFRLEASGEFLEFIPEEESSEPENPPKDNMDDYTLLLSSIESEENVKLPISAKIKQQ  240

Query  796   VKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIP  975
                     N + +F+P+T+  IVG ++GVV  +RKL+I  +A LHVI  S  M+G+AA+P
Sbjct  241   FGNLLVNSNFRAIFSPATLGAIVGFIVGVVPQIRKLMIGGDASLHVIQDSVTMVGEAAVP  300

Query  976   AMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHF  1155
              +TLI+GANLL+GLK +    W VIG+ VVR++ LP+ GI VI  A   G V  D LY F
Sbjct  301   IITLIMGANLLKGLKGANTSIWTVIGIIVVRYIFLPILGILVIKGATQLGLVQPDPLYQF  360

Query  1156  VLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             VLLLQYALP AM IGTI QLF  GE ECSVIMLW Y +AS+A+T WTTYFMW+++
Sbjct  361   VLLLQYALPPAMAIGTIAQLFGAGEGECSVIMLWTYVLASVAVTFWTTYFMWLVA  415



>ref|XP_002263531.1| PREDICTED: uncharacterized transporter YBR287W-like [Vitis vinifera]
Length=390

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 212/404 (52%), Positives = 272/404 (67%), Gaps = 15/404 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF VA MPV++ L++TA+G  LA +R+DILG   R  LN +VF+VF PALV S+L
Sbjct  1     MGLLDLFFVASMPVIRVLLLTALGSFLALDRIDILGDVVRKQLNTVVFFVFNPALVYSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT   +V LWFMP+NIL    IGSALG +LVK TRAP+ L GL++  CAAGN+GN+ 
Sbjct  61    ANTITLDRMVLLWFMPLNILTVCIIGSALGLLLVKTTRAPQHLKGLILGSCAAGNMGNMP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPAVC E+ SPFG P  C T   AYASLSMAIGA+ +W+Y+YNI+R +      SS 
Sbjct  121   LIIIPAVCREKGSPFGAPDVCHTFAMAYASLSMAIGAICLWSYVYNIVRIF------SSN  174

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEA-QIVFEEEEKPSELKRLRQNVKMWADKINLK  828
                G     S  E      +L +   EE  Q+            +++Q ++ ++ KINLK
Sbjct  175   AREGINLHCSISEEYPHQFTLPHPLSEENLQVAIS--------GKMKQLLRKFSRKINLK  226

Query  829   MMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
              + APST   IVG +IG+V  LRKLII   APLHV+  SA +LGDAAIP++ LI+G NLL
Sbjct  227   ELLAPSTTGAIVGFIIGMVPHLRKLIIGGTAPLHVVQDSASLLGDAAIPSIILIMGGNLL  286

Query  1009  RGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSA  1188
             +GLK S I    ++G+  VRF+ LPL GI ++  A  FG V  D L+ FVLLLQYA+P A
Sbjct  287   KGLKGSGIQLSFIVGILAVRFIFLPLLGIIIVKGALRFGLVHPDPLFQFVLLLQYAVPPA  346

Query  1189  MGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             + +GTI QLF  GESECSVIMLW Y +AS++LTLW+T FMW++S
Sbjct  347   INLGTIIQLFGAGESECSVIMLWTYGLASVSLTLWSTLFMWLVS  390



>ref|XP_010029544.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X1 
[Eucalyptus grandis]
Length=445

 Score =   348 bits (892),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 218/445 (49%), Positives = 286/445 (64%), Gaps = 42/445 (9%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MA LDLFVVALMPVLK L+ITA+G +LA  RVDILG  +R HLNN+VF+VF+PALV S L
Sbjct  1     MALLDLFVVALMPVLKVLLITALGSLLAIARVDILGEEARKHLNNIVFFVFSPALVFSCL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ++IT  S+  LWFMP NILLTF +GSALGW+L++ +RAP  L GLV+ CCAAGN GN+L
Sbjct  61    AKSITYKSMASLWFMPCNILLTFIVGSALGWLLIRFSRAPDHLRGLVLGCCAAGNQGNML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT-------  630
             LIIIPAVC E+ SPFGDP +C+T+G  +ASLS+AIGA+Y+W+Y+YNI+R   +       
Sbjct  121   LIIIPAVCREKGSPFGDPESCNTHGMTFASLSLAIGAIYLWSYVYNIMRISSSRNSQGSE  180

Query  631   -----PRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQN  795
                  P ++S  +      +       L   S   D  E     +E  +K     ++   
Sbjct  181   PDVSMPCVHSVGENRNPSEIQKLELLPLQQFSSVEDHVEVDVSTYEGTQKVLVPAKIMIF  240

Query  796   VKMWADKINLKMMFAPStiativgivigvvSF----------------------------  891
             ++M    IN + +FAPSTI  +V   + V                               
Sbjct  241   LRMVWTNINPRTLFAPSTIGALVIEGLNVREVWWQEGEKKAHDVPMVLTNKIIGFIVGTT  300

Query  892   --LRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvv  1065
               LRK  + D+APLHV+  SA +LG+AAIP++TLI+GANLLRGLK S+I   V+IG+  V
Sbjct  301   PPLRKATVGDSAPLHVVLDSASLLGNAAIPSVTLILGANLLRGLKGSSIHPPVIIGILAV  360

Query  1066  rfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSV  1245
             R++ LPL G+ ++  A + G V SD LY FVLLLQ+ALP AM IGTITQLF   E+ECSV
Sbjct  361   RYIALPLLGMMIVRGAVYLGLVQSDPLYQFVLLLQFALPPAMNIGTITQLFGAVEAECSV  420

Query  1246  IMLWNYSVASLALTLWTTYFMWILS  1320
             IMLW Y VA+++LTLW+  FMW++S
Sbjct  421   IMLWTYVVAAVSLTLWSALFMWLVS  445



>emb|CDY31514.1| BnaC05g16230D [Brassica napus]
Length=478

 Score =   348 bits (894),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 203/409 (50%), Positives = 283/409 (69%), Gaps = 20/409 (5%)
 Frame = +1

Query  94    SSKKILMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPA  273
             SS +  M  LDLF+ + +PV K L+IT IG  LA +RV+IL   +R  LNN+VFYVF+P+
Sbjct  90    SSDETRMKLLDLFITSSIPVGKILVITGIGFYLALDRVNILNQDARKQLNNIVFYVFSPS  149

Query  274   LVASSLGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaag  453
             LVASSL ETIT  S+VK+WFMP+N++LTF IGS LGW+++KIT+ P  L G+++ CCAAG
Sbjct  150   LVASSLAETITYESLVKMWFMPLNVVLTFIIGSFLGWLVIKITKPPYHLRGIIVGCCAAG  209

Query  454   nlgnllliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP  633
             NLGN+ LIIIPA+C E+ SPFGDP TC   G  Y +LSMAIG++ IWTY+YN++R     
Sbjct  210   NLGNMPLIIIPAICNEKGSPFGDPETCEKYGLGYVALSMAIGSICIWTYVYNLMRVLA--  267

Query  634   RMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWAD  813
                 S  I+G+    S    L+ +             V + EE+     +++Q V    +
Sbjct  268   --RESPIIIGT----SSTVPLIPTK------------VIQVEEQFGTWSKIKQRVCSATE  309

Query  814   KINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIV  993
              INL  +FAPSTIA ++ + +G++  LRKL+I + APL VI+ S  +LG+  IP +TLI+
Sbjct  310   NINLGTIFAPSTIAALIALGVGLIPTLRKLLIGNTAPLRVIEDSVSLLGEGTIPLLTLII  369

Query  994   GANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQY  1173
             G NLL+GL+ S +   V++GV VVR+VLLP+ G+ ++  A   G + S+ LY FVLLLQY
Sbjct  370   GGNLLKGLRGSGMHKSVILGVVVVRYVLLPIIGVLIVQGAHQLGLITSEPLYQFVLLLQY  429

Query  1174  ALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              +P AM +GTITQLF  GESECSVI+ W+Y++AS++LTLW T+FMW+++
Sbjct  430   VVPPAMNLGTITQLFGSGESECSVILFWSYALASVSLTLWPTFFMWLVA  478



>ref|XP_003517114.1| PREDICTED: uncharacterized protein LOC100785182 isoformX1 [Glycine 
max]
 ref|XP_006573505.1| PREDICTED: uncharacterized protein LOC100785182 isoform X2 [Glycine 
max]
 ref|XP_006573506.1| PREDICTED: uncharacterized protein LOC100785182 isoform X3 [Glycine 
max]
Length=415

 Score =   347 bits (889),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 212/415 (51%), Positives = 281/415 (68%), Gaps = 12/415 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  ++LF VA MPV+K L+ITA+GL+LA + V++LG  +R  +N+LV YVF PALV  +L
Sbjct  1     MGLVELFGVASMPVIKVLLITAVGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  ++V LWFMPVNILLTF IGSALGWIL+K+TRAP+ L GL++  C+AGNLGNL 
Sbjct  61    ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLIMGVCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT--PR---  636
             +IIIPA+C+++ SPFGD   C   G AYASLSMA+GAVYIWTY+YNI+R   +  P+   
Sbjct  121   IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAVGAVYIWTYVYNIMRVSASVVPKDAY  180

Query  637   MNSSTDIMGSGFLDSCREALLSSHSLKYDQDEE-------AQIVFEEEEKPSELKRLRQN  795
               SS  +  SG          SS      +D         + I  EE  K     +++  
Sbjct  181   RTSSFRLEASGEFLEFLPEEESSEPENPSKDNMDDYTLLLSSIESEENVKLPVSAKIKHQ  240

Query  796   VKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIP  975
             +       N + +F+P+T+  IVG ++GVV  +RKL+I  +A LHVI  S  M+G+AA+P
Sbjct  241   IGKLLVNSNFRAIFSPATLGAIVGFIVGVVPQIRKLMIGGDASLHVIQDSVTMVGEAAVP  300

Query  976   AMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHF  1155
              +TLI+GANLL+GLK +    W ++G+ VVR++ LP+ GI VI  A   G V  D LY F
Sbjct  301   VITLIMGANLLKGLKGANTSFWTILGIIVVRYIFLPILGILVIKGATQLGLVQPDPLYQF  360

Query  1156  VLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             VLLLQYALP AM IGTI QLF  GE ECSVIMLW Y++AS+A+T WTTYFMW+++
Sbjct  361   VLLLQYALPPAMAIGTIAQLFGAGEGECSVIMLWTYALASVAVTFWTTYFMWLVA  415



>ref|XP_009149573.1| PREDICTED: uncharacterized transporter YBR287W [Brassica rapa]
Length=383

 Score =   345 bits (884),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 200/403 (50%), Positives = 280/403 (69%), Gaps = 20/403 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ + +PV K L+IT IG  LA +RV+IL   +R  LNN+VFYVF+P+LVASSL
Sbjct  1     MKLLDLFITSSIPVGKILVITGIGFYLALDRVNILNQDARKQLNNIVFYVFSPSLVASSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  S+VK+WFMP+N++LTF IGS LGW+++KIT+ P  L G+++ CCAAGNLGN+ 
Sbjct  61    AETITYESLVKMWFMPLNVVLTFIIGSFLGWLVIKITKPPSHLRGIIVGCCAAGNLGNMP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPA+C E+ SPFGDP TC   G  Y +LSMAIG++ IWTY+YN++R         + 
Sbjct  121   LIIIPAICNEKGSPFGDPETCEKYGLGYVALSMAIGSICIWTYVYNLMRVLA----RETP  176

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKM  831
              I+G            +S ++     +  Q+    EE+     +++Q V    + INL  
Sbjct  177   IIIG------------TSSTVPLIPTKVVQV----EEQFGTWSKIKQRVCSATENINLGT  220

Query  832   MFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLR  1011
             +FAPSTIA ++ + IG++  LRKL+I + APL VI+ S  +LG+  IP +TLI+G NLL+
Sbjct  221   IFAPSTIAALIALGIGLIPTLRKLLIGNTAPLRVIEDSVSLLGEGTIPLLTLIIGGNLLK  280

Query  1012  GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAM  1191
             GL+ S +   V++GV VVR+VLLP+ G+ ++  A + G + S+ LY FVLLLQY +P AM
Sbjct  281   GLRGSGMHKSVILGVVVVRYVLLPIIGVLIVQGAHYLGLITSEPLYQFVLLLQYVVPPAM  340

Query  1192  GIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              +GTITQLF  GE ECSVI+ W+Y++AS++LTLW T+FMW++S
Sbjct  341   NLGTITQLFGSGECECSVILFWSYALASVSLTLWPTFFMWLVS  383



>ref|XP_007134484.1| hypothetical protein PHAVU_010G051100g [Phaseolus vulgaris]
 gb|ESW06478.1| hypothetical protein PHAVU_010G051100g [Phaseolus vulgaris]
Length=425

 Score =   344 bits (882),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 210/425 (49%), Positives = 289/425 (68%), Gaps = 24/425 (6%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LFVVALMPVLK L+ITA+G +LA  R  ILG ++R +LN LV++VF+PALV SSL
Sbjct  1     MEFWKLFVVALMPVLKVLLITALGTILAINRFHILGENTRKNLNTLVYFVFSPALVCSSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  S+V LWFMPVNILLTF IGS LG++LVK+T+ P  L GLV+ CCA+GNLGNL 
Sbjct  61    AETITLRSVVILWFMPVNILLTFVIGSLLGFLLVKLTKVPHHLQGLVLGCCASGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +II+PA+C++  +PFGD   CS N  AYASLSMA+G+VYIW+Y YN++R Y  P++ +  
Sbjct  121   IIIVPALCKQSGNPFGDVNVCSKNALAYASLSMALGSVYIWSYAYNLVRLYA-PKICNEA  179

Query  652   DIMGSGFLDS-------------CREAL-LSSHSLKYDQDEEAQIVFE---------EEE  762
              I+ +   +S             C + L + S      Q E+    FE         + E
Sbjct  180   KIVENSMKNSMSITKSDLENPSTCSKGLPVVSVIDDKSQSEDHVKHFEIHCTKCDDGKTE  239

Query  763   KPSELKRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDS  942
             +  +++ + + +K    KINLK++F PSTI  IVG++IGVV   RKL+I D AP HV++ 
Sbjct  240   EAQKVEMIMKQLKRLIKKINLKILFTPSTIGAIVGLIIGVVPQFRKLLIGDKAPFHVVED  299

Query  943   SADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHF  1122
             S  M+G A IP MTL+VGANL++GL     G  +++G+ V+R ++LP  G+G++    H 
Sbjct  300   SIVMVGYACIPVMTLLVGANLMKGLNGFGKGLPMIVGITVIRCIVLPGIGVGIVKCVVHL  359

Query  1123  GWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTY  1302
             G +  D LY FVLLLQ+A+P A+ + TITQLF VGE ECSVIML  YS A++++TLW+T+
Sbjct  360   GLIHPDPLYEFVLLLQFAVPPAVSLSTITQLFGVGEGECSVIMLATYSCAAVSVTLWSTF  419

Query  1303  FMWIL  1317
             +MW++
Sbjct  420   YMWLV  424



>ref|XP_010270583.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Nelumbo nucifera]
Length=385

 Score =   342 bits (878),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 199/411 (48%), Positives = 268/411 (65%), Gaps = 34/411 (8%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ A MPVLK L++T IG +LA +++DILG  +R HLN +V++VFTPALV S L
Sbjct  1     MGLLDLFITASMPVLKVLLVTLIGSLLALDQIDILGEDARKHLNQIVYFVFTPALVGSYL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT   +  LWFMPVNIL+T+ IGS LGWI+++ITR P  L GL++ CC+AGN+GN+ 
Sbjct  61    AKTITLERMAMLWFMPVNILITYIIGSILGWIVIRITRPPSHLKGLILGCCSAGNMGNMF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR---AYGTPRMN  642
             +I IPAVC+E+ +PFG    C T G AYASLSMAIGAVY+W Y+YN++R      + ++N
Sbjct  121   IIFIPAVCKEKGNPFGAHEICHTYGLAYASLSMAIGAVYLWAYVYNLVRVSSCTSSVQVN  180

Query  643   SST---DIMG--SGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMW  807
              ST    + G  S +  SC EALL+S       D   Q      E   ELK         
Sbjct  181   GSTICSKLSGETSEYKGSCTEALLNSQDCSISSDFSDQYKLPCIEPQGELKF--------  232

Query  808   ADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTL  987
                +   +   P                +R+ +I +NAPL VI  SA ++GD A+PA+TL
Sbjct  233   ---VGFLVGIVPQ---------------MRRSVIGENAPLRVIQDSASLVGDGAVPALTL  274

Query  988   IVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLL  1167
             I+G NL++GL+ S I   ++ G+ +VR++ LPL GI +I  A  +G V SD LY FVLLL
Sbjct  275   IMGGNLMKGLQGSQIKLSLIFGIIIVRYITLPLLGILIIKGAIRYGLVHSDPLYQFVLLL  334

Query  1168  QYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             Q+A+P AM IGTITQLF  GE ECSVIMLW Y +AS+++TLW+T+FMW+L+
Sbjct  335   QFAVPPAMNIGTITQLFGTGERECSVIMLWTYILASVSITLWSTFFMWLLA  385



>ref|XP_009128182.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
Length=387

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 188/404 (47%), Positives = 281/404 (70%), Gaps = 17/404 (4%)
 Frame = +1

Query  109   LMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASS  288
             +M  L LF+ +  PV++ L+IT +G  +A + V++LG  +R  LNN+VFYVF+P+L+ S 
Sbjct  1     MMKLLHLFITSSKPVVEILLITTVGFYMALDGVNLLGQDARKFLNNIVFYVFSPSLIGSR  60

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L  ++T  S++++WFMPVN+LLTF IGS LGWI++ IT+ P  L GL++ CCAAGNLGN+
Sbjct  61    LANSVTYESLMQMWFMPVNVLLTFIIGSFLGWIVILITKPPSHLRGLIVGCCAAGNLGNM  120

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSS  648
              LII+PAVC+E+  PFGDP  C   G  Y +LSMA+G++YIWTY+YN++R      + + 
Sbjct  121   PLIIVPAVCKEKGGPFGDPENCQKYGVGYVALSMAMGSIYIWTYVYNLMRVLTNSPIETQ  180

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLK  828
               I       SC+  L+SS        EE     E+ +K     ++++ +   + K+NL+
Sbjct  181   PSIE-----SSCKVPLISSK-------EE-----EDNQKVGRWDKVKRRMVSLSGKVNLR  223

Query  829   MMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
              +FAPSTIA ++ +V+G+++ +RKLII + APL V+  S  ++GD AIPAMTLI+G NLL
Sbjct  224   TIFAPSTIAAMIALVVGLITPIRKLIIGNGAPLGVLQDSVTLVGDGAIPAMTLIIGGNLL  283

Query  1009  RGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSA  1188
             +G++ S +    ++GV V R++ LP+ G+ ++  A  F  + S+ LY FVLLLQYA+P A
Sbjct  284   KGMRSSGMKKSSIVGVLVARYIFLPISGVLIVRGAYKFDLITSEPLYQFVLLLQYAVPPA  343

Query  1189  MGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             M +GTITQLF  GESECSVI+LW Y++AS++LT+W T+FMW+++
Sbjct  344   MNLGTITQLFGAGESECSVILLWTYALASVSLTVWPTFFMWLVA  387



>gb|KHN28298.1| Putative transporter C5D6.04 [Glycine soja]
Length=416

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 212/416 (51%), Positives = 281/416 (68%), Gaps = 13/416 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  ++LF VA MPV+K L+ITA+GL+LA + V++LG  +R  +N+LV YVF PALV  +L
Sbjct  1     MGLVELFGVASMPVIKVLLITAVGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  ++V LWFMPVNILLTF IGSALGWIL+K+TRAP+ L GL++  C+AGNLGNL 
Sbjct  61    ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLIMGVCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT--PR---  636
             +IIIPA+C+++ SPFGD   C   G AYASLSMA+GAVYIWTY+YNI+R   +  P+   
Sbjct  121   IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAVGAVYIWTYVYNIMRVSASVVPKDAY  180

Query  637   MNSSTDIMGSGFLDSCREALLSSHSLKYDQDEE-------AQIVFEEEEKPSELKRLRQN  795
               SS  +  SG          SS      +D         + I  EE  K     +++  
Sbjct  181   RTSSFRLEASGEFLEFLPEEESSEPENPSKDNMDDYTLLLSSIESEENVKLPVSAKIKHQ  240

Query  796   VKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIP  975
             +       N + +F+P+T+  IVG ++GVV  +RKL+I  +A LHVI  S  M+G+AA+P
Sbjct  241   IGKLLVNSNFRAIFSPATLGAIVGFIVGVVPQIRKLMIGGDASLHVIQDSVTMVGEAAVP  300

Query  976   AMTLIVGANLLRG-LKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYH  1152
              +TLI+GANLL+G LK +    W ++G+ VVR++ LP+ GI VI  A   G V  D LY 
Sbjct  301   VITLIMGANLLKGSLKGANTSFWTILGIIVVRYIFLPILGILVIKGATQLGLVQPDPLYQ  360

Query  1153  FVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             FVLLLQYALP AM IGTI QLF  GE ECSVIMLW Y++AS+A+T WTTYFMW+++
Sbjct  361   FVLLLQYALPPAMAIGTIAQLFGAGEGECSVIMLWTYALASVAVTFWTTYFMWLVA  416



>ref|XP_006390184.1| hypothetical protein EUTSA_v10018685mg [Eutrema salsugineum]
 gb|ESQ27470.1| hypothetical protein EUTSA_v10018685mg [Eutrema salsugineum]
Length=390

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 191/407 (47%), Positives = 284/407 (70%), Gaps = 20/407 (5%)
 Frame = +1

Query  109   LMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASS  288
             +M  LDLF+ +  PV++ L+IT++G  +A + V++LG  +R +LN++VFYVF+P+L+ S 
Sbjct  1     MMKLLDLFITSSKPVVEILLITSVGFYMALDGVNLLGQDARKYLNSIVFYVFSPSLIGSR  60

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L +++T  S+VK+WFMPVN+L TF IGS LGWI++ IT+ P  L GL++ CCAAGNLGN+
Sbjct  61    LADSVTYESLVKMWFMPVNVLFTFIIGSLLGWIVIVITKPPSNLRGLILGCCAAGNLGNM  120

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSS  648
              LIIIPAVC+E+  PFGDP +C   G  YA+LSMA+G+VYIWTY+YN++R      + + 
Sbjct  121   PLIIIPAVCKEKGGPFGDPESCQKYGMGYAALSMAMGSVYIWTYVYNLMRVLSNSPIETQ  180

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMW---ADKI  819
               I  +   DSC+  L+SS               ++EE   ++ R  +  + W   ++K+
Sbjct  181   PSIESN--YDSCKVPLISS---------------KQEEDNHKVGRWEKVKRRWVSLSEKV  223

Query  820   NLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGA  999
             NL+ +FAPSTIA I+ +V+G+V+  RKLII + APL V+  S  ++GD AIPA TLI+G 
Sbjct  224   NLRTIFAPSTIAAIIALVVGLVTPFRKLIIGNVAPLRVLQDSVTLVGDGAIPATTLIIGG  283

Query  1000  NLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYAL  1179
             NLL+G++ S +    +IGV V R++ LP+ G+ ++  A     + S+ LY FVLL+QY +
Sbjct  284   NLLKGMRSSGMKKSSIIGVLVARYIFLPISGVLLVRGAYKLDLITSEPLYQFVLLIQYVV  343

Query  1180  PSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             P AM +GTITQLF  GE+ECSVI+LW Y++AS++LT+W T+FMW+++
Sbjct  344   PPAMSLGTITQLFGAGENECSVILLWTYALASISLTVWPTFFMWLVA  390



>emb|CDY20402.1| BnaC02g24140D [Brassica napus]
Length=387

 Score =   340 bits (873),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 187/404 (46%), Positives = 281/404 (70%), Gaps = 17/404 (4%)
 Frame = +1

Query  109   LMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASS  288
             +M  L LF+ +  PV++ L+IT +G  +A + V++LG  +R  LNN+VFYVF+P+L+ S 
Sbjct  1     MMKLLHLFITSSKPVVEILLITTVGFYMALDGVNLLGQDARKFLNNIVFYVFSPSLIGSR  60

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L  ++T  S++++WFMPVN+LLTF IGS LGWI++ IT+ P  L GL++ CCAAGNLGN+
Sbjct  61    LANSVTYESLMQMWFMPVNVLLTFIIGSFLGWIVILITKPPSHLRGLIVGCCAAGNLGNM  120

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSS  648
              LII+PAVC+E+  PFGDP  C   G  Y +LSMA+G++YIWTY+YN++R      + + 
Sbjct  121   PLIIVPAVCKEKGGPFGDPENCQKYGVGYVALSMAMGSIYIWTYVYNLMRVLTNSPIETQ  180

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLK  828
               I       SC+  L+SS        EE     E+ +K     ++++ +   + K+NL+
Sbjct  181   PSIE-----SSCKVPLISSK-------EE-----EDNQKVGRWDKVKRRMVSLSGKVNLR  223

Query  829   MMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
              +FAPSTIA ++ +V+G+++ +R+LII + APL V+  S  ++GD AIPAMTLI+G NLL
Sbjct  224   TIFAPSTIAAMIALVVGLITPIRRLIIGNGAPLGVLQDSVTLVGDGAIPAMTLIIGGNLL  283

Query  1009  RGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSA  1188
             +G++ S +    ++GV V R++ LP+ G+ ++  A  F  + S+ LY FVLLLQYA+P A
Sbjct  284   KGMRSSGMKKSSIVGVLVARYIFLPISGVLIVRGAYKFDLITSEPLYQFVLLLQYAVPPA  343

Query  1189  MGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             M +GTITQLF  GESECSVI+LW Y++AS++LT+W T+FMW+++
Sbjct  344   MNLGTITQLFGAGESECSVILLWTYALASVSLTVWPTFFMWLVA  387



>gb|KHN41796.1| Putative transporter [Glycine soja]
Length=416

 Score =   341 bits (874),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 217/416 (52%), Positives = 286/416 (69%), Gaps = 13/416 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  ++LF VA MPV+K LIITA+GL+LA + V++LG  +R  +N+LV YVF PALV  +L
Sbjct  1     MGLVELFGVASMPVIKVLIITAVGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  ++V LWFMPVNILLTF IGSALGWIL+K+TRAP+ L GL++  C+AGNLGNL 
Sbjct  61    ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLILGVCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT--PRMN-  642
             +IIIPA+C+++ SPFGD   C   G AYASLSMA+GAVY WTY+YNI+R   +  P+ + 
Sbjct  121   IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAVGAVYTWTYVYNIMRVSASVVPKDDY  180

Query  643   --SSTDIMGSG-FLD--SCREALLSSHSLKYDQDEE----AQIVFEEEEKPSELKRLRQN  795
               SS  +  SG FL+     E+    +  K + D+     + I  EE  K     +++Q 
Sbjct  181   RTSSFRLEASGEFLEFIPEEESSEPENPPKDNMDDYTLLLSSIESEENVKLPISAKIKQQ  240

Query  796   VKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIP  975
                     N + +F+P+T+  IVG ++GVV  +RKL+I  +A LHVI  S  M+G+AA+P
Sbjct  241   FGNLLVNSNFRAIFSPATLGAIVGFIVGVVPQIRKLMIGGDASLHVIQDSVTMVGEAAVP  300

Query  976   AMTLIVGANLLRG-LKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYH  1152
              +TLI+GANLL+G LK +    W VIG+ VVR++ LP+ GI VI  A   G V  D LY 
Sbjct  301   IITLIMGANLLKGSLKGANTSIWTVIGIIVVRYIFLPILGILVIKGATQLGLVQPDPLYQ  360

Query  1153  FVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             FVLLLQYALP AM IGTI QLF  GE ECSVIMLW Y +AS+A+T WTTYFMW+++
Sbjct  361   FVLLLQYALPPAMAIGTIAQLFGAGEGECSVIMLWTYVLASVAVTFWTTYFMWLVA  416



>ref|XP_010649335.1| PREDICTED: uncharacterized transporter C5D6.04 isoform X2 [Vitis 
vinifera]
Length=382

 Score =   338 bits (866),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 206/383 (54%), Positives = 272/383 (71%), Gaps = 21/383 (5%)
 Frame = +1

Query  226   SRHHLNNLVFYVFTPALVASSLGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITR  405
             S H    LVFY+F PALVAS+L +T+TASS+  +WFMPVNILLTF IGSALGWIL+KITR
Sbjct  3     SMHLHTLLVFYIFYPALVASNLADTVTASSLATMWFMPVNILLTFIIGSALGWILIKITR  62

Query  406   APRELHGLVISccaagnlgnllliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAV  585
              P+ LH L++ CC+AGN+GNL  IIIPA+CEE ++PFG  + CST+G AYASLS A+GA+
Sbjct  63    PPQHLHALILGCCSAGNMGNLFFIIIPAICEESDNPFGS-SDCSTDGDAYASLSSALGAI  121

Query  586   YIWTYIYNIIRAYGTP------RMNSSTDIMGSGFL-----DSCREALL----SSHSLKY  720
              +WTY+Y I+R   T         NS+T +  S        D C EALL    S  S  +
Sbjct  122   GVWTYVYMIMRMSATKCKGEINLCNSTTSVRTSREALEISSDCCTEALLPPRDSPRSGNW  181

Query  721   DQDEEAQIVFEEEEKPSEL---KRLRQNVKMWADKINLKMMFAPStiativgivigvvSF  891
               +EE  +  +  E+ SE+   ++++Q VK++ +K N K +F PSTI  I G  IG++  
Sbjct  182   SDEEE--LPHDGSEEKSEVPFSEKIKQKVKIFMEKTNFKQVFTPSTIGVIFGFFIGLIPP  239

Query  892   LRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrf  1071
             +RKLII D+APL VI+SSA +LG+AAIP+ TLI+GANLL GLK S +   V++G+  VR+
Sbjct  240   IRKLIIGDSAPLRVIESSATLLGEAAIPSTTLIMGANLLSGLKGSDVSIVVILGIVAVRY  299

Query  1072  vLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIM  1251
             + LPL G+ V+  A HFG VGS+ L+ FVL+LQYA+P AMG G I QLF+ G+SECSVIM
Sbjct  300   IFLPLLGVVVVKAATHFGLVGSNLLFQFVLMLQYAVPPAMGTGVICQLFQFGQSECSVIM  359

Query  1252  LWNYSVASLALTLWTTYFMWILS  1320
             LW Y+VA  ALTLW+T+FMW++S
Sbjct  360   LWTYAVAGFALTLWSTFFMWLVS  382



>emb|CBI37493.3| unnamed protein product [Vitis vinifera]
Length=379

 Score =   338 bits (866),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 206/381 (54%), Positives = 273/381 (72%), Gaps = 22/381 (6%)
 Frame = +1

Query  235   HLNNL-VFYVFTPALVASSLGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAP  411
             HL+ L VFY+F PALVAS+L +T+TASS+  +WFMPVNILLTF IGSALGWIL+KITR P
Sbjct  2     HLHTLLVFYIFYPALVASNLADTVTASSLATMWFMPVNILLTFIIGSALGWILIKITRPP  61

Query  412   RELHGLVISccaagnlgnllliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYI  591
             + LH L++ CC+AGN+GNL  IIIPA+CEE ++PFG  + CST+G AYASLS A+GA+ +
Sbjct  62    QHLHALILGCCSAGNMGNLFFIIIPAICEESDNPFGS-SDCSTDGDAYASLSSALGAIGV  120

Query  592   WTYIYNIIRAYGTP------RMNSSTDIMGSGFL-----DSCREALL----SSHSLKYDQ  726
             WTY+Y I+R   T         NS+T +  S        D C EALL    S  S  +  
Sbjct  121   WTYVYMIMRMSATKCKGEINLCNSTTSVRTSREALEISSDCCTEALLPPRDSPRSGNWSD  180

Query  727   DEEAQIVFEEEEKPSEL---KRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLR  897
             +EE  +  +  E+ SE+   ++++Q VK++ +K N K +F PSTI  I G  IG++  +R
Sbjct  181   EEE--LPHDGSEEKSEVPFSEKIKQKVKIFMEKTNFKQVFTPSTIGVIFGFFIGLIPPIR  238

Query  898   KLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvL  1077
             KLII D+APL VI+SSA +LG+AAIP+ TLI+GANLL GLK S +   V++G+  VR++ 
Sbjct  239   KLIIGDSAPLRVIESSATLLGEAAIPSTTLIMGANLLSGLKGSDVSIVVILGIVAVRYIF  298

Query  1078  LPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLW  1257
             LPL G+ V+  A HFG VGS+ L+ FVL+LQYA+P AMG G I QLF+ G+SECSVIMLW
Sbjct  299   LPLLGVVVVKAATHFGLVGSNLLFQFVLMLQYAVPPAMGTGVICQLFQFGQSECSVIMLW  358

Query  1258  NYSVASLALTLWTTYFMWILS  1320
              Y+VA  ALTLW+T+FMW++S
Sbjct  359   TYAVAGFALTLWSTFFMWLVS  379



>emb|CDP01744.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   338 bits (867),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 200/414 (48%), Positives = 280/414 (68%), Gaps = 12/414 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDL +VA +PV+K L+I A+G  LA + +DILG S+R  LNN+VF+VF PALV+S+L
Sbjct  1     MGLLDLSLVASIPVVKVLLICALGSFLALDHIDILGDSARKELNNMVFFVFNPALVSSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT+ +I+ LWFMP+NILLT+ +GS LGW + KIT++P+ L GLV+  CAAGNLG+L 
Sbjct  61    AQTITSENIISLWFMPLNILLTYIVGSFLGWEINKITKSPQHLKGLVMGLCAAGNLGSLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
              +++PA+C E+ SPFG P +C     AY SLSMAIGA+Y+W+ +YN +R   T  +N   
Sbjct  121   FVLVPAICREKGSPFGAPESCHKYAMAYVSLSMAIGAIYLWSIVYNTVRVSST-MINEVI  179

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKI----  819
             ++  + F +   +AL    + ++D +  +      E      K  +Q   +  D I    
Sbjct  180   NVNIANFDEETSKALQEQINSEFDSEGTSATDHANESSLPCAKTDKQGKVLILDTIKKQL  239

Query  820   -------NLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPA  978
                    NLK + APST A IVG +IG+V  ++KL+I  NAPLHVI  SA +LG+AA+P 
Sbjct  240   YSFFRSSNLKAIIAPSTTAAIVGFIIGLVPPVQKLLIGANAPLHVIQDSALLLGEAAVPI  299

Query  979   MTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFV  1158
             + L VG NLL+GL+   +   +V+G+  VR V+LPL G+ VI  A H G+V +D LY FV
Sbjct  300   IMLTVGGNLLKGLRGPGVQLSLVLGIIAVRSVVLPLIGVLVIKGAIHLGFVHADPLYQFV  359

Query  1159  LLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LLL YALP A+ IGTITQLF  G+SEC+VI+LW YSV+S+ LTLW+T+FMW+++
Sbjct  360   LLLHYALPPAINIGTITQLFGSGQSECAVILLWTYSVSSVTLTLWSTFFMWLVA  413



>ref|XP_009104669.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
 ref|XP_009104670.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
 ref|XP_009104671.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
 emb|CDX68094.1| BnaA07g21340D [Brassica napus]
Length=388

 Score =   336 bits (861),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 190/404 (47%), Positives = 282/404 (70%), Gaps = 16/404 (4%)
 Frame = +1

Query  109   LMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASS  288
             ++  L LF+ +  PV++ L+IT++GL +A + V++LG  +R +LN++VFYVF P+LV S 
Sbjct  1     MLKLLHLFITSSKPVVEILLITSVGLYMALDGVNLLGPDARKYLNDIVFYVFNPSLVGSR  60

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L +++T  S+VK+WFMP+N+LLTF IGS LGWI++ IT+ P  L GL++ CCAAGNLGN+
Sbjct  61    LADSVTYDSLVKMWFMPINLLLTFIIGSLLGWIVILITKPPSNLRGLIVGCCAAGNLGNM  120

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSS  648
              LIIIPAVC+++  PFGDP  C+  G  Y +LSMA+G+VYIWTY+YNI+R      + + 
Sbjct  121   PLIIIPAVCKDKGGPFGDPENCNKYGMGYVALSMAMGSVYIWTYVYNIMRVLSNSVIETQ  180

