BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19612_g1_i1 len=1023 path=[107:0-263 473:264-425 635:426-1022]

Length=1023
                                                                      Score     E

gb|KEH42203.1|  thylakoid lumenal 15.0 kDa protein                      244   2e-75   
ref|XP_006428390.1|  hypothetical protein CICLE_v10012670mg             242   5e-75   
gb|KCW89390.1|  hypothetical protein EUGRSUZ_A01683                     243   6e-75   
gb|KDO49315.1|  hypothetical protein CISIN_1g038271mg                   239   7e-75   
ref|XP_004249484.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    241   9e-75   
ref|XP_009785062.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    241   1e-74   
ref|XP_002282285.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    240   4e-74   Vitis vinifera
ref|XP_004143269.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    240   5e-74   
ref|XP_004156281.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    240   5e-74   
gb|KDP29148.1|  hypothetical protein JCGZ_16537                         239   5e-74   
ref|XP_002519497.1|  conserved hypothetical protein                     240   9e-74   Ricinus communis
ref|XP_006339080.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    239   1e-73   
ref|XP_004497532.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    239   2e-73   
gb|KCW89388.1|  hypothetical protein EUGRSUZ_A01683                     239   2e-73   
gb|ABK96655.1|  unknown                                                 238   2e-73   Populus trichocarpa x Populus deltoides
ref|XP_010253980.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    238   2e-73   
ref|XP_002322890.1|  hypothetical protein POPTR_0016s09350g             238   2e-73   Populus trichocarpa [western balsam poplar]
ref|XP_006398781.1|  hypothetical protein EUTSA_v10014610mg             238   3e-73   
ref|XP_010253979.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    238   3e-73   
gb|AFK45260.1|  unknown                                                 238   4e-73   
ref|XP_010050932.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    239   4e-73   
ref|XP_008462470.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    237   5e-73   
ref|XP_009588210.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    237   6e-73   
ref|XP_006281063.1|  hypothetical protein CARUB_v10027083mg             237   6e-73   
ref|XP_010445424.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    237   7e-73   
gb|KHG05147.1|  hypothetical protein F383_08683                         236   7e-73   
ref|XP_010050927.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    238   1e-72   
ref|XP_011014881.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    236   2e-72   
ref|XP_007205863.1|  hypothetical protein PRUPE_ppa011178mg             235   2e-72   
ref|NP_001147270.1|  permeases of the major facilitator superfamily     235   3e-72   Zea mays [maize]
ref|XP_008387571.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    235   3e-72   
ref|XP_008387572.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    235   4e-72   
emb|CDY66968.1|  BnaAnng23280D                                          234   5e-72   
ref|XP_010906130.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    234   6e-72   
ref|XP_009376825.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    234   9e-72   
ref|XP_011077324.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    234   1e-71   
ref|XP_009376824.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    234   1e-71   
emb|CDY44363.1|  BnaC02g03140D                                          234   1e-71   
ref|XP_007027395.1|  Thylakoid lumenal 15.0 kDa protein 2 isoform 1     234   1e-71   
ref|XP_008243991.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    233   2e-71   
ref|XP_008808238.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    233   2e-71   
ref|XP_008808234.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    233   2e-71   
ref|XP_002864205.1|  thylakoid lumen 15.0 kDa protein                   233   2e-71   
ref|XP_010442851.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    233   2e-71   
emb|CDP06770.1|  unnamed protein product                                233   2e-71   
ref|XP_010482679.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    233   2e-71   
ref|XP_007027396.1|  Thylakoid lumenal 15.0 kDa protein 2 isoform 2     233   3e-71   
ref|XP_004304457.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    232   3e-71   
ref|XP_010906129.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    233   4e-71   
ref|XP_009125499.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    232   5e-71   
ref|NP_568781.1|  thylakoid lumenal protein 2                           232   7e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007145211.1|  hypothetical protein PHAVU_007G219800g             232   7e-71   
gb|EYU38557.1|  hypothetical protein MIMGU_mgv1a013309mg                231   1e-70   
ref|XP_010543409.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    230   2e-70   
ref|NP_001239900.1|  uncharacterized protein LOC100795443               231   2e-70   
gb|EAZ04170.1|  hypothetical protein OsI_26312                          227   4e-70   Oryza sativa Indica Group [Indian rice]
gb|KFK24794.1|  hypothetical protein AALP_AA8G025800                    229   6e-70   
ref|XP_010684052.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    228   1e-69   
ref|XP_006588451.1|  PREDICTED: uncharacterized protein LOC100795...    229   1e-69   
ref|XP_006588450.1|  PREDICTED: uncharacterized protein LOC100795...    229   1e-69   
gb|ACU16481.1|  unknown                                                 228   2e-69   Glycine max [soybeans]
gb|ABK25844.1|  unknown                                                 226   2e-68   Picea sitchensis
ref|XP_006658638.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    223   3e-67   
ref|XP_006839157.1|  hypothetical protein AMTR_s00097p00038600          221   4e-67   
ref|XP_003581246.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    221   9e-67   
ref|XP_009384038.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    220   2e-66   
ref|XP_009384037.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    220   2e-66   
dbj|BAJ88857.1|  predicted protein                                      219   6e-66   
dbj|BAJ87961.1|  predicted protein                                      219   8e-66   
gb|ACN31712.1|  unknown                                                 216   2e-64   Zea mays [maize]
ref|NP_001149917.1|  permeases of the major facilitator superfamily     215   3e-64   Zea mays [maize]
ref|XP_004975199.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    214   5e-64   
gb|EMS62510.1|  Thylakoid lumenal 15.0 kDa protein 2, chloroplastic     227   2e-63   
ref|XP_010253981.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    207   1e-61   
ref|XP_002992881.1|  hypothetical protein SELMODRAFT_162644             204   6e-61   
ref|XP_002968784.1|  hypothetical protein SELMODRAFT_90688              202   1e-60   
gb|EPS58490.1|  hypothetical protein M569_16322                         199   4e-59   
dbj|BAK03380.1|  predicted protein                                      191   9e-57   
ref|XP_002953353.1|  hypothetical protein VOLCADRAFT_105868             197   2e-56   
ref|XP_001752618.1|  predicted protein                                  191   4e-56   
gb|EMT07626.1|  Thylakoid lumenal 15.0 kDa protein 2, chloroplastic     208   4e-56   
ref|XP_001700629.1|  predicted protein                                  193   1e-55   Chlamydomonas reinhardtii
ref|XP_006493007.1|  PREDICTED: thylakoid lumenal 15.0 kDa protei...    189   6e-55   
ref|XP_006428391.1|  hypothetical protein CICLE_v10012670mg             189   2e-54   
gb|KEH42202.1|  thylakoid lumenal 15.0 kDa protein                      184   1e-52   
ref|XP_002447500.1|  hypothetical protein SORBIDRAFT_06g002030          177   1e-49   Sorghum bicolor [broomcorn]
ref|NP_001059859.1|  Os07g0534000                                       171   1e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002500716.1|  hypothetical protein MICPUN_113635                 171   2e-47   Micromonas commoda
ref|XP_003084179.1|  thylakoid lumen 15.0 kDa protein (ISS)             170   1e-46   
ref|XP_005643972.1|  hypothetical protein COCSUDRAFT_19620              164   5e-45   
ref|XP_007511021.1|  predicted protein                                  166   6e-45   
ref|XP_010240738.1|  PREDICTED: uncharacterized protein LOC100845661    162   4e-43   
ref|XP_003064402.1|  predicted protein                                  161   5e-43   
gb|KFM24375.1|  ATPase family AAA domain-containing protein 2           170   5e-43   
ref|XP_005847996.1|  hypothetical protein CHLNCDRAFT_35354              155   3e-42   
ref|XP_010107488.1|  hypothetical protein L484_024338                   149   1e-40   
ref|XP_003613495.1|  Thylakoid lumenal 15.0 kDa protein                 139   9e-36   
tpg|DAA38604.1|  TPA: hypothetical protein ZEAMMB73_587127              137   5e-35   
ref|XP_001422138.1|  predicted protein                                  131   6e-34   Ostreococcus lucimarinus CCE9901
ref|XP_009032122.1|  hypothetical protein AURANDRAFT_6353               128   3e-32   
ref|XP_005790231.1|  hypothetical protein EMIHUDRAFT_440267             129   7e-32   
ref|XP_005829597.1|  hypothetical protein GUITHDRAFT_95599              129   2e-31   
emb|CBN75528.1|  thylakoid lumen 15.0 kDa protein                       127   1e-30   
dbj|BAA97137.1|  unnamed protein product                                122   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005854163.1|  hypothetical protein NGA_0170500                   121   5e-29   
ref|WP_026073061.1|  hypothetical protein                               122   1e-28   
ref|WP_015189469.1|  hypothetical protein                               122   2e-28   
ref|WP_026723087.1|  hypothetical protein                               121   3e-28   
gb|EWM23129.1|  Putative repair protein                                 122   4e-28   
ref|XP_002290481.1|  thylakoid lumen 15.0-kDa protein                   118   5e-28   Thalassiosira pseudonana CCMP1335
ref|WP_026733822.1|  hypothetical protein                               120   7e-28   
ref|WP_035988478.1|  methanol dehydrogenase                             119   8e-28   
ref|WP_016867646.1|  hypothetical protein                               119   8e-28   
ref|WP_009456528.1|  MULTISPECIES: hypothetical protein                 119   9e-28   
ref|WP_016873918.1|  hypothetical protein                               119   1e-27   
ref|WP_011242771.1|  hypothetical protein                               119   1e-27   
ref|XP_005718349.1|  unnamed protein product                            117   2e-27   
ref|WP_015172682.1|  hypothetical protein                               118   2e-27   
ref|XP_005707417.1|  thylakoid lumen 15.0 kDa protein                   117   3e-27   
ref|WP_017313818.1|  hypothetical protein                               118   3e-27   
ref|WP_017711216.1|  hypothetical protein                               117   5e-27   
ref|WP_016858494.1|  hypothetical protein                               117   5e-27   
ref|WP_011613022.1|  hypothetical protein                               117   6e-27   
ref|WP_017322985.1|  hypothetical protein                               116   1e-26   
ref|WP_015108293.1|  hypothetical protein                               116   2e-26   
ref|XP_002178007.1|  predicted protein                                  115   3e-26   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_035830152.1|  methanol dehydrogenase                             115   3e-26   
ref|WP_015147974.1|  hypothetical protein                               115   5e-26   
ref|WP_017660566.1|  hypothetical protein                               114   6e-26   
ref|WP_036917803.1|  MULTISPECIES: methanol dehydrogenase               114   6e-26   
ref|WP_011935841.1|  hypothetical protein                               114   1e-25   
ref|WP_036029719.1|  methanol dehydrogenase                             113   1e-25   
ref|XP_005537887.1|  hypothetical protein, conserved                    112   2e-25   
ref|WP_017714887.1|  hypothetical protein                               113   2e-25   
ref|WP_011056104.1|  hypothetical protein                               113   2e-25   
ref|WP_036616135.1|  methanol dehydrogenase                             113   2e-25   
gb|EKQ71061.1|  hypothetical protein OsccyDRAFT_1378                    113   2e-25   
ref|WP_015202755.1|  hypothetical protein                               112   3e-25   
ref|WP_015124537.1|  hypothetical protein                               113   3e-25   
ref|WP_009789699.1|  hypothetical protein                               112   3e-25   
ref|WP_011359845.1|  hypothetical protein                               112   3e-25   
ref|WP_017305625.1|  hypothetical protein                               112   3e-25   
ref|WP_015179020.1|  hypothetical protein                               112   4e-25   
ref|WP_012626394.1|  hypothetical protein                               112   4e-25   
ref|WP_038554684.1|  methanol dehydrogenase                             112   5e-25   
ref|WP_012162823.1|  hypothetical protein                               112   5e-25   
gb|EJK58377.1|  hypothetical protein THAOC_21502                        112   5e-25   
gb|AII49311.1|  hypothetical protein KR52_09160                         112   7e-25   
ref|WP_038023196.1|  methanol dehydrogenase                             111   7e-25   
ref|WP_024124479.1|  putative thylakoid membrane protein                111   7e-25   
gb|EAU73760.1|  hypothetical protein RS9916_29664                       111   8e-25   Synechococcus sp. RS9916
ref|WP_009633625.1|  hypothetical protein                               111   9e-25   
ref|WP_036021814.1|  methanol dehydrogenase                             111   9e-25   
ref|WP_036532562.1|  methanol dehydrogenase                             111   9e-25   
ref|WP_012195348.1|  hypothetical protein                               111   9e-25   
ref|WP_011364421.1|  hypothetical protein                               110   1e-24   
gb|EKU97281.1|  hypothetical protein Lepto7375DRAFT_6459                111   1e-24   
ref|WP_006910393.1|  hypothetical protein                               111   1e-24   
ref|WP_036000360.1|  methanol dehydrogenase                             110   1e-24   
ref|WP_036054017.1|  methanol dehydrogenase                             110   1e-24   
ref|WP_010467786.1|  hypothetical protein                               110   1e-24   
gb|AHF63588.1|  hypothetical protein Syncc8109_1218                     110   1e-24   
gb|ESA34484.1|  hypothetical protein N836_16445                         110   2e-24   
ref|WP_008233981.1|  Cell division protein FtsI/penicillin-bindin...    110   2e-24   
ref|WP_037224612.1|  methanol dehydrogenase                             110   2e-24   
emb|CDN17143.1|  Cell division protein FtsI/penicillin-binding pr...    110   3e-24   
ref|WP_027845979.1|  hypothetical protein                               109   4e-24   
ref|WP_007355134.1|  MULTISPECIES: hypothetical protein                 109   4e-24   
ref|WP_006632962.1|  hypothetical protein                               108   7e-24   
ref|WP_006170717.1|  hypothetical protein                               108   1e-23   
gb|AII43358.1|  hypothetical protein KR100_08290                        108   1e-23   
ref|WP_038544557.1|  methanol dehydrogenase                             108   1e-23   
ref|YP_002048781.1|  hypothetical protein PCC_0119                      108   1e-23   Paulinella chromatophora
ref|WP_015122581.1|  methanol dehydrogenase                             107   2e-23   
ref|WP_039728078.1|  methanol dehydrogenase                             107   2e-23   
ref|WP_025782567.1|  hypothetical protein                               107   2e-23   
ref|WP_035154977.1|  methanol dehydrogenase                             107   2e-23   
ref|WP_028951952.1|  hypothetical protein                               107   2e-23   
ref|WP_011826194.1|  hypothetical protein                               107   2e-23   
ref|WP_036915242.1|  MULTISPECIES: methanol dehydrogenase               107   2e-23   
ref|WP_011130044.1|  hypothetical protein                               107   2e-23   
ref|WP_015138114.1|  hypothetical protein                               107   2e-23   
ref|WP_015210123.1|  hypothetical protein                               107   3e-23   
ref|WP_011128176.1|  hypothetical protein                               107   3e-23   
ref|WP_036907138.1|  methanol dehydrogenase                             106   3e-23   
gb|KGG19520.1|  hypothetical protein EV03_1904                          106   4e-23   
ref|WP_011132314.1|  hypothetical protein                               106   4e-23   
ref|WP_015128736.1|  hypothetical protein                               105   7e-23   
ref|WP_015198990.1|  hypothetical protein                               106   8e-23   
ref|WP_026100417.1|  hypothetical protein                               105   8e-23   
ref|WP_038018052.1|  methanol dehydrogenase                             105   9e-23   
ref|WP_007102413.1|  hypothetical protein                               105   1e-22   
ref|WP_010996701.1|  hypothetical protein                               105   1e-22   
gb|EDX86838.1|  hypothetical protein S7335_4545                         105   1e-22   Synechococcus sp. PCC 7335
ref|WP_008189123.1|  hypothetical protein                               105   1e-22   
ref|WP_011619354.1|  hypothetical protein                               105   1e-22   
ref|WP_011317357.1|  hypothetical protein                               105   1e-22   
ref|WP_015212856.1|  hypothetical protein                               105   1e-22   
ref|WP_015181427.1|  hypothetical protein                               105   1e-22   
ref|WP_011293648.1|  hypothetical protein                               104   1e-22   
ref|WP_011434237.1|  hypothetical protein                               104   1e-22   
ref|WP_025952625.1|  hypothetical protein                               105   1e-22   
ref|WP_029956855.1|  hypothetical protein                               103   1e-22   
ref|WP_029552971.1|  hypothetical protein                               105   1e-22   
ref|WP_025930130.1|  hypothetical protein                               105   1e-22   
ref|WP_016949206.1|  hypothetical protein                               105   1e-22   
ref|WP_036920503.1|  methanol dehydrogenase                             104   2e-22   
ref|WP_025888080.1|  hypothetical protein                               103   2e-22   
ref|WP_010317325.1|  hypothetical protein                               105   2e-22   
ref|WP_036892251.1|  MULTISPECIES: methanol dehydrogenase               104   2e-22   
ref|WP_011125163.1|  hypothetical protein                               104   2e-22   
ref|WP_038081678.1|  methanol dehydrogenase                             104   2e-22   
gb|AIQ96875.1|  hypothetical protein EW15_0783                          104   2e-22   
ref|WP_039753557.1|  methanol dehydrogenase                             104   2e-22   
ref|WP_013189814.1|  hypothetical protein                               104   2e-22   
ref|WP_038652049.1|  methanol dehydrogenase                             103   2e-22   
ref|WP_026103252.1|  hypothetical protein                               104   2e-22   
ref|WP_012411221.1|  hypothetical protein                               103   2e-22   
ref|WP_038026411.1|  methanol dehydrogenase                             104   3e-22   
ref|WP_009785794.1|  hypothetical protein                               103   3e-22   
ref|WP_015167594.1|  methanol dehydrogenase                             103   3e-22   
ref|WP_023065898.1|  repair family protein                              103   3e-22   
ref|WP_027403263.1|  hypothetical protein                               103   3e-22   
ref|WP_017746667.1|  hypothetical protein                               103   3e-22   
ref|WP_006103642.1|  hypothetical protein                               103   3e-22   
ref|WP_015079048.1|  hypothetical protein                               103   3e-22   
ref|WP_039204881.1|  methanol dehydrogenase                             103   3e-22   
ref|WP_011823454.1|  hypothetical protein                               103   3e-22   
gb|EHA63464.1|  hypothetical protein Syn8016DRAFT_0505                  103   4e-22   
ref|WP_029955945.1|  hypothetical protein                               102   4e-22   
gb|AII45181.1|  hypothetical protein KR49_01715                         103   4e-22   
ref|WP_025893086.1|  hypothetical protein                               102   5e-22   
ref|WP_008274011.1|  hypothetical protein                               103   5e-22   
ref|WP_025973242.1|  hypothetical protein                               103   5e-22   
ref|WP_011862721.1|  hypothetical protein                               103   5e-22   
ref|WP_006276082.1|  hypothetical protein                               103   5e-22   
ref|WP_025974560.1|  hypothetical protein                               103   6e-22   
ref|WP_009344647.1|  hypothetical protein                               103   6e-22   
ref|WP_038013171.1|  methanol dehydrogenase                             103   6e-22   
ref|WP_025964719.1|  hypothetical protein                               103   6e-22   
ref|WP_028090054.1|  hypothetical protein                               103   6e-22   
ref|WP_028084895.1|  hypothetical protein                               103   6e-22   
ref|WP_025944577.1|  hypothetical protein                               103   6e-22   
ref|WP_025971990.1|  hypothetical protein                               103   6e-22   
ref|WP_025972922.1|  hypothetical protein                               103   6e-22   
ref|WP_025962338.1|  hypothetical protein                               103   6e-22   
ref|WP_025961024.1|  hypothetical protein                               103   6e-22   
ref|WP_025890608.1|  MULTISPECIES: hypothetical protein                 103   7e-22   
ref|WP_025959766.1|  hypothetical protein                               103   7e-22   
gb|AIQ94774.1|  hypothetical protein EW14_0754                          102   7e-22   
ref|WP_017295953.1|  hypothetical protein                               102   7e-22   
ref|WP_025941536.1|  hypothetical protein                               102   7e-22   
ref|WP_006529612.1|  hypothetical protein                               102   8e-22   
ref|WP_025980344.1|  hypothetical protein                               102   8e-22   
ref|WP_009627937.1|  hypothetical protein                               102   8e-22   
ref|WP_011144378.1|  hypothetical protein                               102   9e-22   
ref|WP_032518675.1|  methanol dehydrogenase                             102   9e-22   
ref|WP_032513424.1|  methanol dehydrogenase                             102   9e-22   
ref|WP_017319322.1|  hypothetical protein                               102   9e-22   
ref|WP_032516905.1|  methanol dehydrogenase                             102   1e-21   
ref|WP_002807112.1|  hypothetical protein                               102   1e-21   
ref|WP_032515312.1|  methanol dehydrogenase                             102   1e-21   
ref|WP_025920651.1|  hypothetical protein                               102   1e-21   
ref|WP_015230808.1|  hypothetical protein                               102   1e-21   
ref|WP_011818183.1|  MULTISPECIES: hypothetical protein                 102   1e-21   
ref|WP_025943323.1|  hypothetical protein                               102   1e-21   
ref|WP_039715568.1|  methanol dehydrogenase                             102   1e-21   
ref|WP_015111297.1|  hypothetical protein                               102   1e-21   
ref|WP_025938168.1|  hypothetical protein                               102   1e-21   
ref|WP_012594651.1|  hypothetical protein                               102   1e-21   
ref|WP_019489531.1|  hypothetical protein                               102   1e-21   
ref|WP_015783595.1|  hypothetical protein                               102   1e-21   
ref|WP_011376236.1|  hypothetical protein                               102   1e-21   
ref|WP_019508600.1|  hypothetical protein                               102   1e-21   
ref|WP_025933350.1|  hypothetical protein                               102   1e-21   
ref|WP_025900405.1|  MULTISPECIES: hypothetical protein                 102   1e-21   
ref|WP_015153309.1|  hypothetical protein                               102   2e-21   
ref|WP_032525954.1|  methanol dehydrogenase                             102   2e-21   
ref|WP_036898179.1|  methanol dehydrogenase                             102   2e-21   
ref|WP_029632682.1|  hypothetical protein [                             102   2e-21   
ref|WP_025926271.1|  hypothetical protein                               101   2e-21   
ref|WP_032522239.1|  methanol dehydrogenase                             101   2e-21   
ref|WP_015166202.1|  hypothetical protein                               101   2e-21   
ref|WP_036903747.1|  methanol dehydrogenase                             101   2e-21   
ref|WP_011820067.1|  hypothetical protein                               101   2e-21   
ref|WP_011431197.1|  hypothetical protein                               100   2e-21   
ref|WP_022605185.1|  beta-propeller domains of methanol dehydroge...    101   2e-21   
ref|WP_012007496.1|  hypothetical protein                               101   3e-21   
gb|KGG12548.1|  hypothetical protein EV05_1760                          101   3e-21   
ref|WP_015956457.1|  hypothetical protein                               101   3e-21   
ref|WP_025931673.1|  hypothetical protein                               101   3e-21   
ref|WP_019474132.1|  hypothetical protein                               100   3e-21   
ref|WP_006041407.1|  hypothetical protein                               100   5e-21   
ref|WP_009545771.1|  MULTISPECIES: hypothetical protein                 100   5e-21   
ref|WP_015161018.1|  hypothetical protein                               100   6e-21   
ref|WP_015226949.1|  hypothetical protein                               100   7e-21   
ref|WP_023171690.1|  beta-propeller domains of methanol dehydroge...  99.8    9e-21   
ref|WP_011933110.1|  hypothetical protein                             99.4    1e-20   
ref|WP_025935778.1|  hypothetical protein                             99.4    1e-20   
ref|WP_015193151.1|  hypothetical protein                             99.0    2e-20   
ref|WP_015223195.1|  hypothetical protein                             99.0    2e-20   
ref|WP_018396828.1|  hypothetical protein                             98.2    3e-20   
ref|WP_026785458.1|  MULTISPECIES: hypothetical protein               98.2    3e-20   
ref|WP_026796339.1|  hypothetical protein                             98.2    3e-20   
gb|KEI66902.1|  hypothetical protein A19Y_1923                        97.8    4e-20   
ref|WP_026795902.1|  MULTISPECIES: hypothetical protein               97.8    4e-20   
ref|WP_006194839.1|  hypothetical protein                             97.8    4e-20   
ref|WP_007308062.1|  hypothetical protein                             97.8    4e-20   
gb|EKD06329.1|  hypothetical protein SPLC1_S542740                    95.9    1e-19   
ref|WP_015218127.1|  hypothetical protein                             96.3    1e-19   
ref|WP_006669763.1|  MULTISPECIES: hypothetical protein               95.9    2e-19   
ref|WP_006620265.1|  hypothetical protein                             95.9    2e-19   
ref|WP_002790638.1|  hypothetical protein                             94.7    4e-19   
ref|WP_036485623.1|  methanol dehydrogenase                           94.7    4e-19   
ref|WP_002804615.1|  hypothetical protein                             94.7    4e-19   
ref|WP_024545455.1|  hypothetical protein                             94.4    6e-19   
ref|WP_012306015.1|  hypothetical protein                             94.4    6e-19   
ref|WP_030006154.1|  hypothetical protein                             94.4    6e-19   
ref|WP_015134809.1|  hypothetical protein                             94.4    6e-19   
ref|WP_026148814.1|  hypothetical protein                             93.6    1e-18   
ref|WP_015142521.1|  hypothetical protein                             93.6    1e-18   
ref|WP_006512457.1|  hypothetical protein                             93.2    1e-18   
gb|AIE75018.1|  hypothetical protein D082_24900                       93.2    1e-18   
dbj|GAL91873.1|  cell division protein FtsI/penicillin-binding pr...  93.2    2e-18   
ref|WP_002736671.1|  hypothetical protein                             93.2    2e-18   
ref|WP_012266581.1|  hypothetical protein                             93.2    2e-18   
ref|WP_008201267.1|  hypothetical protein                             92.8    2e-18   
ref|WP_002775882.1|  hypothetical protein                             92.8    2e-18   
ref|WP_002754361.1|  hypothetical protein                             92.8    2e-18   
ref|WP_002758255.1|  hypothetical protein                             92.8    2e-18   
ref|WP_010871939.1|  hypothetical protein                             92.8    2e-18   
ref|WP_013323311.1|  hypothetical protein                             92.8    2e-18   
ref|XP_005539029.1|  hypothetical protein, conserved                  88.6    3e-16   
ref|WP_029953180.1|  hypothetical protein                             82.4    3e-16   
ref|XP_005704117.1|  thylakoid lumen 15.0 kDa protein                 86.7    6e-16   
ref|XP_005643264.1|  hypothetical protein COCSUDRAFT_38534            82.0    7e-15   
ref|XP_005851018.1|  hypothetical protein CHLNCDRAFT_29935            81.3    4e-14   
gb|AES96453.2|  thylakoid lumenal 15.0 kDa protein                    77.4    4e-14   
ref|WP_029983736.1|  hypothetical protein                             77.4    1e-13   
ref|WP_025939018.1|  hypothetical protein                             69.7    9e-11   
ref|XP_005835151.1|  hypothetical protein GUITHDRAFT_86181            70.9    1e-10   
tpg|DAA38602.1|  TPA: hypothetical protein ZEAMMB73_587127            65.1    4e-10   
ref|WP_025924363.1|  hypothetical protein                             60.5    8e-08   
dbj|BAJ96789.1|  predicted protein                                    58.9    2e-07   
dbj|BAJ95424.1|  predicted protein                                    57.8    8e-07   
ref|XP_002505638.1|  predicted protein                                57.8    2e-06   
ref|XP_002950026.1|  hypothetical protein VOLCADRAFT_90449            58.2    2e-06   
ref|XP_003059951.1|  predicted protein                                57.0    2e-06   
ref|XP_001697543.1|  predicted protein                                52.8    1e-04   
ref|XP_005710611.1|  unnamed protein product                          51.6    7e-04   