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLK  828
               I       +C+  L+SS      ++EE     E+  K     R ++ +   ++K+NL 
Sbjct  181   PSIE-----SNCKVPLISS------REEE-----EDNHKVGRWDRFKRRMVSLSEKVNLS  224

Query  829   MMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
              +FAP+TIA I+ +VIG+++ +R+LII + APL V+  S  ++GD AIPA TLI+G NLL
Sbjct  225   TIFAPTTIAAIIALVIGLINPVRELIIGNVAPLGVLQDSVTLVGDGAIPATTLIIGGNLL  284

Query  1009  RGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSA  1188
             +G++ S +    ++GV V R++LLP+ G+ ++  A     + S+ LY FVLL+QYA+P A
Sbjct  285   KGMRSSGMKRSSIVGVLVARYILLPISGVLIVRGAYKLDLITSEPLYQFVLLIQYAVPPA  344

Query  1189  MGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             M +GTITQLF  GESECSVIMLW Y +AS++LT W T+FMW+++
Sbjct  345   MSLGTITQLFGAGESECSVIMLWAYGLASVSLTAWPTFFMWLVA  388



>ref|XP_010428718.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Camelina sativa]
Length=398

 Score =   335 bits (860),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 198/409 (48%), Positives = 284/409 (69%), Gaps = 17/409 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L+LF+ +  PV++TL+IT++G  LA +RV++LG  +R HLNN+VFYVF+P+L+ S L
Sbjct  1     MKLLELFIASSKPVVETLLITSVGFYLALDRVNLLGPDARKHLNNIVFYVFSPSLIGSRL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +++T  S+VK+WFMPVN++LTF IGS LGWI++ IT+ P  L GL+IS CA+GNLG + 
Sbjct  61    ADSVTYESLVKMWFMPVNVMLTFIIGSLLGWIVIVITKPPSHLRGLIISSCASGNLGTMP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPA+C+E+  PFGD  +C   G  Y +LSM +G VY WTYIYN++R      + +  
Sbjct  121   LIIIPAICKEKGGPFGDAESCEKYGMGYVTLSMTMGTVYSWTYIYNLMRVLSNSPVETQH  180

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKM  831
              +  +   +SC+  L+SS     +++EE     +   K    ++L+Q V   ++K++L  
Sbjct  181   SVESN--YNSCKVPLISSK----EEEEE-----DNHNKVGRWEKLKQRVVSLSEKVDLAS  229

Query  832   MFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLR  1011
             +FAP+TIA I+ +VIG+++ LR L+I   APL V+  S  +LGD AIPAMTLI+G NLL+
Sbjct  230   IFAPATIAAIIALVIGLITPLRNLLIGTVAPLRVVQDSLTLLGDGAIPAMTLIMGGNLLK  289

Query  1012  GL------KKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQY  1173
             GL        S I  + +IGV V R++LLP+ G+ ++  A     V S+ LY FVLLLQY
Sbjct  290   GLTMSSGITSSGITKFSIIGVLVARYILLPISGVLIVRGAYKLDLVTSEPLYQFVLLLQY  349

Query  1174  ALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             A+P AM +GT+TQLF  GESECSVIMLW YS+AS++LTLW T+FMW+++
Sbjct  350   AVPPAMNLGTMTQLFGSGESECSVIMLWTYSLASISLTLWPTFFMWLVA  398



>ref|XP_002317634.2| hypothetical protein POPTR_0011s14870g [Populus trichocarpa]
 gb|EEE98246.2| hypothetical protein POPTR_0011s14870g [Populus trichocarpa]
Length=390

 Score =   334 bits (857),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 204/403 (51%), Positives = 279/403 (69%), Gaps = 13/403 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M    LFVVALMPV+K L+ITA+G+ LA ER+DILG  +R HLN+LVFYV  PALV S+L
Sbjct  1     MGLWQLFVVALMPVVKVLLITAVGVFLATERMDILGTDARKHLNSLVFYVLNPALVGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              + IT  SIV LWFMP+NIL+TF  GSALGW+L+KIT+AP  L GL++ CCAAGNLGN+ 
Sbjct  61    AKFITLKSIVMLWFMPLNILITFIAGSALGWLLIKITKAPIHLRGLILGCCAAGNLGNMP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPA CEE+ +PFGD + C  +G AYA+LS+AIG++ +W+Y+YNI+R Y      SST
Sbjct  121   LIIIPAACEEKGNPFGDASICKMHGLAYATLSLAIGSILLWSYVYNILRIY------SST  174

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKM  831
             D       D  +   L        +     ++F +E    E + ++Q  +    K+NLK 
Sbjct  175   DS------DETKPDALPEGIESAREITPGPMLFLKEPSIDE-ENIKQGFQKVLKKLNLKR  227

Query  832   MFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLR  1011
             + +PS    IVG + G +   RK++I D+APL V++ SA  +G++AI   TLI+GANLL+
Sbjct  228   LLSPSINGAIVGFIAGTIPPFRKVLIGDSAPLRVVEDSAYFVGESAITITTLILGANLLK  287

Query  1012  GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAM  1191
             G + S +   V+IG+  VR+++LP+ G+G I  A HFG V SD LY FVLLLQ+ALP A+
Sbjct  288   GFRGSKVPISVIIGITAVRYIILPILGVGFIKCAVHFGAVNSDPLYKFVLLLQFALPPAI  347

Query  1192  GIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              IGT+TQLF  GE+E SVIMLW Y++AS+++ LW+ +FMW++ 
Sbjct  348   NIGTMTQLFGAGEAEYSVIMLWTYALASVSVMLWSAFFMWLVK  390



>ref|XP_010679878.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=398

 Score =   335 bits (858),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 208/409 (51%), Positives = 287/409 (70%), Gaps = 17/409 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MA LDLFV+A +PV+K L+ITAIG VLA ER+DILG ++RHHLN +VFYVF P+LVA +L
Sbjct  1     MALLDLFVLASLPVVKVLLITAIGSVLALERIDILGENARHHLNKVVFYVFNPSLVAGNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T  S + LWFMPVNIL+TF IGS LG I+VK       L GLVI  C+AGNLG +L
Sbjct  61    AKTVTFESFITLWFMPVNILMTFIIGSVLGCIIVKAAGVRNNLKGLVIGACSAGNLGGML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR-AYGTPRMNSS  648
             +I++PA+C+E+ +PFG+   C T   +YASLS+AIGAVY+W Y+YNI+R + G       
Sbjct  121   IILVPAMCKEKGNPFGETDVCETYALSYASLSLAIGAVYLWLYVYNIVRVSVGE------  174

Query  649   TDIMGSGFLDSCREALLSS---HSLKYDQDEEAQIVFEEEEKPSELKRLRQNVK-MWADK  816
                  +G  D+ +E L+ S   H L  + +E   +        S   R+   ++ +  +K
Sbjct  175   ----AAGETDADKEPLIPSVADHGL-INSEEYNPVNCSSTSLISLASRVIHFLRTLLLEK  229

Query  817   INLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVG  996
             IN+K +FAPSTIA IVG VIG+ S +R L+I ++APLH++  SA MLGDAAIP +T+IVG
Sbjct  230   INIKAVFAPSTIAAIVGFVIGMNSSIRNLMIGNDAPLHIVTDSAFMLGDAAIPTVTIIVG  289

Query  997   ANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWV-GSDSLYHFVLLLQY  1173
             ANLL+GLK + I   VVIG+ + R+++LPL GI ++  A   G+V  ++ L+ F+LLLQ+
Sbjct  290   ANLLQGLKGTGIQRRVVIGIVIARYIILPLSGILIVKGAIQVGFVPPNNKLFVFLLLLQH  349

Query  1174  ALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             A+P AM +GT+ QLF  G+SECSVIMLW Y+ A + LTLW+T F+WI++
Sbjct  350   AMPPAMNLGTMMQLFGAGKSECSVIMLWTYASAPVFLTLWSTIFLWIVT  398



>ref|XP_010471808.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=445

 Score =   336 bits (861),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 202/414 (49%), Positives = 287/414 (69%), Gaps = 21/414 (5%)
 Frame = +1

Query  103   KILMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVA  282
             ++ M  L+LF+ +  PV++TL+IT++G  LA +RV++LG  +R HLNN+VFYVF+P+L+ 
Sbjct  45    EVEMKLLELFIASSKPVVETLLITSVGFYLALDRVNLLGPDARKHLNNIVFYVFSPSLIG  104

Query  283   SSLGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlg  462
             S L +++T  S+VK+WFMPVN+LLTF IGS LGWI++ IT+ P  L GL+I CCA+GNLG
Sbjct  105   SRLADSVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLIICCCASGNLG  164

Query  463   nllliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMN  642
              + LIIIPA+C+E+  PFGDP +C   G  Y +LSM +G VY WTYIYN++R       N
Sbjct  165   TMPLIIIPAICKEKGGPFGDPESCEKYGMGYVTLSMTMGTVYSWTYIYNLMRVLS----N  220

Query  643   SSTDIMGS--GFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADK  816
             S  + + S     +SC+  L+SS     +++EE     +   K    ++L++ V   ++K
Sbjct  221   SPVETLHSVESNYNSCKVPLISSK----EEEEE-----DNHNKVGRWEKLKRRVVSLSEK  271

Query  817   INLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVG  996
             ++L  +FAP+TIA I+ ++IG+++ LR L+I   APL VI  S  +LGD AIPAMTLI+G
Sbjct  272   VDLASIFAPATIAAIIALLIGLITPLRNLLIGTVAPLRVIQDSLTLLGDGAIPAMTLIMG  331

Query  997   ANLLRGL------KKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFV  1158
              NLL+GL        S I    +IGV V R++LLP+ G+ ++  A     V S+ LY FV
Sbjct  332   GNLLKGLTMSSGITSSGITKSSIIGVLVARYILLPISGVLIVRGAYKLDLVTSEPLYQFV  391

Query  1159  LLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LLLQYA+P AM +GT+TQLF  GESECSVIMLW YS+AS++LTLW T+FMW+++
Sbjct  392   LLLQYAVPPAMNLGTMTQLFGSGESECSVIMLWTYSLASISLTLWPTFFMWLVA  445



>gb|KHG29771.1| SPAC5D6.04: Uncharacterized transporter C5D6.04 [Gossypium arboreum]
Length=420

 Score =   333 bits (855),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 204/418 (49%), Positives = 285/418 (68%), Gaps = 18/418 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FLDL VVAL+P+LK L++T +GL L  E++++LG  +R +LN +VFYV +P L+ S+L
Sbjct  1     MGFLDLLVVALVPILKVLLVTGVGLFLGIEKINLLGPEARDYLNKIVFYVLSPCLLLSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  S+V LWFMPVN+LLTF +GSALGWIL K+T+ PR L G+VI CC+ GNLGNLL
Sbjct  61    AETITYKSLVTLWFMPVNVLLTFLVGSALGWILAKLTKTPRHLQGIVIGCCSTGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI+ P +C+E NSPF   +TCST+ +AYASLSMA+GA++ W Y Y ++ +Y       S+
Sbjct  121   LIVFPDICDESNSPFSKLSTCSTDAEAYASLSMAVGAIFTWAYAYPLVSSYVIKNTEHSS  180

Query  652   DIMGSGFLDSCREALLSSHSLKYDQ-DEEAQIVFE------EEEKPSELK-RLRQNVKMW  807
                     DSC E LLS     Y Q  E+  +V E      ++ K    K ++ + +K  
Sbjct  181   IQSSEPSPDSCTEPLLSP---SYSQISEDNSVVLELPLTNMQDGKKMPFKEKIVRCIKCI  237

Query  808   ADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTL  987
               KI+L+ +F PSTIA+I G++IG+VS  RK++I DNAPL VI+SSA ++G     + ++
Sbjct  238   TSKIDLEKVFVPSTIASIAGLIIGIVSPFRKVLIADNAPLRVINSSAALIGHVLAGSHSI  297

Query  988   IVGAN-------LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSL  1146
                 N       L + LK+S +   V++GV  VR + LPL GIGV+  A H G VGSD+L
Sbjct  298   NDLDNGGKPFKRLFQCLKRSEMSLVVILGVVAVRNICLPLLGIGVVQAAHHLGVVGSDAL  357

Query  1147  YHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             Y FVL+ QYA+P A+ +GT+TQLF+ G+ E SVI+LW+YSVAS++LTLW+T +M ++S
Sbjct  358   YRFVLMFQYAVPPAINVGTMTQLFKSGQGETSVILLWSYSVASISLTLWSTLYMSLVS  415



>emb|CBI37490.3| unnamed protein product [Vitis vinifera]
Length=459

 Score =   335 bits (858),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 213/429 (50%), Positives = 274/429 (64%), Gaps = 33/429 (8%)
 Frame = +1

Query  103   KILMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVA  282
             +  M  LDLF VA MPV+K L++TA+G  +A +R DI G + R  LN +VF+V       
Sbjct  41    RFQMGLLDLFFVASMPVIKVLLVTAVGSFIALDRFDIFGENVRKQLNTIVFFV---XXXX  97

Query  283   SSLGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlg  462
                           +WFMP NIL+TF IGSALGW+LVK+TRAP+ L GLV+ CCAAGNLG
Sbjct  98    XXXXXXXXGGGGGLMWFMPFNILITFVIGSALGWLLVKLTRAPQHLRGLVLGCCAAGNLG  157

Query  463   nllliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR--AYGTPR  636
             NL LII+PAVC E+ SPFG P  C T G AYASLSMAIGA+Y+W+Y+YNI+R  + GT  
Sbjct  158   NLPLIIVPAVCREKGSPFGAPDVCHTYGMAYASLSMAIGAIYLWSYVYNIVRVSSVGTTE  217

Query  637   MNSSTDIMGSGFLDS---CREALLSSHSLKYDQDEEAQIVF-----EEEEKPSELKRLRQ  792
             + +  D       DS    RE LL S       D   Q+       EE  K +   ++++
Sbjct  218   VINIED-------DSPAKMREPLLDSKDCSISVDYADQLTLPYTQSEENLKVTTADKVKR  270

Query  793   NVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAI  972
              ++M + +IN++ + APST   I+G +IG+V  LRKL+I   APL V+  S  MLGDAAI
Sbjct  271   FLRMLSREINIQALLAPSTTGAILGFIIGMVPQLRKLLIGSTAPLRVLQDSTSMLGDAAI  330

Query  973   PAMTLIVGANLLR-------------GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLA  1113
             PA+TLI+G NLL+              LK S I   ++IG+ VVR++ LPL GI ++  A
Sbjct  331   PALTLIMGGNLLKEYSRDAMVVLFNFSLKGSGIRASLLIGIIVVRYIFLPLLGIAIVKGA  390

Query  1114  RHFGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLW  1293
                G V  D LY FVLLLQYALP AM IGTITQLF  GESECSVIMLW Y++AS+ALTLW
Sbjct  391   VQLGLVNPDPLYQFVLLLQYALPPAMNIGTITQLFGAGESECSVIMLWTYALASVALTLW  450

Query  1294  TTYFMWILS  1320
             +T FMW+++
Sbjct  451   STLFMWLVA  459



>ref|XP_010679877.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=406

 Score =   332 bits (852),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 206/415 (50%), Positives = 287/415 (69%), Gaps = 21/415 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MA LDLFV+A +PV+K L+ITAIG VLA ER+DILG ++RHHLN +VFYVF P+LVA +L
Sbjct  1     MALLDLFVLASLPVVKVLLITAIGSVLALERIDILGENARHHLNKVVFYVFNPSLVAGNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T  S + LWFMPVNIL+TF IGS LG I+VK       L GLVI  C+AGNLG +L
Sbjct  61    AKTVTFESFITLWFMPVNILMTFIIGSVLGCIIVKAAGVRNNLKGLVIGACSAGNLGGML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +I++PA+C+E+ +PFG+   C T   +YASLS+AIGAVY+W Y+YNI+R        S  
Sbjct  121   IILVPAMCKEKGNPFGETDVCETYALSYASLSLAIGAVYLWLYVYNIVRV-------SVG  173

Query  652   DIMGSGFLDSCREALLSS-------HSLKYDQDEEAQIVFEEEEKPSELKRLRQNVK---  801
             +   +G  D+ +E L+ S       +S +Y+    +         P ++    + +    
Sbjct  174   E--AAGETDADKEPLIPSVADHGLINSEEYNPVNCSSTSLMIPIVPGQISLASRVIHFLR  231

Query  802   -MWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPA  978
              +  +KIN+K +FAPSTIA IVG VIG+ S +R L+I ++APLH++  SA MLGDAAIP 
Sbjct  232   TLLLEKINIKAVFAPSTIAAIVGFVIGMNSSIRNLMIGNDAPLHIVTDSAFMLGDAAIPT  291

Query  979   MTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWV-GSDSLYHF  1155
             +T+IVGANLL+GLK + I   VVIG+ + R+++LPL GI ++  A   G+V  ++ L+ F
Sbjct  292   VTIIVGANLLQGLKGTGIQRRVVIGIVIARYIILPLSGILIVKGAIQVGFVPPNNKLFVF  351

Query  1156  VLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             +LLLQ+A+P AM +GT+ QLF  G+SECSVIMLW Y+ A + LTLW+T F+WI++
Sbjct  352   LLLLQHAMPPAMNLGTMMQLFGAGKSECSVIMLWTYASAPVFLTLWSTIFLWIVT  406



>ref|XP_010428717.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Camelina sativa]
Length=399

 Score =   331 bits (848),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 198/410 (48%), Positives = 284/410 (69%), Gaps = 18/410 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L+LF+ +  PV++TL+IT++G  LA +RV++LG  +R HLNN+VFYVF+P+L+ S L
Sbjct  1     MKLLELFIASSKPVVETLLITSVGFYLALDRVNLLGPDARKHLNNIVFYVFSPSLIGSRL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +++T  S+VK+WFMPVN++LTF IGS LGWI++ IT+ P  L GL+IS CA+GNLG + 
Sbjct  61    ADSVTYESLVKMWFMPVNVMLTFIIGSLLGWIVIVITKPPSHLRGLIISSCASGNLGTMP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMA-IGAVYIWTYIYNIIRAYGTPRMNSS  648
             LIIIPA+C+E+  PFGD  +C   G  Y +LSM  +G VY WTYIYN++R      + + 
Sbjct  121   LIIIPAICKEKGGPFGDAESCEKYGMGYVTLSMTQMGTVYSWTYIYNLMRVLSNSPVETQ  180

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLK  828
               +  +   +SC+  L+SS     +++EE     +   K    ++L+Q V   ++K++L 
Sbjct  181   HSVESN--YNSCKVPLISSK----EEEEE-----DNHNKVGRWEKLKQRVVSLSEKVDLA  229

Query  829   MMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
              +FAP+TIA I+ +VIG+++ LR L+I   APL V+  S  +LGD AIPAMTLI+G NLL
Sbjct  230   SIFAPATIAAIIALVIGLITPLRNLLIGTVAPLRVVQDSLTLLGDGAIPAMTLIMGGNLL  289

Query  1009  RGL------KKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQ  1170
             +GL        S I  + +IGV V R++LLP+ G+ ++  A     V S+ LY FVLLLQ
Sbjct  290   KGLTMSSGITSSGITKFSIIGVLVARYILLPISGVLIVRGAYKLDLVTSEPLYQFVLLLQ  349

Query  1171  YALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             YA+P AM +GT+TQLF  GESECSVIMLW YS+AS++LTLW T+FMW+++
Sbjct  350   YAVPPAMNLGTMTQLFGSGESECSVIMLWTYSLASISLTLWPTFFMWLVA  399



>dbj|BAK04863.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   331 bits (848),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 199/414 (48%), Positives = 280/414 (68%), Gaps = 14/414 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L+LFV A MPVL  L++T +G  LA +   ILG  +R HLN +VFYVF P+L+++ L
Sbjct  1     MGLLELFVTACMPVLNMLLVTGVGSFLATDSAGILGKEARKHLNYVVFYVFNPSLISTYL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+ KLWFMPVN+L TF  G   GWI++K+TRAP +L GL++ CC+AGNLGN+ 
Sbjct  61    AKTITMESLAKLWFMPVNVLFTFTFGLIFGWIVIKVTRAPLKLRGLILGCCSAGNLGNIF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY-------GT  630
             LIIIPA+C+E+ SPFG P  C T G AY+SLS+AIGAV++WT  YNIIRA        G 
Sbjct  121   LIIIPALCKEKGSPFGAPDVCQTYGLAYSSLSLAIGAVFLWTGAYNIIRANSNVTEEDGN  180

Query  631   PRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVF---EEEEKPSELKRLRQNVK  801
               +  +  ++    + +  E     HS+  D+ +E  ++      + K   L+R +  V 
Sbjct  181   SPITQTKVLVSGSTISAVSE---DKHSISSDRVDECALLLISNRTKTKVPLLERAKGFVS  237

Query  802   MWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAM  981
               +  ++LK +FAPSTI  IVG +IG    +R  +I D+APL V+  SA+++G AA+P++
Sbjct  238   SVSGAVDLKKLFAPSTIGVIVGFIIGGTPLIRNALIGDDAPLRVLRDSAELIGGAAVPSV  297

Query  982   TLIVGANLLRGLK-KSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFV  1158
             TLI+G NL+ GL+ ++++   V+ GV VVR+VLLPL G  ++  A  +G +  D LY FV
Sbjct  298   TLIMGGNLITGLRGRASVPPSVIAGVVVVRYVLLPLVGTVLVKAAVRYGVIRPDPLYQFV  357

Query  1159  LLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LLLQ+A+P AM IGTITQLF VGESECSVI +W Y++AS+A+T+W+ +FMW LS
Sbjct  358   LLLQHAVPPAMNIGTITQLFGVGESECSVIFVWVYALASVAVTVWSAFFMWTLS  411



>ref|XP_010094503.1| Uncharacterized transporter [Morus notabilis]
 gb|EXB56257.1| Uncharacterized transporter [Morus notabilis]
Length=411

 Score =   331 bits (848),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 205/426 (48%), Positives = 271/426 (64%), Gaps = 38/426 (9%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L LFV A +PVLK L+IT +G  LA +RV I    +R HLN +VFYVF PALV S+L
Sbjct  1     MKILGLFVTASIPVLKVLLITTLGSYLALDRVGIFPEDARKHLNTVVFYVFNPALVGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S++ LWFMPVNIL+ + +GS LGWI+++ITR  + L GL++ C AAGN G +L
Sbjct  61    ANTITYQSMITLWFMPVNILIAYIVGSILGWIVIQITRPSQHLRGLILGCSAAGNFGTIL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT-------  630
             LIIIP +C+ER SPFGDP  C T G AY+SLSMAIG++Y+W+Y+YNI+R   T       
Sbjct  121   LIIIPTLCKERGSPFGDPDVCYTYGMAYSSLSMAIGSIYLWSYVYNIVRISATSDKEFIR  180

Query  631   --------PRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFE--------EEE  762
                      + +S  D+ GS       E LLSS  L+   D   + V          E  
Sbjct  181   KDFPVSKAAKESSRPDLEGS------IEPLLSSTELEEPGDNSDRYVLPLTASEGRAEAA  234

Query  763   KPSELKRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDS  942
              P     +    +M   K+NLK + APST  T+VG VIG+V  +RK +I   APL VI  
Sbjct  235   VPESHLGITHRFRMLVRKLNLKALLAPSTTGTVVGFVIGLVPQIRKTLIGTGAPLRVIQD  294

Query  943   SADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHF  1122
             SA +LGD AIPA+TLI+G NL++GLK + +   +++G+ V R+V+LP  GI V+  A HF
Sbjct  295   SASLLGDGAIPALTLIIGGNLVKGLKGAGMQKSIIVGIIVARYVVLPFLGILVLKGAVHF  354

Query  1123  GWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTY  1302
             G V SD LY FVLLLQ+A+P AM          +GESECSVIMLW Y++AS++LT W+T 
Sbjct  355   GMVQSDPLYQFVLLLQFAVPPAM---------NMGESECSVIMLWTYALASISLTFWSTV  405

Query  1303  FMWILS  1320
             FMW+++
Sbjct  406   FMWLVA  411



>gb|KEH17832.1| auxin efflux carrier family protein [Medicago truncatula]
Length=410

 Score =   330 bits (847),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 217/410 (53%), Positives = 293/410 (71%), Gaps = 9/410 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILG-ASSRHHLNNLVFYVFTPALVASS  288
             M FL LF+VALMPVLK L+IT +G  LA +R DIL   ++R +LN +VF+VF PALV  S
Sbjct  1     MEFLKLFIVALMPVLKVLLITVLGTFLALDRFDILSRETARKNLNTIVFFVFAPALVCGS  60

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L ET+T+ SIV LWFMP+N+LLTF IG+ALGW++VK+ R P  L GLV+ CCAAGNLGNL
Sbjct  61    LAETVTSKSIVTLWFMPLNVLLTFIIGAALGWLVVKLMRVPHHLQGLVLGCCAAGNLGNL  120

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSS  648
              LII+PAVC++  +PFGD   C  NG AYASLSMAIG +YIW+ +YNI+R Y + ++++ 
Sbjct  121   PLIIVPAVCKQTGNPFGDADICHRNGLAYASLSMAIGTIYIWSIVYNIVRIYSS-KISNE  179

Query  649   TDIMGSGF-----LDSCREALLS--SHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMW  807
               +  S F     L++  E + +  SH+    Q E          K S+ +++ + VK+ 
Sbjct  180   VKVDNSMFSSNSTLENDPENISNDRSHNDHVKQFEIECTNSNGHVKVSKKEKIMKQVKVL  239

Query  808   ADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTL  987
             A+K+ LK +FAP+TI  +VG++IGVV   RK++IV+NAPL VI  S  M+GDA IPAMTL
Sbjct  240   AEKMKLKALFAPATIGALVGLLIGVVPIFRKMLIVNNAPLGVIQDSLVMVGDAGIPAMTL  299

Query  988   IVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLL  1167
             +VGANL++GLK       +V+G+ VVRF++LP+ GIG++  A HFG +  D LY F+LLL
Sbjct  300   LVGANLIKGLKGLGKQVPIVVGIIVVRFIILPVIGIGIVKGAIHFGLIHPDPLYQFLLLL  359

Query  1168  QYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             Q+ALP A+ + TITQLF V E ECSVIML  YS A+ +LTLW+T+FMW++
Sbjct  360   QFALPPAVALSTITQLFGVSEGECSVIMLATYSCAAFSLTLWSTFFMWLV  409



>ref|XP_004145562.1| PREDICTED: uncharacterized protein LOC101208244 [Cucumis sativus]
Length=401

 Score =   330 bits (845),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 202/398 (51%), Positives = 275/398 (69%), Gaps = 16/398 (4%)
 Frame = +1

Query  172   TAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSLGETITASSIVKLWFMPVNIL  351
             T +G  LA   +DILG  +R HLN +VFYVF PALV+S+L ETIT S++VK+WFMP NIL
Sbjct  3     TRLGSFLALPSIDILGQEARKHLNGVVFYVFNPALVSSNLAETITYSNMVKMWFMPFNIL  62

Query  352   LTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiIPAVCEERNSPFGDPTT  531
             +TF +GS  GWI+++ T+ P  L GL++ CC+AGNLGN+LLII+PAVC+E+ SPFGD   
Sbjct  63    ITFIVGSLFGWIVIQWTKPPPHLRGLILGCCSAGNLGNILLIIVPAVCQEKGSPFGDSDK  122

Query  532   CSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRM--NSSTDIMGSGFLDSCREALLSS  705
             C+T G AY SLSMAIGA+++W+Y+YNI+R      +  + +++ +      S  E L+ +
Sbjct  123   CTTYGMAYVSLSMAIGAIFLWSYVYNIVRVSSMSHITADPASNNLPITNTSSIEEPLIHN  182

Query  706   HSL-KYD------QDEEAQIVFEEEEKPSELKRLRQ-----NVKMWADKINLKMMFAPSt  849
               L  Y+       + +  +V EE    S  K  R+      +  +   +NLK +FAPST
Sbjct  183   QPLVVYNDDDDDVSNSKKLLVLEENAVISSSKSKREASAAVRITTFIKSLNLKALFAPST  242

Query  850   iativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLRGLK--K  1023
             I  I G VIG++  LR L+I  +APL VID SA +LG+ AIP +TLIVG NLLRGL+  +
Sbjct  243   IGAIAGFVIGLIPQLRNLLIGADAPLRVIDDSAALLGNGAIPTVTLIVGGNLLRGLRGSE  302

Query  1024  SAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAMGIGT  1203
             S +   +V+G+ +VR+V LPL GI ++  A  FGWVGSD LY FVLLLQ+A+P AM IGT
Sbjct  303   SELKKSIVVGIVLVRYVALPLTGILIVRGAAKFGWVGSDPLYLFVLLLQFAVPPAMNIGT  362

Query  1204  ITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             ITQLF  GE+ECSVI+LW Y +AS++LTLW+T FMW++
Sbjct  363   ITQLFGAGEAECSVILLWTYVLASISLTLWSTLFMWLV  400



>ref|XP_003520432.1| PREDICTED: uncharacterized transporter YBR287W-like [Glycine 
max]
Length=424

 Score =   330 bits (845),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 203/424 (48%), Positives = 286/424 (67%), Gaps = 23/424 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF+VAL+PVLK L+ITA+G +LA  R++ILG ++R +LN +VFYVF+P LV SSL
Sbjct  1     MDFWKLFIVALLPVLKVLLITAVGTILAINRLNILGETARKNLNTMVFYVFSPTLVCSSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  +++ LWFMPVNILLTF IGS LG ++VK+TR P  L GLV+ CCAAGNLGNL 
Sbjct  61    AETITLENVLILWFMPVNILLTFVIGSVLGLLVVKLTRVPHHLQGLVLGCCAAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +I++PAVC++  SPFGD   C  N  AYASLSMA+G+VYIW+Y YN++R Y +P++++  
Sbjct  121   IILVPAVCKQSGSPFGDVNVCYKNALAYASLSMALGSVYIWSYAYNLVRLY-SPKISNEV  179

Query  652   DIMGSGFLDSCREALLS--------SHSLKY------DQDEEAQIVFE--------EEEK  765
              +  +  +++      S        S  L +       Q E+    FE        + E+
Sbjct  180   KVDDNSVVENPVSTTKSDPENPSTFSTELPFVSADDRSQTEDHVKHFEIQCTGHNGQVEE  239

Query  766   PSELKRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSS  945
              S+ + +  ++ +   K+NLK++F PSTI  I+G++IGVV   RKL++ DNA L V++ S
Sbjct  240   VSKNRTIMNHLIILVQKVNLKVLFTPSTIGAIIGLIIGVVPQFRKLLVGDNATLRVVEDS  299

Query  946   ADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFG  1125
               M+G A IP MTL+VGANL++GL        ++IGV +VR ++LP  GIGV+      G
Sbjct  300   VIMVGYACIPVMTLLVGANLIKGLNGLGKQLPLIIGVTMVRCIVLPAIGIGVVKGVVRLG  359

Query  1126  WVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYF  1305
              +  D LY F+LLLQ+ALP A+ + TITQLF  GE ECSVIML  YS A++++TLW+T++
Sbjct  360   LIHPDPLYEFLLLLQFALPPAVAMSTITQLFGAGEGECSVIMLATYSCAAVSVTLWSTFY  419

Query  1306  MWIL  1317
             MW++
Sbjct  420   MWLV  423



>gb|KHN44555.1| Putative transporter C5D6.04 [Glycine soja]
Length=424

 Score =   329 bits (844),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 203/424 (48%), Positives = 285/424 (67%), Gaps = 23/424 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF+VAL+PVLK L+ITA+G +LA  R +ILG ++R +LN +VFYVF+P LV SSL
Sbjct  1     MDFWKLFIVALLPVLKVLLITAVGTILAINRFNILGETARKNLNTMVFYVFSPTLVCSSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  +++ LWFMPVNILLTF IGS LG ++VK+TR P  L GLV+ CCAAGNLGNL 
Sbjct  61    AETITLENVLILWFMPVNILLTFVIGSVLGLLVVKLTRVPHHLQGLVLGCCAAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +I++PAVC++  SPFGD   C  N  AYASLSMA+G+VYIW+Y YN++R Y +P++++  
Sbjct  121   IILVPAVCKQSGSPFGDVNVCYKNALAYASLSMALGSVYIWSYAYNLVRLY-SPKISNEV  179

Query  652   DIMGSGFLDSCREALLS--------SHSLKY------DQDEEAQIVFE--------EEEK  765
              +  +  +++      S        S  L +       Q E+    FE        + E+
Sbjct  180   KVDDNSIVENPVSTTKSDPENPSTFSTELPFVSADDRSQTEDHVKHFEIQCTGHNGQVEE  239

Query  766   PSELKRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSS  945
              S+ + +  ++ +   K+NLK++F PSTI  I+G++IGVV   RKL++ DNA L V++ S
Sbjct  240   VSKNRTIMNHLIILVQKVNLKVLFTPSTIGAIIGLIIGVVPQFRKLLVGDNATLRVVEDS  299

Query  946   ADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFG  1125
               M+G A IP MTL+VGANL++GL        ++IGV +VR ++LP  GIGV+      G
Sbjct  300   VIMVGYACIPVMTLLVGANLIKGLNGLGKQLPLIIGVTMVRCIVLPAIGIGVVKGVVRLG  359

Query  1126  WVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYF  1305
              +  D LY F+LLLQ+ALP A+ + TITQLF  GE ECSVIML  YS A++++TLW+T++
Sbjct  360   LIHPDPLYEFLLLLQFALPPAVAMSTITQLFGAGEGECSVIMLATYSCAAVSVTLWSTFY  419

Query  1306  MWIL  1317
             MW++
Sbjct  420   MWLV  423



>gb|EMT00616.1| Putative transporter [Aegilops tauschii]
Length=411

 Score =   327 bits (839),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 201/412 (49%), Positives = 278/412 (67%), Gaps = 10/412 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L+LF+ A MPVL  L++T +G  LA + V ILG  +R HLN +VFYVF PAL+A+ L
Sbjct  1     MGLLELFITACMPVLNMLLVTGVGSFLATDSVGILGKEARKHLNYVVFYVFNPALIATYL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+ +LWFMPVN+  TF  G   GWI++K+T AP +L GL++ CC+AGNLGN+ 
Sbjct  61    AKTITMESMARLWFMPVNVFFTFIFGLIFGWIVIKVTGAPLKLRGLILGCCSAGNLGNIF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT-PRMNSS  648
             LIIIPA+C+E+ SPFG P  C T G AY+SLS+AIGAV++WT  YNIIRA       + S
Sbjct  121   LIIIPALCKEKGSPFGAPDVCQTYGLAYSSLSLAIGAVFLWTGAYNIIRANSNVTEGDGS  180

Query  649   TDIMGSGFLDS----CREALLSSHSLKYDQDEEAQIVF---EEEEKPSELKRLRQNVKMW  807
             + I  +  L S    C ++   +HS+  D+ +E  +       + K   L+R +  +   
Sbjct  181   SPITQTKVLVSGGTRCADS-EDNHSISSDRVDECALPLISNPTKTKVPLLERAKGIISSV  239

Query  808   ADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTL  987
             +  I+L  +FAPSTI  IVG +IG    +R  +I D+APL V+  S +++G AA+P++TL
Sbjct  240   SGAIDLSKLFAPSTIGVIVGFIIGGTPLIRNALIGDDAPLRVLRESGELIGGAAVPSVTL  299

Query  988   IVGANLLRGLKKSA-IggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLL  1164
             I+G NL+ GL+ +A +   V+ GV +VRFVLLPL G  ++  A  +G +  D LY FVLL
Sbjct  300   IMGGNLITGLRGTASVPPSVIAGVVLVRFVLLPLVGTALVKAAVRYGVIRPDPLYQFVLL  359

Query  1165  LQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LQYA+P AM IGTITQLF VGESECSVI +W Y++AS+A+T+W+ +FMW LS
Sbjct  360   LQYAVPPAMNIGTITQLFGVGESECSVIFVWVYALASVAVTMWSAFFMWTLS  411



>ref|XP_010052724.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Eucalyptus grandis]
Length=346