>gb|KEH42203.1| thylakoid lumenal 15.0 kDa protein [Medicago truncatula]
Length=239

 Score =   244 bits (622),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRL QEIAD+EKDTGFKLRVLAQNYP+TPGLA+KDFW+VDD T+VFVADPTFGN
Sbjct  115  LSDGQEKRLVQEIADLEKDTGFKLRVLAQNYPDTPGLAVKDFWQVDDSTVVFVADPTFGN  174

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLDIPRSFWSRLAGKYGNIFYW+EKGEDASIESAVMAIS+CLREPVGANN
Sbjct  175  ILNFNVGATVDLDIPRSFWSRLAGKYGNIFYWREKGEDASIESAVMAISSCLREPVGANN  234

Query  613  CSEVK  627
            CSEVK
Sbjct  235  CSEVK  239



>ref|XP_006428390.1| hypothetical protein CICLE_v10012670mg [Citrus clementina]
 ref|XP_006493006.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR41630.1| hypothetical protein CICLE_v10012670mg [Citrus clementina]
Length=226

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE+RLAQEIAD+EKDTGFKLRVLAQNYPETPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  102  LSDGQERRLAQEIADLEKDTGFKLRVLAQNYPETPGLAIKDFWQVDDRTIVFVADPTFGN  161

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIE+AV+AIS CLREPVG NN
Sbjct  162  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIEAAVVAISNCLREPVGPNN  221

Query  613  CSEVK  627
            CSEVK
Sbjct  222  CSEVK  226



>gb|KCW89390.1| hypothetical protein EUGRSUZ_A01683 [Eucalyptus grandis]
Length=238

 Score =   243 bits (619),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLAQEIADIEKDTGFKLRVLAQNYP+TPGLAIKDFW VDD+TIVFVADPTFGN
Sbjct  114  LSDGQEKRLAQEIADIEKDTGFKLRVLAQNYPDTPGLAIKDFWSVDDQTIVFVADPTFGN  173

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            I+NFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDAS+E+AVMAIS CLREPVGANN
Sbjct  174  IINFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASVEAAVMAISNCLREPVGANN  233

Query  613  CSEVK  627
            CSEVK
Sbjct  234  CSEVK  238



>gb|KDO49315.1| hypothetical protein CISIN_1g038271mg [Citrus sinensis]
Length=158

 Score =   239 bits (611),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE+RLAQEIAD+EKDTGFKLRVLAQNYPETPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  34   LSDGQERRLAQEIADLEKDTGFKLRVLAQNYPETPGLAIKDFWQVDDRTIVFVADPTFGN  93

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIE+AV+AIS CLREPVG NN
Sbjct  94   ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIEAAVVAISNCLREPVGPNN  153

Query  613  CSEVK  627
            CSEVK
Sbjct  154  CSEVK  158



>ref|XP_004249484.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
[Solanum lycopersicum]
Length=219

 Score =   241 bits (616),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLAQEI DIEKDTGFKLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  95   LSDGQEKRLAQEITDIEKDTGFKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  154

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLDIPRSFWSRLAG YGN+FYWKEKGEDASIE+AVMAIS+CLREPVG NN
Sbjct  155  ILNFNVGATVDLDIPRSFWSRLAGTYGNMFYWKEKGEDASIEAAVMAISSCLREPVGPNN  214

Query  613  CSEVK  627
            CSEVK
Sbjct  215  CSEVK  219



>ref|XP_009785062.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
[Nicotiana sylvestris]
Length=226

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLAQEI DIEKDTGFKLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  102  LSDGQEKRLAQEITDIEKDTGFKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  161

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLDIPRSFWSRLAG+YGN+FYWKEKGEDASIE+AVMAIS CLREPVG NN
Sbjct  162  ILNFNVGATVDLDIPRSFWSRLAGQYGNMFYWKEKGEDASIEAAVMAISTCLREPVGPNN  221

Query  613  CSEVK  627
            CSEVK
Sbjct  222  CSEVK  226



>ref|XP_002282285.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
[Vitis vinifera]
 emb|CBI32773.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLAQEI +IEKDTGFKLRVLAQNYP+TPGLAIK+FW+VDDRTIVFVADPTFGN
Sbjct  96   LSDGQEKRLAQEITNIEKDTGFKLRVLAQNYPDTPGLAIKEFWQVDDRTIVFVADPTFGN  155

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIE+AVMAIS CLREPVG NN
Sbjct  156  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIEAAVMAISNCLREPVGPNN  215

Query  613  CSEVK  627
            CSEVK
Sbjct  216  CSEVK  220



>ref|XP_004143269.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
[Cucumis sativus]
 gb|KGN48184.1| hypothetical protein Csa_6G446440 [Cucumis sativus]
Length=228

 Score =   240 bits (612),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE RL QEIADIEKDTG+KLRVLAQNYP TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  104  LSDGQEIRLKQEIADIEKDTGYKLRVLAQNYPVTPGLAIKDFWQVDDRTIVFVADPTFGN  163

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLDIPRSFWSRLAGKYGNIFYWKEKGED+SIESAVMAIS+CLREPVGANN
Sbjct  164  ILNFNVGATVDLDIPRSFWSRLAGKYGNIFYWKEKGEDSSIESAVMAISSCLREPVGANN  223

Query  613  CSEVK  627
            CSE+K
Sbjct  224  CSEIK  228



>ref|XP_004156281.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
[Cucumis sativus]
Length=228

 Score =   240 bits (612),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE RL QEIADIEKDTG+KLRVLAQNYP TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  104  LSDGQEIRLKQEIADIEKDTGYKLRVLAQNYPVTPGLAIKDFWQVDDRTIVFVADPTFGN  163

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLDIPRSFWSRLAGKYGNIFYWKEKGED+SIESAVMAIS+CLREPVGANN
Sbjct  164  ILNFNVGATVDLDIPRSFWSRLAGKYGNIFYWKEKGEDSSIESAVMAISSCLREPVGANN  223

Query  613  CSEVK  627
            CSE+K
Sbjct  224  CSEIK  228



>gb|KDP29148.1| hypothetical protein JCGZ_16537 [Jatropha curcas]
Length=225

 Score =   239 bits (611),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKR+ +EIADIEKDTGFKLRVLAQNYP+TPGLAI+DFW+VDDRTIVFVADPTFGN
Sbjct  101  LSDGQEKRIVEEIADIEKDTGFKLRVLAQNYPDTPGLAIRDFWQVDDRTIVFVADPTFGN  160

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVD+DIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS+CLREPVG NN
Sbjct  161  ILNFNVGASVDIDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGPNN  220

Query  613  CSEVK  627
            CSEVK
Sbjct  221  CSEVK  225



>ref|XP_002519497.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42911.1| conserved hypothetical protein [Ricinus communis]
Length=256

 Score =   240 bits (613),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLAQEI DIEKDTGFKLRVLAQNYP+TPGLAIKDFW VDDRTIVFVADPTFGN
Sbjct  98   LSDGQEKRLAQEIQDIEKDTGFKLRVLAQNYPDTPGLAIKDFWRVDDRTIVFVADPTFGN  157

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGAS+DLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAIS CLREPVG NN
Sbjct  158  ILNFNVGASIDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISNCLREPVGPNN  217

Query  613  CSEV  624
            CSE+
Sbjct  218  CSEL  221



>ref|XP_006339080.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
[Solanum tuberosum]
Length=222

 Score =   239 bits (609),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLAQEI DIEKDTGFKLRVLAQNYP+TPGLAIKD+W+VDD+TIVFVADPTFGN
Sbjct  98   LSDGQEKRLAQEITDIEKDTGFKLRVLAQNYPDTPGLAIKDYWQVDDKTIVFVADPTFGN  157

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLDIPRSFWSRLAG YGN+FYWKEKGEDASIE+AVMAIS+CLREPVG NN
Sbjct  158  ILNFNVGATVDLDIPRSFWSRLAGTYGNMFYWKEKGEDASIEAAVMAISSCLREPVGPNN  217

Query  613  CSEVK  627
            CSEVK
Sbjct  218  CSEVK  222



>ref|XP_004497532.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
[Cicer arietinum]
Length=232

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLAQEIA +EKD G KLRVLAQNYP+TPGLA+KDFW+VDDRT+VFVADPTFGN
Sbjct  108  LSEGQEKRLAQEIAALEKDVGVKLRVLAQNYPDTPGLAVKDFWQVDDRTVVFVADPTFGN  167

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYW+EKGEDASIESAVMAIS+CLREPVG NN
Sbjct  168  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWREKGEDASIESAVMAISSCLREPVGPNN  227

Query  613  CSEVK  627
            CSEVK
Sbjct  228  CSEVK  232



>gb|KCW89388.1| hypothetical protein EUGRSUZ_A01683 [Eucalyptus grandis]
Length=245

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLAQEIADIEKDTGFKLRVLAQNYP+TPGLAIKDFW VDD+TIVFVADPTFGN
Sbjct  114  LSDGQEKRLAQEIADIEKDTGFKLRVLAQNYPDTPGLAIKDFWSVDDQTIVFVADPTFGN  173

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            I+NFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDAS+E+AVMAIS CLREPVGANN
Sbjct  174  IINFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASVEAAVMAISNCLREPVGANN  233

Query  613  CSE  621
            CSE
Sbjct  234  CSE  236



>gb|ABK96655.1| unknown [Populus trichocarpa x Populus deltoides]
Length=220

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLA+EI+DIEKDTGFKLRVLAQNYP+TPGLAI+DFW+VDDRT+VFVADP FGN
Sbjct  96   LSDGQEKRLAEEISDIEKDTGFKLRVLAQNYPDTPGLAIRDFWQVDDRTVVFVADPNFGN  155

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS+CLREPVG NN
Sbjct  156  ILNFNVGASVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGPNN  215

Query  613  CSEVK  627
            CSEVK
Sbjct  216  CSEVK  220



>ref|XP_010253980.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
isoform X2 [Nelumbo nucifera]
Length=224

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRL QEIAD+E+DTGFKLR+LAQNYP+TPGLAI+DFW+VDDRTIVFVADPTFGN
Sbjct  100  LSAGQEKRLTQEIADLERDTGFKLRILAQNYPDTPGLAIRDFWQVDDRTIVFVADPTFGN  159

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS CLREPVG +N
Sbjct  160  ILNFNVGASVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISNCLREPVGPSN  219

Query  613  CSEVK  627
            CSEVK
Sbjct  220  CSEVK  224



>ref|XP_002322890.1| hypothetical protein POPTR_0016s09350g [Populus trichocarpa]
 gb|EEF04651.1| hypothetical protein POPTR_0016s09350g [Populus trichocarpa]
Length=215

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLA+EI+DIEKDTGFKLRVLAQNYP+TPGLAI+DFW+VDDRT+VFVADP FGN
Sbjct  91   LSDGQEKRLAEEISDIEKDTGFKLRVLAQNYPDTPGLAIRDFWQVDDRTVVFVADPNFGN  150

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS+CLREPVG NN
Sbjct  151  ILNFNVGASVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGPNN  210

Query  613  CSEVK  627
            CSEVK
Sbjct  211  CSEVK  215



>ref|XP_006398781.1| hypothetical protein EUTSA_v10014610mg [Eutrema salsugineum]
 gb|ESQ40234.1| hypothetical protein EUTSA_v10014610mg [Eutrema salsugineum]
Length=222

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKR+A+EI+D+EKDTGFKLRVLAQNYPETPGLAIKDFW+VDD TIVFVADPTFGN
Sbjct  98   LSNGQEKRIAKEISDLEKDTGFKLRVLAQNYPETPGLAIKDFWQVDDSTIVFVADPTFGN  157

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS+CLREPVG NN
Sbjct  158  ILNFNVGATVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGPNN  217

Query  613  CSEVK  627
            C+E+K
Sbjct  218  CAEIK  222



>ref|XP_010253979.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=225

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QEKRL QEIAD+E+DTGFKLR+LAQNYP+TPGLAI+DFW+VDDRTIVFVADPTFGNILNF
Sbjct  105  QEKRLTQEIADLERDTGFKLRILAQNYPDTPGLAIRDFWQVDDRTIVFVADPTFGNILNF  164

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANNCSEV  624
            NVGASVDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS CLREPVG +NCSEV
Sbjct  165  NVGASVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISNCLREPVGPSNCSEV  224

Query  625  K  627
            K
Sbjct  225  K  225



>gb|AFK45260.1| unknown [Lotus japonicus]
Length=239

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLAQEIA IEKDTGFKLRVLAQNYP+TPGLA+KDFW+VDDRTIVFVADPTFGN
Sbjct  115  LSDGQEKRLAQEIAAIEKDTGFKLRVLAQNYPDTPGLAVKDFWQVDDRTIVFVADPTFGN  174

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFW RLAGKYGNIFYW++KGEDAS+E+AVMAIS+CLREPVG NN
Sbjct  175  ILNFNVGASVDLDIPRSFWGRLAGKYGNIFYWRDKGEDASVEAAVMAISSCLREPVGPNN  234

Query  613  CSEV  624
            CSEV
Sbjct  235  CSEV  238



>ref|XP_010050932.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
isoform X2 [Eucalyptus grandis]
Length=261

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLAQEIADIEKDTGFKLRVLAQNYP+TPGLAIKDFW VDD+TIVFVADPTFGN
Sbjct  114  LSDGQEKRLAQEIADIEKDTGFKLRVLAQNYPDTPGLAIKDFWSVDDQTIVFVADPTFGN  173

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            I+NFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDAS+E+AVMAIS CLREPVGANN
Sbjct  174  IINFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASVEAAVMAISNCLREPVGANN  233

Query  613  CSE  621
            CSE
Sbjct  234  CSE  236



>ref|XP_008462470.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
[Cucumis melo]
Length=228

 Score =   237 bits (605),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE RL QEIADIEKDTG+KLRVLAQNYP TPGLA+KDFW+VDDRTIVFVADPTFGN
Sbjct  104  LSDGQEIRLKQEIADIEKDTGYKLRVLAQNYPATPGLAVKDFWQVDDRTIVFVADPTFGN  163

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLDIPRSFWSRLAGKYGNIFYWKEKGED+SIESAVMAIS+CLREPVG NN
Sbjct  164  ILNFNVGATVDLDIPRSFWSRLAGKYGNIFYWKEKGEDSSIESAVMAISSCLREPVGPNN  223

Query  613  CSEVK  627
            CSE+K
Sbjct  224  CSEIK  228



>ref|XP_009588210.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
[Nicotiana tomentosiformis]
Length=226

 Score =   237 bits (604),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLA+EI DIEK TGFKLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  102  LSDGQEKRLAEEITDIEKVTGFKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  161

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLDIPRSFWSRLAG+YGN+FYWKEKGEDASIE+AVMAIS CLREPVG NN
Sbjct  162  ILNFNVGATVDLDIPRSFWSRLAGQYGNMFYWKEKGEDASIEAAVMAISTCLREPVGPNN  221

Query  613  CSEVK  627
            CSEVK
Sbjct  222  CSEVK  226



>ref|XP_006281063.1| hypothetical protein CARUB_v10027083mg [Capsella rubella]
 gb|EOA13961.1| hypothetical protein CARUB_v10027083mg [Capsella rubella]
Length=222

 Score =   237 bits (604),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKR+A+EIAD+EKDTGFKLRVLAQNYP TPGLAIKDFW+VDD TIVFVADPTFGN
Sbjct  98   LSNGQEKRIAKEIADLEKDTGFKLRVLAQNYPVTPGLAIKDFWQVDDSTIVFVADPTFGN  157

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS+CLREPVGANN
Sbjct  158  ILNFNVGASVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGANN  217

Query  613  CSEVK  627
            C+E++
Sbjct  218  CAEIQ  222



>ref|XP_010445424.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
[Camelina sativa]
Length=222

 Score =   237 bits (604),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKR+A+EIAD+EKDTGFKLRVLAQNYP TPGLAIKDFW+VDD TIVFVADPTFGN
Sbjct  98   LSNGQEKRIAKEIADLEKDTGFKLRVLAQNYPVTPGLAIKDFWQVDDSTIVFVADPTFGN  157

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLD+PRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS+CLREPVGANN
Sbjct  158  ILNFNVGATVDLDVPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGANN  217

Query  613  CSEVK  627
            C+E+K
Sbjct  218  CAEIK  222



>gb|KHG05147.1| hypothetical protein F383_08683 [Gossypium arboreum]
 gb|KHG13351.1| hypothetical protein F383_04797 [Gossypium arboreum]
 gb|KHG21917.1| hypothetical protein F383_07726 [Gossypium arboreum]
Length=207

 Score =   236 bits (602),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRL QEI+DIEKDTGFKLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  83   LSDGQEKRLIQEISDIEKDTGFKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  142

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVG SVDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS CLREPVG NN
Sbjct  143  ILNFNVGDSVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISNCLREPVGPNN  202

Query  613  CSEVK  627
            CSEVK
Sbjct  203  CSEVK  207



>ref|XP_010050927.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
isoform X1 [Eucalyptus grandis]
 gb|KCW89389.1| hypothetical protein EUGRSUZ_A01683 [Eucalyptus grandis]
Length=281

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLAQEIADIEKDTGFKLRVLAQNYP+TPGLAIKDFW VDD+TIVFVADPTFGN
Sbjct  114  LSDGQEKRLAQEIADIEKDTGFKLRVLAQNYPDTPGLAIKDFWSVDDQTIVFVADPTFGN  173

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            I+NFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDAS+E+AVMAIS CLREPVGANN
Sbjct  174  IINFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASVEAAVMAISNCLREPVGANN  233

Query  613  CSE  621
            CSE
Sbjct  234  CSE  236



>ref|XP_011014881.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
[Populus euphratica]
Length=220

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLA+EI+DIEKDTGFKLRVLAQNYP+TPGLAI+DFW+VDDRT+VFVADP FGN
Sbjct  96   LSDGQEKRLAEEISDIEKDTGFKLRVLAQNYPDTPGLAIRDFWQVDDRTVVFVADPNFGN  155

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS+CLREPVG NN
Sbjct  156  ILNFNVGASVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGPNN  215

Query  613  CSEVK  627
            CS+VK
Sbjct  216  CSDVK  220



>ref|XP_007205863.1| hypothetical protein PRUPE_ppa011178mg [Prunus persica]
 gb|EMJ07062.1| hypothetical protein PRUPE_ppa011178mg [Prunus persica]
Length=220

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLAQEI DIEKDTGFKLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  96   LSDGQEKRLAQEIDDIEKDTGFKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  155

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLD+PRSFWSRLAGKYGN+FYWKEKGED +IE+AV+AIS+CL+EPVG++N
Sbjct  156  ILNFNVGASVDLDVPRSFWSRLAGKYGNMFYWKEKGEDGAIEAAVVAISSCLKEPVGSDN  215

Query  613  CSEVK  627
            CSEVK
Sbjct  216  CSEVK  220



>ref|NP_001147270.1| permeases of the major facilitator superfamily [Zea mays]
 gb|ACG26491.1| permeases of the major facilitator superfamily [Zea mays]
Length=224

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKR+A+EI+D+EKDTGFKLRVLAQNYP TPGLAIKD+W+VDD TIVFVADPTFGN
Sbjct  100  LSDGQEKRIAEEISDLEKDTGFKLRVLAQNYPVTPGLAIKDYWQVDDSTIVFVADPTFGN  159

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS+CLREPVGANN
Sbjct  160  ILNFNVGASVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGANN  219

Query  613  CSEV  624
            C+EV
Sbjct  220  CAEV  223



>ref|XP_008387571.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
isoform X1 [Malus domestica]
Length=226

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLA+EIADIEK TG+KLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  102  LSDGQEKRLAEEIADIEKYTGYKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  161

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLD+PRSFWSRLAGKYGN+FYWKEKGED +IESAVMAIS+CL+EPV ANN
Sbjct  162  ILNFNVGASVDLDVPRSFWSRLAGKYGNMFYWKEKGEDGAIESAVMAISSCLKEPVDANN  221

Query  613  CSEVK  627
            CSEVK
Sbjct  222  CSEVK  226



>ref|XP_008387572.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
isoform X2 [Malus domestica]
Length=224

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLA+EIADIEK TG+KLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  100  LSDGQEKRLAEEIADIEKYTGYKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  159

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLD+PRSFWSRLAGKYGN+FYWKEKGED +IESAVMAIS+CL+EPV ANN
Sbjct  160  ILNFNVGASVDLDVPRSFWSRLAGKYGNMFYWKEKGEDGAIESAVMAISSCLKEPVDANN  219

Query  613  CSEVK  627
            CSEVK
Sbjct  220  CSEVK  224



>emb|CDY66968.1| BnaAnng23280D [Brassica napus]
Length=224

 Score =   234 bits (598),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKR+A+EI+D+EKDTGFKLRVLAQNYP TPGLAIKD+W+VDD TIVFVADPTFGN
Sbjct  100  LSDGQEKRIAEEISDLEKDTGFKLRVLAQNYPVTPGLAIKDYWQVDDSTIVFVADPTFGN  159

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS+CLREPVGANN
Sbjct  160  ILNFNVGASVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGANN  219

Query  613  CSEV  624
            C+EV
Sbjct  220  CAEV  223



>ref|XP_010906130.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=222

 Score =   234 bits (598),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRL QEIAD+EKDTGFKLR+L+QNYP+TPGLA+KDFWEVDDRTIVFVADPTFGN
Sbjct  98   LSAGQEKRLCQEIADLEKDTGFKLRILSQNYPDTPGLAVKDFWEVDDRTIVFVADPTFGN  157

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLD+PRSFWSRL+GKYGN+FYWKEKGEDASIE+AVMAIS CLR+PVG NN
Sbjct  158  ILNFNVGASVDLDVPRSFWSRLSGKYGNMFYWKEKGEDASIEAAVMAISNCLRDPVGPNN  217

Query  613  CSEVK  627
            CS+VK
Sbjct  218  CSDVK  222



>ref|XP_009376825.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009334665.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=224

 Score =   234 bits (596),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLA+EIADIEK TG+KLRVLAQNYP+TPGLAIKDFW VDDRTIVFVADPTFGN
Sbjct  100  LSDGQEKRLAEEIADIEKYTGYKLRVLAQNYPDTPGLAIKDFWRVDDRTIVFVADPTFGN  159

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLD+PRSFWSRLAGKYGN+FYWKEKGED +IESAVMAIS+CL+EPV ANN
Sbjct  160  ILNFNVGASVDLDVPRSFWSRLAGKYGNMFYWKEKGEDGAIESAVMAISSCLKEPVDANN  219

Query  613  CSEVK  627
            CSEVK
Sbjct  220  CSEVK  224



>ref|XP_011077324.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
[Sesamum indicum]
Length=224

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKR+AQEI  +EKDTG+KLRVLAQNYP+TPGLAIKDFW+VDD TIVFVADPTFGN
Sbjct  100  LSDGQEKRIAQEIDALEKDTGYKLRVLAQNYPDTPGLAIKDFWKVDDNTIVFVADPTFGN  159

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIE+AVMAIS+CLREP GANN
Sbjct  160  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIEAAVMAISSCLREPAGANN  219

Query  613  CSEVK  627
            CSEV+
Sbjct  220  CSEVR  224



>ref|XP_009376824.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009334664.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=226

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLA+EIADIEK TG+KLRVLAQNYP+TPGLAIKDFW VDDRTIVFVADPTFGN
Sbjct  102  LSDGQEKRLAEEIADIEKYTGYKLRVLAQNYPDTPGLAIKDFWRVDDRTIVFVADPTFGN  161

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLD+PRSFWSRLAGKYGN+FYWKEKGED +IESAVMAIS+CL+EPV ANN
Sbjct  162  ILNFNVGASVDLDVPRSFWSRLAGKYGNMFYWKEKGEDGAIESAVMAISSCLKEPVDANN  221

Query  613  CSEVK  627
            CSEVK
Sbjct  222  CSEVK  226



>emb|CDY44363.1| BnaC02g03140D [Brassica napus]
Length=224

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKR+A+EI+D+EKDTGFKLRVLAQNYP TPGLAIKD+W+VDD TIVFVADPTFGN
Sbjct  100  LSDGQEKRIAEEISDLEKDTGFKLRVLAQNYPVTPGLAIKDYWQVDDSTIVFVADPTFGN  159

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS+CLREPVGANN
Sbjct  160  ILNFNVGASVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGANN  219

Query  613  CSEV  624
            C+EV
Sbjct  220  CAEV  223



>ref|XP_007027395.1| Thylakoid lumenal 15.0 kDa protein 2 isoform 1 [Theobroma cacao]
 gb|EOY07897.1| Thylakoid lumenal 15.0 kDa protein 2 isoform 1 [Theobroma cacao]
Length=258

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLA+EI +IEKDTGFKLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  134  LSDGQEKRLAEEIGNIEKDTGFKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  193

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AV+AIS CLREPVG NN
Sbjct  194  ILNFNVGASVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVLAISNCLREPVGPNN  253

Query  613  CSEVK  627
            CSEVK
Sbjct  254  CSEVK  258



>ref|XP_008243991.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
[Prunus mume]
 ref|XP_008243993.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
[Prunus mume]
Length=222