 Score =   325 bits (833),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 196/346 (57%), Positives = 251/346 (73%), Gaps = 17/346 (5%)
 Frame = +1

Query  334   MPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiIPAVCEERNSP  513
             MPVNILLTF IGSAL W+L+K+TR PR L  LVI CCAAGNLGNLLLII+PAVC E NSP
Sbjct  1     MPVNILLTFIIGSALAWVLIKLTRTPRHLQSLVIGCCAAGNLGNLLLIILPAVCTETNSP  60

Query  514   FGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMN-----------SSTDIM  660
             FGD +TCST G+AYASLSMAIGAVYIW Y+Y ++R     R             ++ +++
Sbjct  61    FGDSSTCSTYGEAYASLSMAIGAVYIWCYVYPLMRISAEKRAEETDPKDSTASLNADEVI  120

Query  661   GSGFLDSCREALLSSHSLKY------DQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN  822
               G  +   E LL+S            +DE  Q  FE + K   LK++RQ++    + I+
Sbjct  121   SGGLPEIITEPLLASEDSPSPMDCISQEDEICQTRFEGKTKILCLKKIRQHITTITEHID  180

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
             +K +FAPSTIA I+G +IGV S +RKLII D+APL VI ++ D+LG+AAIP +TLI+GAN
Sbjct  181   IKKLFAPSTIAVIIGFIIGVASPIRKLIIGDDAPLRVIYNATDLLGEAAIPCITLIIGAN  240

Query  1003  LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALP  1182
             LLRGLK+S +   V+IGV  +R++ LPL GIGV+  A HFG VGSD+LY F L+LQ+ALP
Sbjct  241   LLRGLKRSTVSPVVIIGVITIRYIALPLIGIGVVKAAHHFGMVGSDALYQFTLMLQFALP  300

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              AM +GTITQL E GE+ECS+IMLW Y+VASL+LTLW+T+FMWI++
Sbjct  301   PAMNVGTITQLLEAGENECSIIMLWTYAVASLSLTLWSTFFMWIVT  346



>ref|XP_009592390.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Nicotiana tomentosiformis]
Length=374

 Score =   326 bits (836),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 192/379 (51%), Positives = 261/379 (69%), Gaps = 27/379 (7%)
 Frame = +1

Query  247   LVFYVFTPALVASSLGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHG  426
             +VF+VF PALV+S+L +TIT+ S+ KLWFMP+NIL TF IGS LGW +++ITR P+ L G
Sbjct  2     IVFFVFNPALVSSNLAKTITSESMKKLWFMPLNILFTFIIGSILGWAVIQITRPPQHLRG  61

Query  427   LVISccaagnlgnllliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIY  606
             LV+ CCAAGNLGN+LLIIIPAVC+E+ SPFGDP  C T G  YASLSMA+GA+Y+W+Y+Y
Sbjct  62    LVVGCCAAGNLGNMLLIIIPAVCKEKGSPFGDPGVCHTYGMGYASLSMAVGAIYLWSYVY  121

Query  607   NIIR----------------AYGTPRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEA  738
             NI+R                A  +PR +S +       L +  E+LL S +    +    
Sbjct  122   NIVRISSSKSSKEVEINDSSASRSPRESSISQ------LGTSTESLLPSKAFNGSESPPE  175

Query  739   QI-----VFEEEEKPSELKRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKL  903
             Q+      F+ + +     + +Q +++ + KINLK + APST   + G ++G++  +RKL
Sbjct  176   QLELPSTRFDHKTQMQPGTKFKQYMEIISRKINLKRLLAPSTTGALAGFIVGLIPQIRKL  235

Query  904   IIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLP  1083
             +I D APLHVI+ +A +LGD AIP +TLI+G NLL+GL  S I   +++G+  VR++ LP
Sbjct  236   MIGDVAPLHVIEDTAILLGDGAIPLLTLIMGGNLLKGLTGSGIQKSLLVGIIGVRYIALP  295

Query  1084  LCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNY  1263
             L GI V+  A H G V  D LY FVLLLQ+ALP AM IGTITQLF  GESECSVIM W Y
Sbjct  296   LIGIAVVKGAIHLGLVQHDPLYQFVLLLQFALPPAMNIGTITQLFGAGESECSVIMFWAY  355

Query  1264  SVASLALTLWTTYFMWILS  1320
             ++AS++LTLWTT+FMW+++
Sbjct  356   ALASVSLTLWTTFFMWLVA  374



>ref|XP_009366044.1| PREDICTED: uncharacterized transporter YBR287W-like [Pyrus x 
bretschneideri]
Length=378

 Score =   325 bits (834),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 201/403 (50%), Positives = 267/403 (66%), Gaps = 27/403 (7%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M    L V AL+PVLK L ITA+G  LA +RV+ILG  +R +LN +VFYVF PALV+S++
Sbjct  1     MELKQLLVTALIPVLKVLSITALGSYLALDRVNILGEVTRKNLNTVVFYVFGPALVSSNV  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T T  ++VK+WF+PVNIL+TF IGS LG +L+++ R P  L GLV+ CCAAGNLG +L
Sbjct  61    AQTSTYRNMVKMWFIPVNILITFIIGSILGCLLIQLIRPPAHLRGLVLGCCAAGNLGMML  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+P VC+E+ SPFG P  C      YASLSMA+G  Y+W+Y+YNI+R           
Sbjct  121   LIIVPEVCKEKGSPFGAPDVCHIYAMGYASLSMAVGDFYVWSYVYNIVRI----------  170

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKM  831
                      S R       +  Y+Q  E        ++ +  ++L Q + M   KINLK 
Sbjct  171   ---------SSRRG-----NQDYNQSVERS---STSDQATTSRKLEQRIVMVFQKINLKS  213

Query  832   MFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLR  1011
             +FAPSTI  +VG  IGV+  +RKL + D APL VI  +A +LGD AIP++ LI+G NLL+
Sbjct  214   IFAPSTIGALVGFPIGVIPQIRKLFLGDGAPLRVIQDTAYLLGDGAIPSLILIIGGNLLK  273

Query  1012  GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAM  1191
             GL+ S I   +V+G+ VVR+V LPL GI V+  A  FG V SD LY FVLLLQ++LP AM
Sbjct  274   GLRGSGIQKSLVVGIIVVRYVALPLIGILVVKGALKFGLVHSDPLYLFVLLLQFSLPPAM  333

Query  1192  GIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              IG +TQ+F  GE+ECSVIMLW Y+ ASL+LT W+  FMW+++
Sbjct  334   NIGIMTQVFGAGENECSVIMLWTYAFASLSLTFWSAAFMWLVA  376



>gb|EEC84799.1| hypothetical protein OsI_31863 [Oryza sativa Indica Group]
Length=413

 Score =   327 bits (837),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 205/416 (49%), Positives = 273/416 (66%), Gaps = 16/416 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L+LF+ A +PVL  L++T +G  LA + V IL   +R +LNN+VFYVF P+LVA+ L
Sbjct  1     MGLLELFITACVPVLNMLLVTGVGSFLATDFVGILNKDARKYLNNIVFYVFNPSLVATYL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+ KLWFMPVNILL    G  LGWI+V +TRAP  L GL++ CC+AGN GN+ 
Sbjct  61    AQTITLESLAKLWFMPVNILLACTFGLILGWIVVHVTRAPARLRGLILGCCSAGNWGNIF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY------GTP  633
             LIIIPA+C+E+ SPFG P  C T G AY+SLSMA+GAV++WT  YNI+RA       G  
Sbjct  121   LIIIPALCKEKGSPFGAPDVCHTYGLAYSSLSMALGAVFLWTVAYNIMRATSKVADEGNA  180

Query  634   RMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSEL------KRLRQN  795
             R N  T +  SG   S   A   + S+  D ++    +      PS        +R ++ 
Sbjct  181   RTN-DTKVSNSG--SSTGTASEENLSIPNDNNQCTLPLISNSSVPSSKTKVTLSERAKRF  237

Query  796   VKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIP  975
             V      I+ K +FAPSTIA I+G +IG    +R  II +NAPL VI  SAD++G  AIP
Sbjct  238   VSSMFGAIDFKKIFAPSTIAVIIGFIIGGTPLIRNAIIGENAPLRVIHESADLIGGGAIP  297

Query  976   AMTLIVGANLLRGLK-KSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYH  1152
             ++TLI+G NLL GL+ +++I   V+  V VVR++LLP  G  ++  A H G +  D LY 
Sbjct  298   SVTLIMGGNLLNGLRGEASIQPSVIASVIVVRYILLPSLGTLLVKSAVHLGLIHPDPLYQ  357

Query  1153  FVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             F+LLLQYA+P AM IGTITQLF VGESECSVI +W Y++AS+A+T+W+ +FMW LS
Sbjct  358   FILLLQYAVPPAMNIGTITQLFGVGESECSVIFVWVYALASVAVTVWSAFFMWTLS  413



>gb|KDO85259.1| hypothetical protein CISIN_1g015164mg [Citrus sinensis]
Length=381

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 204/381 (54%), Positives = 258/381 (68%), Gaps = 19/381 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ + +PVLK L+ITA+G  LA + V+ILG  +R H+NNLVFYVF PALVAS+L
Sbjct  1     MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               TIT  S++KLWFMP N+L+TF +GS LGWI+V+ TR P    GL++ CCAAGNLGN+ 
Sbjct  61    ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHFRGLIVGCCAAGNLGNMP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT-------  630
             LIIIPAVC+E+ SPFG P TC T G AY SLSMA+GA+Y+W+Y+YNI+RA  T       
Sbjct  121   LIIIPAVCKEKGSPFGSPDTCQTYGLAYVSLSMAVGAIYLWSYVYNIVRASSTGISRESR  180

Query  631   ----PRMNSSTD--IMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQ  792
                 P   S  D  I G+G   SC E LLSS       D+ A      E K S    ++Q
Sbjct  181   TIDEPFSKSVADGSISGTG---SCSEPLLSSKEFLTPADQLALPCTISEVKGSY--SMKQ  235

Query  793   NVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAI  972
              VK++  KINLK MFAPSTI  + G +IG+V  +RK +I D+APL VI  SA ++GD AI
Sbjct  236   QVKLFFAKINLKSMFAPSTIGALAGFIIGLVPLIRKSMIGDSAPLRVIQDSASLIGDGAI  295

Query  973   PAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDS-LY  1149
             P +TL+VG NLLRGL+ S I   +V G+ V R+V LPL GI ++  A  FG+V SD  LY
Sbjct  296   PTVTLVVGGNLLRGLRGSGIQKSIVFGIVVARYVALPLVGIVIVKGAVRFGFVCSDDLLY  355

Query  1150  HFVLLLQYALPSAMGIGTITQ  1212
              F+LLLQ+A+P AM IGT  Q
Sbjct  356   QFILLLQFAMPPAMNIGTNKQ  376



>ref|XP_009600925.1| PREDICTED: uncharacterized transporter C5D6.04-like [Nicotiana 
tomentosiformis]
 ref|XP_009600926.1| PREDICTED: uncharacterized transporter C5D6.04-like [Nicotiana 
tomentosiformis]
 ref|XP_009600927.1| PREDICTED: uncharacterized transporter C5D6.04-like [Nicotiana 
tomentosiformis]
Length=379

 Score =   324 bits (831),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 200/379 (53%), Positives = 269/379 (71%), Gaps = 15/379 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M+  +LF++ALMPVLKTL+I  +GL LA +R+ IL A +RHHLNNLVFY+F PA+ AS +
Sbjct  1     MSIEELFILALMPVLKTLLIAVVGLFLALDRISILTAEARHHLNNLVFYIFFPAICASGV  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               + T + I  LWF+PV+IL+TF +GSALGWILVKITRAPR LHGLVI CCA GN+GNL 
Sbjct  61    IGSSTETGIFSLWFIPVSILITFLVGSALGWILVKITRAPRHLHGLVIGCCAGGNMGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP------  633
             +IIIPA+C E+N+PFGD  TC+ NG  Y +LSM IGA+ IW+Y+Y II AYG        
Sbjct  121   VIIIPAICAEKNNPFGDSVTCTKNGMGYVTLSMGIGAIGIWSYVYKIIWAYGKRDDGDVS  180

Query  634   -----RMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNV  798
                  R N   +      LDS   ALL + +  +  DE + ++   E K S    + + V
Sbjct  181   IYSKLRENQHGETSKES-LDSITRALLPNSNSNFKDDEASAMI---ETKVSIPIIIEKKV  236

Query  799   KMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPA  978
             K   + ++L ++F P TIATIVGI+I  VS ++ +++ D APL  ++SS  +LG+AAIP+
Sbjct  237   KSLMEYVDLSVVFRPPTIATIVGIIIASVSPIQDIMVGDRAPLRFVESSVVLLGEAAIPS  296

Query  979   MTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFV  1158
             MT+I+GANLLRG K+S +G W++IG+ +VRFV LP+ G+GVI +A++ G VGSD LYHFV
Sbjct  297   MTIIMGANLLRGFKRSGVGIWLLIGIIIVRFVFLPIIGVGVIIVAKNLGMVGSDPLYHFV  356

Query  1159  LLLQYALPSAMGIGTITQL  1215
             +LLQYA+P AM IGTIT +
Sbjct  357   ILLQYAVPPAMAIGTITSV  375



>ref|XP_006437710.1| hypothetical protein CICLE_v10031658mg [Citrus clementina]
 ref|XP_006484432.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Citrus sinensis]
 gb|ESR50950.1| hypothetical protein CICLE_v10031658mg [Citrus clementina]
Length=343

 Score =   323 bits (828),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 193/346 (56%), Positives = 257/346 (74%), Gaps = 20/346 (6%)
 Frame = +1

Query  334   MPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiIPAVCEERNSP  513
             MPVNILL+F IGSAL WIL+KITR P  L GLVI CC+AGN+GNLLLII+PAVCEE NSP
Sbjct  1     MPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLLLIIVPAVCEESNSP  60

Query  514   FGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY--------GTPRMNSSTDIMGSG  669
             FGD + CS+ GKAYASLSMA+GA+YIWTY+Y ++  Y        GT + +S   I+ SG
Sbjct  61    FGDTSVCSSYGKAYASLSMAVGAIYIWTYVYYVMSLYLNKSVSDAGTNK-DSRIHIISSG  119

Query  670   ------FLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSE---LKRLRQNVKMWADKIN  822
                   FL+S R+ LL  HS      +++QI  E     S    L ++RQ +  + +KI+
Sbjct  120   ESSTDIFLESSRKPLL--HSSDRHSPDDSQIQAETRSTKSRFPFLDKMRQRINKFTEKID  177

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
             LKM+FAPSTIA I+G VIG +S  RK+I+ ++APL V+DSSA ++G+AAIPAMTL++GAN
Sbjct  178   LKMIFAPSTIAAIIGFVIGTISPFRKVIVGESAPLRVLDSSAALVGEAAIPAMTLVIGAN  237

Query  1003  LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALP  1182
             LL GLK+S +G  +++G+  +R++LLPL GI ++  A  FG++GSDSLY F+LLLQYA+P
Sbjct  238   LLSGLKRSGVGVSLIMGIIAIRYILLPLLGIVIVKAAYRFGFIGSDSLYQFILLLQYAVP  297

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              A+ +GTI QLFE  ESECSVI+LW Y+VA+ ALTLW T+++W+L+
Sbjct  298   PALAVGTIIQLFETSESECSVILLWTYAVAAFALTLWITFYIWLLT  343



>gb|KDO70040.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
 gb|KDO70041.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
 gb|KDO70042.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
Length=343

 Score =   323 bits (827),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 193/346 (56%), Positives = 257/346 (74%), Gaps = 20/346 (6%)
 Frame = +1

Query  334   MPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiIPAVCEERNSP  513
             MPVNILL+F IGSAL WIL+KITR P  L GLVI CC+AGN+GNLLLII+PAVCEE NSP
Sbjct  1     MPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLLLIIVPAVCEESNSP  60

Query  514   FGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY--------GTPRMNSSTDIMGSG  669
             FGD + CS+ GKAYASLSMA+GA+YIWTY+Y ++  Y        GT + +S   I+ SG
Sbjct  61    FGDTSVCSSYGKAYASLSMAVGAIYIWTYVYYVMSLYLNKSVSDAGTNK-DSRIHIISSG  119

Query  670   ------FLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSE---LKRLRQNVKMWADKIN  822
                   FL+S R+ LL  HS      +++QI  E     S    L ++RQ +  + +KI+
Sbjct  120   ESSTNIFLESSRKPLL--HSSDRRSPDDSQIQAETRSTKSRFPFLDKMRQRINKFTEKID  177

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
             LKM+FAPSTIA I+G VIG +S  RK+I+ ++APL V+DSSA ++G+AAIPAMTL++GAN
Sbjct  178   LKMIFAPSTIAAIIGFVIGTISPFRKVIVGESAPLRVLDSSAALVGEAAIPAMTLVIGAN  237

Query  1003  LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALP  1182
             LL GLK+S +G  +++G+  +R++LLPL GI ++  A  FG++GSDSLY F+LLLQYA+P
Sbjct  238   LLSGLKRSGVGVSLIMGIIAIRYILLPLLGIVIVKAAYRFGFIGSDSLYQFILLLQYAVP  297

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              A+ +GTI QLFE  ESECSVI+LW Y+VA+ ALTLW T+++W+L+
Sbjct  298   PALAVGTIIQLFETSESECSVILLWTYAVAAFALTLWITFYIWLLT  343



>gb|KEH17831.1| auxin efflux carrier family protein [Medicago truncatula]
Length=416

 Score =   325 bits (834),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 202/419 (48%), Positives = 276/419 (66%), Gaps = 21/419 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL LF+VAL PVL TL I  IG VLA + + IL  +++ HLN +V++VFTPAL+ SSL
Sbjct  1     MNFLKLFLVALAPVLNTLFIAIIGAVLALDNIGILTKNAKKHLNIIVYFVFTPALLYSSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S++ LWFMP+NILL + IG+ L WIL KITR PR LHGLV+ CCAAGNLG+L 
Sbjct  61    AKTITLKSLIMLWFMPLNILLRYIIGTTLAWILTKITRVPRHLHGLVMGCCAAGNLGSLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP-----R  636
             LII+PA+C+ R+ PFGD  +C   G A+ SL+MA+G +Y W+ +YNI+R Y TP     +
Sbjct  121   LIIVPAICKGRSHPFGDVDSCYHKGLAFTSLTMAVGHIYAWSIVYNILRIY-TPKTMVVK  179

Query  637   MNSST---DIMGSGFLDSC---------REALLSSHSLKYDQDEEAQIVFEEEEKPSELK  780
              + ST   +I     L  C          E+L + H    DQ +    V + +EK  E  
Sbjct  180   FDESTKFEEINNPKNLSICSIRALTPIKEESLSNGH---IDQLQVECKVIDGQEKVVEKP  236

Query  781   RLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLG  960
              + +++K+  DKI LK +FAP+   ++ G++IG+V   RKL++  +APLHV+ +S  MLG
Sbjct  237   NIMKHLKILGDKIKLKELFAPALWGSMFGVIIGIVPQFRKLLVGQSAPLHVVQTSIVMLG  296

Query  961   DAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSD  1140
             +A IP+M L+VGANLL+GLK       +V+G+ VV ++ LP  GI ++  A HF  + SD
Sbjct  297   EACIPSMILLVGANLLKGLKGLGNKVPLVVGIIVVMYIALPAIGICIVKGAAHFRLINSD  356

Query  1141  SLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
              LY FVLLL Y +P A+ I T+TQL  VG+SECS+IM   YS A L LTLW T FMW++
Sbjct  357   PLYQFVLLLHYVVPPAVSISTMTQLLGVGQSECSLIMFATYSSAPLLLTLWCTVFMWLV  415



>ref|XP_011004410.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
 ref|XP_011004411.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
 ref|XP_011004412.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
 ref|XP_011004413.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
 ref|XP_011004414.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
Length=411

 Score =   325 bits (833),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 199/411 (48%), Positives = 277/411 (67%), Gaps = 8/411 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M    LFVV+LMPV+K L++T +G+ LA ER+DILG  +R HLN+LV+YV  PALV S+L
Sbjct  1     MGLWQLFVVSLMPVVKVLLMTTLGVFLATERMDILGTDARKHLNSLVYYVLNPALVGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              + IT  SIV LWFMP+NI +TF  GSALGW+L+KIT+AP  L GL++ CCAAGNLGN+ 
Sbjct  61    AKFITLKSIVMLWFMPLNIFITFIAGSALGWLLIKITKAPNHLRGLIVGCCAAGNLGNMP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY-GTPRMNSS  648
             LIIIPA CEE+++PFGD + C  +G AYA+LS+AIG++ +W+Y+YNI+R Y  T    + 
Sbjct  121   LIIIPAACEEKDNPFGDASICKMHGLAYATLSLAIGSILLWSYVYNIVRIYSSTDSDETK  180

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELK-------RLRQNVKMW  807
              D +  G   +          LK    +E    FE +   S  K        +++  +  
Sbjct  181   PDALPEGLESAVEITPGPMLFLKEPSIDEGMENFELDRAVSNGKAKVPFPENIKRGFQKV  240

Query  808   ADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTL  987
               K+NLK + +PS    IVG + G +   RKL+I D+APL V++ SA  +G++AI   TL
Sbjct  241   LKKLNLKRLLSPSINGAIVGFIAGTIPPFRKLLIGDSAPLRVVEDSAYFVGESAITITTL  300

Query  988   IVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLL  1167
             IVGANLL+G + S +   V+IG+  VR+++LP+ G+ +I  A H G V SD LY FVLLL
Sbjct  301   IVGANLLKGFRGSKVPISVIIGITAVRYIILPILGVVIIKCAVHLGAVNSDPLYKFVLLL  360

Query  1168  QYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             Q+ALP A+ IGT+TQLF  GE+E SVIMLW Y++AS+++ LW+ +FMW++ 
Sbjct  361   QFALPPAINIGTMTQLFGAGEAEYSVIMLWTYALASVSVMLWSAFFMWLVK  411



>gb|EEE69960.1| hypothetical protein OsJ_29847 [Oryza sativa Japonica Group]
Length=413

 Score =   324 bits (831),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 203/416 (49%), Positives = 272/416 (65%), Gaps = 16/416 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L+LF+ A +PVL  L++T +G  LA + V IL   +R +LNN+VFYVF P+LVA+ L
Sbjct  1     MGLLELFITACVPVLNMLLVTGVGSFLATDFVGILNKDARKYLNNIVFYVFNPSLVATYL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT   + KLWFMPVNILL    G  LGWI+V +TRAP  L GL++ CC+AGN GN+ 
Sbjct  61    AQTITLEGLAKLWFMPVNILLACTFGLILGWIVVHVTRAPARLRGLILGCCSAGNWGNIF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY------GTP  633
             LIIIPA+C+E+ SPFG P  C T G AY+SLSMA+GAV++WT  YNI+RA       G  
Sbjct  121   LIIIPALCKEKGSPFGAPDVCHTYGLAYSSLSMALGAVFLWTVAYNIMRATSKVADEGNA  180

Query  634   RMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSEL------KRLRQN  795
             R N  T +  SG   S   A   + S+  D ++    +      PS        +R ++ 
Sbjct  181   RTN-DTKVSNSG--SSTGTASEENLSIPNDNNQCTLPLISNSSVPSSKTKVTLSERAKRF  237

Query  796   VKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIP  975
             V      I+ K +FAPSTIA I+G +IG    +R  II +NAPL VI  SAD++G  AIP
Sbjct  238   VSSMFGAIDFKKIFAPSTIAVIIGFIIGGTPLIRNAIIGENAPLRVIHESADLIGGGAIP  297

Query  976   AMTLIVGANLLRGLK-KSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYH  1152
             ++TLI+G NLL GL+ ++++   V+  V VVR++LLP  G  ++  A H G +  D LY 
Sbjct  298   SVTLIMGGNLLNGLRGEASVQPSVIASVIVVRYILLPSLGTLLVKSAVHLGLIHPDPLYQ  357

Query  1153  FVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             F+LLLQYA+P AM IGTITQLF VGESECSVI +W Y++AS+A+T+W+ +FMW LS
Sbjct  358   FILLLQYAVPPAMNIGTITQLFGVGESECSVIFVWVYALASVAVTVWSAFFMWTLS  413



>ref|XP_007134485.1| hypothetical protein PHAVU_010G051100g [Phaseolus vulgaris]
 gb|ESW06479.1| hypothetical protein PHAVU_010G051100g [Phaseolus vulgaris]
Length=394

 Score =   323 bits (827),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 199/413 (48%), Positives = 268/413 (65%), Gaps = 31/413 (8%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LFVVALMPVLK L+ITA+G +LA  R  ILG ++R +LN LV++VF+PALV SSL
Sbjct  1     MEFWKLFVVALMPVLKVLLITALGTILAINRFHILGENTRKNLNTLVYFVFSPALVCSSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT  S+V LWFMPVNILLTF IGS LG++LVK+T+ P  L GLV+ CCA+GNLGNL 
Sbjct  61    AETITLRSVVILWFMPVNILLTFVIGSLLGFLLVKLTKVPHHLQGLVLGCCASGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +II+PA+C++  +PFGD   CS N  AYASLSMA+G+VYIW+Y YN++R Y  P++    
Sbjct  121   IIIVPALCKQSGNPFGDVNVCSKNALAYASLSMALGSVYIWSYAYNLVRLYA-PKI----  175

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADK-----  816
                       C EA +  +S+K        I   + E PS   +    V +  DK     
Sbjct  176   ----------CNEAKIVENSMK----NSMSITKSDLENPSTCSKGLPVVSVIDDKSQSED  221

Query  817   ------INLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPA  978
                   I+        T   +  I+  V  F RKL+I D AP HV++ S  M+G A IP 
Sbjct  222   HVKHFEIHCTKCDDGKTEEIVGLIIGVVPQF-RKLLIGDKAPFHVVEDSIVMVGYACIPV  280

Query  979   MTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFV  1158
             MTL+VGANL++GL     G  +++G+ V+R ++LP  G+G++    H G +  D LY FV
Sbjct  281   MTLLVGANLMKGLNGFGKGLPMIVGITVIRCIVLPGIGVGIVKCVVHLGLIHPDPLYEFV  340

Query  1159  LLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             LLLQ+A+P A+ + TITQLF VGE ECSVIML  YS A++++TLW+T++MW++
Sbjct  341   LLLQFAVPPAVSLSTITQLFGVGEGECSVIMLATYSCAAVSVTLWSTFYMWLV  393



>ref|XP_011030710.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
 ref|XP_011030711.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
Length=411

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 198/411 (48%), Positives = 276/411 (67%), Gaps = 8/411 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M    LFVV+LMPV+K L++T +G+ LA ER+DILG  +R HLN+LV+YV  PALV S+L
Sbjct  1     MGLWQLFVVSLMPVVKVLLMTTLGVFLATERMDILGTDARKHLNSLVYYVLNPALVGSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              + IT  SI  LWFMP+NI +TF  GSALGW+L+KIT+AP  L GL++ CCAAGNLGN+ 
Sbjct  61    AKFITLKSIAMLWFMPLNIFITFIAGSALGWLLIKITKAPNHLRGLIVGCCAAGNLGNMP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY-GTPRMNSS  648
             LIIIPA CEE+++PFGD + C  +G AYA+LS+AIG++ +W+Y+YNI+R Y  T    + 
Sbjct  121   LIIIPAACEEKDNPFGDASICKMHGLAYATLSLAIGSILLWSYVYNIVRIYSSTDSDETK  180

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELK-------RLRQNVKMW  807
              D +  G   +          LK    +E    FE +   S  K        +++  +  
Sbjct  181   PDALPEGLESAVEITPGPMLFLKEPSIDEGMENFELDRAVSNGKAKVPFPENIKRGFQKV  240

Query  808   ADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTL  987
               K+NLK + +PS    IVG + G +   RKL+I D+APL V++ SA  +G++AI   TL
Sbjct  241   LKKLNLKRLLSPSINGAIVGFIAGTIPPFRKLLIGDSAPLRVVEDSAYFVGESAITITTL  300

Query  988   IVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLL  1167
             IVGANLL+G + S +   V+IG+  VR+++LP+ G+ +I  A H G V SD LY FVLLL
Sbjct  301   IVGANLLKGFRGSKVPISVIIGITAVRYIILPILGVVIIKCAVHLGAVNSDPLYKFVLLL  360

Query  1168  QYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             Q+ALP A+ IGT+TQLF  GE+E SVIMLW Y++AS+++ LW+ +FMW++ 
Sbjct  361   QFALPPAINIGTMTQLFGAGEAEYSVIMLWTYALASVSVMLWSAFFMWLVK  411



>ref|XP_010649331.1| PREDICTED: uncharacterized protein LOC100249991 isoform X4 [Vitis 
vinifera]
 ref|XP_010649332.1| PREDICTED: uncharacterized protein LOC100249991 isoform X4 [Vitis 
vinifera]
 ref|XP_010649333.1| PREDICTED: uncharacterized protein LOC100249991 isoform X4 [Vitis 
vinifera]
Length=347

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 193/348 (55%), Positives = 257/348 (74%), Gaps = 17/348 (5%)
 Frame = +1

Query  325   LWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiIPAVCEER  504
             +WFMPVNILLTF IGSALGW+L+KITR P+ L GLV+ CC+AGNLGNLLLIIIPA+CEE 
Sbjct  1     MWFMPVNILLTFVIGSALGWVLIKITRTPQHLQGLVLGCCSAGNLGNLLLIIIPAICEEE  60

Query  505   NSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRM------NSSTDIMGS  666
             ++PFGD + CSTNG+AYASLS+AIGA+ IW+Y+Y I+R             +S+  I  S
Sbjct  61    DNPFGD-SDCSTNGEAYASLSLAIGAIGIWSYVYTIMRISANKCKKEINLDDSTISIRTS  119

Query  667   G-----FLDSCREALLSSHSLKY-----DQDEEAQIVFEEEEKPSELKRLRQNVKMWADK  816
             G       + C EALL S          D+ E A    E ++K   L++++Q V++  +K
Sbjct  120   GETLEILSEGCTEALLPSKDCPSSRECSDEVELAHAGSEGKQKVPFLEKIKQQVEILMEK  179

Query  817   INLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVG  996
             I+LK +FAPSTI  IVG  IG++S +RKLII D+APLHVI+SSA  +G+AA+P+ TLI+G
Sbjct  180   IDLKKVFAPSTIGVIVGFFIGLISPIRKLIIGDSAPLHVIESSAYFVGEAAVPSTTLIMG  239

Query  997   ANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYA  1176
             ANLL+GLK S +   V++G+  VR++ LPL G+ V+  A HFG VGS+SL+ FVL+LQYA
Sbjct  240   ANLLKGLKGSDVSIVVILGIMAVRYIALPLLGVVVVKAAHHFGLVGSNSLFQFVLMLQYA  299

Query  1177  LPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LP AM  GT++QLFE G+SECSVIMLW Y+VA+ +LTLW+++FMW++S
Sbjct  300   LPPAMSTGTMSQLFEFGQSECSVIMLWTYAVAAFSLTLWSSFFMWLVS  347



>ref|XP_003578336.1| PREDICTED: uncharacterized protein LOC100826810 [Brachypodium 
distachyon]
 ref|XP_010238302.1| PREDICTED: uncharacterized protein LOC100826810 [Brachypodium 
distachyon]
 ref|XP_010238303.1| PREDICTED: uncharacterized protein LOC100826810 [Brachypodium 
distachyon]
Length=415

 Score =   321 bits (822),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 199/415 (48%), Positives = 274/415 (66%), Gaps = 12/415 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L+LF+ A +PVL  L++T +G  LA +   ILG  +R HLN +VFYVF P LVA+ L
Sbjct  1     MGLLELFITACVPVLNMLLVTGVGSFLASDFAGILGKEARKHLNFVVFYVFNPCLVATYL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+ KLWFMPVNIL  F  G   GWI+VK+T AP +L GL++ CC+AGNLGN+ 
Sbjct  61    AKTITLESLAKLWFMPVNILFAFTFGLIFGWIVVKVTGAPLKLRGLILGCCSAGNLGNIF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYG--TPRMNS  645
             LIIIPA+C+E+ SPFG+P  C T G AY+SLS+A+GAV +WT  YNIIRA    T    +
Sbjct  121   LIIIPALCKEKGSPFGNPDACQTYGLAYSSLSLALGAVVLWTGAYNIIRANSQVTEGDGN  180

Query  646   STDIMGSGFLDSCREALLS--SHSLKYDQDEEAQI-------VFEEEEKPSELKRLRQNV  798
             S       F+    E  +S  +HS+  ++  E+ +       V  ++ K    +R ++ V
Sbjct  181   SPTPQTKVFVSGSTEGAVSEENHSISSNRLNESTLPLISSPTVSSKKTKIPLSERAKKIV  240

Query  799   KMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPA  978
                +  ++LK +FAPSTI+ IVG +IG    +R  +I +NAPL V   SA+++G  AIP+
Sbjct  241   SSVSGAVDLKKLFAPSTISVIVGFIIGGTPLIRNAMIGENAPLRVFRESAELIGGGAIPS  300

Query  979   MTLIVGANLLRGLKKSA-IggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHF  1155
             +TLI+G NL+ GL+  A +   V+ G+  VR++LLP  G  +I  A  FG +  D LY F
Sbjct  301   VTLIMGGNLITGLRGGASVQPSVIAGIVAVRYILLPSVGTVLIKTAVRFGIIQPDPLYQF  360

Query  1156  VLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             +LLLQYA+P AM IGTITQLF VGESECSVI +W Y++AS+A+T+W+ +FMW LS
Sbjct  361   ILLLQYAVPPAMNIGTITQLFGVGESECSVIFVWVYALASVAVTVWSAFFMWTLS  415



>ref|XP_010270584.1| PREDICTED: uncharacterized protein LOC104606871 isoform X3 [Nelumbo 
nucifera]
Length=380

 Score =   319 bits (817),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 190/416 (46%), Positives = 262/416 (63%), Gaps = 49/416 (12%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ A MPVLK L++T IG +LA +++DILG  +R HLN +V++VFTPALV S L
Sbjct  1     MGLLDLFITASMPVLKVLLVTLIGSLLALDQIDILGEDARKHLNQIVYFVFTPALVGSYL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT   +  LWFMPVNIL+T+ IGS LGWI+++ITR P  L GL++ CC+AGN+GN+ 
Sbjct  61    AKTITLERMAMLWFMPVNILITYIIGSILGWIVIRITRPPSHLKGLILGCCSAGNMGNMF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR---AYGTPRMN  642
             +I IPAVC+E+ +PFG    C T G AYASLSMAIGAVY+W Y+YN++R      + ++N
Sbjct  121   IIFIPAVCKEKGNPFGAHEICHTYGLAYASLSMAIGAVYLWAYVYNLVRVSSCTSSVQVN  180

Query  643   SST---DIMG--SGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELK-----RLRQ  792
              ST    + G  S +  SC EALL+S       D   Q      E   ELK     + R 
Sbjct  181   GSTICSKLSGETSEYKGSCTEALLNSQDCSISSDFSDQYKLPCIEPQGELKGPISVKFRH  240

Query  793   NVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAI  972
              +++  + IN K + +PS I   VG ++G+V  +R+ +I +NAPL VI  SA ++GD A+
Sbjct  241   QLEILLENINWKALVSPSIIGAFVGFLVGIVPQMRRSVIGENAPLRVIQDSASLVGDGAV  300

Query  973   PAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYH  1152
             PA+TLI+G NL++GL+ S                         I L+  FG         
Sbjct  301   PALTLIMGGNLMKGLQGSQ------------------------IKLSLIFG---------  327

Query  1153  FVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
                ++ +A+P AM IGTITQLF  GE ECSVIMLW Y +AS+++TLW+T+FMW+L+
Sbjct  328   ---IIIFAVPPAMNIGTITQLFGTGERECSVIMLWTYILASVSITLWSTFFMWLLA  380



>ref|XP_002462579.1| hypothetical protein SORBIDRAFT_02g028510 [Sorghum bicolor]
 gb|EER99100.1| hypothetical protein SORBIDRAFT_02g028510 [Sorghum bicolor]
Length=414