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLAQEI +IEKDTGFKLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  98   LSDGQEKRLAQEIDNIEKDTGFKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  157

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLD+PRSFWSRLAGKYGN+FYWKEKGED +IE+AV+AIS+CL+EPVG++N
Sbjct  158  ILNFNVGASVDLDVPRSFWSRLAGKYGNMFYWKEKGEDGAIEAAVVAISSCLKEPVGSDN  217

Query  613  CSEVK  627
            CSEVK
Sbjct  218  CSEVK  222



>ref|XP_008808238.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=223

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRL QEI D+EKDTGFKLR+LAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  99   LSAGQEKRLLQEIEDLEKDTGFKLRILAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  158

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRL+GKYGN+FYWKEKGEDAS+E+AV+AIS CLREPVG NN
Sbjct  159  ILNFNVGASVDLDIPRSFWSRLSGKYGNMFYWKEKGEDASVEAAVIAISNCLREPVGPNN  218

Query  613  CSEVK  627
            CS+VK
Sbjct  219  CSDVK  223



>ref|XP_008808234.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
isoform X1 [Phoenix dactylifera]
 ref|XP_008808236.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
isoform X1 [Phoenix dactylifera]
 ref|XP_008808237.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=226

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRL QEI D+EKDTGFKLR+LAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  99   LSAGQEKRLLQEIEDLEKDTGFKLRILAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  158

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRL+GKYGN+FYWKEKGEDAS+E+AV+AIS CLREPVG NN
Sbjct  159  ILNFNVGASVDLDIPRSFWSRLSGKYGNMFYWKEKGEDASVEAAVIAISNCLREPVGPNN  218

Query  613  CSEVK  627
            CS+VK
Sbjct  219  CSDVK  223



>ref|XP_002864205.1| thylakoid lumen 15.0 kDa protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40464.1| thylakoid lumen 15.0 kDa protein [Arabidopsis lyrata subsp. lyrata]
Length=222

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKR+AQEIA++EKDTGFKLRVLAQNYP TPGLAIKDFW+VDD TIVFVADPTFGN
Sbjct  98   LSNGQEKRIAQEIANLEKDTGFKLRVLAQNYPVTPGLAIKDFWQVDDSTIVFVADPTFGN  157

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS+CLREPVG NN
Sbjct  158  ILNFNVGATVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGPNN  217

Query  613  CSEVK  627
            C+E++
Sbjct  218  CAEIQ  222



>ref|XP_010442851.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
[Camelina sativa]
Length=222

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKR+A+EIAD+EKDTGFKLRVLAQNYP TPGLAIKDFW+VDD TIVFVADPTFGN
Sbjct  98   LSNGQEKRIAKEIADLEKDTGFKLRVLAQNYPVTPGLAIKDFWQVDDSTIVFVADPTFGN  157

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS+CLREPVG  N
Sbjct  158  ILNFNVGATVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGPTN  217

Query  613  CSEVK  627
            C+E+K
Sbjct  218  CAEIK  222



>emb|CDP06770.1| unnamed protein product [Coffea canephora]
Length=235

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE RLAQEIA IEKDTGFKLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  111  LSDGQENRLAQEIAAIEKDTGFKLRVLAQNYPDTPGLAIKDFWKVDDRTIVFVADPTFGN  170

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVD+D+PRSFW RLAGKYGN+FYWKEKGEDASIE+AV+AI  CLREPVGANN
Sbjct  171  ILNFNVGASVDIDVPRSFWGRLAGKYGNMFYWKEKGEDASIEAAVVAIGNCLREPVGANN  230

Query  613  CSEVK  627
            CSEVK
Sbjct  231  CSEVK  235



>ref|XP_010482679.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
[Camelina sativa]
Length=222

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKR+A+EIAD+EKDTGFKLRVLAQNYP TPGLAIKDFW+VDD TIVFVADPTFGN
Sbjct  98   LSNGQEKRIAKEIADLEKDTGFKLRVLAQNYPVTPGLAIKDFWQVDDSTIVFVADPTFGN  157

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS+CLREPVG  N
Sbjct  158  ILNFNVGATVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGPTN  217

Query  613  CSEVK  627
            C+E+K
Sbjct  218  CAEIK  222



>ref|XP_007027396.1| Thylakoid lumenal 15.0 kDa protein 2 isoform 2 [Theobroma cacao]
 gb|EOY07898.1| Thylakoid lumenal 15.0 kDa protein 2 isoform 2 [Theobroma cacao]
Length=230

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLA+EI +IEKDTGFKLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  100  LSDGQEKRLAEEIGNIEKDTGFKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  159

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AV+AIS CLREPVG NN
Sbjct  160  ILNFNVGASVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVLAISNCLREPVGPNN  219

Query  613  CSE  621
            CSE
Sbjct  220  CSE  222



>ref|XP_004304457.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=217

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLAQEIA+IEKDTGFKLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  93   LSDGQEKRLAQEIANIEKDTGFKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  152

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA +DLD+PRSFWSRLAGKYGN+FYWKEKGED SIE+AV AIS+CLREPVG++N
Sbjct  153  ILNFNVGALIDLDVPRSFWSRLAGKYGNMFYWKEKGEDVSIEAAVTAISSCLREPVGSDN  212

Query  613  CSEVK  627
            CSEV+
Sbjct  213  CSEVR  217



>ref|XP_010906129.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=230

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            +EKRL QEIAD+EKDTGFKLR+L+QNYP+TPGLA+KDFWEVDDRTIVFVADPTFGNILNF
Sbjct  110  KEKRLCQEIADLEKDTGFKLRILSQNYPDTPGLAVKDFWEVDDRTIVFVADPTFGNILNF  169

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANNCSEV  624
            NVGASVDLD+PRSFWSRL+GKYGN+FYWKEKGEDASIE+AVMAIS CLR+PVG NNCS+V
Sbjct  170  NVGASVDLDVPRSFWSRLSGKYGNMFYWKEKGEDASIEAAVMAISNCLRDPVGPNNCSDV  229

Query  625  K  627
            K
Sbjct  230  K  230



>ref|XP_009125499.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
[Brassica rapa]
Length=224

 Score =   232 bits (592),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKR+A+EI+D+EKDTGFKLRVLAQNYP TPGLA+KD+W+VDD TIVFVADPTFGN
Sbjct  100  LSDGQEKRIAEEISDLEKDTGFKLRVLAQNYPVTPGLAMKDYWQVDDSTIVFVADPTFGN  159

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS+CLREPVGANN
Sbjct  160  ILNFNVGATVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGANN  219

Query  613  CSEV  624
            C+EV
Sbjct  220  CAEV  223



>ref|NP_568781.1| thylakoid lumenal protein 2 [Arabidopsis thaliana]
 sp|Q9LVV5.2|TL15B_ARATH RecName: Full=Thylakoid lumenal 15.0 kDa protein 2, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK82479.1| AT5g52970/MNB8_3 [Arabidopsis thaliana]
 gb|AAM10309.1| AT5g52970/MNB8_3 [Arabidopsis thaliana]
 gb|AED96284.1| thylakoid lumenal protein 2 [Arabidopsis thaliana]
Length=223

 Score =   232 bits (591),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKR+AQEIA++EKDTGFKLRVLAQNYP TPGLAIKDFW+VDD TIVFVADPTFGN
Sbjct  99   LSNGQEKRIAQEIANLEKDTGFKLRVLAQNYPVTPGLAIKDFWQVDDSTIVFVADPTFGN  158

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS+CLREPVG NN
Sbjct  159  ILNFNVGATVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGRNN  218

Query  613  CSEVK  627
            C+E++
Sbjct  219  CAEIQ  223



>ref|XP_007145211.1| hypothetical protein PHAVU_007G219800g [Phaseolus vulgaris]
 gb|ESW17205.1| hypothetical protein PHAVU_007G219800g [Phaseolus vulgaris]
Length=229

 Score =   232 bits (591),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLA EI  +E DTGFKLRVLAQNYP+TPGLA+KDFW VDDRT+VFVADPTFGN
Sbjct  105  LSDGQEKRLAAEIDALEADTGFKLRVLAQNYPDTPGLAVKDFWRVDDRTVVFVADPTFGN  164

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIE+AVMAIS CLREPVG NN
Sbjct  165  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIEAAVMAISNCLREPVGPNN  224

Query  613  CSEV  624
            CSEV
Sbjct  225  CSEV  228



>gb|EYU38557.1| hypothetical protein MIMGU_mgv1a013309mg [Erythranthe guttata]
Length=224

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE+R+AQEI  +EKDTG+KLR+LAQNYP+TPGLAIKDFW+VDD TIVFVADPTFGN
Sbjct  100  LSDGQERRIAQEIDALEKDTGYKLRLLAQNYPDTPGLAIKDFWKVDDNTIVFVADPTFGN  159

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDAS+E+AVMAIS CLREPV ANN
Sbjct  160  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASVEAAVMAISTCLREPVSANN  219

Query  613  CSEVK  627
            CSEVK
Sbjct  220  CSEVK  224



>ref|XP_010543409.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
[Tarenaya hassleriana]
Length=220

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE+R+A+EIAD+EKDTG+KLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  96   LSDGQEERIAREIADLEKDTGYKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  155

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVG +VDLD+PRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS CLREPVG NN
Sbjct  156  ILNFNVGETVDLDVPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISNCLREPVGPNN  215

Query  613  CSEVK  627
            C+EVK
Sbjct  216  CAEVK  220



>ref|NP_001239900.1| uncharacterized protein LOC100795443 [Glycine max]
 gb|ACU19994.1| unknown [Glycine max]
 gb|KHN39044.1| Thylakoid lumenal 15.0 kDa protein 2, chloroplastic [Glycine 
soja]
Length=229

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLA+EIA +E DTGFKLRVLAQNYP TPGLAIKDFW+VDDRT+VFVADPTFGN
Sbjct  105  LSDGQEKRLAEEIAALEADTGFKLRVLAQNYPVTPGLAIKDFWQVDDRTVVFVADPTFGN  164

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLD+PRSFW+RLAGKYGNIFYWKEKGEDASIE+AVMAIS+CLREPVG NN
Sbjct  165  ILNFNVGATVDLDVPRSFWNRLAGKYGNIFYWKEKGEDASIEAAVMAISSCLREPVGPNN  224

Query  613  CSEV  624
            CSEV
Sbjct  225  CSEV  228



>gb|EAZ04170.1| hypothetical protein OsI_26312 [Oryza sativa Indica Group]
 gb|EEE67315.1| hypothetical protein OsJ_24560 [Oryza sativa Japonica Group]
Length=162

 Score =   227 bits (579),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L P QE RL QEI D+EKDTG+KLRVLAQNYP+TPGLAIKDFW+VDD+TIVFVADPTFGN
Sbjct  38   LSPGQENRLRQEIEDLEKDTGYKLRVLAQNYPDTPGLAIKDFWQVDDQTIVFVADPTFGN  97

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            I+NFNVGA VDLDIPRSFWSR++GKYGN+F+WKEKGEDASIE+AVMA+S CLREP GANN
Sbjct  98   IINFNVGALVDLDIPRSFWSRVSGKYGNMFFWKEKGEDASIEAAVMAVSRCLREPTGANN  157

Query  613  CSEV  624
            CSEV
Sbjct  158  CSEV  161



>gb|KFK24794.1| hypothetical protein AALP_AA8G025800 [Arabis alpina]
Length=224

 Score =   229 bits (584),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE+RLA+EI D+EKDTGFKLRVLAQNYP TPGLAIKDFW+VDD TIVFVADPTFGN
Sbjct  100  LSNGQERRLAKEIDDLEKDTGFKLRVLAQNYPVTPGLAIKDFWQVDDSTIVFVADPTFGN  159

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLD+PRSFW+RLAGKYGN+FYWKEKGEDASIE+AVMAIS+CLREPVG NN
Sbjct  160  ILNFNVGATVDLDVPRSFWNRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGPNN  219

Query  613  CSEVK  627
            C+E++
Sbjct  220  CAEIQ  224



>ref|XP_010684052.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=213

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLA+EIA++E+DTGFKLR+LAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  89   LSSGQEKRLAEEIAELERDTGFKLRILAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  148

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVG  VDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIE+AV AI+ CL+EPVG +N
Sbjct  149  ILNFNVGDQVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIEAAVNAITYCLKEPVGPSN  208

Query  613  CSEVK  627
            CSEVK
Sbjct  209  CSEVK  213



>ref|XP_006588451.1| PREDICTED: uncharacterized protein LOC100795443 isoform X2 [Glycine 
max]
Length=230

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLA+EIA +E DTGFKLRVLAQNYP TPGLAIKDFW+VDDRT+VFVADPTFGN
Sbjct  105  LSDGQEKRLAEEIAALEADTGFKLRVLAQNYPVTPGLAIKDFWQVDDRTVVFVADPTFGN  164

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLD+PRSFW+RLAGKYGNIFYWKEKGEDASIE+AVMAIS+CLREPVG NN
Sbjct  165  ILNFNVGATVDLDVPRSFWNRLAGKYGNIFYWKEKGEDASIEAAVMAISSCLREPVGPNN  224

Query  613  CSE  621
            CSE
Sbjct  225  CSE  227



>ref|XP_006588450.1| PREDICTED: uncharacterized protein LOC100795443 isoform X1 [Glycine 
max]
Length=230

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLA+EIA +E DTGFKLRVLAQNYP TPGLAIKDFW+VDDRT+VFVADPTFGN
Sbjct  105  LSDGQEKRLAEEIAALEADTGFKLRVLAQNYPVTPGLAIKDFWQVDDRTVVFVADPTFGN  164

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLD+PRSFW+RLAGKYGNIFYWKEKGEDASIE+AVMAIS+CLREPVG NN
Sbjct  165  ILNFNVGATVDLDVPRSFWNRLAGKYGNIFYWKEKGEDASIEAAVMAISSCLREPVGPNN  224

Query  613  CSE  621
            CSE
Sbjct  225  CSE  227



>gb|ACU16481.1| unknown [Glycine max]
Length=228

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKRLA+EIA +E DTGFKLRV AQNYP TPGLAIKDFW+VDDRT+VFVADPTFGN
Sbjct  104  LSDGQEKRLAEEIAALEADTGFKLRVSAQNYPVTPGLAIKDFWQVDDRTVVFVADPTFGN  163

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA+VDLD+PRSFW+RLAGKYGNIFYWKEKGEDASIE+AVMAIS+CLREPVG NN
Sbjct  164  ILNFNVGATVDLDVPRSFWNRLAGKYGNIFYWKEKGEDASIEAAVMAISSCLREPVGPNN  223

Query  613  CSEV  624
            CSEV
Sbjct  224  CSEV  227



>gb|ABK25844.1| unknown [Picea sitchensis]
Length=243

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L P QE R+ QEI D+EKDTGFKLRVLAQNYPETPGLA++DFW+VDD T+VFVADPTFGN
Sbjct  119  LSPGQESRIIQEITDLEKDTGFKLRVLAQNYPETPGLAVRDFWQVDDNTVVFVADPTFGN  178

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGAS+DL+IPRSFW RLAGKYGNIFYW+EKGEDASIE+AV A+S+CLREP G+N 
Sbjct  179  ILNFNVGASIDLNIPRSFWGRLAGKYGNIFYWREKGEDASIEAAVSAVSSCLREPQGSNA  238

Query  613  CSEVK  627
            CSE+K
Sbjct  239  CSEIK  243



>ref|XP_006658638.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
[Oryza brachyantha]
Length=242

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE RL QEI D+EK+TG+KLRVLAQNYP+TPGLAIKDFW+VDD+TIVFVADPTFGN
Sbjct  118  LSAGQENRLRQEIEDLEKETGYKLRVLAQNYPDTPGLAIKDFWQVDDQTIVFVADPTFGN  177

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            I+NFNVGA VDLDIPRSFWSR++GKYGN+FYWKEKGEDASIE+AVMA+S CLREP GANN
Sbjct  178  IINFNVGALVDLDIPRSFWSRVSGKYGNMFYWKEKGEDASIEAAVMAVSRCLREPTGANN  237

Query  613  CSEV  624
            CSEV
Sbjct  238  CSEV  241



>ref|XP_006839157.1| hypothetical protein AMTR_s00097p00038600 [Amborella trichopoda]
 gb|ERN01726.1| hypothetical protein AMTR_s00097p00038600 [Amborella trichopoda]
Length=209

 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE R+ QEI ++EKDTGFKLRVLAQNYP+TPGLA+KD+W+VDD+TIVFVADP FGN
Sbjct  85   LSTGQEYRIIQEIVNLEKDTGFKLRVLAQNYPDTPGLAVKDYWQVDDKTIVFVADPAFGN  144

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA VDLD+PRSFWSRLAGKYGN+FYWKEKGEDAS+E+AV+AIS CLREPVG NN
Sbjct  145  ILNFNVGALVDLDVPRSFWSRLAGKYGNMFYWKEKGEDASVEAAVLAISRCLREPVGQNN  204

Query  613  CSEVK  627
            CSE++
Sbjct  205  CSEIE  209



>ref|XP_003581246.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
[Brachypodium distachyon]
Length=236

 Score =   221 bits (564),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE RL QEI D+EKDTG+KLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  112  LSSGQENRLRQEIEDLEKDTGYKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  171

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            I+NFN+G+ +DLDIP+SFWSR++GKYGN+FYWKEKGEDASIE AVMAIS CLREP GA+N
Sbjct  172  IINFNIGSLIDLDIPQSFWSRVSGKYGNMFYWKEKGEDASIEGAVMAISRCLREPTGASN  231

Query  613  CSEV  624
            CSEV
Sbjct  232  CSEV  235



>ref|XP_009384038.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=222

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L  SQE+RL +EIAD+EK+TG KLR+LAQNYP+TPG+A+KDFW+VD+RTIVFVADPTFGN
Sbjct  98   LSASQERRLCEEIADLEKETGVKLRILAQNYPDTPGMAVKDFWQVDERTIVFVADPTFGN  157

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            IL+FNVGA+VDLD+PR+FWSR+AGKYGN+FYWKEKGEDASIE+AVMAI++CLREP   NN
Sbjct  158  ILHFNVGATVDLDVPRNFWSRVAGKYGNMFYWKEKGEDASIEAAVMAITSCLREPTAPNN  217

Query  613  CSEV  624
            C EV
Sbjct  218  CMEV  221



>ref|XP_009384037.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=226

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L  SQE+RL +EIAD+EK+TG KLR+LAQNYP+TPG+A+KDFW+VD+RTIVFVADPTFGN
Sbjct  102  LSASQERRLCEEIADLEKETGVKLRILAQNYPDTPGMAVKDFWQVDERTIVFVADPTFGN  161

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            IL+FNVGA+VDLD+PR+FWSR+AGKYGN+FYWKEKGEDASIE+AVMAI++CLREP   NN
Sbjct  162  ILHFNVGATVDLDVPRNFWSRVAGKYGNMFYWKEKGEDASIEAAVMAITSCLREPTAPNN  221

Query  613  CSEV  624
            C EV
Sbjct  222  CMEV  225



>dbj|BAJ88857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=236

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE R+ QEI D+EKDTG+KLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  112  LSSGQENRIRQEIEDLEKDTGYKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  171

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            I+NFN+G+ +DLDIP+SFWSR+AGKYGN+FYWKEKGEDASIE AV AIS CLREP GA+N
Sbjct  172  IINFNIGSLIDLDIPQSFWSRVAGKYGNMFYWKEKGEDASIEGAVTAISRCLREPTGASN  231

Query  613  CSEV  624
            CSEV
Sbjct  232  CSEV  235



>dbj|BAJ87961.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=236

 Score =   219 bits (558),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE R+ QEI D+EKDTG+KLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  112  LSSGQENRIRQEIEDLEKDTGYKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  171

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            I+NFN+G+ +DLDIP+SFWSR+AGKYGN+FYWKEKGEDASIE AV AIS CLREP GA+N
Sbjct  172  IINFNIGSLIDLDIPQSFWSRVAGKYGNMFYWKEKGEDASIEGAVTAISRCLREPTGASN  231

Query  613  CSEV  624
            CSEV
Sbjct  232  CSEV  235



>gb|ACN31712.1| unknown [Zea mays]
 tpg|DAA38605.1| TPA: permease of the major facilitator family protein [Zea mays]
Length=244

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE RL QEI D+EKDTG+KLRVLAQNYP+TPGLAIKDFW+VD+RTIVFVADPTFGN
Sbjct  120  LSSGQENRLRQEIEDLEKDTGYKLRVLAQNYPDTPGLAIKDFWQVDERTIVFVADPTFGN  179

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            I+NFN+G  VDLD+PRSFWS+++GKYGN+FYWKEKGEDASIE+AV AIS CLR P G NN
Sbjct  180  IINFNIGPLVDLDVPRSFWSQVSGKYGNMFYWKEKGEDASIEAAVTAISRCLRNPAGTNN  239

Query  613  CSEV  624
            CSEV
Sbjct  240  CSEV  243



>ref|NP_001149917.1| permeases of the major facilitator superfamily [Zea mays]
 gb|ACG37193.1| permeases of the major facilitator superfamily [Zea mays]
Length=244

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE RL QEI D+EKDTG+KLRVLAQNYP+TPGLAIKDFW+VD+RTIVFVADPTFGN
Sbjct  120  LSSGQENRLRQEIEDLEKDTGYKLRVLAQNYPDTPGLAIKDFWQVDERTIVFVADPTFGN  179

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            I+NFN+G  VDLD+PRSFWS+++GKYGN+FYWKEKGEDASIE+AV AIS CLR P G NN
Sbjct  180  IINFNIGPLVDLDVPRSFWSQVSGKYGNMFYWKEKGEDASIEAAVTAISRCLRNPAGTNN  239

Query  613  CSEV  624
            CSEV
Sbjct  240  CSEV  243



>ref|XP_004975199.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
[Setaria italica]
Length=243

 Score =   214 bits (546),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE RL QEI D+EKDTG+KLRVLAQNYP+TPGLAIKD+W+VD+RTIVFVADPTFGN
Sbjct  119  LSSGQENRLRQEIEDLEKDTGYKLRVLAQNYPDTPGLAIKDYWQVDERTIVFVADPTFGN  178

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            I+NFN+G  VDLDIPRSFWS+++GKYGN+FYWKEKGEDASIE+AV AIS CLR+P G NN
Sbjct  179  IINFNIGPLVDLDIPRSFWSQVSGKYGNMFYWKEKGEDASIEAAVTAISRCLRDPSGTNN  238

Query  613  CSEV  624
            CSEV
Sbjct  239  CSEV  242



>gb|EMS62510.1| Thylakoid lumenal 15.0 kDa protein 2, chloroplastic [Triticum 
urartu]
Length=969

 Score =   227 bits (578),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE RL QEI D+EKDTG+KLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  821  LSSGQENRLRQEIEDLEKDTGYKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGN  880

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            I+NFN+G+ +DLDIP+SFWSR+AGKYGN+FYWKEKGEDASIE AVMAIS CLREP GA+N
Sbjct  881  IINFNIGSLIDLDIPQSFWSRVAGKYGNMFYWKEKGEDASIEGAVMAISRCLREPTGASN  940

Query  613  CSE  621
            CSE
Sbjct  941  CSE  943



>ref|XP_010253981.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
isoform X3 [Nelumbo nucifera]
Length=214

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 107/121 (88%), Gaps = 11/121 (9%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QEKRL QEIAD+E+DTGFKLR+LAQNYP+TPGLAI+DFW+VDDRTIVFVADPTF      
Sbjct  105  QEKRLTQEIADLERDTGFKLRILAQNYPDTPGLAIRDFWQVDDRTIVFVADPTF------  158

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANNCSEV  624
                 VDLDIPRSFWSRLAGKYGN+FYWKEKGEDASIE+AVMAIS CLREPVG +NCSEV
Sbjct  159  -----VDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISNCLREPVGPSNCSEV  213

Query  625  K  627
            K
Sbjct  214  K  214



>ref|XP_002992881.1| hypothetical protein SELMODRAFT_162644 [Selaginella moellendorffii]
 gb|EFJ06072.1| hypothetical protein SELMODRAFT_162644 [Selaginella moellendorffii]
Length=178

 Score =   204 bits (520),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE R+AQEI +IE+ TGFKLRVLAQNYP TPGLAI++FW+VDD TIVFVADP+ GN
Sbjct  54   LSEGQEGRIAQEIKEIEELTGFKLRVLAQNYPNTPGLAIREFWKVDDNTIVFVADPSLGN  113

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDL++PRSFWSRLAG+YGN+FYW+EKGEDASIE+AV AIS+CLREP G   
Sbjct  114  ILNFNVGASVDLNVPRSFWSRLAGQYGNVFYWREKGEDASIEAAVAAISSCLREPPGPRA  173

Query  613  CSEV  624
            CS +
Sbjct  174  CSTI  177



>ref|XP_002968784.1| hypothetical protein SELMODRAFT_90688, partial [Selaginella moellendorffii]
 gb|EFJ29900.1| hypothetical protein SELMODRAFT_90688, partial [Selaginella moellendorffii]
Length=146

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE R+AQEI +IE+ TGFKLRVLAQNYP TPGLAI++FW+VDD TIVFVADP+ GN
Sbjct  22   LSEGQEGRIAQEIKEIEELTGFKLRVLAQNYPNTPGLAIREFWKVDDNTIVFVADPSLGN  81

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDL++PRSFWSRLAG+YGN+FYW+EKGEDASIE+AV AIS+CLREP G   
Sbjct  82   ILNFNVGASVDLNVPRSFWSRLAGQYGNVFYWREKGEDASIEAAVAAISSCLREPPGPRA  141

Query  613  CSEV  624
            CS +
Sbjct  142  CSTI  145



>gb|EPS58490.1| hypothetical protein M569_16322, partial [Genlisea aurea]
Length=174

 Score =   199 bits (507),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE+RL++EIA +EK+TG+KLR+LAQNYP+TPGLAIKDFW VDD TIVFVADPTFGN
Sbjct  50   LSDGQERRLSEEIASLEKETGYKLRILAQNYPDTPGLAIKDFWGVDDNTIVFVADPTFGN  109

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGASVDLDIPRSFWSRLAGKYGN+FYWKEKGED SIE+AV AI+AC REP+    
Sbjct  110  ILNFNVGASVDLDIPRSFWSRLAGKYGNMFYWKEKGEDVSIEAAVEAIAACSREPLNTTK  169