 Score =   320 bits (820),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 200/414 (48%), Positives = 276/414 (67%), Gaps = 11/414 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L+LFV A +PV   L++T +G  LA +   IL   +R HLNN+VFYVF+P+LVA  L
Sbjct  1     MDLLELFVTACVPVFNMLLVTGVGSFLATDFAGILSKEARKHLNNIVFYVFSPSLVAIYL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+ KLWFMPVNILL F  G + GWI+VK+TRAP +L GL++ CC+AGNLGN+ 
Sbjct  61    AKTITMESLAKLWFMPVNILLAFTFGLSFGWIVVKVTRAPAKLRGLILGCCSAGNLGNIF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT------P  633
             LIIIPA+C+E+ SPFG    C   G AY+SLSMAIGAV++W+  YNI+R           
Sbjct  121   LIIIPALCQEKGSPFGAADVCQNIGLAYSSLSMAIGAVFVWSIAYNIVRVTSNLTEGDAD  180

Query  634   RMNSSTDIMGSG-FLDSCREALLSSHSLKYDQDEEAQI---VFEEEEKPSELKRLRQNVK  801
                + T ++ SG  + S  E   S+ +   D+     I   +   ++K S L+R ++ + 
Sbjct  181   AQTNETKVLNSGNAIGSVAEENCSASNDCADECTLPLILTSIRPTKDKHSMLERAQKVLS  240

Query  802   MWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAM  981
               ++ ++LK +FAPSTIA IVG +IG    +R  II D+APL V+  SA+++G  AIP++
Sbjct  241   SISEAVDLKKLFAPSTIAVIVGFIIGGTPLIRNAIIGDSAPLRVLQESAELIGGGAIPSI  300

Query  982   TLIVGANLLRGLKKSA-IggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFV  1158
             TLI+GANLL G++  A +   V+ GV VVR++LLPL G  ++  A   G +  D LY F+
Sbjct  301   TLIMGANLLNGVRGGASVPPSVIAGVIVVRYILLPLLGTALVKGAVRLGLIQPDPLYQFI  360

Query  1159  LLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             L LQYA+P AM IGTI QLF VGESECSVI +W Y++AS+A+T+W+ +FMW LS
Sbjct  361   LHLQYAVPPAMNIGTIMQLFGVGESECSVIFVWVYALASVAVTIWSAFFMWTLS  414



>ref|XP_006485673.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X4 
[Citrus sinensis]
Length=391

 Score =   317 bits (811),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 199/420 (47%), Positives = 276/420 (66%), Gaps = 46/420 (11%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLF+ A +PVLK                             +VF+VF PALV SSL
Sbjct  1     MKILDLFIAAFIPVLK-----------------------------VVFFVFNPALVGSSL  31

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              + ITA  I  LWFMP+NIL+T+ +GS+LGWI++K T+AP +L GLV+ CCAAGNLGN+L
Sbjct  32    ADHITAEGIGMLWFMPLNILITYIVGSSLGWIVLKTTKAPYDLWGLVLGCCAAGNLGNML  91

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT------P  633
              IIIPA+C+ER SPFGD   C   G  Y++LSMAIGA+Y+W+Y+YNI+R Y +       
Sbjct  92    FIIIPAICKERGSPFGDADACYRQGMVYSALSMAIGAIYMWSYVYNIVRIYSSCTNSEGE  151

Query  634   RMNSSTDIMG------SGFLDSCREALLSSHSLKYDQDEEAQIVFE---EEEKPSE--LK  780
             ++++ST+ +           +S    LL  +     +D       +      KP    L+
Sbjct  152   KLDNSTENITPMEETTEKLSNSRMRPLLPLNGCSAVKDHLNHFELDCSITARKPQVQLLE  211

Query  781   RLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLG  960
             +++Q  + +A K NL+ +FAPSTIA I+G ++G++   RKL+I ++APL V++ SA +LG
Sbjct  212   KIKQCFQTFATKFNLRKLFAPSTIAAIIGFMVGIIPEFRKLLIGEHAPLRVVEGSASLLG  271

Query  961   DAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSD  1140
             +A+IP +TLIVGANLLRGLK + I   ++IGV V+R++ LPL G+G++  A HFG+V SD
Sbjct  272   EASIPTVTLIVGANLLRGLKGTRIQLSLIIGVIVIRYIALPLLGVGIVKGAIHFGFVKSD  331

Query  1141  SLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              LY FVLLLQ+ALP A+ IGT+TQLF  GESE SVIMLW Y++AS +LT WTT+FMW++ 
Sbjct  332   PLYQFVLLLQFALPPAVNIGTMTQLFRAGESEYSVIMLWTYALASFSLTFWTTFFMWLVK  391



>ref|XP_004515364.1| PREDICTED: uncharacterized protein LOC101492524 isoform X1 [Cicer 
arietinum]
Length=419

 Score =   318 bits (814),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 219/418 (52%), Positives = 295/418 (71%), Gaps = 16/418 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LFVVALMPVLK L+ITA+G  L+ +R DIL  ++  +LN +VF+VF+PALV SSL
Sbjct  1     MEFWKLFVVALMPVLKVLLITALGTFLSLDRFDILKETASKNLNTIVFFVFSPALVCSSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ETIT+ SI+ LWFMP+N+LLTF IG+ALGW+LVK+ + P  L GL + CCAAGNLGNL 
Sbjct  61    AETITSRSIITLWFMPLNVLLTFIIGAALGWLLVKLIKVPYHLQGLALGCCAAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP-----R  636
             LII+PAVC+++ +PFGD   C  NG AYASLSMAI ++YIW+ +YNI+R Y        +
Sbjct  121   LIIVPAVCKQKGNPFGDLDICHRNGLAYASLSMAIASIYIWSIVYNIVRIYSNKISNEVK  180

Query  637   MNSSTDIMGSGFLDSCREALLSSH---SLKYDQ---DEEAQIVFE-----EEEKPSELKR  783
             ++ ST+I     L++ +E + + +   S+  D+   D   Q   E        K  + +R
Sbjct  181   VDDSTNITPVCALENGQENISTCYVGPSVSNDKSHADHVKQFGIECTIPNGRGKVPKKER  240

Query  784   LRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGD  963
             + + +K+ A+KINLK++FAPSTI  IVG++IGVV   RKL+IVDNA L V+  S  M+GD
Sbjct  241   IVKQLKVLAEKINLKVLFAPSTIGAIVGLIIGVVPIFRKLLIVDNAVLGVLQDSIVMVGD  300

Query  964   AAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDS  1143
             A IPAMTL+VGANLL+GLK       +++G+ VVRF+LLP+ GIG++  A H G +  D 
Sbjct  301   AGIPAMTLLVGANLLKGLKGLGKQFPLIVGIIVVRFILLPVIGIGIVKGAIHIGLIHPDP  360

Query  1144  LYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             LY F+LLLQ+ALP A+ + TITQLF   E ECSVIML  YS A+ +LTLW+T+FMW++
Sbjct  361   LYQFLLLLQFALPPAVAMSTITQLFGASEGECSVIMLATYSCAAFSLTLWSTFFMWLV  418



>ref|XP_004957210.1| PREDICTED: uncharacterized protein LOC101771023 [Setaria italica]
Length=415

 Score =   317 bits (813),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 197/417 (47%), Positives = 271/417 (65%), Gaps = 17/417 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L+LFV A +PV   L++T +G  LA +   IL   +R HLNN+VFYVF P+LVA  L
Sbjct  1     MGLLELFVTACVPVFNMLLVTGVGSFLATDFAGILSKEARKHLNNIVFYVFNPSLVAIYL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+ KLWFMPVNILL F  G   GWI+VK+TR P +L GL++ CC+AGNLGN+ 
Sbjct  61    AKTITMESLAKLWFMPVNILLAFTFGLFFGWIVVKVTRVPAKLRGLILGCCSAGNLGNIF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY-------GT  630
             LIIIPA+C+E+ SPFG+   C T G AY+SLSMAIGAV++W+ +YNI+R         G 
Sbjct  121   LIIIPALCKEKGSPFGEHDVCQTYGLAYSSLSMAIGAVFLWSIVYNIVRVTSNVTVGDGN  180

Query  631   PRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMW-  807
              + N +  ++     ++  E   S+ +   D  +E  +     + P    ++      W 
Sbjct  181   AQTNQTEVLIPGSATETVAEENCSALN---DHSDERTLPLISTDIPPTKNKVPLLESTWK  237

Query  808   -----ADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAI  972
                  + K++LK +FAPSTIA IVG +IG    +R  II D+APL V+  SA+++G  AI
Sbjct  238   FLSSISKKVDLKKLFAPSTIAVIVGFIIGGTPLIRNAIIGDSAPLRVLQESAELIGGGAI  297

Query  973   PAMTLIVGANLLRGLKKSA-IggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLY  1149
             P++TLI+GANLL G++  A +   V+ GV VVR++LLPL G G++  A   G +  D LY
Sbjct  298   PSVTLIMGANLLNGVRGGARVQPSVIAGVIVVRYILLPLLGTGLVKGAVRLGLIQPDPLY  357

Query  1150  HFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              F+L LQYA+P AM IGTI QLF VG SECSVI +W Y++AS+A+T+W+ +FMW LS
Sbjct  358   QFILHLQYAVPPAMNIGTIMQLFGVGASECSVIFVWVYALASVAVTVWSAFFMWTLS  414



>ref|XP_010681116.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=406

 Score =   316 bits (809),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 202/420 (48%), Positives = 277/420 (66%), Gaps = 34/420 (8%)
 Frame = +1

Query  115   AFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSLG  294
             ++ +L  VA MPVLK L+ITA+GL LA  R+DILG +  +HLN +VF+VF PALV S+L 
Sbjct  3     SWFNLLFVASMPVLKVLLITALGLFLALNRIDILGEAVTNHLNKVVFFVFGPALVGSNLA  62

Query  295   ETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnlll  474
             +T+T  S + LWFM V IL+TF IGS +GW+L K+T+AP+ + GL+++ C+AGNLGNL +
Sbjct  63    KTVTFESFLTLWFMLVKILITFLIGSTMGWVLAKVTKAPKHIKGLILASCSAGNLGNLPI  122

Query  475   iiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYG---------  627
             II+PA+C+E+ S FG P  C   G AYASLSMAIG++Y W Y YNI+R            
Sbjct  123   IILPAICKEKGSRFGAPNICERYGLAYASLSMAIGSIYFWLYAYNIVRISSKEVKANEGE  182

Query  628   TPRMNSSTD-------IMGSGF-LDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKR  783
             T  MN   D       +  S + LD+ R   LS+ S KY Q   +              R
Sbjct  183   TSAMNVPVDEAEPNPPLHSSIYSLDAPR---LSNSSTKYVQVTLSS-------------R  226

Query  784   LRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGD  963
             ++Q +   + + NLK + APSTI  IVG +IG++S  R++++ +N PLHVI  +  M+GD
Sbjct  227   IKQRLTNISKEFNLKAVLAPSTIGAIVGFIIGMISPFRRVLMDNNGPLHVIGDTGFMIGD  286

Query  964   AAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGS-D  1140
             AAIP  TLI+GANLLRGLK S I    +IG+ VVR++ LPL GI ++  A   G+V S D
Sbjct  287   AAIPCTTLILGANLLRGLKGSGIQSTTIIGIIVVRYIFLPLLGILIVKGAVFAGFVQSHD  346

Query  1141  SLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
               + FVLLLQY+LP A+ IGT+T+LF  G++ECSVIMLW   +A + LTLW T+++W+LS
Sbjct  347   IFFQFVLLLQYSLPPAVSIGTVTELFGAGQNECSVIMLWTNVLAPVMLTLWCTFYLWLLS  406



>ref|XP_007134486.1| hypothetical protein PHAVU_010G051200g [Phaseolus vulgaris]
 gb|ESW06480.1| hypothetical protein PHAVU_010G051200g [Phaseolus vulgaris]
Length=377

 Score =   315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 185/402 (46%), Positives = 266/402 (66%), Gaps = 26/402 (6%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L LFV+ALMP LK L+IT +G  LA +R D+L  ++  ++N LV++VF+PAL  SSL
Sbjct  1     MEILRLFVIALMPNLKVLLITVLGSFLAMKRFDLLSETAISNMNTLVYFVFSPALACSSL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               T+T   ++ LWFMP  I+LT  +G+ALGW+LVKIT+ P  L GLV+ CCA GNLGNL 
Sbjct  61    ASTMTLRGLITLWFMPFCIVLTVVVGTALGWLLVKITKVPYHLKGLVLGCCAVGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             L+++PA+C E+++PFGD T C  NG AYASLS+A+ ++ +W++ YNI+R Y +P+     
Sbjct  121   LMVVPAICREKSNPFGDETVCYKNGMAYASLSLALASILVWSFAYNIVRIY-SPK-----  174

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKM  831
                     + C E        K DQ  +      E E     K++ Q +KM +   NLK+
Sbjct  175   --------EICNEE-------KVDQITQNPTFASESE-----KKVIQYLKMLSKWSNLKL  214

Query  832   MFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLR  1011
             +F P+ I  ++G++IGVV   R LI+  NAPL+VI  S  M+G+A +PAMT++VGANLL 
Sbjct  215   VFPPTLIGAVIGLIIGVVPQFRNLIVSGNAPLYVIQDSIIMIGNACLPAMTILVGANLLE  274

Query  1012  GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAM  1191
             GLK   +   ++ G+ ++R + LP+ G+  +  A HFG++  D LY FVLLLQ+ALP A+
Sbjct  275   GLKGDRVKFSLIFGIIIIRNIALPVLGVATVKGAVHFGFIHHDPLYEFVLLLQFALPPAV  334

Query  1192  GIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
              I T TQLF  G+ ECS+IML  YS A+++LTLW T+F+W++
Sbjct  335   AISTSTQLFGSGKGECSIIMLATYSFAAVSLTLWCTFFIWLV  376



>tpg|DAA62056.1| TPA: hypothetical protein ZEAMMB73_195263 [Zea mays]
Length=454

 Score =   314 bits (805),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 197/427 (46%), Positives = 268/427 (63%), Gaps = 23/427 (5%)
 Frame = +1

Query  97    SKKILMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPAL  276
             S K  M  + LF+ A +PV   L++T +G  LA +   IL   +R HLNN+VFYVF P+ 
Sbjct  32    SSKWKMDLIQLFITACVPVFNMLLVTGVGSFLAADFAGILSKEARKHLNNVVFYVFNPSF  91

Query  277   VASSLGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagn  456
             V+  L +TIT  S+ KLWFMPVNILL F  G   GWI+VK+TRAP +L GL++ CC+AGN
Sbjct  92    VSIYLAKTITMESLAKLWFMPVNILLAFTFGLFFGWIVVKVTRAPAKLRGLILGCCSAGN  151

Query  457   lgnllliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR------  618
             LGN+ LI+IPA+C+E+ SPFG P  C   G AY SLSMAIGAV++W+  YNIIR      
Sbjct  152   LGNIFLIVIPALCKEKGSPFGAPDVCQDIGLAYFSLSMAIGAVFVWSIAYNIIRVTSKVE  211

Query  619   ----AYGTPRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFE--------EEE  762
                  +G  + N   D++ SG   S R  +    +     D   +             + 
Sbjct  212   EGGGGHGNAQTNEP-DVLSSG---SGRGTVAEEKNSSTSNDCAHECTLPLLSNRIPAAKN  267

Query  763   KPSELKRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDS  942
             K  +L R R+ +    + ++LK +FAPSTIA IVG +IG    +R  II D+APL V+  
Sbjct  268   KEPKLGRARKFLSSVCETVDLKKLFAPSTIAVIVGFIIGGTPLIRNAIIGDSAPLRVLQE  327

Query  943   SADMLGDAAIPAMTLIVGANLLRGLKKSA-IggwvvigvqvvrfvLLPLCGIGVITLARH  1119
             S +++G  AIP++TLI+GANLL G++  A +   V+ GV  VR++LLPL G  ++  A  
Sbjct  328   STELIGGGAIPSVTLIMGANLLNGVRSGARVPPSVIAGVVAVRYILLPLLGTALVKGAVR  387

Query  1120  FGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTT  1299
              G +  D LY F+L LQYA+P AM IGTI QLF VGESECSVI +W Y++AS+A+T+W+ 
Sbjct  388   LGLIQPDPLYQFILHLQYAVPPAMNIGTIMQLFGVGESECSVIFVWVYALASVAVTVWSA  447

Query  1300  YFMWILS  1320
             +FMW LS
Sbjct  448   FFMWTLS  454



>gb|AFW58767.1| hypothetical protein ZEAMMB73_122963 [Zea mays]
Length=454

 Score =   314 bits (805),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 197/427 (46%), Positives = 268/427 (63%), Gaps = 23/427 (5%)
 Frame = +1

Query  97    SKKILMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPAL  276
             S K  M  + LF+ A +PV   L++T +G  LA +   IL   +R HLNN+VFYVF P+ 
Sbjct  32    SSKWKMDLIQLFITACVPVFNMLLVTGVGSFLATDFAGILSKEARKHLNNVVFYVFNPSF  91

Query  277   VASSLGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagn  456
             V+  L +TIT  S+ KLWFMPVNILL F  G   GWI+VK+TRAP +L GL++ CC+AGN
Sbjct  92    VSIYLAKTITMESLAKLWFMPVNILLAFTFGLFFGWIVVKVTRAPAKLRGLILGCCSAGN  151

Query  457   lgnllliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR------  618
             LGN+ LI+IPA+C+E+ SPFG P  C   G AY SLSMAIGAV++W+  YNIIR      
Sbjct  152   LGNIFLIVIPALCKEKGSPFGAPDVCQDIGLAYFSLSMAIGAVFVWSIAYNIIRVTSKVE  211

Query  619   ----AYGTPRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFE--------EEE  762
                  +G  + N   D++ SG   S R  +    +     D   +             + 
Sbjct  212   EGGGGHGNAQTNEP-DVLSSG---SGRGTVAEEKNSSTSNDCAHECTLPLLSNRIPAAKN  267

Query  763   KPSELKRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDS  942
             K  +L R R+ +    + ++LK +FAPSTIA IVG +IG    +R  II D+APL V+  
Sbjct  268   KEPKLGRARKFLSSVCETVDLKKLFAPSTIAVIVGFIIGGTPLIRNAIIGDSAPLRVLQE  327

Query  943   SADMLGDAAIPAMTLIVGANLLRGLKKSA-IggwvvigvqvvrfvLLPLCGIGVITLARH  1119
             S +++G  AIP++TLI+GANLL G++  A +   V+ GV  VR++LLPL G  ++  A  
Sbjct  328   STELIGGGAIPSVTLIMGANLLNGVRSGARVPPSVIAGVVAVRYILLPLLGTALVKGAVR  387

Query  1120  FGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTT  1299
              G +  D LY F+L LQYA+P AM IGTI QLF VGESECSVI +W Y++AS+A+T+W+ 
Sbjct  388   LGLIQPDPLYQFILHLQYAVPPAMNIGTIMQLFGVGESECSVIFVWVYALASVAVTVWSA  447

Query  1300  YFMWILS  1320
             +FMW LS
Sbjct  448   FFMWTLS  454



>ref|XP_008652869.1| PREDICTED: uncharacterized protein LOC103632939 [Zea mays]
Length=418

 Score =   313 bits (802),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 195/422 (46%), Positives = 266/422 (63%), Gaps = 23/422 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  + LF+ A +PV   L++T +G  LA +   IL   +R HLNN+VFYVF P+ V+  L
Sbjct  1     MDLIQLFITACVPVFNMLLVTGVGSFLAADFAGILSKEARKHLNNVVFYVFNPSFVSIYL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+ KLWFMPVNILL F  G   GWI+VK+TRAP +L GL++ CC+AGNLGN+ 
Sbjct  61    AKTITMESLAKLWFMPVNILLAFTFGLFFGWIVVKVTRAPAKLRGLILGCCSAGNLGNIF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR----------A  621
             LI+IPA+C+E+ SPFG P  C   G AY SLSMAIGAV++W+  YNIIR           
Sbjct  121   LIVIPALCKEKGSPFGAPDVCQDIGLAYFSLSMAIGAVFVWSIAYNIIRVTSKVEEGGGG  180

Query  622   YGTPRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFE--------EEEKPSEL  777
             +G  + N   D++ SG   S R  +    +     D   +             + K  +L
Sbjct  181   HGNAQTNEP-DVLSSG---SGRGTVAEEKNSSTSNDCAHECTLPLLSNRIPAAKNKEPKL  236

Query  778   KRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADML  957
              R R+ +    + ++LK +FAPSTIA IVG +IG    +R  II D+APL V+  S +++
Sbjct  237   GRARKFLSSVCETVDLKKLFAPSTIAVIVGFIIGGTPLIRNAIIGDSAPLRVLQESTELI  296

Query  958   GDAAIPAMTLIVGANLLRGLKKSA-IggwvvigvqvvrfvLLPLCGIGVITLARHFGWVG  1134
             G  AIP++TLI+GANLL G++  A +   V+ GV  VR++LLPL G  ++  A   G + 
Sbjct  297   GGGAIPSVTLIMGANLLNGVRSGARVPPSVIAGVVAVRYILLPLLGTALVKGAVRLGLIQ  356

Query  1135  SDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWI  1314
              D LY F+L LQYA+P AM IGTI QLF VGESECSVI +W Y++AS+A+T+W+ +FMW 
Sbjct  357   PDPLYQFILHLQYAVPPAMNIGTIMQLFGVGESECSVIFVWVYALASVAVTVWSAFFMWT  416

Query  1315  LS  1320
             LS
Sbjct  417   LS  418



>ref|XP_008663364.1| PREDICTED: uncharacterized protein LOC103641814 [Zea mays]
Length=418

 Score =   313 bits (802),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 195/422 (46%), Positives = 266/422 (63%), Gaps = 23/422 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  + LF+ A +PV   L++T +G  LA +   IL   +R HLNN+VFYVF P+ V+  L
Sbjct  1     MDLIQLFITACVPVFNMLLVTGVGSFLATDFAGILSKEARKHLNNVVFYVFNPSFVSIYL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+ KLWFMPVNILL F  G   GWI+VK+TRAP +L GL++ CC+AGNLGN+ 
Sbjct  61    AKTITMESLAKLWFMPVNILLAFTFGLFFGWIVVKVTRAPAKLRGLILGCCSAGNLGNIF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR----------A  621
             LI+IPA+C+E+ SPFG P  C   G AY SLSMAIGAV++W+  YNIIR           
Sbjct  121   LIVIPALCKEKGSPFGAPDVCQDIGLAYFSLSMAIGAVFVWSIAYNIIRVTSKVEEGGGG  180

Query  622   YGTPRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFE--------EEEKPSEL  777
             +G  + N   D++ SG   S R  +    +     D   +             + K  +L
Sbjct  181   HGNAQTNEP-DVLSSG---SGRGTVAEEKNSSTSNDCAHECTLPLLSNRIPAAKNKEPKL  236

Query  778   KRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADML  957
              R R+ +    + ++LK +FAPSTIA IVG +IG    +R  II D+APL V+  S +++
Sbjct  237   GRARKFLSSVCETVDLKKLFAPSTIAVIVGFIIGGTPLIRNAIIGDSAPLRVLQESTELI  296

Query  958   GDAAIPAMTLIVGANLLRGLKKSA-IggwvvigvqvvrfvLLPLCGIGVITLARHFGWVG  1134
             G  AIP++TLI+GANLL G++  A +   V+ GV  VR++LLPL G  ++  A   G + 
Sbjct  297   GGGAIPSVTLIMGANLLNGVRSGARVPPSVIAGVVAVRYILLPLLGTALVKGAVRLGLIQ  356

Query  1135  SDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWI  1314
              D LY F+L LQYA+P AM IGTI QLF VGESECSVI +W Y++AS+A+T+W+ +FMW 
Sbjct  357   PDPLYQFILHLQYAVPPAMNIGTIMQLFGVGESECSVIFVWVYALASVAVTVWSAFFMWT  416

Query  1315  LS  1320
             LS
Sbjct  417   LS  418



>emb|CDP01772.1| unnamed protein product [Coffea canephora]
Length=422

 Score =   311 bits (796),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 192/426 (45%), Positives = 268/426 (63%), Gaps = 27/426 (6%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  L  VA MP+++ L+I+ +G V+A E +++L A +R  LN +VF VFTP+L+ +SL
Sbjct  1     MGFWTLLEVASMPIIQVLLISVLGAVMATEHLNLLPADARKSLNKIVFMVFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMPVNI LTF  G  LGWI VK+ +    L GLVI+ C++GNLGNLL
Sbjct  61    AKTVTLDDIISWWFMPVNIGLTFVFGGILGWIAVKLVKPRPHLEGLVIATCSSGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNII----RAY-----  624
             LII+PA+C+E  SPFGD  TCST G +YAS SMA+G +YIWTY Y++I    R Y     
Sbjct  121   LIIVPAICKEDGSPFGDHNTCSTIGLSYASFSMALGGIYIWTYTYHLIKNSARKYEAEKA  180

Query  625   ------GTPRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEE---KPSEL  777
                     P  +   D        + RE +    S+  D  E  +   E +    + S  
Sbjct  181   AWVETLAEPNKDLDADEKSQLLEANAREHV----SVSVDSTEPTEDDVENQNVVSQGSSF  236

Query  778   KRLRQNVKMWADKIN-----LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDS  942
             K  +QN   W          L+ +  P+T+A I+G++ G +++LR LII DNAPLHVI  
Sbjct  237   KPKQQNASFWTKLFGIVYQILEELTTPATLAAIIGLIFGAITWLRNLIIGDNAPLHVIQD  296

Query  943   SADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHF  1122
             S  +LGD  +P + LI+G NL++GL+K+ +   +++ V  VR++LLP  GIGV+  A HF
Sbjct  297   SIALLGDGTLPCIILILGGNLIQGLRKARLKPAIIVAVICVRYILLPGIGIGVVKAATHF  356

Query  1123  GWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTY  1302
             G++  D LYHFVLL+QY LP AM IGT+TQL +V + ECSV++LW Y  A L+LT+W+T 
Sbjct  357   GFLPPDPLYHFVLLIQYTLPPAMNIGTMTQLVDVAQEECSVLLLWTYLFAVLSLTVWSTI  416

Query  1303  FMWILS  1320
             FMWIL+
Sbjct  417   FMWILA  422



>emb|CDX85953.1| BnaC06g21810D [Brassica napus]
Length=365

 Score =   308 bits (790),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 172/404 (43%), Positives = 259/404 (64%), Gaps = 39/404 (10%)
 Frame = +1

Query  109   LMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASS  288
             ++  L LF+ +  PV++ L+IT++GL +A + V++LG  +R +LN++VFYVF P+LV S 
Sbjct  1     MLKLLHLFITSSKPVVEILLITSVGLYMALDGVNLLGPDARKYLNDIVFYVFNPSLVGSR  60

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L +++T  S+VK+WFMP+N+LLTF IGS LGWI++ IT+ P  L GL++           
Sbjct  61    LADSVTYESLVKMWFMPINLLLTFIIGSLLGWIVILITKPPSHLRGLIV-----------  109

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSS  648
                     C+       DP  C+  G  Y +LSMA+G+VYIWTY+YN++R      + + 
Sbjct  110   ------GCCD------ADPENCNKYGMGYVALSMAMGSVYIWTYVYNLMRVLSNSPIETQ  157

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLK  828
               I       SC+  L+SS      ++EE     EE  K     R ++ +   ++K+NL 
Sbjct  158   PSIE-----SSCKVPLISS------KEEE-----EENHKVGRWDRFKRRMVSLSEKVNLS  201

Query  829   MMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
              +F P+TIA I+ +VIG+++ +RKLII + APL V+  S  ++GD AIPA TLI+G NLL
Sbjct  202   TIFTPTTIAAIIALVIGLINPVRKLIIGNVAPLGVLQDSVTLVGDGAIPATTLIIGGNLL  261

Query  1009  RGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSA  1188
             +G++ S +    +IGV V R++LLP+ G+ ++  A     + S+ LY FVLL+QYA+P A
Sbjct  262   KGMRSSGMKRSSIIGVLVARYILLPISGVLIVRGAYKLDLITSEPLYQFVLLIQYAVPPA  321

Query  1189  MGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             M +GTITQLF  GESECSV+MLW Y +AS++LT W T+FMW+++
Sbjct  322   MSLGTITQLFGAGESECSVVMLWAYGLASVSLTAWPTFFMWLVA  365



>ref|XP_007144117.1| hypothetical protein PHAVU_007G130200g [Phaseolus vulgaris]
 gb|ESW16111.1| hypothetical protein PHAVU_007G130200g [Phaseolus vulgaris]
Length=407

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 197/409 (48%), Positives = 278/409 (68%), Gaps = 10/409 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASS-RHHLNNLVFYVFTPALVASS  288
             M F  LF  AL+PVLK L++T +G  L  +R ++L  S+ R+HLN LV++VFTPALV S 
Sbjct  1     MDFWKLFTTALVPVLKVLLVTGLGTFLGLQRFNLLRESAARNHLNALVYFVFTPALVCSI  60

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L +TIT  S+V +WFMP+NIL TF IG+ALGW+ +KIT+A  ++ GLV+ CCAAGNLGN+
Sbjct  61    LAKTITFESLVLVWFMPLNILFTFIIGTALGWLCLKITKAASDMQGLVLGCCAAGNLGNM  120

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSS  648
              LIIIPAVC++  +PFG    C+  G AYASLSMAI  +YIWT++Y+IIR Y     N +
Sbjct  121   PLIIIPAVCKDSGTPFGAVDVCNKKGMAYASLSMAISNIYIWTFVYHIIRVYSCRNFNVN  180

Query  649   TDIMGSGFLDSCREALLSSHS------LKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWA  810
                  +    S  EA L +HS        +  D   Q    + +  S+  ++ + +K   
Sbjct  181   KVDNSTVGPVSAIEADLENHSSTPEVTAAHTNDLVTQF---KSDTVSKENQIIKPLKTLV  237

Query  811   DKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLI  990
              ++NLK++ AP T+ +I+G++IGVV   +K+ + D+AP  V++ SA +LGDA IPAMTL+
Sbjct  238   KRLNLKILLAPPTMGSILGLIIGVVPPFQKMFVGDDAPFRVVEDSASLLGDACIPAMTLL  297

Query  991   VGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQ  1170
             VGANLL G K+S +   +++G+ VVR++ LP+ G+ ++  A  FG +  D LYHF+LLLQ
Sbjct  298   VGANLLNGFKRSELKVSLLVGIIVVRYMALPILGVVIVKGAIRFGIIHQDPLYHFILLLQ  357

Query  1171  YALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             YALP A+GI TITQLF  GE+ECS++ML     AS  LTLW+T+FMW++
Sbjct  358   YALPPAIGISTITQLFGAGETECSIVMLATNVCASFTLTLWSTFFMWLV  406



>ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus communis]
 gb|EEF40726.1| auxin:hydrogen symporter, putative [Ricinus communis]
Length=406

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 192/408 (47%), Positives = 262/408 (64%), Gaps = 7/408 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF VA MP+++ L+I+ +G  +A    ++L + +R  LN +VF VFTP+L+ +SL
Sbjct  1     MGFWTLFEVASMPIIQVLLISGLGAFMATNYCNLLTSDARKSLNKIVFVVFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMPVN+ LTF IG  LGW+LVK+ +    L GLVI+ C++GNLGNLL
Sbjct  61    AQTVTLQDIISWWFMPVNVGLTFLIGGILGWVLVKVLKPKPYLEGLVIATCSSGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI++PA+C E  SPFGD  TC + G +YAS SMAIG  YIWTY Y++IR   T       
Sbjct  121   LIVVPAICNENGSPFGDRETCKSIGLSYASFSMAIGGFYIWTYTYHLIRTSATKLRAIQA  180

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN---  822
             +   S   +   EA   +H LK  +D+E  +V       S   +  Q    W+  I    
Sbjct  181   EEEASKAPNKDLEATPETHLLK-GEDQE-HVVISVPSIKSVDDQESQPASSWSKWIGILR  238

Query  823   --LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVG  996
               ++ + AP TIA I G + G  +FLR LII  +APL VI  S  +LGD  IP +TLI+G
Sbjct  239   QIMEELLAPPTIAAIFGFLFGATTFLRNLIIGSSAPLRVIQDSIKLLGDGTIPCITLILG  298

Query  997   ANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYA  1176
              NL++GL+ S I  W+++GV  VRF++LP  GI ++  A   G++ SD LYHFVL++QY 
Sbjct  299   GNLIQGLRSSRIKPWIIVGVLFVRFMMLPAIGIWLVKAAGSLGFLPSDPLYHFVLMVQYT  358

Query  1177  LPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LP AM IGT+TQLF+VG+ ECSV+ LW Y VA+LALT W+T +MWILS
Sbjct  359   LPPAMNIGTMTQLFDVGQEECSVLFLWTYLVAALALTFWSTIYMWILS  406



>ref|XP_010029570.1| PREDICTED: uncharacterized protein LOC104419566 [Eucalyptus grandis]
 gb|KCW56488.1| hypothetical protein EUGRSUZ_I02215 [Eucalyptus grandis]
Length=420

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 196/424 (46%), Positives = 269/424 (63%), Gaps = 25/424 (6%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF VA MP+L+ L+I+ +G  +A E   +L A +R  LN +VF VFTP+L+ + L
Sbjct  1     MGFWTLFEVASMPILQVLLISGLGAFMATEYCGLLTADARKSLNKIVFMVFTPSLMFAGL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               T+T   I+  WFMPVNI +TF IG  LGWI+VK+ +    L GLVI+ CA+GNLGNLL
Sbjct  61    ARTVTFQDIISWWFMPVNIAVTFLIGGMLGWIVVKLLKPKPYLEGLVIATCASGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYG--------  627
             LII+PA+C E NSPFGD + CS+ G +YAS SMA+G  +IWTY Y ++R+          
Sbjct  121   LIIVPAICNEDNSPFGDKSACSSVGLSYASFSMALGGFFIWTYTYQLVRSSSVKYKELQA  180

Query  628   ----TPRMNSSTDIMGSGFL---DSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRL  786
                 + + N   D   S  L   ++     +S  S K  +D E Q V  +E   S  K  
Sbjct  181   ADDFSKQPNKDLDSNESTRLLKGENQEPVAISVQSTKSVEDVEDQAVISQE---SSGKSE  237

Query  787   RQNVKMWAD------KINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSA  948
             +++V +W        KI L+ + AP+T+A I+G + G +S+LRKLII D+APL VI  S 
Sbjct  238   KESVTLWGKFAGVLHKI-LEELLAPATLAAILGFIFGAISWLRKLIIGDSAPLRVIQDSV  296

Query  949   DMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGW  1128
              +LGD  IP +TLI+G NL +GL+ S I   V++GV  VR+++ P  GIGV+  A   G+
Sbjct  297   KLLGDGTIPCITLILGGNLTQGLRTSRIRPCVILGVLSVRYIISPAIGIGVVKAANSLGF  356

Query  1129  VGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFM  1308
             +  D LYH+VL++Q+ LP AM IGT+TQLF VG+ ECSV+ LW Y  A+LALT W+T +M
Sbjct  357   LPPDPLYHYVLMVQFTLPPAMNIGTMTQLFNVGQEECSVLFLWTYLAAALALTFWSTVYM  416

Query  1309  WILS  1320
             WILS
Sbjct  417   WILS  420



>ref|XP_010681117.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=397

 Score =   307 bits (787),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 198/420 (47%), Positives = 269/420 (64%), Gaps = 43/420 (10%)
 Frame = +1

Query  115   AFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSLG  294
             ++ +L  VA MPVLK L+ITA+GL LA  R+DILG +  +HLN +VF+VF PALV S+L 
Sbjct  3     SWFNLLFVASMPVLKVLLITALGLFLALNRIDILGEAVTNHLNKVVFFVFGPALVGSNLA  62

Query  295   ETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnlll  474
             +T+T  S + LWFM V IL+TF IGS +GW+L K+T+AP+ + G         NLGNL +
Sbjct  63    KTVTFESFLTLWFMLVKILITFLIGSTMGWVLAKVTKAPKHIKG---------NLGNLPI  113

Query  475   iiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYG---------  627
             II+PA+C+E+ S FG P  C   G AYASLSMAIG++Y W Y YNI+R            
Sbjct  114   IILPAICKEKGSRFGAPNICERYGLAYASLSMAIGSIYFWLYAYNIVRISSKEVKANEGE  173

Query  628   TPRMNSSTD-------IMGSGF-LDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKR  783
             T  MN   D       +  S + LD+ R   LS+ S KY Q   +              R
Sbjct  174   TSAMNVPVDEAEPNPPLHSSIYSLDAPR---LSNSSTKYVQVTLSS-------------R  217

Query  784   LRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGD  963
             ++Q +   + + NLK + APSTI  IVG +IG++S  R++++ +N PLHVI  +  M+GD
Sbjct  218   IKQRLTNISKEFNLKAVLAPSTIGAIVGFIIGMISPFRRVLMDNNGPLHVIGDTGFMIGD  277

Query  964   AAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGS-D  1140
             AAIP  TLI+GANLLRGLK S I    +IG+ VVR++ LPL GI ++  A   G+V S D
Sbjct  278   AAIPCTTLILGANLLRGLKGSGIQSTTIIGIIVVRYIFLPLLGILIVKGAVFAGFVQSHD  337

Query  1141  SLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
               + FVLLLQY+LP A+ IGT+T+LF  G++ECSVIMLW   +A + LTLW T+++W+LS
Sbjct  338   IFFQFVLLLQYSLPPAVSIGTVTELFGAGQNECSVIMLWTNVLAPVMLTLWCTFYLWLLS  397



>ref|XP_010680628.1| PREDICTED: uncharacterized transporter YBR287W isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010680629.1| PREDICTED: uncharacterized transporter YBR287W isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=403

 Score =   307 bits (786),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 187/410 (46%), Positives = 270/410 (66%), Gaps = 14/410 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL LF VA MP+L+ LII+ +G  +A E  ++L A +R  LN +V+ VFTPAL+ +SL
Sbjct  1     MGFLSLFEVASMPILQVLIISGLGAFMATEYCNLLTADARRSLNKIVYVVFTPALMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMP+N+ LTF IG ALGWI VK+ +    L GLVI+ C+A NLGNL+
Sbjct  61    AKTVTLQDIISWWFMPINVGLTFIIGGALGWIAVKLLKPGLHLEGLVIASCSAANLGNLV  120

Query  472   liiIPAVCEERNSPFGDP-TTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP-RMNS  645
             LI++PA+C E  SPFGD    CS+ G +YAS SMA+G  YIWTY +++IR+     +   
Sbjct  121   LIVVPAICHEDGSPFGDDHAACSSIGLSYASFSMALGGFYIWTYTFHLIRSSSVKFKALK  180

Query  646   STDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINL  825
             + +   S   +   EA   +H L    DEE Q  ++ E  P  +   +++V +W   + L
Sbjct  181   AAEQEASRDPNKDLEANAKTHLL----DEEIQ-GYDAENHP--VSHEKKSVPIWRKIVEL  233

Query  826   -----KMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLI  990
                  + + AP TIA ++G++ G +++L+ LII DNAPL VI    ++LG+  +P + LI
Sbjct  234   LRQIVEELMAPPTIAAVIGLIFGSITWLKGLIIGDNAPLRVIQDCINLLGNGLLPCIILI  293

Query  991   VGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQ  1170
             +G NL++GL+ + I   +++G+  V+++LLP+ GIGV+  A  FG++  D LYHFVL+LQ
Sbjct  294   LGGNLIQGLRSAKIKTTMILGILFVKYLLLPIIGIGVVKAADSFGFLPPDPLYHFVLMLQ  353

Query  1171  YALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             + LP AM IGT+ QLF+VG+ ECSVI LW Y  A+LALT W+T FMWILS
Sbjct  354   FTLPPAMSIGTMAQLFDVGQEECSVIFLWTYVFAALALTFWSTVFMWILS  403



>ref|XP_007010168.1| Auxin efflux carrier family protein, putative [Theobroma cacao]
 gb|EOY18978.1| Auxin efflux carrier family protein, putative [Theobroma cacao]
Length=410

 Score =   304 bits (779),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 195/414 (47%), Positives = 268/414 (65%), Gaps = 26/414 (6%)
 Frame = +1

Query  145   MPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSLGETITASSIVK  324
             MPVLK ++I AIGL+LA +RV +LG  ++ HLN +VFYVFTPAL ASSL ET+T  S   
Sbjct  1     MPVLKIILIIAIGLLLALDRVKLLGPEAKRHLNKIVFYVFTPALAASSLAETMTFKSFTT  60

Query  325   LWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiIPAVCEER  504
             LWFMPVNIL+TF +GSAL W+L+KITR P+ L G+ I  C++ +L +L LI++PAVCEE 
Sbjct  61    LWFMPVNILITFVLGSALAWLLIKITRTPKHLQGIFIG-CSSADLASLPLIMVPAVCEEP  119

Query  505   NSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSSTDIMGS------  666
             ++PFGD + CSTN K YASLS++IGA+++W+Y+Y I+R Y    + SST ++ S      
Sbjct  120   SNPFGDQSVCSTNAKPYASLSLSIGAIFMWSYVYGIMRMYANKSIESSTTVINSPRDTSE  179

Query  667   GFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKMMFAPS  846
                 S  +A L S            +  E   K S LK++   +KM + KI+LK +FAP+
Sbjct  180   TVSGSRTQAALPSSGCNTSHLPRT-LSGERSTKMSGLKKIMPRIKMISGKIDLKKVFAPT  238

Query  847   tiativgivi------gvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
              +A ++   +        VS +RKL+I ++APL VIDSSA +LG   I  M +   ANLL
Sbjct  239   AVAAVMPKCLHCWVYNRAVSTIRKLMIGNSAPLRVIDSSAYILGK--IINMMISGEANLL  296

Query  1009  RGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSA  1188
              GLK S +   V+IG+  VR + LPL GIGV+  A HFG VGSDSLY FVL+LQ  +   
Sbjct  297   TGLKGSDVSRNVIIGIIAVRNIFLPLSGIGVVKAAHHFGLVGSDSLYQFVLMLQILVSLL  356

Query  1189  MGI----------GTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
               +          GT+ QLF++G+ E S+IMLW    A++ LTLW+T+FMW+L+
Sbjct  357   NKLISTDLIQLLAGTMAQLFQLGQGETSMIMLWTSVTAAVTLTLWSTFFMWLLA  410



>ref|XP_011022138.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
 ref|XP_011022139.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
Length=418

 Score =   305 bits (780),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 195/418 (47%), Positives = 262/418 (63%), Gaps = 15/418 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF VA +P+++ L+I+ +G ++A E +++L   +R  LN LVF VFTP+L+ +SL
Sbjct  1     MGFWTLFEVASLPIIQVLLISFLGALMATEYMNLLPKDARRSLNKLVFMVFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMPVNI  TF IG  LGWILVKI R    L GLVI+ C++GNLGNLL
Sbjct  61    AKTVTLEDIISWWFMPVNIGFTFLIGGTLGWILVKILRPKPYLEGLVIATCSSGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PA+C E  SPFGD + CS+ G +YAS SMA+G  +IWTY + +IR           
Sbjct  121   LIIVPAICNEDGSPFGDSSICSSVGLSYASFSMALGGFFIWTYTFYLIRTSAAKLKALQA  180

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVF------EEEEK----PSELKRLRQNVK  801
              +  S   ++  EA   +H L    +E   IV       E+ E       E +  + NV 
Sbjct  181   VVEVSKAPNNDLEARHETHLLIRQDEENGAIVVASSKSAEDTESHAIVSQESEHGKGNVS  240

Query  802   MWADKIN-----LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDA  966
              W   I      L+ + AP T+A I+G + G  +FLR LII   APL VI  S  +LGD 
Sbjct  241   SWTKLIGFLHQILEELLAPPTLAAILGFIFGATAFLRNLIIGSEAPLRVIQDSIKLLGDG  300

Query  967   AIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSL  1146
              IP +TLI+G NL  GL+ S I  W+V+GV  VR+++LP  G+ V+  A H G++ SD L
Sbjct  301   TIPCITLILGGNLTEGLRASKIKSWIVVGVICVRYIILPAIGMWVVKAAGHLGFLPSDPL  360

Query  1147  YHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             +H+VL++QY LP AM IGT+TQLF VG+ ECSV+ LW Y VA+LALT W+T FMWILS
Sbjct  361   FHYVLMIQYTLPPAMNIGTMTQLFNVGQEECSVLFLWTYLVAALALTAWSTIFMWILS  418



>ref|XP_010550503.1| PREDICTED: uncharacterized transporter YBR287W isoform X4 [Tarenaya 
hassleriana]
Length=396

 Score =   303 bits (777),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 181/406 (45%), Positives = 265/406 (65%), Gaps = 13/406 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL L  VA MP+++ L+I+ +G  LA +   +L A +R  LN LVF VFTP L+ +SL
Sbjct  1     MGFLALLEVASMPIVQVLLISVLGAFLATDYCSLLSAETRRSLNKLVFVVFTPCLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMP+N+ +TF +G  LGW++VK+ +   +LHGL+I+ CA+GN+GNL+
Sbjct  61    AKTVTLQDIISWWFMPLNVGITFLVGGVLGWLVVKVLKPKPQLHGLIIATCASGNMGNLM  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI++PA+C+E  SPFG  + C + G +YAS SMA+G  YIWTY Y ++R+        ++
Sbjct  121   LILVPAICDEEGSPFGSRSVCRSIGLSYASFSMALGGFYIWTYSYQLVRSSAVQFKALAS  180

Query  652   DIMGSGF-LDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLR--QNVKMWADKIN  822
              +      +DS       +H LK D + + Q      ++PSE K+     N+K    +I 
Sbjct  181   SVKSQNKDIDSDHH----THLLKTDIETQTQ-----HDQPSEKKKASAWTNIKDLLHQI-  230

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
             L+ +FAP TI  I+G   G   +LR LII + AP  V+  S  +LGD  IP +TLI+G N
Sbjct  231   LEELFAPPTIGAILGFAFGATKWLRNLIIGETAPFRVVQDSVQLLGDGTIPCITLILGGN  290

Query  1003  LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALP  1182
             L++GL+ SA+   V++GV  VR+++LP+ GIGV+ LA +FG++  D L+ +VL+LQ+ LP
Sbjct  291   LIQGLRSSAVKTSVLVGVICVRYIILPIIGIGVVQLAGNFGFLPEDPLFKYVLMLQFTLP  350

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              AM I T+ QLF+V + ECSVI LW Y VASLALT+W+T F+ ILS
Sbjct  351   PAMNISTMAQLFDVAQDECSVIFLWTYLVASLALTVWSTIFLSILS  396



>gb|AES95390.2| auxin efflux carrier family protein [Medicago truncatula]
Length=379

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 183/378 (48%), Positives = 256/378 (68%), Gaps = 14/378 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+LF VA  PV+K L++T IGL+LA + +++LG  +R+  N+LV YVF P L+  +L
Sbjct  1     MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARNQTNHLVHYVFNPGLIGGNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  ++V LWFMPVNIL+TF +GSALGWI++K+T+ PR + GL++  C+AGNLGNL 
Sbjct  61    AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT---PRMN  642
             +IIIPA+C+++ SPFGDP  C   G AYASLSMAIGAV+IWTY+YNI+R          N
Sbjct  121   IIIIPAICKDKGSPFGDPDVCYQFGMAYASLSMAIGAVFIWTYVYNIMRISSRNVHKECN  180

Query  643   SSTDIMGSGFLDSCREALLSSHSLKY------DQDEEAQIVFEEEEKPSELK-----RLR  789
              S+D +         ++++   S  Y      + D+   ++  + E   ++K     +++
Sbjct  181   KSSDSITLEDSRDVSQSIIEEGSENYTSPTKGNVDDAYTLLLSKNESEQKIKVPVFDKIK  240

Query  790   QNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAA  969
                 M     N + +F+P+T+  IVG ++GVV +LR+L+I  NAPLHVI+ SA MLGDAA
Sbjct  241   HKFGMILGNPNFRGIFSPATLGAIVGFIVGVVPWLRRLMIGSNAPLHVIEDSASMLGDAA  300

Query  970   IPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLY  1149
             IP +TLI+GANLLRGLK ++   W +IG+ VVR++LLP+ G+ +I  A H G V  D LY
Sbjct  301   IPTITLIMGANLLRGLKGASTPFWTIIGIIVVRYILLPIFGVLIIKGATHLGLVQIDPLY  360

Query  1150  HFVLLLQYALPSAMGIGT  1203
              FVLLLQYALP AM IG 
Sbjct  361   QFVLLLQYALPPAMNIGN  378



>gb|KCW76787.1| hypothetical protein EUGRSUZ_D01141 [Eucalyptus grandis]
Length=320

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 179/318 (56%), Positives = 230/318 (72%), Gaps = 17/318 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  LDLFVVALMPVLK L++TA+G +LA ERV++LG  ++ H+NNLVFY+F+P+L+AS L
Sbjct  1     MGVLDLFVVALMPVLKVLLVTAVGSLLAMERVNLLGRDAKQHVNNLVFYIFSPSLIASKL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT SS+V LWFMPVNILLTF IGSAL W+L+K+TR PR L  LVI CCAAGNLGNLL
Sbjct  61    ADTITLSSLVTLWFMPVNILLTFIIGSALAWVLIKLTRTPRHLQSLVIGCCAAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMN---  642
             LII+PAVC E NSPFGD +TCST G+AYASLSMAIGAVYIW Y+Y ++R     R     
Sbjct  121   LIILPAVCTETNSPFGDSSTCSTYGEAYASLSMAIGAVYIWCYVYPLMRISAEKRAEETD  180

Query  643   --------SSTDIMGSGFLDSCREALLSSHSLK------YDQDEEAQIVFEEEEKPSELK  780
                     ++ +++  G  +   E LL+S            +DE  Q  FE + K   LK
Sbjct  181   PKDSTASLNADEVISGGLPEIITEPLLASEDSPSPMDCISQEDEICQTRFEGKTKILCLK  240

Query  781   RLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLG  960
             ++RQ++    + I++K +FAPSTIA I+G +IGV S +RKLII D+APL VI ++ D+LG
Sbjct  241   KIRQHITTITEHIDIKKLFAPSTIAVIIGFIIGVASPIRKLIIGDDAPLRVIYNATDLLG  300

Query  961   DAAIPAMTLIVGANLLRG  1014
             +AAIP +TLI+GANLLRG
Sbjct  301   EAAIPCITLIIGANLLRG  318



>ref|XP_006435463.1| hypothetical protein CICLE_v10001325mg [Citrus clementina]
 gb|ESR48703.1| hypothetical protein CICLE_v10001325mg [Citrus clementina]
Length=338

 Score =   299 bits (766),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 237/343 (69%), Gaps = 19/343 (6%)
 Frame = +1

Query  334   MPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiIPAVCEERNSP  513
             MP N+L+TF +GS LGWI+V+ TR P  L GL++ CCAAGNLGN+ LIIIPAVC+E+ SP
Sbjct  1     MPFNVLITFLVGSILGWIVVQFTRPPSHLRGLIVGCCAAGNLGNMPLIIIPAVCKEKGSP  60

Query  514   FGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT-----------PRMNSSTD--  654
             FG P TC T G AYASLSMA+GA+Y+W+Y+YNI+RA  T           P   S  D  
Sbjct  61    FGSPDTCQTYGLAYASLSMAVGAIYLWSYVYNIVRASSTGISRESRTIDEPFSKSVADGS  120

Query  655   IMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKMM  834
             I G+G   SC E LLSS       D+ A      E K S    ++Q VK++  KINLK M
Sbjct  121   ISGTG---SCSEPLLSSKEFLTPADQLALPCTISEVKGSY--SMKQQVKLFFAKINLKSM  175

Query  835   FAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLRG  1014
             FAPSTI  + G +IG+V   RK +I D+APL VI  SA ++GD AIP +TL+VG NLLRG
Sbjct  176   FAPSTIGALAGFIIGLVPLFRKSMIGDSAPLRVIQDSASLIGDGAIPTVTLVVGGNLLRG  235

Query  1015  LKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDS-LYHFVLLLQYALPSAM  1191
             L+ S I   +V G+ V R+V LPL GI ++  A  FG+V SD  LY F+LLLQ+A+P AM
Sbjct  236   LRGSGIQKSIVFGIVVARYVALPLVGIVIVKGAVRFGFVCSDDLLYQFILLLQFAMPPAM  295

Query  1192  GIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              IGTITQLF  GESECSVIMLW Y++AS+++TLW+T+F+W++S
Sbjct  296   NIGTITQLFGAGESECSVIMLWTYALASVSITLWSTFFLWLVS  338



>ref|XP_002462580.1| hypothetical protein SORBIDRAFT_02g028520 [Sorghum bicolor]
 gb|EER99101.1| hypothetical protein SORBIDRAFT_02g028520 [Sorghum bicolor]
Length=414

 Score =   302 bits (773),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 192/416 (46%), Positives = 270/416 (65%), Gaps = 15/416 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  ++LF  A +PV   L+IT +G  LA +   IL   +R +LNN+VFYVF P+LVA  L
Sbjct  1     MGLIELFATACVPVFNMLLITGVGSFLATDFAGILSKEARKYLNNIVFYVFNPSLVAIYL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+ KLWFMPVNILL F  G   GWI+VK+TRAP +L GL++ CC+AGNLGN+ 
Sbjct  61    AKTITMESLAKLWFMPVNILLAFIFGLFFGWIVVKVTRAPAKLKGLILGCCSAGNLGNIF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT------P  633
             LIIIPA+C+E+ SPFG P  C   G AY+SLS+AIGAV++W+ +YNI+            
Sbjct  121   LIIIPALCKEKGSPFGAPDVCQDIGLAYSSLSLAIGAVFLWSIVYNIVHVTSNVTEGDDS  180

Query  634   RMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQI------VFEEEEKPSELKRLRQN  795
                + T ++ SG  ++       + S   D  +E  +      +   ++K   L R  + 
Sbjct  181   AQTNETKVLNSG--NATGAIAEENCSTSNDCTDECALPLISTSIRPIKDKEPMLGRGWKF  238

Query  796   VKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIP  975
             +   +  ++LK +FAPSTIA IVG +IG    +R  II ++APL V+  S++++G  AIP
Sbjct  239   LSSISKTVDLKKLFAPSTIAVIVGFIIGGTPLIRNAIIGESAPLRVLQESSELIGGGAIP  298

Query  976   AMTLIVGANLLRGLKKSA-IggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYH  1152
             ++TLI+GANLL G++  A +   V+ GV VVR++LLPL G  ++  A   G +  D LY 
Sbjct  299   SVTLIMGANLLNGVQGGASVPPSVIAGVIVVRYILLPLLGTALVKGAVWLGLIQPDPLYQ  358

Query  1153  FVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             F+L LQYA+P AM IGTI QLF VGESECSVI +W Y++AS+A+T+W+ +FMW+LS
Sbjct  359   FILHLQYAVPPAMNIGTIMQLFGVGESECSVIFVWVYALASVAVTIWSAFFMWMLS  414



>ref|XP_009112263.1| PREDICTED: uncharacterized transporter YBR287W [Brassica rapa]
Length=393

 Score =   301 bits (770),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 176/408 (43%), Positives = 267/408 (65%), Gaps = 20/408 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+L  VA MP+++ L+I+ +G  LA +   +L A +R  +N LVF VFTP ++ ++L
Sbjct  1     MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMP+N+ +TF +G  LGW++VK+     +LHGL+I+ CA+GN+GNL+
Sbjct  61    AQTVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +I++PA+C+E  SPFG+ + C + G +YAS SMA+G  YIWTY Y ++R+       S+T
Sbjct  121   IILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFYIWTYSYQLVRS-------SAT  173

Query  652   DIMGSGFLDSCREALLSSHS----LKYDQDEEAQIVFEEEEKPSE-LKRLRQNVKMWADK  816
                  G + S  + + S       LK  Q+++ +I  +E+   S  +K L   +      
Sbjct  174   QFKALGLVKSANKDMDSDDPRSLLLKPQQNQDLEIQVKEKVSTSTYIKDLLHQI------  227

Query  817   INLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVG  996
               L+ +FAP T+  I+G + G  ++LR LII +NAPL VI  S  +LGD  IP +TLI+G
Sbjct  228   --LEELFAPPTVGAILGFIFGATNWLRNLIIGENAPLRVIQDSVKLLGDGTIPCITLILG  285

Query  997   ANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYA  1176
              NL++GL+ SA+   V++GV  VR+++LP+ G+GV+ LA   G++  D L+ +VL+LQ+ 
Sbjct  286   GNLIQGLRSSAVKTSVIVGVICVRYIILPVVGVGVVQLAWSLGYLPPDPLFRYVLMLQFT  345

Query  1177  LPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LP AM I T+ QLF+V + ECSVI LW Y VASLALT+W+T F+ ILS
Sbjct  346   LPPAMNISTMAQLFDVAQDECSVIFLWTYLVASLALTMWSTIFLSILS  393



>emb|CDY18579.1| BnaA09g08160D [Brassica napus]
Length=394

 Score =   301 bits (770),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 178/408 (44%), Positives = 270/408 (66%), Gaps = 19/408 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+L  VA MP+++ L+I+ +G  LA +   +L A +R  +N LVF VFTP ++ ++L
Sbjct  1     MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMP+N+ +TF +G  LGW++VK+     +LHGL+I+ CA+GN+GNL+
Sbjct  61    AQTVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +I++PA+C+E  SPFG+ + C + G +YAS SMA+G  YIWTY Y ++R+       S+T
Sbjct  121   IILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFYIWTYSYQLVRS-------SAT  173

Query  652   DIMGSGFLDSCREALLSSHS-----LKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADK  816
                  G + S  + + S        LK  Q+++ +I  + +EK S     R  +K    +
Sbjct  174   QFKALGLVKSANKDMDSDDPRSLLLLKPQQNQDLEI--QVKEKVST----RTYIKDLLHQ  227

Query  817   INLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVG  996
             I L+ +FAP T+  I+G + G  ++LR LII +NAPL VI  S  +LGD  IP +TLI+G
Sbjct  228   I-LEELFAPPTVGAILGFIFGATNWLRNLIIGENAPLRVIQDSVKLLGDGTIPCITLILG  286

Query  997   ANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYA  1176
              NL++GL+ SA+   V++GV  VR+++LP+ G+GV+ LA   G++ +D L+ +VL+LQ+ 
Sbjct  287   GNLIQGLRSSAVKTSVIVGVICVRYIILPVVGVGVVQLAWSLGYLPADPLFRYVLMLQFT  346

Query  1177  LPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LP AM I T+ QLF+V + ECSVI LW Y VASLALT+W+T F+ ILS
Sbjct  347   LPPAMNISTMAQLFDVAQDECSVIFLWTYLVASLALTMWSTIFLSILS  394



>ref|NP_177779.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 gb|AAG51958.1|AC015450_19 unknown protein; 54709-56576 [Arabidopsis thaliana]
 gb|AEE35856.1| auxin efflux carrier family protein [Arabidopsis thaliana]
Length=415

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 192/426 (45%), Positives = 277/426 (65%), Gaps = 34/426 (8%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L+LF+ +  PV++TL+IT++G  LA + V++LG  +R HLNN+VFYVF+P+L+ S L
Sbjct  1     MKLLELFIASSKPVVETLLITSVGFYLALDTVNLLGHDARKHLNNIVFYVFSPSLIGSRL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +++T  S+VK+WFMPVN+LLTF IGS LGWI++ IT+ P +L GL+ISCCA+GNLG + 
Sbjct  61    ADSVTYESLVKMWFMPVNVLLTFMIGSLLGWIVIVITKPPSQLRGLIISCCASGNLGTMP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIY---------------  606
             LIIIPA+C+E+  PFGD  +C   G  Y +LSM   A +I  Y +               
Sbjct  121   LIIIPAICKEKGGPFGDSESCEKYGMGYVTLSMT--AFFISVYKHDTNWYVSGGNGLLMD  178

Query  607   ---NIIRAYGTPRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSEL  777
                N++R      + + T  + S + DSC+  L+SS   + ++D      +EE       
Sbjct  179   LYINLMRVLSNSPVETHTHSIESNYDDSCKVQLISSKEEEKEEDNHQVGRWEE-------  231

Query  778   KRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADML  957
               ++Q V   + K+NL  +FAP+TIA I+ +VIG+++ LR LII   AP  VI  S  +L
Sbjct  232   --VKQRVVSLSKKVNLGSIFAPATIAAIIALVIGLITPLRNLIIGTVAPFRVIQDSLTLL  289

Query  958   GDAAIPAMTLIVGANLLRGLKKSAIggwvvig-----vqvvrfvLLPLCGIGVITLARHF  1122
             GD AIPAMTLI+G NLL+G+++S +    +       V V R++LLP+ G+ ++  A   
Sbjct  290   GDGAIPAMTLILGGNLLKGMRRSEVRSSEMKNSCIIGVLVARYILLPVSGVLLVRGAYKL  349

Query  1123  GWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTY  1302
               V S+ LY FVLLLQYA+P AM +GT TQLF  GESECSVIMLW YS+A+++LT+W T+
Sbjct  350   DLVTSEPLYQFVLLLQYAVPPAMNLGTKTQLFGAGESECSVIMLWTYSLAAVSLTVWPTF  409

Query  1303  FMWILS  1320
             FMW+++
Sbjct  410   FMWLVT  415



>ref|XP_010466350.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010444860.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010484705.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=395

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 180/406 (44%), Positives = 272/406 (67%), Gaps = 14/406 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+L  VA MP+++ L+I+ +G  LA +   +L A +R  +N LVF VFTP ++ ++L
Sbjct  1     MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMP+N+ +TF +G  LGW++VK+     +LHGL+I+ CA+GN+GNL+
Sbjct  61    AQTVTLQDIISWWFMPINVGITFLVGGILGWLMVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI++PA+C+E  SPFG+ + C + G +YAS SMA+G  YIWTY Y ++R+  T       
Sbjct  121   LILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFYIWTYSYQLVRSSAT----QFK  176

Query  652   DIMGSGFLDSCREALLSSHS---LKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN  822
              +  +G + S  + + S  +   LK  Q+++ +I  + ++K S     R  +K    +I 
Sbjct  177   ALAAAGMVKSPNKDIDSDPNTLLLKPHQNQDLEI--QGKQKVST----RTYIKDLLHQI-  229

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
             L+ +FAP TI  I+G V G  ++LR LII +NAPL VI  S  +LGD  IP +TLI+G N
Sbjct  230   LEELFAPPTIGAILGFVFGATNWLRNLIIGENAPLRVIQDSVKLLGDGTIPCITLILGGN  289

Query  1003  LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALP  1182
             L++GL+ SA+   V++GV  VR+++LP+ G+GV+ LA + G++  D L+ +VL+LQ+ LP
Sbjct  290   LIQGLRSSAVKTSVIVGVICVRYLILPVVGVGVVQLAGNLGYLPPDPLFRYVLMLQFTLP  349

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              AM I T+TQLF+V + ECSVI LW Y VASLALT+W+T F+ ILS
Sbjct  350   PAMNISTMTQLFDVAQDECSVIFLWTYLVASLALTVWSTIFLSILS  395



>ref|XP_006282359.1| hypothetical protein CARUB_v10028656mg [Capsella rubella]
 gb|EOA15257.1| hypothetical protein CARUB_v10028656mg [Capsella rubella]
Length=395

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 180/407 (44%), Positives = 271/407 (67%), Gaps = 16/407 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+L  VA MP+++ L+I+ +G  LA +   +L A +R  +N LVF VFTP ++ ++L
Sbjct  1     MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMP+N+ +TF +G  LGW+LVK+     +LHGL+I+ CA+GN+GNL+
Sbjct  61    AQTVTLQDIISWWFMPINVGITFLVGGILGWLLVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI++PA+C+E  SPFG+ + C + G +YAS SMA+G  YIWTY Y ++R+  T       
Sbjct  121   LILVPAICDEEGSPFGNRSVCRSVGLSYASFSMALGGFYIWTYSYQLVRSSAT----QFK  176

Query  652   DIMGSGFLDSCREALLSS-HS--LKYDQDEEAQIVFEEE-EKPSELKRLRQNVKMWADKI  819
              +  +G + S  + + S  H+  LK  Q+++ +I  +++    S +K L   +       
Sbjct  177   ALPAAGLVKSPNKDIDSDPHTLLLKPHQNQDLEIQGKQKVSTSSYIKNLLHQI-------  229

Query  820   NLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGA  999
              L+ +FAP TI  I+G V G  ++LR LII +NAPL VI  S  +LGD  IP +TLI+G 
Sbjct  230   -LEELFAPPTIGAILGFVFGATNWLRNLIIGENAPLRVIQDSIKLLGDGTIPCITLILGG  288

Query  1000  NLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYAL  1179
             NL++GL+ SA+   V++GV  VR+++LP+ G+GV+ LA + G++ SD L+ +VL+LQ+ L
Sbjct  289   NLIQGLRSSAVKTSVIVGVTCVRYIILPVVGVGVVQLAGNLGYLPSDPLFRYVLMLQFTL  348

Query  1180  PSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             P AM I T+ QLF+V + ECSVI LW Y VASLALT+W+T F+ ILS
Sbjct  349   PPAMNISTMAQLFDVAQEECSVIFLWTYLVASLALTVWSTIFLSILS  395



>ref|XP_009798619.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Nicotiana sylvestris]
Length=350

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 178/354 (50%), Positives = 240/354 (68%), Gaps = 27/354 (8%)
 Frame = +1

Query  322   KLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiIPAVCEE  501
             KLWFMP+NIL TF IGS LGW +++ITR P+ L GLV+ CCAAGNLGN+LLIIIPAVC+E
Sbjct  3     KLWFMPINILFTFIIGSILGWAVIQITRPPQHLRGLVVGCCAAGNLGNMLLIIIPAVCKE  62

Query  502   RNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR----------------AYGTP  633
             + SPFGDP  C T G  YASLSMA+GA+Y+W+Y+YNI+R                A  +P
Sbjct  63    KGSPFGDPGICHTYGMGYASLSMAVGAIYLWSYVYNIVRISSSKSSKEVEINDSSASRSP  122

Query  634   RMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQI-----VFEEEEKPSELKRLRQNV  798
             R +S +       L +  E+LL S +    +    Q+      F+ + +     + +Q +
Sbjct  123   RESSISQ------LGTSTESLLPSKAFNGSESPPEQLELPSTRFDHKTQMQPGTKFKQYM  176

Query  799   KMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPA  978
             ++ + KINLK + APST   + G ++G++  +RKL+I D APLHVI+ +A +LGD AIP 
Sbjct  177   EIISRKINLKRLLAPSTTGALAGFIVGLIPQIRKLMIGDVAPLHVIEDTAILLGDGAIPL  236

Query  979   MTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFV  1158
             +TLI+G NLL+GL  S I   +++G+  VR++ LPL GI V+  A H G V  D LY FV
Sbjct  237   LTLIMGGNLLKGLTGSGIQKSLLVGIIGVRYIALPLIGIAVVKGAIHLGLVQHDPLYQFV  296

Query  1159  LLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LLLQ+ALP AM IGTITQLF  GESECSVIM W Y++AS++LTLWTT+FMW+++
Sbjct  297   LLLQFALPPAMNIGTITQLFGAGESECSVIMFWAYALASVSLTLWTTFFMWLVA  350



>ref|XP_009592449.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X3 
[Nicotiana tomentosiformis]
Length=350

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 178/354 (50%), Positives = 240/354 (68%), Gaps = 27/354 (8%)
 Frame = +1

Query  322   KLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiIPAVCEE  501
             KLWFMP+NIL TF IGS LGW +++ITR P+ L GLV+ CCAAGNLGN+LLIIIPAVC+E
Sbjct  3     KLWFMPLNILFTFIIGSILGWAVIQITRPPQHLRGLVVGCCAAGNLGNMLLIIIPAVCKE  62

Query  502   RNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR----------------AYGTP  633
             + SPFGDP  C T G  YASLSMA+GA+Y+W+Y+YNI+R                A  +P
Sbjct  63    KGSPFGDPGVCHTYGMGYASLSMAVGAIYLWSYVYNIVRISSSKSSKEVEINDSSASRSP  122

Query  634   RMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQI-----VFEEEEKPSELKRLRQNV  798
             R +S +       L +  E+LL S +    +    Q+      F+ + +     + +Q +
Sbjct  123   RESSISQ------LGTSTESLLPSKAFNGSESPPEQLELPSTRFDHKTQMQPGTKFKQYM  176

Query  799   KMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPA  978
             ++ + KINLK + APST   + G ++G++  +RKL+I D APLHVI+ +A +LGD AIP 
Sbjct  177   EIISRKINLKRLLAPSTTGALAGFIVGLIPQIRKLMIGDVAPLHVIEDTAILLGDGAIPL  236

Query  979   MTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFV  1158
             +TLI+G NLL+GL  S I   +++G+  VR++ LPL GI V+  A H G V  D LY FV
Sbjct  237   LTLIMGGNLLKGLTGSGIQKSLLVGIIGVRYIALPLIGIAVVKGAIHLGLVQHDPLYQFV  296

Query  1159  LLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LLLQ+ALP AM IGTITQLF  GESECSVIM W Y++AS++LTLWTT+FMW+++
Sbjct  297   LLLQFALPPAMNIGTITQLFGAGESECSVIMFWAYALASVSLTLWTTFFMWLVA  350



>gb|KFK28259.1| hypothetical protein AALP_AA8G493500 [Arabis alpina]
Length=395

 Score =   300 bits (767),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 180/406 (44%), Positives = 272/406 (67%), Gaps = 14/406 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+L  VA MP+++ L+I+ +G  LA +   +L A +R  +N LVF VFTP ++ S+L
Sbjct  1     MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFSNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMP+N+ +TF +G  LGW++VK+     +LHGL+I+ CA+GNLGNL+
Sbjct  61    AQTVTLQDIISWWFMPINVGITFLVGGILGWVVVKVLNPKPQLHGLIIATCASGNLGNLM  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI++PA+C+E  SPFG+ + C + G +YAS SMA+G  YIWTY Y ++R+  T       
Sbjct  121   LILVPAICDEEGSPFGNRSVCRSVGLSYASFSMALGGFYIWTYSYQLVRSSAT----QFK  176

Query  652   DIMGSGFLDSCREALLSSHS---LKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN  822
              +  +G + S  + + S      LK  Q+++ +I  + ++K S     R  +K    +I 
Sbjct  177   ALEAAGLVKSPNKDIDSDPRTLLLKPHQNQDLEI--QGKQKVST----RTYIKDLLHQI-  229

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
             L+ +FAP TI  I+G V G  ++LR LII +NAPL VI  S  +LG+  IP +TLI+G N
Sbjct  230   LEELFAPPTIGAILGFVFGATNWLRNLIIGENAPLRVIQDSVKLLGEGTIPCVTLILGGN  289

Query  1003  LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALP  1182
             L+ GL+ S++   V++GV  VR+++LP+ G+GV+ LA + G++ +D L+ +VL+LQ+ALP
Sbjct  290   LINGLRSSSVKISVIVGVICVRYIILPVVGVGVVQLAGNLGYLPADPLFRYVLMLQFALP  349

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              AM I T+TQLF+V + ECSVI LW Y +ASLALT+W+T F+ ILS
Sbjct  350   PAMNISTMTQLFDVAQDECSVIFLWTYLIASLALTIWSTIFLSILS  395



>ref|XP_010681118.1| PREDICTED: uncharacterized protein LOC104896113 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=374

 Score =   298 bits (764),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 189/406 (47%), Positives = 264/406 (65%), Gaps = 38/406 (9%)
 Frame = +1

Query  115   AFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSLG  294
             ++ +L  VA MPVLK L+ITA+GL LA  R+DILG +  +HLN +VF+VF PALV S+L 
Sbjct  3     SWFNLLFVASMPVLKVLLITALGLFLALNRIDILGEAVTNHLNKVVFFVFGPALVGSNLA  62

Query  295   ETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnlll  474
             +T+T  S + LWFM V IL+TF IGS +GW+L K+T+AP+ + GL+++ C+AGNLGNL +
Sbjct  63    KTVTFESFLTLWFMLVKILITFLIGSTMGWVLAKVTKAPKHIKGLILASCSAGNLGNLPI  122