Query  613  CSEVK  627
            CSE+K
Sbjct  170  CSEIK  174



>dbj|BAK03380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=105

 Score =   191 bits (485),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  316  FKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNFNVGASVDLDIPRSFWSR  495
            +KLRVLAQNYP+TPGLAIKDFW+VDDRTIVFVADPTFGNI+NFN+G+ +DLDIP+SFWSR
Sbjct  2    YKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGNIINFNIGSLIDLDIPQSFWSR  61

Query  496  LAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANNCSEV  624
            +AGKYGN+FYWKEKGEDASIE AV AIS CLREP GA+NCSEV
Sbjct  62   VAGKYGNMFYWKEKGEDASIEGAVTAISRCLREPTGASNCSEV  104



>ref|XP_002953353.1| hypothetical protein VOLCADRAFT_105868 [Volvox carteri f. nagariensis]
 gb|EFJ45663.1| hypothetical protein VOLCADRAFT_105868 [Volvox carteri f. nagariensis]
Length=294

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L PS+E+R+A E+A +EKDTGFKLRVLAQNYPETPGLAI+++W VDD T+VFVADPTFG+
Sbjct  152  LTPSEERRIAAEVAALEKDTGFKLRVLAQNYPETPGLAIREYWGVDDNTVVFVADPTFGD  211

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA VDL++PRSFW+RLAGKYGN FYW+E GE ASI +AV AI  CLRE  G   
Sbjct  212  ILNFNVGAGVDLEVPRSFWTRLAGKYGNKFYWQENGEAASILNAVSAIDTCLREEPGKFK  271

Query  613  CSEVK  627
            CS V+
Sbjct  272  CSTVQ  276



>ref|XP_001752618.1| predicted protein [Physcomitrella patens]
 gb|EDQ82489.1| predicted protein [Physcomitrella patens]
Length=159

 Score =   191 bits (486),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   Q  R+   +  +E+DTG+KLRVLAQNYP TPGLA++DFW VDD T+VFVADP+ GN
Sbjct  35   LSSGQVDRIKNAVESLEQDTGYKLRVLAQNYPTTPGLAVRDFWSVDDNTVVFVADPSLGN  94

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA VDL IPRSFW+RLAGKYGN FYW+E GEDASIE+AV AI  CLREP G   
Sbjct  95   ILNFNVGAGVDLSIPRSFWTRLAGKYGNKFYWQEMGEDASIEAAVNAIGECLREPAGPRA  154

Query  613  CSEVK  627
            CSE+K
Sbjct  155  CSEIK  159



>gb|EMT07626.1| Thylakoid lumenal 15.0 kDa protein 2, chloroplastic [Aegilops 
tauschii]
Length=1261

 Score =   208 bits (529),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 108/128 (84%), Gaps = 10/128 (8%)
 Frame = +1

Query  253   LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETP----------GLAIKDFWEVDDRTI  402
             L   QE RL QEI D+EKDTG+KLRVLAQNYP+TP          GLAIKDFW+VDDRTI
Sbjct  1100  LSSGQENRLRQEIEDLEKDTGYKLRVLAQNYPDTPVHMCIDICKDGLAIKDFWQVDDRTI  1159

Query  403   VFVADPTFGNILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISA  582
             VFVADPTFGNI+NFN+G+ +DLDIP+SFWSR+AGKYGN+FYWKEKGEDASIE AVMAIS 
Sbjct  1160  VFVADPTFGNIINFNIGSLIDLDIPQSFWSRVAGKYGNMFYWKEKGEDASIEGAVMAISR  1219

Query  583   CLREPVGA  606
             CLREP GA
Sbjct  1220  CLREPTGA  1227



>ref|XP_001700629.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO97958.1| predicted protein [Chlamydomonas reinhardtii]
Length=246

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L PS+EKR+  E++++EKDTGFKLRVLAQNYPETPGLAI+++W VDD T+VFVADPTFG+
Sbjct  102  LTPSEEKRIITEVSNLEKDTGFKLRVLAQNYPETPGLAIREYWGVDDNTVVFVADPTFGD  161

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNFNVGA +DL++PRSFW RLAGKYGN FYW+E GE ASI +AV AI  CLRE  G   
Sbjct  162  ILNFNVGAGIDLEVPRSFWGRLAGKYGNKFYWQENGEAASILNAVSAIDTCLREEPGRFK  221

Query  613  CSEVK  627
            CS V+
Sbjct  222  CSTVQ  226



>ref|XP_006493007.1| PREDICTED: thylakoid lumenal 15.0 kDa protein 2, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=198

 Score =   189 bits (481),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE+RLAQEIAD+EKDTGFKLRVLAQNYPETPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  102  LSDGQERRLAQEIADLEKDTGFKLRVLAQNYPETPGLAIKDFWQVDDRTIVFVADPTFGN  161

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEK  537
            ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEK
Sbjct  162  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEK  196



>ref|XP_006428391.1| hypothetical protein CICLE_v10012670mg [Citrus clementina]
 gb|ESR41631.1| hypothetical protein CICLE_v10012670mg [Citrus clementina]
Length=220

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE+RLAQEIAD+EKDTGFKLRVLAQNYPETPGLAIKDFW+VDDRTIVFVADPTFGN
Sbjct  102  LSDGQERRLAQEIADLEKDTGFKLRVLAQNYPETPGLAIKDFWQVDDRTIVFVADPTFGN  161

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEK  537
            ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEK
Sbjct  162  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEK  196



>gb|KEH42202.1| thylakoid lumenal 15.0 kDa protein [Medicago truncatula]
Length=220

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QEKRL QEIAD+EKDTGFKLRVLAQNYP+TPGLA+KDFW+VDD T+VFVADPTFGNILNF
Sbjct  119  QEKRLVQEIADLEKDTGFKLRVLAQNYPDTPGLAVKDFWQVDDSTVVFVADPTFGNILNF  178

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEK  537
            NVGA+VDLDIPRSFWSRLAGKYGNIFYW+EK
Sbjct  179  NVGATVDLDIPRSFWSRLAGKYGNIFYWREK  209



>ref|XP_002447500.1| hypothetical protein SORBIDRAFT_06g002030 [Sorghum bicolor]
 gb|EES11828.1| hypothetical protein SORBIDRAFT_06g002030 [Sorghum bicolor]
Length=253

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 101/139 (73%), Gaps = 17/139 (12%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIV---------  405
            L   QE RL Q I D+EKDTGFKLRVLAQNYP+TPGLAIKDFW+VD+  +          
Sbjct  116  LSSGQENRLRQVIEDLEKDTGFKLRVLAQNYPDTPGLAIKDFWQVDELLLFLLLIQPLNW  175

Query  406  ------FVADPTFGNILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAV  567
                     DP   NI+NFN+G  VDLD+PRSFWS+++GKYGN+FYWKEKGEDASIE+AV
Sbjct  176  KAINPFLATDPC--NIINFNIGPLVDLDVPRSFWSQVSGKYGNMFYWKEKGEDASIEAAV  233

Query  568  MAISACLREPVGANNCSEV  624
             AIS CLR P G NNCSEV
Sbjct  234  TAISRCLRNPTGTNNCSEV  252



>ref|NP_001059859.1| Os07g0534000 [Oryza sativa Japonica Group]
 dbj|BAC79580.1| putative thylakoid lumen 15.0-kDa protein [Oryza sativa Japonica 
Group]
 dbj|BAD32132.1| putative thylakoid lumen 15.0-kDa protein [Oryza sativa Japonica 
Group]
 dbj|BAF21773.1| Os07g0534000 [Oryza sativa Japonica Group]
 dbj|BAG88764.1| unnamed protein product [Oryza sativa Japonica Group]
Length=125

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 95/111 (86%), Gaps = 3/111 (3%)
 Frame = +1

Query  205  CNPRL*ISCSLALWLSLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWE  384
            C PR   +   +L L +   QE RL QEI D+EKDTG+KLRVLAQNYP+TPGLAIKDFW+
Sbjct  11   CFPR---NSPPSLMLLVFSPQENRLRQEIEDLEKDTGYKLRVLAQNYPDTPGLAIKDFWQ  67

Query  385  VDDRTIVFVADPTFGNILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEK  537
            VDD+TIVFVADPTFGNI+NFNVGA VDLDIPRSFWSR++GKYGN+F+WKEK
Sbjct  68   VDDQTIVFVADPTFGNIINFNVGALVDLDIPRSFWSRVSGKYGNMFFWKEK  118



>ref|XP_002500716.1| hypothetical protein MICPUN_113635 [Micromonas sp. RCC299]
 gb|ACO61974.1| hypothetical protein MICPUN_113635 [Micromonas sp. RCC299]
Length=242

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  274  RLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNFNVG  453
            RL  E+ ++EKDTG+KLRVLAQ YP+TPGLA+KD+W VDD T+VFVADP  GNILNF+VG
Sbjct  106  RLTTEVRNLEKDTGYKLRVLAQAYPKTPGLAVKDYWNVDDDTVVFVADPGLGNILNFSVG  165

Query  454  ASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANNCSEVK  627
             +VDLD+P SFW+RL+GKYG  FYW+E GE+ASI +AV AI  C RE  G   CS+V+
Sbjct  166  HNVDLDVPPSFWTRLSGKYGTKFYWQENGEEASISNAVSAIDTCFREEPGKLKCSKVQ  223



>ref|XP_003084179.1| thylakoid lumen 15.0 kDa protein (ISS) [Ostreococcus tauri]
 emb|CAL58595.1| TPM domain [Ostreococcus tauri]
Length=259

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L  S   RL + +  +E+DTG KLRVLAQ YP+TPGLA+K++W VDD T+VFVADP  GN
Sbjct  108  LGKSDVARLTKTVESLERDTGLKLRVLAQAYPQTPGLAVKEYWNVDDDTVVFVADPGLGN  167

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNF+VGA+VDL+IP SFW+RLA KYG  FYW EKGE+ASI +AV A++ C REP G   
Sbjct  168  ILNFSVGANVDLEIPPSFWTRLANKYGTKFYWSEKGEEASISAAVNAVNQCAREPQGRAK  227

Query  613  CSEV  624
            CS++
Sbjct  228  CSKI  231



>ref|XP_005643972.1| hypothetical protein COCSUDRAFT_19620 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19428.1| hypothetical protein COCSUDRAFT_19620 [Coccomyxa subellipsoidea 
C-169]
Length=200

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 101/129 (78%), Gaps = 4/129 (3%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTF-G  429
            L P +E R+ +E+  +E DTG KLRVLAQNYP TPGLA++D+W+VD+ T+VFVADP+  G
Sbjct  53   LTPGEETRIIKEVESLESDTGVKLRVLAQNYPTTPGLAVRDYWKVDEDTVVFVADPSLGG  112

Query  430  NILNFNVGASVDLDIPRS---FWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPV  600
            NILNFNVGA++DL IPR+   FW+RL+ KYG  +YW+E+GE ++I +AV AI  C REP+
Sbjct  113  NILNFNVGANIDLRIPRARCNFWTRLSSKYGTKYYWQERGEGSAIVNAVSAIDTCAREPL  172

Query  601  GANNCSEVK  627
            G   CS+++
Sbjct  173  GRLQCSKIQ  181



>ref|XP_007511021.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66581.1| predicted protein [Bathycoccus prasinos]
Length=271

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L P + KRL   + ++++DTG KLR+LAQ YP+TPGLAIKD+W VDD T+VFVADP  GN
Sbjct  120  LTPREVKRLQTRVENLQRDTGVKLRILAQAYPQTPGLAIKDYWGVDDDTVVFVADPGLGN  179

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNF++GA+VDL++P +FW++LA KYG  FYW +KGE+ASI +AV AI  CL EP G   
Sbjct  180  ILNFSIGANVDLEVPPNFWTKLANKYGTKFYWADKGEEASIVAAVDAIEFCLNEPSGRAK  239

Query  613  CSEV  624
            C+ V
Sbjct  240  CTTV  243



>ref|XP_010240738.1| PREDICTED: uncharacterized protein LOC100845661 [Brachypodium 
distachyon]
Length=306

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QE RL QEI D+EKDTG+KLRVLAQNYP+TPGLAIKDFW+ DDRTIVFVADPTFGNI+NF
Sbjct  210  QENRLRQEIEDLEKDTGYKLRVLAQNYPDTPGLAIKDFWQFDDRTIVFVADPTFGNIINF  269

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKG  540
            N+G+ +DLDI +SFWSR +GKYGN+FYWK +G
Sbjct  270  NIGSLIDLDILQSFWSRASGKYGNMFYWKGRG  301



>ref|XP_003064402.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51307.1| predicted protein [Micromonas pusilla CCMP1545]
Length=293

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 97/135 (72%), Gaps = 10/135 (7%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L P + KRL  E+ ++E+DTG KLRVLAQ YP TPGLA+KD+W VDD T+VFVADP  GN
Sbjct  109  LTPGEIKRLTGEVKNLERDTGMKLRVLAQAYPNTPGLAVKDYWSVDDDTVVFVADPGLGN  168

Query  433  ILNFNVG----------ASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISA  582
            ILNF+VG          A+VDLD+P +FW+RLAGKYG   YW++ GE+ASI +AV AI  
Sbjct  169  ILNFSVGAFYLTLVPIRANVDLDVPPNFWTRLAGKYGTKSYWQDNGEEASIANAVSAIDT  228