Query  475   iiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSSTD  654
             II+PA+C+E+ S FG P  C   G AYASLSMAIG++Y W Y YNI+R            
Sbjct  123   IILPAICKEKGSRFGAPNICERYGLAYASLSMAIGSIYFWLYAYNIVR------------  170

Query  655   IMGSGFLDSCREALLSSHSLKYDQDEEAQI---VFEEEEKPSELKRLRQNVKMWADKINL  825
                           +SS  +K ++ E + +   V E E  P     L  ++      ++ 
Sbjct  171   --------------ISSKEVKANEGETSAMNVPVDEAEPNPP----LHSSIY----SLDA  208

Query  826   KMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANL  1005
               +   ST   IVG +IG++S  R++++ +N PLHVI  +  M+GDAAIP  TLI+GANL
Sbjct  209   PRLSNSSTKYVIVGFIIGMISPFRRVLMDNNGPLHVIGDTGFMIGDAAIPCTTLILGANL  268

Query  1006  LRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGS-DSLYHFVLLLQYALP  1182
             LRGLK S I    +IG+ VVR++ LPL GI ++  A   G+V S D  + FVLLLQY+LP
Sbjct  269   LRGLKGSGIQSTTIIGIIVVRYIFLPLLGILIVKGAVFAGFVQSHDIFFQFVLLLQYSLP  328

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              A+ IGT+T+LF  G++ECSVIMLW   +A + LTLW T+++W+LS
Sbjct  329   PAVSIGTVTELFGAGQNECSVIMLWTNVLAPVMLTLWCTFYLWLLS  374



>ref|XP_002306421.2| auxin efflux carrier family protein [Populus trichocarpa]
 ref|XP_006382977.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa]
 ref|XP_006382978.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa]
 ref|XP_006382979.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa]
 gb|EEE93417.2| auxin efflux carrier family protein [Populus trichocarpa]
 gb|ERP60774.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa]
 gb|ERP60775.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa]
 gb|ERP60776.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa]
Length=418

 Score =   300 bits (767),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 192/423 (45%), Positives = 263/423 (62%), Gaps = 25/423 (6%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF VA +P+++ L+I+  G ++A E +++L   +R  LN LVF VFTP+L+ +SL
Sbjct  1     MGFWTLFEVASLPIIQVLLISFFGALMATEYLNLLPKDARKSLNKLVFMVFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMPVNI LTF IG  LGWILVKI R    L GLVI+ C++GNLGNLL
Sbjct  61    AKTVTLEDIISWWFMPVNIGLTFLIGGILGWILVKILRPKPYLEGLVIATCSSGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PA+C E  SPFGD + C++ G +YAS SMA+G  +IWTY +++IR           
Sbjct  121   LIIVPAICTEDGSPFGDSSICTSVGLSYASFSMALGGFFIWTYTFHLIRTSAAKLKALQA  180

Query  652   DIMGSGFLDSCREALLSSH---------------SLKYDQDEEAQIVFEEEEKPSELKRL  786
              +  S   ++  +A   +H               S K  +D E+  +  +E +       
Sbjct  181   VVEASKAPNNDFDASQETHLLIGQDQENVAIGVASSKSAEDTESHAIVSQESEHG-----  235

Query  787   RQNVKMWADKIN-----LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSAD  951
             + NV  W   I      L+ +  P TIA I+G + G  +FLR LII   APL VI  S  
Sbjct  236   KGNVSSWTKLIGFLHQILEELLEPPTIAAILGFIFGATTFLRNLIIGSEAPLRVIQDSIK  295

Query  952   MLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWV  1131
             +LGD  IP +TLI+G NL  GL+ S I  W+V+GV  VR+++LP  G+ V+  A H G++
Sbjct  296   LLGDGTIPCITLILGGNLTEGLRASKIKSWIVVGVICVRYIILPAIGMWVVKAAGHLGFL  355

Query  1132  GSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMW  1311
              SD L+H+VL++QY LP AM IGT+TQLF+VG+ ECSV+ LW Y VA+LALT W+T FMW
Sbjct  356   PSDPLFHYVLMIQYTLPPAMNIGTMTQLFDVGQEECSVLFLWTYLVAALALTAWSTIFMW  415

Query  1312  ILS  1320
             ILS
Sbjct  416   ILS  418



>ref|XP_003548795.1| PREDICTED: uncharacterized protein LOC100804439 isoform X1 [Glycine 
max]
 ref|XP_006599262.1| PREDICTED: uncharacterized protein LOC100804439 isoform X2 [Glycine 
max]
Length=418

 Score =   299 bits (766),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 201/426 (47%), Positives = 288/426 (68%), Gaps = 34/426 (8%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDIL-GASSRHHLNNLVFYVFTPALVASS  288
             M F DLF VALMPVL+TL+IT +GL++A +R ++L    +R++LNNLVFY+FTPAL+ + 
Sbjct  1     MKFWDLFFVALMPVLETLLITLLGLLIATQRFNLLRSVEARNYLNNLVFYIFTPALLVAD  60

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L ETIT + +V++WF+ VNI LT  +GS LGW+L KI + P+ L GLV  CC AGNLGN+
Sbjct  61    LAETITFNRLVEMWFLLVNIFLTLVVGSILGWMLNKIAKTPKHLRGLVNGCCTAGNLGNM  120

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPR----  636
             LLII+PAVCE+ +S FGD +TCST G+AYA+ S  +G V+IWTY++ I+    T +    
Sbjct  121   LLIIVPAVCEQSSSIFGDSSTCSTYGQAYAAFSTGVGTVFIWTYLF-IVMDTSTDKSTKK  179

Query  637   -MNSSTDIMGSGFLD----SCREALLSS--------------HSLKYDQDEEAQIVFEEE  759
              +NS + I  +G L+    +  E+LL+S              H L YD +          
Sbjct  180   EINSDSVICSAGTLERFPPNITESLLTSTDSVSIDDLSIQPDHELPYDNNGR--------  231

Query  760   EKPSELKRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVID  939
              K   L  +  ++      + ++ +F PSTIA I+G  IG +S ++KL++ D+AP  VI 
Sbjct  232   -KTPILDNITSSITKCMGYVKVETVFTPSTIAVIIGFAIGAISPIKKLVVGDSAPFRVII  290

Query  940   SSADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARH  1119
             SSA ++G+A I +MTL+VGANLL GLKKS I  +++IG+ VVRF++ P+ GI ++  A +
Sbjct  291   SSASLVGEATIVSMTLVVGANLLNGLKKSGISIFLIIGIMVVRFIISPILGILIVKAAYY  350

Query  1120  FGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTT  1299
             +G++GS SLY FVL+LQYALP A  +GT+ Q+   GESECS+IM+W Y +A+ +LTLW T
Sbjct  351   WGFIGSYSLYQFVLMLQYALPPATIVGTVAQMLGNGESECSLIMIWTYFIATFSLTLWCT  410

Query  1300  YFMWIL  1317
             +FMW+L
Sbjct  411   FFMWML  416



>emb|CDX81425.1| BnaC09g08360D [Brassica napus]
Length=393

 Score =   298 bits (764),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 176/403 (44%), Positives = 264/403 (66%), Gaps = 10/403 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+L  VA MP+++ L+I+ +G  LA +   +L A +R  +N LVF VFTP ++ ++L
Sbjct  1     MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMP+N+ +TF +G  LGW++VK+     +LHGL+I+ CA+GN+GNL+
Sbjct  61    AQTVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +I++PA+C+E  SPFG+ + C + G +YAS SMA+G  YIWTY Y ++R+  T       
Sbjct  121   IILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFYIWTYSYQLVRSSATQFRALGL  180

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKM  831
                 +  +DS   +LL     + +QD E Q V E+    + +K L   +        L+ 
Sbjct  181   VKSANKDMDSDPRSLLLPKP-QQNQDLEIQ-VKEKVSTQTYIKDLLHQI--------LEE  230

Query  832   MFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLR  1011
             +FAP T+  I+G + G  ++LR LII +NAPL VI  S  +LGD  IP +TLI+G NL++
Sbjct  231   LFAPPTVGAILGFIFGATNWLRNLIIGENAPLRVIQDSVKLLGDGTIPCITLILGGNLIQ  290

Query  1012  GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAM  1191
             GL+ SA+   V++GV  VR+++LP+ G+GV+ LA   G++  D L+ +VL+LQ+ LP AM
Sbjct  291   GLRSSAVKTSVIVGVICVRYIILPVVGVGVVQLAWSLGYLPPDPLFRYVLMLQFTLPPAM  350

Query  1192  GIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              I T+ QLF+V + ECSVI LW Y VASLALT+W+T F+ ILS
Sbjct  351   NISTMAQLFDVAQDECSVIFLWTYLVASLALTMWSTIFLSILS  393



>emb|CDY57767.1| BnaC02g45080D [Brassica napus]
Length=395

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 178/407 (44%), Positives = 268/407 (66%), Gaps = 16/407 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+L  VA MP+++ L+I+ +G  LA +   +L A +R  +N LVF VFTP ++ ++L
Sbjct  1     MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMP+N+ +TF +G  LGW++VK+     +LHGL+I+ CA+GN+GNL+
Sbjct  61    AQTVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI++PA+C+E  SPFG+ + C + G +YAS SMA+G  YIWTY Y ++R+  T       
Sbjct  121   LILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFYIWTYSYQLVRSSAT----QFR  176

Query  652   DIMGSGFLDSCREALLSSHS---LKYDQDEEAQI-VFEEEEKPSELKRLRQNVKMWADKI  819
              +  +G + S  + + S      LK  Q+++ +I V E+    + +K L   +       
Sbjct  177   ALEAAGLVKSPNKEIDSDPRTLLLKPQQNQDLEIQVKEKVSTGTYIKDLLHQI-------  229

Query  820   NLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGA  999
              L+ +FAP TI  I+G V G  ++LR LII +NAPL VI  S  +LGD  IP +TLI+G 
Sbjct  230   -LEELFAPPTIGAILGFVFGATNWLRNLIIGENAPLRVIQDSVKLLGDGTIPCITLILGG  288

Query  1000  NLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYAL  1179
             NL++GL+ SA+   V++GV  VR+++LP+ G+GV+ LA + G++  D L+ +VL+LQ+ L
Sbjct  289   NLIQGLRSSAVKTSVIVGVICVRYIILPVVGVGVVQLAWNLGYLPPDPLFRYVLMLQFTL  348

Query  1180  PSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             P AM I T+ QLF+V + ECSVI LW Y VASLALT+W+T F+ ILS
Sbjct  349   PPAMNISTMAQLFDVAQDECSVIFLWTYLVASLALTVWSTIFLSILS  395



>ref|XP_006393787.1| hypothetical protein EUTSA_v10005581mg [Eutrema salsugineum]
 gb|ESQ31073.1| hypothetical protein EUTSA_v10005581mg [Eutrema salsugineum]
Length=395

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 180/406 (44%), Positives = 273/406 (67%), Gaps = 14/406 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+L  VA MP+++ L+I+ +G  LA +   +L A +R  +N LVF VFTP ++ ++L
Sbjct  1     MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMP+N+ +TF +G  LGW++VK+     +LHGL+I+ CA+GN+GNL+
Sbjct  61    AQTVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP-RMNSS  648
             LI++PA+C+E  SPFG+ + C + G +YAS SMA+G  YIWTY Y ++R+  T  +  ++
Sbjct  121   LILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFYIWTYSYQLVRSSATQFKALAA  180

Query  649   TDIMGS--GFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN  822
             T ++ +    +DS    LL    LK  Q+++ +I  + ++K S     R  +K    +I 
Sbjct  181   TGVVKTPNKDIDSDPHTLL----LKPQQNQDLEI--QVKQKVST----RTYIKDLLHQI-  229

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
             L+ +FAP TI  I+G   G  ++LR LII +NAPL VI  S  +LGD  IP +TLI+G N
Sbjct  230   LEELFAPPTIGAILGFAFGATNWLRNLIIGENAPLRVIQDSVKLLGDGTIPCITLILGGN  289

Query  1003  LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALP  1182
             L++GL+ SA+   V++GV  VR+++LP+ G+GV+ LA + G++  D L+ +VL+LQ+ LP
Sbjct  290   LIQGLRSSAVKTSVIVGVICVRYIILPVVGVGVVQLAWNLGYLPPDPLFRYVLMLQFTLP  349

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              AM I T+ QLF+V + ECSVI LW Y VASLALT+W+T F+ ILS
Sbjct  350   PAMNISTMAQLFDVAQDECSVIFLWTYLVASLALTVWSTIFLSILS  395



>ref|XP_002866780.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43039.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=395

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 177/407 (43%), Positives = 266/407 (65%), Gaps = 16/407 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+L  VA MP+++ L+I+ +G  LA +   +L A +R  +N LVF VFTP ++ ++L
Sbjct  1     MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ET+T   I+  WFMP+N+ +TF +G  LGW++VK+     +LHGL+I+ CA+GN+GNL+
Sbjct  61    AETVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI++PA+C+E  SPFG+ + C + G +YAS SMA+G  YIWTY Y ++R+  T       
Sbjct  121   LILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFYIWTYSYQLVRSSAT----QFR  176

Query  652   DIMGSGFLDSCREALLSS-HSLKYDQDEEAQIVFEEEEKPSE---LKRLRQNVKMWADKI  819
              +  +G + S  + + S  H+L     +   +  + ++K S    +K L   +       
Sbjct  177   ALEAAGLVKSPNKDIDSDPHTLLLKPHQNQDLEIQGKQKVSTGTYIKDLLHQI-------  229

Query  820   NLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGA  999
              L+ +FAP TI  I+G V G  ++LR LII +NAPL VI  S  +LGD  IP +TLI+G 
Sbjct  230   -LEELFAPPTIGAILGFVFGATNWLRNLIIGENAPLRVIQDSVKLLGDGTIPCITLILGG  288

Query  1000  NLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYAL  1179
             NL++GL+ SA+   V++GV  VR+++LP+ G+GV+ LA + G++  D L+ +VL+LQ+ L
Sbjct  289   NLIQGLRSSAVKTSVIMGVICVRYIILPVVGVGVVQLAGNLGYLPPDPLFRYVLMLQFTL  348

Query  1180  PSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             P AM I T+ QLF+V + ECSVI LW Y VASLALT+W+T F+ ILS
Sbjct  349   PPAMNISTMAQLFDVAQDECSVIFLWTYLVASLALTIWSTIFLSILS  395



>emb|CDY55102.1| BnaA02g34870D [Brassica napus]
Length=395

 Score =   296 bits (759),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 181/407 (44%), Positives = 269/407 (66%), Gaps = 16/407 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+L  VA MP+++ L+I+ +G  LA +   +L A +R  +N LVF VFTP ++ ++L
Sbjct  1     MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMP+N+ +TF +G  LGW++VK+     +LHGL+I+ CA+GN+GNL+
Sbjct  61    AQTVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP-RMNSS  648
             LI++PA+C+E  SPFG+ + C + G +YAS SMA+G  YIWTY Y ++R+  T  R   +
Sbjct  121   LILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFYIWTYSYQLVRSSATQFRALEA  180

Query  649   TDIMGS--GFLDSCREALLSSHSLKYDQDEEAQI-VFEEEEKPSELKRLRQNVKMWADKI  819
               +  S    +DS    LL    LK  Q+++ +I V E+    + +K L   +       
Sbjct  181   AGLAKSPNKEIDSDPRTLL----LKPQQNQDLEIQVKEKVSTGTYIKDLLHQI-------  229

Query  820   NLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGA  999
              L+ +FAP TI  I+G V G  ++LR LII +NAPL VI  S  +LGD  IP +TLI+G 
Sbjct  230   -LEELFAPPTIGAILGFVFGATNWLRNLIIGENAPLRVIQDSVKLLGDGTIPCITLILGG  288

Query  1000  NLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYAL  1179
             NL++GL+ SA+   V++GV  VR+++LP+ G+GV+ LA + G++  D L+ +VL+LQ+ L
Sbjct  289   NLIQGLRSSAVKTSVIVGVICVRYIILPVVGVGVVQLAWNLGYLPPDPLFRYVLMLQFTL  348

Query  1180  PSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             P AM I T+ QLF+V + ECSVI LW Y VASLALT+W+T F+ ILS
Sbjct  349   PPAMNISTMAQLFDVAQDECSVIFLWTYLVASLALTVWSTIFLSILS  395



>ref|XP_006409300.1| hypothetical protein EUTSA_v10022717mg [Eutrema salsugineum]
 gb|ESQ50753.1| hypothetical protein EUTSA_v10022717mg [Eutrema salsugineum]
Length=397

 Score =   296 bits (759),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 169/409 (41%), Positives = 262/409 (64%), Gaps = 20/409 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  L  VA MPV++ LII+ +G  LA +R  +    +R+ +N +VF +F PAL+ ++L
Sbjct  1     MGFFSLLEVASMPVIQVLIISLVGAFLATDRCKLFPVEARNSMNKVVFVIFAPALMFANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   ++  WFMPVN+ LTF IG  LGW++VKI + P  L GL+++  ++GN+GNL 
Sbjct  61    AQTVTLQDMISWWFMPVNMGLTFLIGGILGWMVVKILKPPPYLEGLIVATSSSGNMGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +I++PA+C+E  SPFG+ + C T G +YAS SMA+G  YIWTY + +I+       +   
Sbjct  121   IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFYIWTYTFRLIKGSAMKLRD---  177

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVF--EEEEKPSELKRLRQNVKMWADKIN-  822
                    ++   +A + S +   + D + Q++    +++K S +K   +    W   ++ 
Sbjct  178   -------IEESEKATIKSSNSDLEADHKTQLLLGASQDKKTSVVK---EETGFWRKGVDL  227

Query  823   ----LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLI  990
                 L+ + AP T+  IVG   G V +LR LII D+APL +I  +A +LGD  IP MT+I
Sbjct  228   VHEILEELLAPPTLGAIVGFFFGAVKWLRNLIIGDDAPLRIIQGTAKLLGDGTIPCMTII  287

Query  991   VGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQ  1170
             +G NL++GL+ SA+   VV+G+  VR+++LP+ GIGV+  A  FG++  D L+ +VL+LQ
Sbjct  288   LGGNLIQGLRSSAVKPVVVLGIVCVRYIILPIIGIGVVKTAESFGFLPQDPLFQYVLMLQ  347

Query  1171  YALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             + LP AM IGT+TQL+ VG+ ECSV+MLW Y +A LALT+W+T F+ +L
Sbjct  348   FTLPPAMNIGTMTQLYNVGQDECSVLMLWTYLIAILALTVWSTIFLHLL  396



>ref|XP_006302565.1| hypothetical protein CARUB_v10020672mg [Capsella rubella]
 gb|EOA35463.1| hypothetical protein CARUB_v10020672mg [Capsella rubella]
Length=318

 Score =   293 bits (751),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 169/332 (51%), Positives = 234/332 (70%), Gaps = 14/332 (4%)
 Frame = +1

Query  325   LWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiIPAVCEER  504
             +WFMPVN+L TF IGS LGWI+V IT+ PR L GL++  CAAGNLGNL LII+PAVC+E+
Sbjct  1     MWFMPVNVLFTFMIGSLLGWIVVVITKPPRHLRGLIVGSCAAGNLGNLPLIIVPAVCKEK  60

Query  505   NSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSSTDIMGSGFLDSC  684
               PFGDP +C   G  Y SLSMA+G++YIWTY+YN++R   +P +     +      DSC
Sbjct  61    GGPFGDPESCEKYGMGYVSLSMAMGSIYIWTYMYNLMRVLSSPPVEIPQSLESD--YDSC  118

Query  685   REALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKMMFAPStiativ  864
             +  L+SS        EE     E+  K    +++++ +   ++K+NL+ +FAPSTIA ++
Sbjct  119   KVPLISSK-------EE-----EDNNKVGRWEKVKRRLVSLSEKVNLRTIFAPSTIAAMI  166

Query  865   givigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLRGLKKSAIggwv  1044
              +VIG+++ LRKLII   APL V+  S  ++GD AIPAMTLI+G NLL+G+K S +    
Sbjct  167   ALVIGLITPLRKLIIGTEAPLRVLQDSVTLVGDGAIPAMTLIIGGNLLKGIKSSGMKMSS  226

Query  1045  vigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEV  1224
             +IGV V R++LLP+CG+ ++  A     + S+ LY FVLLLQYA+P AM +GTITQLF  
Sbjct  227   IIGVLVARYILLPMCGVLIVRGAYKLDLITSEPLYQFVLLLQYAVPPAMNLGTITQLFGT  286

Query  1225  GESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             GESECSVIMLW YS+AS++LT+W T+FMW+++
Sbjct  287   GESECSVIMLWTYSLASISLTVWPTFFMWLVA  318



>ref|XP_009759349.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X1 
[Nicotiana sylvestris]
Length=415

 Score =   297 bits (760),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 187/423 (44%), Positives = 265/423 (63%), Gaps = 28/423 (7%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  L  VA MP+L+ LII+ +G V+A + + +L A +R  LN +VF  FTP+L+ +SL
Sbjct  1     MGFWTLLEVASMPILQVLIISVLGAVMATDYLKLLPADARKSLNKIVFVAFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              E++T   I+  WFMPVN+ LTF  G  LGWI VKI +    L GL+I+ C++GNLGNLL
Sbjct  61    AESVTFQDIISWWFMPVNVGLTFLFGGILGWIAVKILKPKPHLEGLIIATCSSGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR-----------  618
             LI+IPA+C+E  SPFGD   C++ G +YAS SMA+G  YIWTY Y +IR           
Sbjct  121   LIVIPAICKEDGSPFGDHRVCASVGLSYASFSMALGGFYIWTYTYQLIRSSSLKFKALKA  180

Query  619   ----AYGTPRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRL  786
                 A+  P  +  T+   S  LD+  +  L     K  +++  +     +    ELK+ 
Sbjct  181   AEEEAFKEPNKDLDTN-EKSYLLDNNAQDHLPVSVTKSTENQTQKAC---KAADMELKK-  235

Query  787   RQNVKMWADKIN-----LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSAD  951
                V  W+  +      L+ + AP T+  IVG + G V++L+ L+I D APL VI  S  
Sbjct  236   ---VSTWSKIVGVLHTFLEELTAPPTLGAIVGFLFGSVTWLKNLVIGDAAPLRVIQDSVK  292

Query  952   MLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWV  1131
             +LGD  IP +TLI+G NL +GL+K+ +   ++I V  VRF+L PL GIG++  A + G++
Sbjct  293   LLGDGTIPCITLILGGNLTQGLRKAQVKPLIIIAVVSVRFILSPLIGIGIVKAAANLGFL  352

Query  1132  GSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMW  1311
              +D LYHFVL+LQY +P AM IGT+TQLF+V + ECSV+ +W Y VA+LALT+W+T FMW
Sbjct  353   PADPLYHFVLMLQYTVPPAMNIGTMTQLFDVAQEECSVLFMWTYLVAALALTIWSTVFMW  412

Query  1312  ILS  1320
             +LS
Sbjct  413   LLS  415



>ref|XP_009759350.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X2 
[Nicotiana sylvestris]
Length=414

 Score =   296 bits (759),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 184/417 (44%), Positives = 264/417 (63%), Gaps = 17/417 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  L  VA MP+L+ LII+ +G V+A + + +L A +R  LN +VF  FTP+L+ +SL
Sbjct  1     MGFWTLLEVASMPILQVLIISVLGAVMATDYLKLLPADARKSLNKIVFVAFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              E++T   I+  WFMPVN+ LTF  G  LGWI VKI +    L GL+I+ C++GNLGNLL
Sbjct  61    AESVTFQDIISWWFMPVNVGLTFLFGGILGWIAVKILKPKPHLEGLIIATCSSGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI+IPA+C+E  SPFGD   C++ G +YAS SMA+G  YIWTY Y +IR+  + +  +  
Sbjct  121   LIVIPAICKEDGSPFGDHRVCASVGLSYASFSMALGGFYIWTYTYQLIRS-SSLKFKALK  179

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVF--------EEEEKPSELKRLR-QNVKM  804
                   F +  ++  L ++   Y  D  AQ           E + K  +   +  + V  
Sbjct  180   AAEEEAFKEPNKD--LDTNEKSYLLDNNAQDHLPVSVTKSTENQTKACKAADMELKKVST  237

Query  805   WADKIN-----LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAA  969
             W+  +      L+ + AP T+  IVG + G V++L+ L+I D APL VI  S  +LGD  
Sbjct  238   WSKIVGVLHTFLEELTAPPTLGAIVGFLFGSVTWLKNLVIGDAAPLRVIQDSVKLLGDGT  297

Query  970   IPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLY  1149
             IP +TLI+G NL +GL+K+ +   ++I V  VRF+L PL GIG++  A + G++ +D LY
Sbjct  298   IPCITLILGGNLTQGLRKAQVKPLIIIAVVSVRFILSPLIGIGIVKAAANLGFLPADPLY  357

Query  1150  HFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             HFVL+LQY +P AM IGT+TQLF+V + ECSV+ +W Y VA+LALT+W+T FMW+LS
Sbjct  358   HFVLMLQYTVPPAMNIGTMTQLFDVAQEECSVLFMWTYLVAALALTIWSTVFMWLLS  414



>ref|XP_003612434.1| Auxin efflux carrier protein [Medicago truncatula]
 gb|AES95392.1| auxin efflux carrier family protein [Medicago truncatula]
Length=353

 Score =   294 bits (753),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 242/346 (70%), Gaps = 14/346 (4%)
 Frame = +1

Query  325   LWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiIPAVCEER  504
             +WFMPVNIL+TF +GSALGWI++K+T+ PR + GL++  C+AGNLGNL +IIIPA+C+++
Sbjct  8     MWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLPIIIIPAICKDK  67

Query  505   NSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT---PRMNSSTDIMGSGFL  675
              SPFGDP  C   G AYASLSMAIGAV+IWTY+YNI+R          N S+D +     
Sbjct  68    GSPFGDPDVCYQFGMAYASLSMAIGAVFIWTYVYNIMRISSRNVHKECNKSSDSITLEDS  127

Query  676   DSCREALLSSHSLKY------DQDEEAQIVFEEEEKPSELK-----RLRQNVKMWADKIN  822
                 ++++   S  Y      + D+   ++  + E   ++K     +++    M     N
Sbjct  128   RDVSQSIIEEGSENYTSPTKGNVDDAYTLLLSKNESEQKIKVPVFDKIKHKFGMILGNPN  187

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
              + +F+P+T+  IVG ++GVV +LR+L+I  NAPLHVI+ SA MLGDAAIP +TLI+GAN
Sbjct  188   FRGIFSPATLGAIVGFIVGVVPWLRRLMIGSNAPLHVIEDSASMLGDAAIPTITLIMGAN  247

Query  1003  LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALP  1182
             LLRGLK ++   W +IG+ VVR++LLP+ G+ +I  A H G V  D LY FVLLLQYALP
Sbjct  248   LLRGLKGASTPFWTIIGIIVVRYILLPIFGVLIIKGATHLGLVQIDPLYQFVLLLQYALP  307

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              AM IGTI QLF  GESECSV+MLW Y++AS+A+TLW+TYFMW++S
Sbjct  308   PAMNIGTIAQLFGAGESECSVMMLWTYALASIAVTLWSTYFMWLVS  353



>ref|XP_009607642.1| PREDICTED: uncharacterized transporter C5D6.04 [Nicotiana tomentosiformis]
 ref|XP_009607643.1| PREDICTED: uncharacterized transporter C5D6.04 [Nicotiana tomentosiformis]
Length=414

 Score =   296 bits (759),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 184/424 (43%), Positives = 264/424 (62%), Gaps = 31/424 (7%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  L  VA MP+L+ LII+ +G V+A + + +L A +R  LN +VF  FTP+L+ +SL
Sbjct  1     MGFWTLLEVASMPILQVLIISVLGAVMATDYLKLLPADARKSLNKIVFVAFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              E++T   I+  WFMPVN+ LTF  G  LGWI VKI +    L GL+I+ C++GNLGNLL
Sbjct  61    AESVTFQDIISWWFMPVNVGLTFLFGGILGWIAVKILKPKPHLEGLIIATCSSGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI+IPA+C+E  SPFGD   C++ G +YAS SMA+G  YIWTY Y +IR+       SS 
Sbjct  121   LIVIPAICKEDGSPFGDHRVCASVGLSYASFSMALGGFYIWTYTYQLIRS-------SSL  173

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIV---------------FEEEEKPSELKRL  786
                    L++  E      +   D +E++ ++                E + K  +   +
Sbjct  174   KFKA---LNAAEEEAFKEPNKDIDTNEKSYLLTNNAQDHLPVSVTKSIENQTKDCKAADM  230

Query  787   RQN-VKMWADKIN-----LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSA  948
               N V  W+  +      L+ + AP T+  IVG + G V++L+ L+I D APL VI  S 
Sbjct  231   EPNKVSTWSKIVGVLHTFLEELTAPPTLGAIVGFLFGSVTWLKNLVIGDAAPLRVIQDSV  290

Query  949   DMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGW  1128
              +LGD  IP +TLI+G NL +GL+K+ +   ++I V  VR++L PL GIG++  A + G+
Sbjct  291   KLLGDGTIPCITLILGGNLTQGLRKAQVKPLIIIAVLSVRYILSPLIGIGIVKAAANLGF  350

Query  1129  VGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFM  1308
             + +D LYHFVL+LQY +P AM IGT+TQLF+V + ECSV+ +W Y VA+LALT+W+T FM
Sbjct  351   LPADPLYHFVLMLQYTVPPAMNIGTMTQLFDVAQEECSVLFMWTYLVAALALTIWSTVFM  410

Query  1309  WILS  1320
             W+LS
Sbjct  411   WLLS  414



>ref|XP_007046465.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao]
 gb|EOX90622.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao]
Length=420

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 183/424 (43%), Positives = 264/424 (62%), Gaps = 25/424 (6%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M+F  LF VA MP+L+ LII+ +G  +A +   +L A +R  LN LVF VFTP+L+ +SL
Sbjct  1     MSFWTLFEVASMPILQVLIISVLGAFMATDHCKLLSADTRRSLNKLVFVVFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMPVNI +TF +G  +GWI+VKI R    L GL+I+ C++GNLGNLL
Sbjct  61    AKTVTLQDIISWWFMPVNIGITFLVGGIVGWIVVKILRPKPHLEGLIIATCSSGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP-RMNSS  648
             LI++PAVC E  SPFG+   CS+ G +YAS SMA+G  Y+WT  Y +++      +   +
Sbjct  121   LIVVPAVCNEDGSPFGNRNVCSSVGLSYASFSMALGGFYVWTITYQMVKTSAVKFKALEA  180

Query  649   TDIMGSGFLDSCREALLSSHSLK----YDQ-----------DEEAQIVFEEEEKPSELKR  783
              + + S   +   +A   SH LK     +Q           D E Q+   +E  P+E   
Sbjct  181   AEDLASKEPNKNLDATAESHLLKGKGHQEQVAITAATKSVADPEKQLNVSQETGPNE---  237

Query  784   LRQNVKMWADKIN-----LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSA  948
              +     W   +      L+ + AP T+  I+G + G  ++LR LII + APL VI  S 
Sbjct  238   -KGQASFWIKVVRFLHQILEELMAPPTLGAILGFIFGATTWLRNLIIGEGAPLRVIQDSI  296

Query  949   DMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGW  1128
              +LGD  IP +TLI+GANL++GL+ SAI   +++GV  VR+V+LP  GI ++  A + G+
Sbjct  297   KLLGDGTIPCITLILGANLIQGLRSSAIKPLIIVGVVCVRYVILPAVGIWIVKAAGNLGF  356

Query  1129  VGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFM  1308
             +  D L+H+VL++Q+ +P AM IGT+TQLF+VG+ ECSV+ LW Y  A LALT W+T FM
Sbjct  357   LPPDPLFHYVLMIQFTVPPAMNIGTMTQLFDVGQEECSVLFLWTYLAAGLALTTWSTVFM  416

Query  1309  WILS  1320
             WIL+
Sbjct  417   WILT  420



>ref|XP_006343325.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
tuberosum]
Length=395

 Score =   294 bits (753),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 177/403 (44%), Positives = 259/403 (64%), Gaps = 10/403 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF VA MP+L+ L+I+ +G ++A    +IL + +R  LN +VF VFTP++  +SL
Sbjct  1     MGFWTLFEVASMPILQMLLISVLGALMATNYFNILHSDTRRSLNKIVFVVFTPSITFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMP+NI LTF +G  LGW++VKI +    L GL+I+ C+ GNLGNLL
Sbjct  61    TKTVTLDDIISWWFMPINIGLTFLVGGILGWLVVKILKPEVHLEGLIIATCSTGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP-RMNSS  648
             L++IPA+C+E  SPFGD   C++ G +Y S SMA+G  YIWTY Y++IR+     +   +
Sbjct  121   LLVIPAICKEDGSPFGDHGICASVGLSYVSFSMAVGGFYIWTYTYHLIRSSSVKFKAIKA  180

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLK  828
              + +    +D   +A   SH L++D  E   I   E    S++ R    +        ++
Sbjct  181   ENALKKPNMD-LVDANEKSHLLQHDDTENQMIKVCEVSSWSKIARTLNKI--------VE  231

Query  829   MMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLL  1008
              + AP TIA I+G++ G +++L+ LII  NAPL VI  +  +LGD  IP +TLI+G NL 
Sbjct  232   ELLAPPTIAAILGLIFGSITWLKNLIIGSNAPLRVIQDTVKLLGDGTIPCITLILGGNLT  291

Query  1009  RGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSA  1188
             +GLKK+ +   ++I V  VR++  PL GI V+  A  FG++ +D LY FVL++QY LP A
Sbjct  292   QGLKKAKVKPMIIIAVVCVRYIFSPLLGILVLKAASKFGFLAADPLYKFVLMIQYTLPPA  351

Query  1189  MGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             M IGT+TQLF+V + ECSV+ LW Y  A+ ALT+W+T FMW+L
Sbjct  352   MNIGTMTQLFDVAQEECSVLFLWTYLAAAFALTIWSTIFMWLL  394



>ref|XP_004512294.1| PREDICTED: uncharacterized protein LOC101507155 isoform X1 [Cicer 
arietinum]
Length=365

 Score =   293 bits (751),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 177/359 (49%), Positives = 245/359 (68%), Gaps = 21/359 (6%)
 Frame = +1

Query  298   TITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllli  477
             T+T    +  WFMPVNIL+TF +GS LGWI++KITR P+ + GL++  C+AGNLGNL +I
Sbjct  10    TVTVLVFIIRWFMPVNILVTFLLGSVLGWIIIKITRPPKNIEGLIVGVCSAGNLGNLPII  69

Query  478   iIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR------------A  621
             IIPA+C+++ SPFGDP  C  +G +YASLSMA+GA++IWTY+YNI+R            +
Sbjct  70    IIPAICKDKGSPFGDPDVCYQDGISYASLSMALGAIFIWTYVYNIMRISSSKVYIEGNKS  129

Query  622   YGTPRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVF------EEEEKPSELKR  783
               T  + +S D +   F++   E +     +K + D++A I+       E++ K   L +
Sbjct  130   SDTITLEASGDDVSESFIEEGSETI---TQVKGNVDDDAYILLLSKNQSEQKVKVPMLHK  186

Query  784   LRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGD  963
             ++    M     N + +F+P+T+  IVG +IGVV  LR L+I  NAPLHVI+ S  MLGD
Sbjct  187   MKHQCGMVLSNPNFRGIFSPATLGAIVGFIIGVVPQLRSLMIGSNAPLHVIEDSTSMLGD  246

Query  964   AAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDS  1143
             AAIP +TLI+GANLL+GLK ++   W +IG+  VR++LLP+ GI ++  A   G V  D 
Sbjct  247   AAIPTITLIMGANLLKGLKGASTPFWTIIGIIGVRYILLPIFGILIVKGATQLGLVPVDP  306

Query  1144  LYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LY F+LLLQYALP AM IGTI QLF  GESECSVIMLW Y++AS+A+TLW+TYFMW++S
Sbjct  307   LYQFILLLQYALPPAMSIGTIAQLFGAGESECSVIMLWTYALASIAVTLWSTYFMWLVS  365



>ref|XP_007046466.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao]
 gb|EOX90623.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao]
Length=421

 Score =   294 bits (753),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 180/421 (43%), Positives = 263/421 (62%), Gaps = 18/421 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M+F  LF VA MP+L+ LII+ +G  +A +   +L A +R  LN LVF VFTP+L+ +SL
Sbjct  1     MSFWTLFEVASMPILQVLIISVLGAFMATDHCKLLSADTRRSLNKLVFVVFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMPVNI +TF +G  +GWI+VKI R    L GL+I+ C++GNLGNLL
Sbjct  61    AKTVTLQDIISWWFMPVNIGITFLVGGIVGWIVVKILRPKPHLEGLIIATCSSGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP-RMNSS  648
             LI++PAVC E  SPFG+   CS+ G +YAS SMA+G  Y+WT  Y +++      +   +
Sbjct  121   LIVVPAVCNEDGSPFGNRNVCSSVGLSYASFSMALGGFYVWTITYQMVKTSAVKFKALEA  180

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNV----------  798
              + + S   +   +A   SH LK    +E   +    +  ++ ++  QNV          
Sbjct  181   AEDLASKEPNKNLDATAESHLLKGKGHQEQVAITAATKSVADPEKQLQNVSQETGPNEKG  240

Query  799   --KMWADKIN-----LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADML  957
                 W   +      L+ + AP T+  I+G + G  ++LR LII + APL VI  S  +L
Sbjct  241   QASFWIKVVRFLHQILEELMAPPTLGAILGFIFGATTWLRNLIIGEGAPLRVIQDSIKLL  300

Query  958   GDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGS  1137
             GD  IP +TLI+GANL++GL+ SAI   +++GV  VR+V+LP  GI ++  A + G++  
Sbjct  301   GDGTIPCITLILGANLIQGLRSSAIKPLIIVGVVCVRYVILPAVGIWIVKAAGNLGFLPP  360

Query  1138  DSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             D L+H+VL++Q+ +P AM IGT+TQLF+VG+ ECSV+ LW Y  A LALT W+T FMWIL
Sbjct  361   DPLFHYVLMIQFTVPPAMNIGTMTQLFDVGQEECSVLFLWTYLAAGLALTTWSTVFMWIL  420

Query  1318  S  1320
             +
Sbjct  421   T  421



>ref|XP_011096969.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X1 
[Sesamum indicum]
Length=411

 Score =   294 bits (752),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 181/421 (43%), Positives = 260/421 (62%), Gaps = 28/421 (7%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  L  ++ MP+L+ LII+ +G  +A + + +L   +R  LN +VF VFTP+L+ +SL
Sbjct  1     MGFWSLLEISSMPILQVLIISVLGAFMATDYLKLLPPDARRSLNKIVFVVFTPSLIFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+    I+  WFMPVN+ +TF IG  LGW+ VKI R    L  L+I+ CA GNLGN+L
Sbjct  61    AKTVRFQDIIAWWFMPVNVGITFLIGGGLGWVAVKILRPQPHLQDLIIAICATGNLGNIL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPA+C+E  +PFG+   C+  G +Y S SMA+G+ YIWTY Y++IR     R  S  
Sbjct  121   LIIIPAICKEDGNPFGEEAVCTRVGLSYVSFSMALGSFYIWTYTYHLIR-----RAASKY  175

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKP-------------SELKRLRQ  792
               M     +  +EA     +   + +E   ++  EE  P                 + +Q
Sbjct  176   RAMLEDAEEPSKEA-----NKDLEANERTLLLSGEEHVPVSSNAGEDHSRKVPRNDQWKQ  230

Query  793   NVKMWADKINL-----KMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADML  957
             +  +W+  + +     + + AP  +A I+G++ G V++LR LII +NAPL VID S  +L
Sbjct  231   SATVWSQILGIFHQIVEELKAPPVLAAIIGLIFGGVTWLRNLIIGENAPLRVIDDSVKLL  290

Query  958   GDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGS  1137
             GD  IP +TLI+G NL +GL K+ +    V+ V  VR+ +LP  GIGV+ LA H G++ S
Sbjct  291   GDGTIPCITLILGGNLTQGLSKARLKSTTVVAVICVRYAILPAVGIGVVKLASHLGFLPS  350

Query  1138  DSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             D LYHFVL+LQ+ +P AM IGT+TQLF+V + ECSV+ LW Y VA+LALT W+T FMWIL
Sbjct  351   DPLYHFVLMLQFTVPPAMNIGTMTQLFDVAQEECSVLFLWTYLVAALALTGWSTVFMWIL  410

Query  1318  S  1320
             +
Sbjct  411   T  411



>gb|ABR18184.1| unknown [Picea sitchensis]
Length=455

 Score =   295 bits (754),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 197/421 (47%), Positives = 266/421 (63%), Gaps = 20/421 (5%)
 Frame = +1

Query  109   LMAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASS  288
             +MAFL L  VA MPVL+ L+I+ +G  LA   VD+L A  R H+N +VF VFTPAL+ +S
Sbjct  38    IMAFLALLEVASMPVLRILLISGLGAFLATSYVDVLTADVRKHVNKVVFIVFTPALMFAS  97

Query  289   LGETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnl  468
             L +++T  +IV  W+MPVN+LLTF IG   GWI+VKITR PR L GLVI  CAAGN+GNL
Sbjct  98    LSKSVTLDNIVSWWYMPVNLLLTFLIGGFCGWIVVKITRTPRHLSGLVIGNCAAGNVGNL  157

Query  469   lliiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYG-------  627
             LLIIIPA+CE++ SPFGD   C   G AYAS SMAIGA+YIW+ +YNI+R+         
Sbjct  158   LLIIIPAICEQKASPFGDAGVCMDYGMAYASFSMAIGAIYIWSIVYNIVRSSSYQRDEET  217

Query  628   ---------TPRMNSSTDIMGSGFLDSCREALLSSHSLKYDQ-DEEAQIVFEEEEKPSEL  777
                       P  +SS   + S  L      + SS          E Q   ++  K +  
Sbjct  218   QIEARIEERIPSKDSSNTGLQSSLLQEVHTEVPSSTGKNGSLFPSETQDFNKDVGKGNIF  277

Query  778   KRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADML  957
             +R   N+    + + L  + AP TI  +VG ++G +   + L +  N PL VI  S  +L
Sbjct  278   QRHLSNL---TNGLQLSEILAPPTIGAVVGFIVGAIPQTKGLFVGPNPPLQVIQDSIALL  334

Query  958   GDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGS  1137
             GD  IP +TLI+G NL +GL+ S +   ++IG+ +VRF++LPL GI ++  A + G    
Sbjct  335   GDGTIPTITLILGGNLTKGLQSSTVKPSIIIGIILVRFLILPLIGILIVKSATYLGMAHP  394

Query  1138  DSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             DSLY F+LL+Q+ALP AM IGT+TQLF VGESECSVI LW Y +A++A+T W+T +MW+L
Sbjct  395   DSLYQFILLIQFALPPAMNIGTMTQLFGVGESECSVIFLWTYLLAAIAITGWSTLYMWLL  454

Query  1318  S  1320
             S
Sbjct  455   S  455



>ref|XP_007134489.1| hypothetical protein PHAVU_010G051500g [Phaseolus vulgaris]
 gb|ESW06483.1| hypothetical protein PHAVU_010G051500g [Phaseolus vulgaris]
Length=420

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 184/421 (44%), Positives = 269/421 (64%), Gaps = 21/421 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF VA   ++K L+IT +G +LA  R +IL  ++  H+N +V++VFTPAL+ S +
Sbjct  1     MDFWMLFFVAFTSIMKLLLITVLGALLAHHRFNILRENATKHINAMVYFVFTPALIYSGI  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               T+T  S+V LWFMP++IL+T+  G+  GW+++K  R P  LHGLV+ CCAAGNL +  
Sbjct  61    SNTLTIKSMVMLWFMPLSILVTYITGTFAGWLMIKTIRVPPHLHGLVLGCCAAGNLASFP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNS--  645
             LII+P +CE++N+PFGD   C  NG AYASLSMA+G  Y W + +N++R Y +P++++  
Sbjct  121   LIIVPTICEDKNNPFGDEAICHRNGLAYASLSMAVGYTYSWCFTFNVVRIY-SPKIDAVK  179

Query  646   ---------STDIMGSGFLDSCREALL----SSHSLKYDQDE---EAQIVFEEEEKPSEL  777
                      ST   G   L  C    L     +  L    D    E ++   +E+ P +L
Sbjct  180   VDESSINPKSTTETGPKNLLKCPCGALVMNEDTEKLNGGTDPPKFECKVANGQEKVPEKL  239

Query  778   KRLRQNVKMWADKI-NLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADM  954
             K ++  +K+ A+KI  +K + APSTIA I+G+ IG+V   RKL++ D A  +V+  +  M
Sbjct  240   KFMKW-LKLLAEKIKKMKTLIAPSTIAAILGLTIGIVPQFRKLLVGDKAIFNVVQDTLIM  298

Query  955   LGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVG  1134
             LGDA++P M L++GANL++GLK       +++G+ VV+FV+LP+ GI ++  A HF  + 
Sbjct  299   LGDASVPTMVLLLGANLVKGLKAIGQQVPLIVGIIVVKFVVLPVIGICIVKSAVHFNLIR  358

Query  1135  SDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWI  1314
              D LY FVLLLQY +P AM + TITQ+F VGE ECS IML  YS A++ L LW T FMW+
Sbjct  359   HDPLYQFVLLLQYVVPPAMVVSTITQMFGVGECECSAIMLATYSCAAVLLPLWCTLFMWL  418

Query  1315  L  1317
             +
Sbjct  419   V  419



>gb|KHN01043.1| Putative transporter C5D6.04 [Glycine soja]
Length=423

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 201/423 (48%), Positives = 283/423 (67%), Gaps = 22/423 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M    LF+ ALMPVLK L++TA+G  LA  R +IL  S+R HLN +V++VFTPAL  S L
Sbjct  1     MQLWKLFITALMPVLKLLLLTAVGAFLALHRFNILRKSARKHLNVIVYFVFTPALAFSIL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S++ +WFMP+N+LLT+ IG+ALGW+ +KIT+ P ++ GLV+ CCAAGN+GNLL
Sbjct  61    TKTITFRSLIMVWFMPLNVLLTYIIGAALGWLFLKITKEPSDMQGLVLGCCAAGNVGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMN-SS  648
             LII+PAVC+E  SPFG    C+  G AYASLS+AIG +Y+WT+ YNIIR Y     N + 
Sbjct  121   LIIVPAVCKESGSPFGAVDVCNKKGMAYASLSLAIGNIYLWTFAYNIIRIYSGKIFNVNK  180

Query  649   TDIMGSGFLDSCREALLSSHS---------LKYDQDEE--------AQIVFEEEEKPS--  771
              D    G + S  E  L SHS         +  + D           +I      K S  
Sbjct  181   VDDSTVGPV-SAIETDLESHSTVPVVTAEDISENNDRTTHFGTYVAGKIFCTASGKGSYI  239

Query  772   -ELKRLRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSA  948
               L  L+ +++   DK+NLK++ +P+TI +I+G+++GVV   +K+ + DNAPL V++ SA
Sbjct  240   FPLLLLQASLRTLVDKLNLKVILSPATIGSILGLIVGVVPPFQKMFVGDNAPLSVVEDSA  299

Query  949   DMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGW  1128
              MLGD++ PAMTL++GANLL GLK+S +   +++G+ V+R++ LP+ G+ ++  A HFG 
Sbjct  300   SMLGDSSTPAMTLLLGANLLNGLKRSGMKFSLLVGIVVIRYIALPILGVVIVKGAIHFGI  359

Query  1129  VGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFM  1308
             +  D LY FVL+LQYALP A  I TITQLF   ++ECS++ML  Y  AS +LTLW+T FM
Sbjct  360   IHHDPLYQFVLMLQYALPPATSISTITQLFGARQTECSIVMLATYVCASFSLTLWSTLFM  419

Query  1309  WIL  1317
             W++
Sbjct  420   WLV  422



>ref|XP_009359620.1| PREDICTED: uncharacterized transporter YBR287W [Pyrus x bretschneideri]
Length=412

 Score =   292 bits (748),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 180/412 (44%), Positives = 257/412 (62%), Gaps = 9/412 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  L  VA MP+ + LII+ +G  +A E  ++L   +R  +N +VF VFTPALV +++
Sbjct  1     MGFWTLLEVACMPIFQVLIISVLGAFMATEYWNLLPLDARKSINRIVFVVFTPALVFANV  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT   IV  WFM VNI LTF +G  LGWI+VKI +      G+VI+  ++GNLGNLL
Sbjct  61    AKTITFGDIVSWWFMVVNIGLTFLVGGILGWIVVKIFKPKPYQEGVVIATVSSGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI++PA+C E  +PFGD + C T G AY S SMA+G  +IWTY Y +IR           
Sbjct  121   LILVPAICNEDGNPFGDHSVCKTTGLAYVSFSMALGNFFIWTYSYQLIRTSSIRWKEHQA  180

Query  652   DIMGSGFLDSCR---EALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN  822
                       C    +A   +  LK + +E+A +V  E      +    ++   ++ K+ 
Sbjct  181   AEEAEEASRRCNTDLDADEETQLLKGEDEEQAAVVVSETSVNHAIVAPDESNMPFSHKVF  240

Query  823   ------LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMT  984
                   L  + AP T+A IVG  +G ++ ++ +II D+APLHVI+ S   LG+  IP +T
Sbjct  241   AFFRQILHELLAPPTVAAIVGFFVGAITVIKNIIIGDDAPLHVIEDSITQLGNGTIPCIT  300

Query  985   LIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLL  1164
             LI+G NL++GL+K  I    ++G+ + ++V+ P  GIG++T A   G + SDSL+HFVL+
Sbjct  301   LILGGNLIQGLRKPTIKVPTLLGMIIAKYVVQPAIGIGIVTGADKLGLLPSDSLFHFVLM  360

Query  1165  LQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LQ+ LP AM IGT+TQL++VGE+ECSVI LW Y VA+LALT+W+T FMWILS
Sbjct  361   LQFTLPPAMNIGTMTQLYDVGEAECSVIFLWMYLVAALALTVWSTIFMWILS  412



>ref|XP_009418347.1| PREDICTED: uncharacterized transporter YBR287W-like [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 187/422 (44%), Positives = 255/422 (60%), Gaps = 20/422 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF+VA  P+++ L+I  +G  LA    ++L  S+R  +N +VF VFTP+L+ +SL
Sbjct  1     MGFWSLFLVASEPIVQVLLIGLLGAYLASGYSNVLSPSARRDMNKVVFSVFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMP+NI +TF +G  LGWI+VKI   PR L GLVI+  +AGNLGNLL
Sbjct  61    AKTVTFEEIISWWFMPINIGITFLVGGVLGWIVVKILGPPRHLEGLVIATSSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LIIIPAVCEE  +PFGD   CS  G +Y S SMA+G  YIWTY Y++IR  G     S +
Sbjct  121   LIIIPAVCEENGNPFGDQQICSARGLSYVSFSMALGGFYIWTYTYSLIRNDGQTYHGSQS  180

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQ-------IVFEEEEKPSELKRLR------Q  792
                GS   D     +    +L  + D+E         +  E  E   EL  L       Q
Sbjct  181   QSNGSIEADRNGSCINEGANLVEEDDQELSTNQENILLSIEVAENQIELPLLSSGNLQGQ  240

Query  793   NVKMWAD------KINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADM  954
              V +W        KI +  + AP TI  I G V+GV+ +L+ L +   APL V   S  +
Sbjct  241   RVSIWHKMKETLHKI-VDELLAPPTIGAIAGFVVGVIPWLKSLFVGATAPLRVFQDSIKL  299

Query  955   LGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVG  1134
             LG+  +P +TLI+G NL +GL+KS I   VV  +  +RF +LP  GI V+  A   G+V 
Sbjct  300   LGEGTVPCITLILGGNLTQGLRKSQIKPVVVFAILCIRFAILPAFGIAVVKAAYELGFVP  359

Query  1135  SDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWI  1314
              D LY +VL++Q+ +P AM IGT+ QLF+VG+ ECSVI++W Y VA++ALT+W+T FMWI
Sbjct  360   YDPLYRYVLMIQFTVPPAMNIGTMAQLFDVGQEECSVILMWTYVVAAIALTIWSTIFMWI  419

Query  1315  LS  1320
             LS
Sbjct  420   LS  421



>ref|XP_008805481.1| PREDICTED: uncharacterized transporter YBR287W-like [Phoenix 
dactylifera]
Length=399

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 179/393 (46%), Positives = 258/393 (66%), Gaps = 10/393 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M   +LF+ A +PVL  L++T +G + A  R+ ILG  +  HLNN+VF+VF PALVA++L
Sbjct  1     MGLFNLFITASVPVLNVLLLTGVGSITATRRIGILGKDATKHLNNVVFFVFNPALVATNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+V LWFMPVN+LL F IGSALGW++++IT AP  L G++++ C+AGN+GNLL
Sbjct  61    SQTITLESMVLLWFMPVNLLLNFVIGSALGWVVIQITNAPTHLRGVILASCSAGNVGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR---AYGTPRMN  642
             LI++PA+C+E+ +P G P  C T G AYASLSMAIG +  W+Y+YNI+R        +MN
Sbjct  121   LILVPAMCKEKGTPLGSPDVCGTYGLAYASLSMAIGTILQWSYVYNIVRISLCGEEGKMN  180

Query  643   SSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN  822
             +  ++    F +  +  L   HS      EEA        + +++K L   +   +  ++
Sbjct  181   N--NLPKVEFPEETKSLL--PHSCTRSTPEEASTSGCMAPRLNKIKNLMSKL---SGVVH  233

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
             LK MFAP+TI  I+G +IGV+  +R+ I+  +APL VI  SA +LG+  IP++ LI G N
Sbjct  234   LKRMFAPATIGVIIGFIIGVIPQIREAIVGQDAPLRVIQDSAVLLGNGTIPSLILITGGN  293

Query  1003  LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALP  1182
             L +GL    +   +++GV VVR++ LPL G  ++  A H G V  D LY F+LLLQ+A+P
Sbjct  294   LTKGLHGPGVKSTLILGVAVVRYIALPLFGAAIVKGAIHLGLVHPDPLYQFILLLQHAVP  353

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLA  1281
              AM I ++ Q+FE GE E SVI LW Y+VAS+A
Sbjct  354   PAMNIASMIQMFEAGEGELSVIFLWTYAVASVA  386



>ref|XP_004232583.1| PREDICTED: uncharacterized transporter C5D6.04-like [Solanum 
lycopersicum]
Length=405

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 180/419 (43%), Positives = 265/419 (63%), Gaps = 30/419 (7%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F+ L  VA MP+L+ LI++ +G V+A + + +L A +R +LN +VF +FTPAL+ +SL
Sbjct  1     MGFMTLLEVASMPILQVLIVSGLGAVMATDYLKLLPADARKYLNRIVFVIFTPALMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              E++T   I+  WFMPVN+ LTF  G  LGWI +KI +    L GL+I+ C++GNLGNLL
Sbjct  61    AESVTFQDIITWWFMPVNVGLTFLFGGILGWIAMKILKPKPHLEGLIIATCSSGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR-----------  618
             LI+IPA+C+E  SPFGD  TC++ G +YAS SMA+G  YIWT+ Y +IR           
Sbjct  121   LIVIPAICKEDGSPFGDHKTCASVGLSYASFSMALGGFYIWTFTYQLIRNSSLKFKSLKT  180

Query  619   -----AYGTPRMNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKR  783
                  A+  P ++S T+   S  LD+  +  L   + K  +++  ++        S  ++
Sbjct  181   AEENEAFKGPNVDSETN-EKSCLLDNNSQDQLPISTTKTTENQTVEV--------SSWRK  231

Query  784   LRQNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGD  963
             +   V  + ++I      AP T+  IVG + G V++L+ L+I D APL VI  S  +LGD
Sbjct  232   IVGVVHTFLEEIT-----APPTLGAIVGFLFGSVTWLKNLVIGDAAPLRVIQDSVKLLGD  286

Query  964   AAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDS  1143
               IP +TLI+G NL +GL+K+ +    +I V  VRF+  PL GI ++  A + G++ +D 
Sbjct  287   GTIPCITLILGGNLTQGLRKAEVKPSTIIAVVCVRFIFSPLIGIVIVKTAANLGFLPADP  346

Query  1144  LYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LYHFVL+LQY +P AM I T+TQL +V + ECSV+++W Y VA+ ALT+W+T FMWILS
Sbjct  347   LYHFVLMLQYTVPPAMNISTMTQLVDVAQEECSVLIMWTYLVAASALTIWSTIFMWILS  405



>ref|NP_001280772.1| uncharacterized transporter YBR287W-like [Malus domestica]
 gb|ABQ95657.1| auxin hydrogen symporter [Malus domestica]
Length=412

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 179/412 (43%), Positives = 264/412 (64%), Gaps = 9/412 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  L  VA MP+ + LII+ +G ++A E  ++L   +R  +N +VF VFTPALV S++
Sbjct  1     MGFWTLLEVACMPIFQVLIISVLGALMATEYWNLLPLDARKSINKVVFVVFTPALVFSNV  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT   IV  WFM VNI LTF +G  LGWI+VKI +      G+VI+  ++GNLGNLL
Sbjct  61    AKTITFGDIVSWWFMVVNIGLTFLVGGILGWIVVKIFKPKPYQEGVVIATVSSGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT--PRMNS  645
             LI++PA+C E  +PFGD + C T G AY S SMA+G  +IWTY Y +IR        + +
Sbjct  121   LILVPAICNEDGNPFGDHSVCKTTGLAYVSFSMALGNFFIWTYSYQLIRTSSIRWKELQA  180

Query  646   STDIM-GSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKI-  819
             + +    S   ++  +A   +H LK + +E+A +V  E      +    ++   ++ K+ 
Sbjct  181   AEETEEASKRRNTDLDADEETHLLKREDEEQAAVVVSETSVNQAIVTPDESNMPFSHKVL  240

Query  820   -----NLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMT  984
                   L  + AP T+A IVG  +G ++ ++ +II D+APLHVI+ S   LG+  IP +T
Sbjct  241   EFFRQILHELLAPPTVAAIVGFFVGSITVIKNIIIGDDAPLHVIEDSITRLGNGTIPCIT  300

Query  985   LIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLL  1164
             LI+G NL++GL+K  I    ++GV + +++++P  GIG++T A   G + S+SL+HFVL+
Sbjct  301   LILGGNLIQGLRKPTIKVPTLLGVIIAKYIVMPAIGIGIVTGADKLGLLPSNSLFHFVLM  360

Query  1165  LQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LQ+ LP AM IGT+ QL++V E+ECSVI LW Y VA+LALT+W+T FMWILS
Sbjct  361   LQFTLPPAMNIGTMAQLYDVAEAECSVIFLWTYLVAALALTVWSTIFMWILS  412



>ref|XP_010467522.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010467523.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=393

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 172/407 (42%), Positives = 264/407 (65%), Gaps = 20/407 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  L  VA MPV++ LI++ +G  LA +R  +    +R+ +N +VF +F PAL+ ++L
Sbjct  1     MGFWSLLEVASMPVIQVLIMSIVGAFLASDRCKLFPIEARNSMNKVVFVLFAPALMFANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               T+T   I+  WFMPVN+ LTF IG  LGWI+VKI + P  L GL+I+ C++GN+GNL 
Sbjct  61    ARTVTLEDIISWWFMPVNMGLTFLIGGLLGWIVVKILKPPPYLEGLIIATCSSGNMGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +I++PA+C+E  SPFG+ + C T G +YAS SMA+G  YIWTY + +I+        S+ 
Sbjct  121   IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFYIWTYTFRLIKG-------SAM  173

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN---  822
              I     ++   +A++ S +   + D++ +++   E+     K +++    W+  +N   
Sbjct  174   KIQA---MEESEKAVIKSSNNDLEADQKTRLLNAPED-----KLVKKGTGFWSKGVNFLH  225

Query  823   --LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVG  996
               L+ + AP T+  I+G + G VS+LR LII D+APL +I ++A +LGD  IP MT+I+G
Sbjct  226   EILEELLAPPTLGAIIGFIFGAVSWLRNLIIGDDAPLRIIQTTAKLLGDGTIPCMTIILG  285

Query  997   ANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYA  1176
              NL++GL+ SA+   VVIG+  VR+++LP+ GIGV+  A   G +  D L+ +VL+LQ+ 
Sbjct  286   GNLIQGLRSSAVKPVVVIGIVCVRYIILPIIGIGVVLTAASLGLLPEDPLFQYVLMLQFT  345

Query  1177  LPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             LP AM IGT+TQL+ V + ECSV+MLW Y VA  ALT+W+T F+ +L
Sbjct  346   LPPAMNIGTMTQLYNVAQDECSVLMLWTYLVAIPALTVWSTIFLHLL  392



>ref|XP_010270517.1| PREDICTED: uncharacterized protein LOC104606827 [Nelumbo nucifera]
 ref|XP_010270519.1| PREDICTED: uncharacterized protein LOC104606827 [Nelumbo nucifera]
Length=419

 Score =   292 bits (747),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 184/419 (44%), Positives = 261/419 (62%), Gaps = 16/419 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF VA MPVL+ L+I+ +G  +A    ++L A +R H+N +VF  FTP+L+ + L
Sbjct  1     MGFWTLFQVASMPVLQVLLISILGAFMATNYCNLLNADARRHMNKIVFITFTPSLMFACL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMPVNI LTF IG  LGWILVKI +    L GLVI+ C+AGNLGNLL
Sbjct  61    AKTVTFQDIISWWFMPVNIGLTFLIGGILGWILVKILKPEPYLEGLVIATCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI++PA+C E  SPFGD   C + G +YAS+SMA+G  +IW+Y Y++IR  G        
Sbjct  121   LIVVPAICNEDGSPFGDHNVCGSVGLSYASMSMALGGFFIWSYTYHLIRTSGIKYRALQA  180

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSE----------LKRLRQNVK  801
                     ++  +A   +H LK D  E+A +V     KP +          ++R  +   
Sbjct  181   AQSIPKVPNTDPDATGETHLLKTDDQEKAVVVLVPPAKPVDEDTENKVVIAIERAGEGKM  240

Query  802   MWADKIN------LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGD  963
                 K+       L+ +  P TIA I+G + G   +L+ L+I ++APL VI  S  +LGD
Sbjct  241   ALWGKVEETLHQILEELMTPPTIAAILGFIFGATPWLKNLLIGESAPLRVIQDSIKLLGD  300

Query  964   AAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDS  1143
               IP +TLI+G NL +GL+ + +   V++GV  VR+V+LP  GIGV+  A   G + SD 
Sbjct  301   GTIPCITLILGGNLTQGLRSARLKPLVILGVIFVRYVILPTIGIGVVIAAGKLGLLPSDP  360

Query  1144  LYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             L+ +VL++Q+ LP AM IGT+TQLF+VG+ ECSV+ LW Y VA+LALT+W+T +MWIL+
Sbjct  361   LFGYVLMVQFTLPPAMNIGTMTQLFDVGQEECSVLYLWTYLVAALALTVWSTVYMWILT  419



>ref|XP_006388075.1| hypothetical protein POPTR_0365s00230g [Populus trichocarpa]
 gb|ERP46989.1| hypothetical protein POPTR_0365s00230g [Populus trichocarpa]
Length=428

 Score =   292 bits (747),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 193/428 (45%), Positives = 261/428 (61%), Gaps = 25/428 (6%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF VA +P+++ L+I+  G ++A E +++L   +R  LN LVF VFTP+L+ +SL
Sbjct  1     MGFWTLFEVASLPIIQVLLISFFGALMATEYLNLLPKDARKSLNKLVFMVFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMPVNI  TF IG  LGWILVKI R    L GLVI+ C++GNLGNLL
Sbjct  61    AKTVTLEDIISWWFMPVNIGFTFLIGGILGWILVKILRPKPYLEGLVIATCSSGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LII+PA+C E  SPFGD + C++ G +YAS SMA+G  +IWTY +++IR           
Sbjct  121   LIIVPAICTEDGSPFGDSSICTSVGLSYASFSMALGGFFIWTYTFHLIRTSAAKLKALQA  180

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVF------EEEEK----PSELKRLRQNVK  801
              +  S   ++  +A   +H L     E   IV       E+ E       E +  + NV 
Sbjct  181   VVEVSKAPNNDLDASQETHLLIGQDQENVAIVVASSKSAEDTESRAIVSQESEHGKGNVS  240

Query  802   MWADKIN-----LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLG--  960
              W   I      L+ + AP T+A I+G + G  +FLR LII   APL VI  S  +LG  
Sbjct  241   SWTKLIGFLHQILEELLAPPTLAAILGFIFGATTFLRNLIIGSEAPLRVIQDSIKLLGYL  300

Query  961   --------DAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLAR  1116
                     D  IP +TLI+G NL  GL+ S I  W+V+GV  VR+++LP  G+ V+  A 
Sbjct  301   KVKTLCCRDGTIPCITLILGGNLTEGLRASKIKSWIVVGVICVRYIILPAIGMWVVKAAG  360

Query  1117  HFGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWT  1296
             H G++ SD L+H+VL++QY LP AM IGT+TQLF VG+ ECSV+ LW Y VA+LALT W+
Sbjct  361   HLGFLPSDPLFHYVLMIQYTLPPAMNIGTMTQLFNVGQEECSVLFLWTYLVAALALTAWS  420

Query  1297  TYFMWILS  1320
             T FMWILS
Sbjct  421   TIFMWILS  428



>emb|CDY26812.1| BnaC09g09390D [Brassica napus]
Length=393

 Score =   290 bits (743),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 172/402 (43%), Positives = 261/402 (65%), Gaps = 10/402 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  L  VA MPV++ LII+ +G  LA +R  +    +R+ +N +VF +F PAL+ ++L
Sbjct  1     MGFWSLLEVASMPVIQVLIISLVGAYLATDRCKLFPVEARNSMNKVVFVIFAPALMFANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   +V  WFMPVN+ LTF IG  LGW++VKI + P  L GL+++ C++GN+GNL 
Sbjct  61    AQTVTLQDMVSWWFMPVNMGLTFLIGGLLGWMVVKILKPPPYLEGLIVATCSSGNMGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +I++PA+C+E  SPFG+ + C T G +YAS SMA+G  YIWTY + +I+  G+       
Sbjct  121   IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFYIWTYTFRLIK--GSAMKFKEI  178

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKINLKM  831
             +      + S    L + H  K     E ++V EE          R+ V    +   L+ 
Sbjct  179   EESEKTAIKSSNSDLEADHKTKLLGAPEGELVKEET------GFWRKGVDFLHEI--LEE  230

Query  832   MFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLR  1011
             + AP T+  I+G + G V++LR LII D+APL ++ ++A +LGD  IP MT+I+G NL++
Sbjct  231   LRAPPTVGAIIGFIFGAVTWLRNLIIGDDAPLRIVQATAKLLGDGTIPCMTIILGGNLIQ  290

Query  1012  GLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAM  1191
             GL+ SA+   VV+G+  VR+++LP+ GIGV+  A  FG++ +D L+ +VL+LQ+ LP AM
Sbjct  291   GLRSSAVKPVVVLGIVCVRYIILPIIGIGVVKTAESFGFLPADPLFQYVLMLQFTLPPAM  350

Query  1192  GIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
              IGT+TQL+ VG+ ECSV+MLW Y +A LALT+W+T F+ +L
Sbjct  351   NIGTMTQLYNVGQDECSVLMLWTYLIAILALTVWSTIFLHLL  392



>ref|XP_010317676.1| PREDICTED: uncharacterized protein LOC101262895 [Solanum lycopersicum]
Length=395

 Score =   290 bits (743),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 175/406 (43%), Positives = 258/406 (64%), Gaps = 16/406 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF VA MP+L+ L+I+ +G ++A    +IL + +R  LN +VF VFTP++  +SL
Sbjct  1     MEFWTLFEVASMPILQMLLISVLGALMATNYFNILHSDTRKSLNKIVFVVFTPSITFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
               T+T + I+  WFMP+NI +TF IG  LGW++VKI +    L GL+I+ C+ GNLGNL 
Sbjct  61    TRTVTLNDIISWWFMPINIGITFLIGGILGWLVVKILKPELHLEGLIIATCSTGNLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRA----YGTPRM  639
             LI+IPA+C+E  SPFGD   C++ G +Y S SMA+G  YIWTY Y++IR+    +   + 
Sbjct  121   LIVIPAICKEDGSPFGDQKNCASLGLSYVSFSMAVGGFYIWTYTYHLIRSSSVKFKAIKA  180

Query  640   NSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKI  819
              ++        LD+  +    SH L+++  E   I   E    S++ R    +       
Sbjct  181   ENALKKPNMDLLDANEK----SHLLQHNDTENQMIKVCEVSSWSKIARTLNKI-------  229

Query  820   NLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGA  999
              ++ + AP TIA I+G++ G +++L+ LII +NAPL VI  +  +LGD  IP +TLI+G 
Sbjct  230   -VEELLAPPTIAAILGLIFGSITWLKNLIIGNNAPLRVIQDTVKLLGDGTIPCITLILGG  288

Query  1000  NLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYAL  1179
             NL +GL+K+ +   ++I V  VR++  PL GI ++  A  FG++ SD LY FVL++QY L
Sbjct  289   NLTQGLRKAKVKPMIIIAVVCVRYIFSPLIGILLLKSASKFGFLTSDPLYKFVLMIQYTL  348

Query  1180  PSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             P AM IGT+TQLF+V + ECSV+ LW Y  A  ALT+W+T FMW+L
Sbjct  349   PPAMNIGTMTQLFDVAQEECSVLFLWTYLAAVFALTIWSTIFMWLL  394



>ref|XP_006661381.1| PREDICTED: uncharacterized protein LOC102707339 [Oryza brachyantha]
Length=443

 Score =   292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 196/444 (44%), Positives = 269/444 (61%), Gaps = 46/444 (10%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L LF+ A +PVL  L++T +G  LA +   +L   +R +LNN+VFYVF+P+LVA+ L
Sbjct  1     MDLLQLFITACVPVLNMLLVTGVGSFLATDFAGLLNKEARKYLNNIVFYVFSPSLVATYL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+ KLWFMPVNILL    G   GWI++ +TRAP  L GL++ CC+AGN GN+ 
Sbjct  61    AQTITLESLAKLWFMPVNILLACTFGLIFGWIVIHVTRAPARLRGLILGCCSAGNWGNIF  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY-----GTPR  636
             LIIIPA+C+E+ SPFG P  C T G AY+SLSMA+GAV +WT  YNI+RA      G  +
Sbjct  121   LIIIPALCKEKGSPFGAPDVCHTYGLAYSSLSMALGAVVLWTVAYNIMRATSKVTEGNGQ  180

Query  637   MN-SSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQI-------VFEEEEKPSELKRLRQ  792
              N ++  I GSG   +  E    + S+  D   +  +       V   + K +  +R + 
Sbjct  181   ANHTNVSISGSGTGTASEE----NFSILNDNTNQCTLPLISNSSVPSTKTKVAMSERAKG  236

Query  793   NVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAI  972
              V M+   I+ K +FAPSTIA IVG +IG    +R  +I DNAPL VI  S+D++G  AI
Sbjct  237   FVSMFG-AIDFKKIFAPSTIAVIVGFIIGGTPLIRNAVIGDNAPLRVIQESSDLIGGGAI  295

Query  973   PAMTLIVGANLLRGLKKSA-IggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLY  1149
             P++TLI+G NLL G++  A +   V++ V VVR++LLP  G  ++  A   G +  D LY
Sbjct  296   PSVTLIMGGNLLNGIRGGAGVQPSVIVAVIVVRYILLPSVGTVLVKSAVRLGLIHPDPLY  355

Query  1150  HFVLLLQYALPSAMGIGT---------------------------ITQLFEVGESECSVI  1248
              F+LLLQYA+P AM IG                            + QLF VGESECSVI
Sbjct  356   QFILLLQYAVPPAMNIGKQRSLTELLIDERYISLLIYMHAVHHLFMRQLFGVGESECSVI  415

Query  1249  MLWNYSVASLALTLWTTYFMWILS  1320
              +W Y++AS+A+T+W+  FMW LS
Sbjct  416   FVWAYALASVAVTVWSALFMWALS  439



>ref|XP_009112433.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
 ref|XP_009112434.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
 emb|CDY30361.1| BnaA09g09160D [Brassica napus]
Length=393

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 171/407 (42%), Positives = 266/407 (65%), Gaps = 20/407 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  L  VA MPV++ LII+ +G  LA +R  +    +R+ +N +VF +F PAL+ ++L
Sbjct  1     MGFWSLLEVASMPVIQVLIISLVGAYLATDRCKLFPVEARNSMNKVVFVIFAPALMFANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   +V  WFMPVN+ LTF IG  LGW++VKI + P  L GL+++ C++GN+GNL 
Sbjct  61    AQTVTLQDMVSWWFMPVNMGLTFLIGGLLGWMVVKILKPPPYLEGLIVATCSSGNMGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +I++PA+C+E  SPFG+ + C T G +YAS SMA+G  YIWTY + +I+           
Sbjct  121   IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFYIWTYTFRLIKGSAMKFKEME-  179

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN---  822
                     +S + A+ SS+S   + D + +++   E    EL  +++    W   ++   
Sbjct  180   --------ESEKTAIKSSNS-DLEADHKTKLLGAPE---GEL--VKKETGFWRKGVDFLH  225

Query  823   --LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVG  996
               L+ + AP T+  I+G + G V++LR LII D+APL ++ ++A +LGD  IP MT+I+G
Sbjct  226   EILEELRAPPTVGAIIGFIFGAVTWLRNLIIGDDAPLRIVQATAKLLGDGTIPCMTIILG  285

Query  997   ANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYA  1176
              NL++GL+ SA+   VV+G+  VR+++LP+ GIGV+  A  FG++ +D L+ +VL+LQ+ 
Sbjct  286   GNLIQGLRSSAVKPVVVLGIVCVRYIILPIIGIGVVKTAESFGFLPADPLFQYVLMLQFT  345

Query  1177  LPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             LP AM IGT+TQL+ VG+ ECSV+MLW Y +A LALT+W+T F+ +L
Sbjct  346   LPPAMNIGTMTQLYNVGQDECSVLMLWTYLIAILALTVWSTIFLHLL  392



>ref|XP_008242098.1| PREDICTED: uncharacterized transporter YBR287W [Prunus mume]
 ref|XP_008242099.1| PREDICTED: uncharacterized transporter YBR287W [Prunus mume]
Length=413

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 190/423 (45%), Positives = 263/423 (62%), Gaps = 30/423 (7%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  L  VA MP  + LII+ +G  +A E  ++L A +R  +N +VF VFTP+LV +S+
Sbjct  1     MGFWTLLEVACMPTFQVLIISLLGAFMATEYWNLLPADARRSMNKVVFVVFTPSLVFASV  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT   I+ +WFM VN+ LTF  G  LGWILVKI R      GLV++ C++ NLGNL 
Sbjct  61    AKTITFEDIISMWFMIVNVGLTFLFGGILGWILVKIVRPKPYQEGLVMAACSSANLGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI+IPA+CEE  +PFGD + C   G +Y S SMA+G  +IWTY Y +IR          T
Sbjct  121   LILIPAICEEDGNPFGDHSVCKRVGLSYVSFSMALGGFFIWTYSYQLIR----------T  170

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVF---EEEEKPSEL---KRLRQNVKMWAD  813
               M    L +   A  +S +   D D E +      E+EE+ S +      R    + AD
Sbjct  171   SAMKWKALQAIEAAEEASKNPNSDLDAEGETPLLKGEDEEQGSIVVSSNGSRNQEAIVAD  230

Query  814   KIN--------------LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSAD  951
             + +              L  + AP T+A IVG  IG + FL+KLII D+APL VI+ S  
Sbjct  231   ESDVPFSRKVVAFVKQILHELLAPPTVAAIVGFFIGSIPFLKKLIIGDSAPLRVIEDSIT  290

Query  952   MLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWV  1131
              LG+  IP +TLI+G NL++GL+KS I   ++IGV +VR+V++P+ GIG++  A   G++
Sbjct  291   QLGNGTIPCITLILGGNLIQGLRKSTIKIPIIIGVIIVRYVVMPVIGIGIVIGASKVGFL  350

Query  1132  GSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMW  1311
              SD L+HFVL++Q+ LP AM IGT+TQLF+V E+ECSVI LW Y VA+LALT+W+T +MW
Sbjct  351   PSDPLFHFVLMVQFTLPPAMNIGTMTQLFDVAEAECSVIFLWTYLVAALALTIWSTVYMW  410

Query  1312  ILS  1320
             +LS
Sbjct  411   LLS  413



>ref|NP_201399.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 dbj|BAB10403.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED98134.1| auxin efflux carrier family protein [Arabidopsis thaliana]
Length=395

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 185/406 (46%), Positives = 275/406 (68%), Gaps = 14/406 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL+L  VA MP+++ L+I+ +G  LA +   +L A +R  +N LVF VFTP ++ ++L
Sbjct  1     MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              ET+T   I+  WFMP+N+ +TF +G  LGW++VK+     +LHGL+I+ CA+GN+GNL+
Sbjct  61    AETVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP-RMNSS  648
             LI++PA+C+E  SPFG+ + C + G +YAS SMA+G  YIWTY Y ++R+  T  R   +
Sbjct  121   LILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFYIWTYSYQLVRSSATQFRALEA  180

Query  649   TDIMGS--GFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN  822
               ++ S    +DS   ALL    LK  Q+++ +I  + ++K S     R  +K    +I 
Sbjct  181   AGLVKSPNKDIDSDPHALL----LKPHQNQDLEI--QGKQKVST----RTYIKDLLHQI-  229

Query  823   LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGAN  1002
             L+ +FAP TI  I+G V G  ++LR LII +NAPL VI  S  +LG+  IP +TLI+G N
Sbjct  230   LEELFAPPTIGAILGFVFGATNWLRNLIIGENAPLRVIQDSVKLLGEGTIPCITLILGGN  289

Query  1003  LLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALP  1182
             L++GL+ SA+   V++GV +VR++LLP+ G+GV+ LA + G++  D L+ +VL+LQ+ALP
Sbjct  290   LIQGLRSSAVKKSVIVGVIIVRYILLPVVGVGVVQLAGNLGYLPPDPLFRYVLMLQFALP  349

Query  1183  SAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              AM I T+ QLF+V + ECSVI LW Y VASLALT+W+T F+ ILS
Sbjct  350   PAMNISTMAQLFDVAQDECSVIFLWTYLVASLALTVWSTIFLSILS  395



>ref|XP_006467106.1| PREDICTED: uncharacterized transporter YBR287W-like [Citrus sinensis]
Length=423

 Score =   290 bits (741),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 186/429 (43%), Positives = 267/429 (62%), Gaps = 32/429 (7%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF VA MP+++ L+I+ +G ++A +  ++L A +R  LN +VF VFTP+L+ +SL
Sbjct  1     MGFWTLFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMPVN+ +TF IG  LGWI+VK+ R    L GLVI+ CA+GNLGNLL
Sbjct  61    AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYG--------  627
             LII+PA+C E+ SPFG+   CS+ G +YAS SMA+G  +IW+Y Y +I+           
Sbjct  121   LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMALGGFFIWSYSYQLIKQSSVRYKALAQ  180

Query  628   ------TPR-------MNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKP  768
                    P+        N+ T ++  G  D   +  +   S K   D E QI+  +    
Sbjct  181   AAEPEEVPKEVNKDFDANAQTQLL-RGTTDDQEDVSVLVASTKSSSDPECQIIVPQA---  236

Query  769   SELKRLRQNVKMWADKIN-----LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHV  933
             S L+  +++   W   +      L+ + AP T+A IVG + G V +LR LII D+APL V
Sbjct  237   SHLQTRKES--FWKRSLEFLHQLLEELLAPPTLAAIVGFIFGAVVWLRNLIIGDSAPLRV  294

Query  934   IDSSADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLA  1113
             I  S ++LGD  IP +TLI+G NL++GL+ S +   ++I V  VR++ LP  G+ V+  A
Sbjct  295   IQDSIEILGDGTIPCITLILGGNLIQGLRSSTLKPLIIIAVVCVRYIALPFIGVWVVKAA  354

Query  1114  RHFGWVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLW  1293
                G++ SD LYH+VL++Q+ LP AM IGT+TQLF+V + ECSV+ LW Y VA+LALT W
Sbjct  355   AALGFLPSDPLYHYVLMVQFTLPPAMNIGTMTQLFDVAQEECSVLFLWTYLVAALALTGW  414

Query  1294  TTYFMWILS  1320
             +  FMWILS
Sbjct  415   SMVFMWILS  423



>gb|KDP43785.1| hypothetical protein JCGZ_22412 [Jatropha curcas]
Length=408

 Score =   288 bits (738),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 183/411 (45%), Positives = 266/411 (65%), Gaps = 11/411 (3%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF VA MP+L+ L+I+ +G  +A    +IL   +R  LN +VF VFTP+L+ +SL
Sbjct  1     MGFWTLFEVASMPILQVLLISILGAFMATSYCNILTTDARKSLNKIVFIVFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   ++  WFMPVNI LTF IG  LGWI+VK+ +    L GLVI+ C++GNLGNLL
Sbjct  61    AKTVTFQDVISWWFMPVNIGLTFLIGGILGWIVVKLLKPQPHLEGLVIATCSSGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR--AYGTPRMNS  645
             LI+IPA+C E  SPF D  TC + G +YAS  MA+G  +IWTY Y++IR  A     + +
Sbjct  121   LIVIPAICNEDGSPF-DRDTCRSVGLSYASFYMALGGFFIWTYTYSLIRSSAAKLKVIEA  179

Query  646   STDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKI--  819
             + +I  +   ++  EA   +H LK ++ E A     + E  + + +       + +K+  
Sbjct  180   AEEITKAP--NNDLEASQETHLLKQEEKEHAAKSVVDTETEAVVSQEHGKGVPFLNKLLG  237

Query  820   ----NLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTL  987
                  L+ + AP T+  I+G + G ++FLRKLI+ DNAPL VI  S  +LG+  IP +TL
Sbjct  238   SLHKILEELLAPPTLGAILGFIFGAITFLRKLIVGDNAPLRVIQDSITLLGEGTIPCITL  297

Query  988   IVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLL  1167
             I+G NL++GL+ S +  W+++ V  VR+V+LP  G+ ++  A  FG++ S+ LY +VL++
Sbjct  298   ILGGNLIQGLRSSRLKPWIIVSVLFVRYVMLPAIGVWLVKGAAKFGFLPSEPLYQYVLMI  357

Query  1168  QYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             QY LP AM IGT+TQLF VG+ ECSV+ LW Y  A+LALT+W+T FMWILS
Sbjct  358   QYTLPPAMNIGTMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWILS  408



>ref|XP_004512295.1| PREDICTED: uncharacterized protein LOC101507155 isoform X2 [Cicer 
arietinum]
Length=344

 Score =   286 bits (732),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 239/347 (69%), Gaps = 21/347 (6%)
 Frame = +1

Query  334   MPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiIPAVCEERNSP  513
             MPVNIL+TF +GS LGWI++KITR P+ + GL++  C+AGNLGNL +IIIPA+C+++ SP
Sbjct  1     MPVNILVTFLLGSVLGWIIIKITRPPKNIEGLIVGVCSAGNLGNLPIIIIPAICKDKGSP  60

Query  514   FGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR------------AYGTPRMNSSTDI  657
             FGDP  C  +G +YASLSMA+GA++IWTY+YNI+R            +  T  + +S D 
Sbjct  61    FGDPDVCYQDGISYASLSMALGAIFIWTYVYNIMRISSSKVYIEGNKSSDTITLEASGDD  120

Query  658   MGSGFLDSCREALLSSHSLKYDQDEEAQIVF------EEEEKPSELKRLRQNVKMWADKI  819
             +   F++   E +     +K + D++A I+       E++ K   L +++    M     
Sbjct  121   VSESFIEEGSETI---TQVKGNVDDDAYILLLSKNQSEQKVKVPMLHKMKHQCGMVLSNP  177

Query  820   NLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGA  999
             N + +F+P+T+  IVG +IGVV  LR L+I  NAPLHVI+ S  MLGDAAIP +TLI+GA
Sbjct  178   NFRGIFSPATLGAIVGFIIGVVPQLRSLMIGSNAPLHVIEDSTSMLGDAAIPTITLIMGA  237

Query  1000  NLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYAL  1179
             NLL+GLK ++   W +IG+  VR++LLP+ GI ++  A   G V  D LY F+LLLQYAL
Sbjct  238   NLLKGLKGASTPFWTIIGIIGVRYILLPIFGILIVKGATQLGLVPVDPLYQFILLLQYAL  297

Query  1180  PSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             P AM IGTI QLF  GESECSVIMLW Y++AS+A+TLW+TYFMW++S
Sbjct  298   PPAMSIGTIAQLFGAGESECSVIMLWTYALASIAVTLWSTYFMWLVS  344



>gb|KHG10464.1| Transporter protein [Gossypium arboreum]
Length=407

 Score =   288 bits (737),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 177/409 (43%), Positives = 257/409 (63%), Gaps = 8/409 (2%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF VA MP+L+ LII+ +G  +A +   +L    R  LN +VF VFTP+L+ +SL
Sbjct  1     MGFWTLFEVASMPILQVLIISLLGAFMATDYCKLLPVDIRRSLNRIVFVVFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMPVNI LTF +G  LGWI+VKI +    L GL+I+ C++GNLGNLL
Sbjct  61    AKTVTLQDIISWWFMPVNIGLTFLVGIILGWIVVKILKPKPYLEGLIIATCSSGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP-RMNSS  648
             LI++PA+C E  SPFGD   C+  G +YAS SMA+G  Y+WT  +++IRA     R + +
Sbjct  121   LIVVPAICNEDGSPFGDTNVCTRIGLSYASFSMALGGFYLWTITFHMIRASSLKLRDDEA  180

Query  649   TDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN--  822
              +   S   +   +A   S  LK + +E+  I+ +  +  S   + + N  +W   +   
Sbjct  181   AEDFSSKQPNKNLDATPQSQLLKGESEEQVAILVKAPQDTSP--KAKGNAPLWRQVVRFL  238

Query  823   ---LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIV  993
                L+ + AP T+  I G   G + +LR L+I   APL V+  S  +LGDA IP +TLI+
Sbjct  239   HQILEELMAPPTLGAIFGFTFGAIDWLRNLVIGPGAPLRVVQDSIKLLGDATIPCITLIL  298

Query  994   GANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQY  1173
             GANL +GL+ S I   V++GV  VR+++LP+ GI ++  A   G++  D L+ +VL++Q+
Sbjct  299   GANLTQGLRSSTIKPMVIMGVVCVRYIILPVVGIFIVKAAGDLGFLPPDPLFRYVLMVQF  358

Query  1174  ALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              LP AM IGT+ QLF+VG+ ECSV+ LW Y  A+LALT W+T FMWIL+
Sbjct  359   TLPPAMNIGTMAQLFDVGQDECSVLFLWTYLAAALALTSWSTVFMWILT  407



>ref|XP_009614500.1| PREDICTED: uncharacterized protein LOC104107409 isoform X1 [Nicotiana 
tomentosiformis]
Length=416

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 178/421 (42%), Positives = 267/421 (63%), Gaps = 23/421 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF VA MP+L+ L+I+ +G ++A + + +L + +R  LN +VF +FTP+L+ +SL
Sbjct  1     MGFWTLFEVASMPILQVLLISILGALMATDYLKLLHSDARRSLNKIVFVIFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMP+NI LTF +G  LGW++VKI +    L GL+I+ C+AGNLGNLL
Sbjct  61    AKTVTLDDIISWWFMPINIGLTFLVGGILGWLVVKILKPELHLEGLIIATCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT-------  630
             LI+IPA+C+E+ SPFGD   C++ G +YAS SMA+G  YIWTY Y++IR+          
Sbjct  121   LIVIPAICKEKGSPFGDHGICASVGLSYASFSMAVGGFYIWTYTYHLIRSSSVKFKALKA  180

Query  631   ------PRMNSSTDIMGSGFL---DSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKR  783
                    + N   D      L    +  + ++S    KYD + + +   + + +P     
Sbjct  181   AEEDALKKPNKDFDASEKSHLLEGVAQDDLVVSISPTKYDPENQTKTCEKADMEPK----  236

Query  784   LRQNVKMWADKIN--LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADML  957
              +  V  W+  ++  ++ + AP T+A I+G++ G V++L+ LII   APL VI  S  +L
Sbjct  237   -KGEVLSWSKFLHKIVEELLAPPTVAAIIGLIFGSVTWLKNLIIGSAAPLRVIQDSVKLL  295

Query  958   GDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGS  1137
             GD  IP +TLI+G NL +GL+K+ +   ++I V  VR++  PL GI V+  A   G++ +
Sbjct  296   GDGTIPCITLILGGNLTQGLRKAKVKPMIIITVVCVRYIFSPLVGILVLKGAGKLGFLAA  355

Query  1138  DSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             D LY FVL++QY LP AM IGT+TQLF+V + ECSV+ LW Y VA+ ALT+W+T FMW+L
Sbjct  356   DPLYKFVLMIQYTLPPAMNIGTMTQLFDVAQEECSVLFLWTYLVAAFALTIWSTVFMWLL  415

Query  1318  S  1320
             S
Sbjct  416   S  416



>ref|XP_009130575.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
Length=384

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 175/396 (44%), Positives = 262/396 (66%), Gaps = 16/396 (4%)
 Frame = +1

Query  145   MPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSLGETITASSIVK  324
             MP+++ L+I+ +G  LA +   +L A +R  +N LVF VFTP ++ ++L +T+T   I+ 
Sbjct  1     MPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANLAQTVTLQDIIS  60

Query  325   LWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiIPAVCEER  504
              WFMP+N+ +TF +G  LGW++VK+     +LHGL+I+ CA+GN+GNL+LI++PA+C+E 
Sbjct  61    WWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLMLILVPAICDEE  120

Query  505   NSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTP-RMNSSTDIMGS--GFL  675
              SPFG+ + C + G +YAS SMA+G  YIWTY Y ++R+  T  R   +  +  S    +
Sbjct  121   GSPFGNRSVCRSIGLSYASFSMALGGFYIWTYSYQLVRSSATQFRALEAAGLAKSPNKEI  180

Query  676   DSCREALLSSHSLKYDQDEEAQI-VFEEEEKPSELKRLRQNVKMWADKINLKMMFAPSti  852
             DS    LL    LK  Q+++ +I V E+    + +K L   +        L+ +FAP TI
Sbjct  181   DSDPRTLL----LKPQQNQDLEIQVKEKVSTGTYIKDLLHQI--------LEELFAPPTI  228

Query  853   ativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLRGLKKSAI  1032
               I+G V G  ++LR LII +NAPL VI  S  +LGD  IP +TLI+G NL++GL+ SA+
Sbjct  229   GAILGFVFGATNWLRNLIIGENAPLRVIQDSVKLLGDGTIPCITLILGGNLIQGLRSSAV  288

Query  1033  ggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAMGIGTITQ  1212
                V++GV  VR+++LP+ G+GV+ LA + G++  D L+ +VL+LQ+ LP AM I T+ Q
Sbjct  289   KTSVIVGVICVRYIILPVVGVGVVQLAWNLGYLPPDPLFRYVLMLQFTLPPAMNISTMAQ  348

Query  1213  LFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             LF+V + ECSVI LW Y VASLALT+W+T F+ ILS
Sbjct  349   LFDVAQDECSVIFLWTYLVASLALTVWSTIFLSILS  384



>dbj|BAK01989.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=416

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 183/417 (44%), Positives = 270/417 (65%), Gaps = 15/417 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M FL L VVA MP+++ L+I  IG  LA     +  AS+R  +N +VF VFTP+L+ ++L
Sbjct  1     MGFLSLLVVASMPIVQVLLIGVIGAFLASGYSKVFTASARRDMNKVVFTVFTPSLIFANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T S ++  WFMPVNI +TF +GSALGW+  KI + P+   GL+++ C+AGNLGNLL
Sbjct  61    AKTVTLSDVISWWFMPVNIAITFLVGSALGWLACKILKPPQHFRGLIMAFCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFG-DPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGT--PRMN  642
             LI++PAVC+E  +PFG D + C + G +Y+SLSMA+G ++IWTY Y++++  G    +M 
Sbjct  121   LIVVPAVCDEDGNPFGNDRSQCRSRGLSYSSLSMALGGLFIWTYTYSLMQKSGKLYHKMQ  180

Query  643   S--------STDIMGSGFLDSCREALLSSHSLKYDQDEEAQI---VFEEEEKPSELKRLR  789
             S        S +    GF     EA L   +   + DE ++I   +   E   +  K   
Sbjct  181   SKSVQCPADSDEEHLQGFKAGDEEAALPPSASPEEHDEGSRIEAPLLSCESDVANNKGFW  240

Query  790   QNVKMWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAA  969
              N+K    ++  ++M AP TI+ I+G V+G+V +L+ LII D APL VI  S +++G+  
Sbjct  241   TNLKEAVHQLVEELM-APPTISAIIGFVVGLVPWLKSLIIGDGAPLRVIQDSLELMGNGT  299

Query  970   IPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLY  1149
             IP +TLI+G NL +GL+KS +   V++ +  +R+V +P+ GI V+  A   G++  D LY
Sbjct  300   IPCITLILGGNLTQGLRKSVLKRSVIVAIVCIRYVAMPVIGIAVVRAAHGVGFLPHDPLY  359

Query  1150  HFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
              +VL+LQ+ALP AM IGT+ QLF+VG+ ECSVI LW Y VA++ALT W+T FM ILS
Sbjct  360   RYVLMLQFALPPAMNIGTMAQLFDVGQEECSVIFLWTYLVAAVALTTWSTVFMSILS  416



>ref|XP_010913879.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Elaeis guineensis]
Length=396

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 174/400 (44%), Positives = 258/400 (65%), Gaps = 27/400 (7%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M  L+LFV A +PVL  L++T +G + A  R+ ILG  +  HLNN+VF+VF PALVA++L
Sbjct  1     MGLLNLFVTASIPVLNVLLLTGVGSICATRRIGILGKDATKHLNNVVFFVFNPALVATNL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +TIT  S+V LWFMPVN+LL F +GSALGW++++IT AP  L G++++CC+AGN+GNLL
Sbjct  61    SQTITMESMVLLWFMPVNLLLNFVLGSALGWVVIQITNAPTHLRGVILACCSAGNVGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             LI++PA+C+E+ +P G    C T G AYASLSMAIG +  W+Y+YNI+R        S  
Sbjct  121   LILVPAMCKEKGTPLGSHDVCGTYGLAYASLSMAIGTILQWSYVYNIVRI-------SLC  173

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKP----------SELKRLRQNVK  801
             D          +E  ++++  K +  EE + +      P          + L +++  ++
Sbjct  174   D----------KEGSVNNNMPKVEFPEETKSLLPPSCSPEKVSISGCMAARLNKMKYLMR  223

Query  802   MWADKINLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAM  981
               +  ++LK MFAP++I  I+G +IG +  +R+ I+  +APL VI  SA +LG+  IP++
Sbjct  224   KLSGVVHLKRMFAPASIGVIIGFIIGAIPQIREAIVGQDAPLRVIQDSAALLGNGTIPSL  283

Query  982   TLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVL  1161
              LI G NL +GL    +   +++GV +VR++ LPL G  ++  A H G V  D LY F+L
Sbjct  284   ILITGGNLTKGLHGPGVKCTLILGVAIVRYIALPLFGAAMVKGAIHLGLVHPDPLYQFIL  343

Query  1162  LLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLA  1281
             LLQ+A+P AM I ++ Q+FE GE E SVI LW Y+VAS+A
Sbjct  344   LLQHAVPPAMNIASMIQMFEAGEGELSVIFLWTYAVASVA  383



>ref|XP_006587541.1| PREDICTED: uncharacterized protein LOC100810166 isoform X2 [Glycine 
max]
Length=340

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 175/340 (51%), Positives = 236/340 (69%), Gaps = 11/340 (3%)
 Frame = +1

Query  334   MPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnllliiIPAVCEERNSP  513
             MPVNIL TF +GSALGWIL+K+TR P+ + GL++ CC+AGNLGNL +III A+C++  SP
Sbjct  1     MPVNILGTFILGSALGWILIKMTRPPKRMEGLILGCCSAGNLGNLPMIIIAAICKQEGSP  60

Query  514   FGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSSTDIMGSGFLDSCREA  693
             FG+P  C+  G AYA+LSMAIGAV++W+Y+YN++R   +   N       S  L +  + 
Sbjct  61    FGEPDLCNQYGMAYAALSMAIGAVFLWSYVYNLMRISSSRIQNEDRTSNDSSMLKASADI  120

Query  694   LLSS--------HSLKYDQDEEAQIVFEE---EEKPSELKRLRQNVKMWADKINLKMMFA  840
              +S         ++ K   D    I+  E   EEK S   +++  V+M +  +N K MFA
Sbjct  121   SVSHPHNFSKTLNTTKGTVDNAYTILLPETNSEEKVSFPSKIKHYVRMISSHLNFKSMFA  180

Query  841   PStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVGANLLRGLK  1020
             PST+  I G +IGVV  +R  +I +NAPLHV++ SA MLG+AAIP +TLI+GANLL+GLK
Sbjct  181   PSTLGAIAGFIIGVVPQIRNFMIGNNAPLHVVEDSASMLGEAAIPTVTLIMGANLLKGLK  240

Query  1021  KSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYALPSAMGIG  1200
              +    W ++G+ VVR++ LPL GI V+  A H   V SD+LY FVLLLQYALP AM IG
Sbjct  241   GTTAPVWTIVGIVVVRYIFLPLLGIAVVKGAMHLSLVHSDALYQFVLLLQYALPPAMNIG  300

Query  1201  TITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             TI QLF  GESECSVIMLW Y++AS+A+TLW+T+FMW++S
Sbjct  301   TIAQLFGSGESECSVIMLWTYALASIAVTLWSTFFMWLVS  340



>ref|XP_009779996.1| PREDICTED: uncharacterized protein LOC104229115 [Nicotiana sylvestris]
 ref|XP_009779997.1| PREDICTED: uncharacterized protein LOC104229115 [Nicotiana sylvestris]
Length=419

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 177/424 (42%), Positives = 268/424 (63%), Gaps = 26/424 (6%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF VA MP+L+ L+I+ +G ++A + + +L + +R  LN +VF VFTP+L+ +SL
Sbjct  1     MGFWTLFEVASMPILQVLLISILGALMATDYLKLLHSDARRSLNKIVFVVFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMP+NI LTF +G  LGW++VKI +    L GL+I+ C+AGNLGNLL
Sbjct  61    AKTVTLDDIISWWFMPINIGLTFLVGGILGWLVVKILKPDLHLEGLIIATCSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIR-----------  618
             LI+IPA+C+E+ SPFGD   C++ G +YAS SMA+G  YIWT+ Y++IR           
Sbjct  121   LIVIPAICKEKRSPFGDHGICASVGLSYASFSMAVGGFYIWTHTYHLIRSSSVKFKALKA  180

Query  619   ----AYGTPR----MNSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSE  774
                 A   P      N  + ++     +    ++  + S  YD + + +   + + +P E
Sbjct  181   AEEDALKKPNNDFDANERSHLLEGVDQNDLALSIAPTKSTAYDPENQTKACEKTDMEPRE  240

Query  775   LKRLRQNVKMWADKIN--LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSA  948
                    V  W+  ++  ++ + AP T+A I+G++ G V++L+ LII   APL VI  S 
Sbjct  241   -----GEVSSWSKFLHKIVEELLAPPTVAAIIGLIFGSVTWLKNLIIGSAAPLRVIQDSI  295

Query  949   DMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGW  1128
              +LGD  IP +TLI+G NL +GL+K+ +   ++I V  VR++  PL GI V+ +A   G+
Sbjct  296   KLLGDGTIPCITLILGGNLTQGLRKAKVKPMIIISVVCVRYIFSPLVGILVLKVADKLGF  355

Query  1129  VGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFM  1308
             + +D LY FV+++QY LP AM IGT+TQLF+V + ECSV+ LW Y VA+ ALT+W+T FM
Sbjct  356   LAADPLYKFVIMIQYTLPPAMNIGTMTQLFDVAQEECSVLFLWTYLVAAFALTIWSTVFM  415

Query  1309  WILS  1320
             W+LS
Sbjct  416   WLLS  419



>gb|ABR16386.1| unknown [Picea sitchensis]
Length=426

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 177/424 (42%), Positives = 262/424 (62%), Gaps = 22/424 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             MAF DL +VA MPV+K L+I+ +G VL+     +L   S  H+N ++F VFTPAL+ +SL
Sbjct  1     MAFWDLLIVASMPVVKILLISGLGAVLSTRYAGVLTEDSLKHVNKVIFVVFTPALMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +++T   ++  W MP N+ LTF  G+ LGWI+VKIT+ P  L+G+V++ C AGN+GNLL
Sbjct  61    AQSVTFEDLISWWSMPFNVFLTFLFGAILGWIIVKITKPPEYLNGIVVANCCAGNMGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAY---------  624
             LI++PA+C E+ SPFG+P+ C  NG AYAS SMA+G+V+IWTY Y++IR+          
Sbjct  121   LIVVPALCHEKGSPFGEPSVCKLNGIAYASFSMALGSVFIWTYAYSLIRSSSQIHEEKEF  180

Query  625   --GTPRMNSSTDIMG--SGFLDSCR---EALLSSHSLKYDQDEEAQIVF---EEEEKPSE  774
               G      + D  G  S  L + +   E   S      D+   + +V       +KPS 
Sbjct  181   KNGLEEKIPNIDYAGETSKLLQTIQIIPEVPSSGGDYPSDKQSASGLVVVNSSSSKKPSC  240

Query  775   LKRLRQNVKMWADK---INLKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSS  945
              +   + VK +  K   +  + + AP TI  I G ++G +  +  LI+  +APL VI  S
Sbjct  241   FQAWPRKVKQYMKKTADLLFEELKAPPTIGVIAGFMVGAIPPVNALIVGASAPLRVIQDS  300

Query  946   ADMLGDAAIPAMTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFG  1125
               +LGD AIP + L++G +L++GL  S +   +++ +   +FVLLP+ GI V+  A + G
Sbjct  301   ISLLGDGAIPGIILLMGGHLVKGLSSSKLRPMIIVLIICAKFVLLPVIGIFVVKGASNLG  360

Query  1126  WVGSDSLYHFVLLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYF  1305
              + +D LYHFVL++QY +P AM IGT+ QLF VGE ECSVI  W Y +A+++LT W+T +
Sbjct  361   LLPADPLYHFVLMIQYTVPPAMNIGTMAQLFNVGEQECSVIFFWTYLLAAISLTFWSTVY  420

Query  1306  MWIL  1317
             MWIL
Sbjct  421   MWIL  424



>ref|XP_009386671.1| PREDICTED: uncharacterized transporter YBR287W-like [Musa acuminata 
subsp. malaccensis]
Length=404

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 180/414 (43%), Positives = 260/414 (63%), Gaps = 21/414 (5%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  LF+VA  P L+ L+I  +G  LA    ++L A +R  +N +VF VFTP+L+ +SL
Sbjct  1     MGFWSLFLVASEPNLQFLLIGTLGAYLASSYSNVLLADARRDMNKVVFAVFTPSLMFASL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMPVNI +TF +G  LGWI VKI R P+ L GLVI+  +AGNLGNLL
Sbjct  61    AKTVTFEQIISWWFMPVNIGITFLVGGILGWIAVKILRPPKHLEGLVIASTSAGNLGNLL  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNII----RAYGTPRM  639
             LIIIPA+CEE  +PFGD   CS+ G +Y S SMA+G  YIWT  Y ++    + Y   ++
Sbjct  121   LIIIPAICEENGNPFGDKNICSSRGLSYVSFSMALGGFYIWTIAYGLMKNAGKVYHGSQL  180

Query  640   NSSTDIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLR-QNVKMWADK  816
              S+      G +   +E++LS      ++  + QI         E+  L  + VK+W +K
Sbjct  181   GSNLVKEDGGGVSPGQESMLSVSVQPVEEVGQNQI---------EVPLLHDKGVKLW-EK  230

Query  817   IN------LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPA  978
             +N      ++ + AP T+A I+G  +G + +L+ L I  +APL V+  S  +LGD  +P 
Sbjct  231   LNGILHNIVEELMAPPTVAAIIGFAVGAIPWLKSLFIGASAPLRVVQGSIKLLGDGTVPC  290

Query  979   MTLIVGANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFV  1158
             +TLI+G NL +G  KS I   V++ +  VR+++LP  GIGV+  A   G+V  D LY +V
Sbjct  291   ITLILGGNLTQGFHKSRIKRKVILAIVCVRYMILPAFGIGVVKAAYELGFVPYDPLYRYV  350

Query  1159  LLLQYALPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWILS  1320
             L++Q+ +P AM I T+ QLF+VG+ ECSVI LW Y +A++ALT+W+T FMWILS
Sbjct  351   LMIQFTVPPAMNIATMAQLFDVGQDECSVIFLWTYVIATVALTVWSTIFMWILS  404



>gb|AAM60930.1| unknown [Arabidopsis thaliana]
Length=396

 Score =   286 bits (733),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 168/407 (41%), Positives = 265/407 (65%), Gaps = 17/407 (4%)
 Frame = +1

Query  112   MAFLDLFVVALMPVLKTLIITAIGLVLAFERVDILGASSRHHLNNLVFYVFTPALVASSL  291
             M F  L  VA MPV++ L ++ +G  +A +R  +    +R+ +N +VF +F PAL+ ++L
Sbjct  1     MGFWSLLEVASMPVIQVLFMSLVGAFMASDRCKLFPVEARNSMNKVVFVLFAPALMFANL  60

Query  292   GETITASSIVKLWFMPVNILLTFAIGSALGWILVKITRAPRELHGLVISccaagnlgnll  471
              +T+T   I+  WFMPVN+ LTF IG  LGW++VKI + P  L GL+++ C+AGN+GNL 
Sbjct  61    AQTVTLEDIISWWFMPVNMGLTFLIGGLLGWLVVKILKPPPYLEGLIVATCSAGNMGNLP  120

Query  472   liiIPAVCEERNSPFGDPTTCSTNGKAYASLSMAIGAVYIWTYIYNIIRAYGTPRMNSST  651
             +I++PA+C+E  SPFG+ + C T G +YAS SMA+G  YIWTY + +I+        S+ 
Sbjct  121   IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFYIWTYTFRLIKG-------SAM  173

Query  652   DIMGSGFLDSCREALLSSHSLKYDQDEEAQIVFEEEEKPSELKRLRQNVKMWADKIN---  822
              +      +S + A+ SS+S   + D +  ++   E+K  E K +++    W   ++   
Sbjct  174   KV--QAIEESEKIAIKSSNS-DLEADHKTHLLGAPEDK--ENKVVKEETGFWRKGVDFLH  228

Query  823   --LKMMFAPStiativgivigvvSFLRKLIIVDNAPLHVIDSSADMLGDAAIPAMTLIVG  996
               L+ + AP T+  I+G + G V +LR LII D+APL ++ S+A +LGD  IP MT+I+G
Sbjct  229   EILEELLAPPTLGAIIGFIFGAVRWLRNLIIGDDAPLRIVQSTAKLLGDGTIPCMTIILG  288

Query  997   ANLLRGLKKSAIggwvvigvqvvrfvLLPLCGIGVITLARHFGWVGSDSLYHFVLLLQYA  1176
              NL++GL+ SA+   VV+G+   R++ +P+ GIG++  A + G++ +D L+ +VL+LQ+ 
Sbjct  289   GNLIQGLRSSAVKPMVVLGIVCARYIAMPIIGIGIVLTAANLGFLPADPLFQYVLMLQFT  348

Query  1177  LPSAMGIGTITQLFEVGESECSVIMLWNYSVASLALTLWTTYFMWIL  1317
             LP AM IGT+TQL+ V + ECSV+MLW Y VA LALT+W+T F+ +L
Sbjct  349   LPPAMNIGTMTQLYNVAQDECSVLMLWTYLVAILALTVWSTIFLHLL  395



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3661749424872