Query  583  CLREPVGANNCSEVK  627
            C RE  G   C++++
Sbjct  229  CFREEPGRFKCAKIQ  243



>gb|KFM24375.1| ATPase family AAA domain-containing protein 2 [Auxenochlorella 
protothecoides]
Length=1041

 Score =   170 bits (430),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 72/125 (58%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +1

Query  253   LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
             L  ++E R+   +  +EKDTG K RVLAQNYP+TPGLAIKD+W VDD T+V VADPTFGN
Sbjct  913   LTETEETRMRDRLQHLEKDTGIKFRVLAQNYPDTPGLAIKDYWSVDDNTVVLVADPTFGN  972

Query  433   ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
             +LNFN+G ++D  IPR+FWS++AG++GN FY +E+G D +I +AV A+  CLREP+    
Sbjct  973   VLNFNIGINIDSFIPRNFWSKVAGRFGNKFYVEEQGRDVAIINAVAAVDHCLREPIDRTQ  1032

Query  613   CSEVK  627
             CSE++
Sbjct  1033  CSEIR  1037



>ref|XP_005847996.1| hypothetical protein CHLNCDRAFT_35354, partial [Chlorella variabilis]
 gb|EFN55894.1| hypothetical protein CHLNCDRAFT_35354, partial [Chlorella variabilis]
Length=159

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 100/133 (75%), Gaps = 8/133 (6%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPE--------TPGLAIKDFWEVDDRTIVF  408
            L   +EKR+ Q +  +E DTG KLRVLAQNYP+        TPGLAIKD+W VD  T+VF
Sbjct  23   LTDGEEKRIRQRVDALEADTGVKLRVLAQNYPQARPAAAGVTPGLAIKDYWGVDSDTVVF  82

Query  409  VADPTFGNILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            VADP  GNILNFNVGA+VDL +PR+FWSRLAG++G  FYW+++G+DA+I +AV AI  C+
Sbjct  83   VADPNTGNILNFNVGANVDLLVPRNFWSRLAGRFGTKFYWQDQGQDAAIVNAVAAIDNCI  142

Query  589  REPVGANNCSEVK  627
            REP+G   CS ++
Sbjct  143  REPIGRGQCSAIR  155



>ref|XP_010107488.1| hypothetical protein L484_024338 [Morus notabilis]
 gb|EXC16170.1| hypothetical protein L484_024338 [Morus notabilis]
Length=94

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 78/90 (87%), Gaps = 11/90 (12%)
 Frame = +1

Query  358  GLAIKDFWEVDDRTIVFVADPTFGNILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEK  537
            GLAI+DFW+VDDRTIVFVADPTF           VDLDIPRSFWSRLAGKYGNIFYWKEK
Sbjct  16   GLAIRDFWQVDDRTIVFVADPTF-----------VDLDIPRSFWSRLAGKYGNIFYWKEK  64

Query  538  GEDASIESAVMAISACLREPVGANNCSEVK  627
            GEDASIE+AVMAIS+CLREPVG +NCSEVK
Sbjct  65   GEDASIEAAVMAISSCLREPVGPSNCSEVK  94



>ref|XP_003613495.1| Thylakoid lumenal 15.0 kDa protein [Medicago truncatula]
Length=179

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 78/102 (76%), Gaps = 20/102 (20%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QEKRLAQEIAD+EK TGFKLRVLAQNYP+TP          DD T+VFVADPT GNILNF
Sbjct  72   QEKRLAQEIADLEKATGFKLRVLAQNYPDTP----------DDSTVVFVADPTIGNILNF  121

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVM  570
            NVGA+VDLD PR+FWSRLAGKYGN          ASIESAV+
Sbjct  122  NVGATVDLDTPRNFWSRLAGKYGN----------ASIESAVI  153



>tpg|DAA38604.1| TPA: hypothetical protein ZEAMMB73_587127 [Zea mays]
Length=210

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 79/124 (64%), Gaps = 34/124 (27%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE RL QEI D+EKDTG+KLRVLAQNYP+TP                         
Sbjct  120  LSSGQENRLRQEIEDLEKDTGYKLRVLAQNYPDTP-------------------------  154

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
                     VDLD+PRSFWS+++GKYGN+FYWKEKGEDASIE+AV AIS CLR P G NN
Sbjct  155  ---------VDLDVPRSFWSQVSGKYGNMFYWKEKGEDASIEAAVTAISRCLRNPAGTNN  205

Query  613  CSEV  624
            CSEV
Sbjct  206  CSEV  209



>ref|XP_001422138.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP00455.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=88

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  274  RLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNFNVG  453
            RL  E+  +EKDTG +LRVLAQ YP+TPGLA+K++W VDD T+VFVADP  GNILNF+VG
Sbjct  1    RLTTEVEALEKDTGVRLRVLAQAYPQTPGLAVKEYWNVDDDTVVFVADPGLGNILNFSVG  60

Query  454  ASVDLDIPRSFWSRLAGKYGNIFYWKEK  537
             ++DL+IP SFW+RLA KYG  FYW E+
Sbjct  61   GNLDLEIPPSFWTRLANKYGTKFYWSER  88



>ref|XP_009032122.1| hypothetical protein AURANDRAFT_6353, partial [Aureococcus anophagefferens]
 gb|EGB12604.1| hypothetical protein AURANDRAFT_6353, partial [Aureococcus anophagefferens]
Length=147

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 84/120 (70%), Gaps = 3/120 (3%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTF--  426
            L   ++KRL    A  EK +GFK+RVL Q+YPETPGLAIKD+W+VDD+T+V +AD     
Sbjct  28   LTKGEQKRLDVLAAKTEKASGFKIRVLCQSYPETPGLAIKDYWKVDDKTVVLIADKGLKG  87

Query  427  -GNILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVG  603
              NILNFNVG  +   +P  FW+RL G++G   YW++KGED +I +AV AI+ CL++  G
Sbjct  88   TSNILNFNVGDGLADVLPTPFWTRLQGRFGTSRYWRDKGEDVAITNAVEAIAYCLQQEDG  147



>ref|XP_005790231.1| hypothetical protein EMIHUDRAFT_440267 [Emiliania huxleyi CCMP1516]
 gb|EOD37802.1| hypothetical protein EMIHUDRAFT_440267 [Emiliania huxleyi CCMP1516]
Length=223

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 100/172 (58%), Gaps = 8/172 (5%)
 Frame = +1

Query  97   LQTIPIPVAPEKHCFPIPNTNRLSKPRRSQSK*MLVCNPRL*ISCSLALWLSLCPSQEKR  276
            LQ +P+ +A        P+   L++P       +L   P   +   + L   L   +  +
Sbjct  11   LQHVPLVLA--AALTSAPSLPALARPEGVNKPELLPTGP---VQRVIDLQKFLTSGERTK  65

Query  277  LAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADP-TFG--NILNFN  447
            +  ++A IE +TGFKLRVL Q YP TPGLAIKD+W +DD++IV VAD  T G  N+LNFN
Sbjct  66   MDTQLAKIEAETGFKLRVLCQQYPNTPGLAIKDYWGLDDKSIVLVADKGTKGTSNMLNFN  125

Query  448  VGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVG  603
            V     L +P +FW+RL   +GN F+ KE GED +I  AV AI  CLRE +G
Sbjct  126  VAEGAKLQLPNTFWTRLQSTFGNTFFVKENGEDVAIRRAVDAIDYCLREDLG  177



>ref|XP_005829597.1| hypothetical protein GUITHDRAFT_95599 [Guillardia theta CCMP2712]
 gb|EKX42617.1| hypothetical protein GUITHDRAFT_95599 [Guillardia theta CCMP2712]
Length=268

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 83/119 (70%), Gaps = 5/119 (4%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG-  429
            L   Q  ++ + +A +E+DTG+K+RVL Q YP+TPGLAIKD+W VDD+TIV V D   G 
Sbjct  132  LTKGQVAKMDKLLAKLEEDTGYKMRVLCQRYPQTPGLAIKDYWGVDDKTIVMVVDRGSGK  191

Query  430  ----NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
                NILNFNVG  V+L +P  FW+RL   +G +FY KE GEDA++ +AV A+  CLR+
Sbjct  192  AGQANILNFNVGQGVELALPPVFWTRLRNFFGTVFYVKENGEDAAVINAVDAVVGCLRQ  250



>emb|CBN75528.1| thylakoid lumen 15.0 kDa protein [Ectocarpus siliculosus]
Length=269

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 82/124 (66%), Gaps = 7/124 (6%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVAD-----  417
            L   Q KR+ +++ D+EK TG++LR+L Q YPETPGLA+KD+W+VDD+TIV V D     
Sbjct  122  LTKGQVKRINKQLEDLEKATGYRLRLLCQKYPETPGLAVKDYWKVDDKTIVMVVDSGDDD  181

Query  418  --PTFGNILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLR  591
                  NILNFNVG  + L +P  FW RL  KYGN F+ ++ G D +I SAV +I+ CLR
Sbjct  182  RKSGAVNILNFNVGDGLRLGLPPQFWQRLQNKYGNRFFVRDNGVDGAIISAVDSITLCLR  241

Query  592  EPVG  603
               G
Sbjct  242  SETG  245



>dbj|BAA97137.1| unnamed protein product [Arabidopsis thaliana]
Length=179

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 75/125 (60%), Gaps = 44/125 (35%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QEKR+AQEIA++EKDTGFKLRVLAQNYP TPGLAIKDFW+VDD TIVFVADPTF  
Sbjct  99   LSNGQEKRIAQEIANLEKDTGFKLRVLAQNYPVTPGLAIKDFWQVDDSTIVFVADPTF--  156

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
                                                      +AVMAIS+CLREPVG NN
Sbjct  157  ------------------------------------------AAVMAISSCLREPVGRNN  174

Query  613  CSEVK  627
            C+E++
Sbjct  175  CAEIQ  179



>ref|XP_005854163.1| hypothetical protein NGA_0170500 [Nannochloropsis gaditana CCMP526]
 gb|EKU22196.1| hypothetical protein NGA_0170500 [Nannochloropsis gaditana CCMP526]
Length=187

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 83/121 (69%), Gaps = 8/121 (7%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   Q+KRL+Q++  +EKD+G K+R+L Q YP+TPGLAIKD+W +DD++IV VAD    N
Sbjct  45   LTSGQKKRLSQQLDALEKDSGIKVRLLCQRYPDTPGLAIKDYWGLDDKSIVVVADKGPAN  104

Query  433  I--------LNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            I        LNFNVG+ + L +P +FW+RL  ++G+IFY +  G+D +I + +  I  C+
Sbjct  105  IKQVATRNLLNFNVGSGLQLLLPPAFWNRLRSQFGSIFYLRSHGDDEAIIATINTIDTCI  164

Query  589  R  591
            R
Sbjct  165  R  165



>ref|WP_026073061.1| hypothetical protein [Nodosilinea nodulosa]
Length=263

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE+ L  ++ D E +TG+KLRVL Q Y +TPG A+KDFW +DDR+I+ VADP  G
Sbjct  46   SLTSRQEEDLETQLNDFETETGWKLRVLTQ-YDQTPGRAVKDFWGLDDRSIMLVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNF+VG +V   +PR+FW  L  +YGN F+ +E GED SI SA+ +I  CLR+
Sbjct  105  NLLNFSVGDAVYDLLPRTFWIELQTRYGNQFFVRENGEDNSILSALESIEGCLRQ  159



>ref|WP_015189469.1| hypothetical protein [Gloeocapsa sp. PCC 7428]
 ref|YP_007128759.1| hypothetical protein Glo7428_3112 [Gloeocapsa sp. PCC 7428]
 gb|AFZ31599.1| hypothetical protein Glo7428_3112 [Gloeocapsa sp. PCC 7428]
Length=268

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE+RLAQE+ + E +TG+KLRVL Q Y  TPG A+KDFW +D+++I+ VAD   G
Sbjct  52   SLTSVQEERLAQELEEFEAETGWKLRVLTQ-YDRTPGAAVKDFWSLDEKSILVVADSRGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NILNFNVG +V   +PR+FW  L  ++GN+++ +E+GED +I  ++ ++  CLR+
Sbjct  111  NILNFNVGDAVYQLLPRTFWVELQTRFGNLYFVREEGEDQAIIQSIESVETCLRQ  165



>ref|WP_026723087.1| hypothetical protein [Fischerella sp. PCC 9431]
Length=268

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL P QE+ L +++   E  TG+KLRVL Q Y  TPGLAIK+FW++DD++++ VAD + G
Sbjct  52   SLNPVQEENLVKKLEQFEAQTGWKLRVLTQ-YDRTPGLAIKNFWKLDDKSVLLVADASGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NILNFNVG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ +I  CLR+
Sbjct  111  NILNFNVGDAVYKLLPRTFWVELQTRFGNLYFVREEGEDGAIIQALESIETCLRQ  165



>gb|EWM23129.1| Putative repair protein [Nannochloropsis gaditana]
Length=329

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 83/121 (69%), Gaps = 8/121 (7%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   Q+KRL+Q++  +EKD+G K+R+L Q YP+TPGLAIKD+W +DD++IV VAD    N
Sbjct  159  LTSGQKKRLSQQLDALEKDSGIKVRLLCQRYPDTPGLAIKDYWGLDDKSIVVVADKGPAN  218

Query  433  I--------LNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            I        LNFNVG+ + L +P +FW+RL  ++G+IFY +  G+D +I + +  I  C+
Sbjct  219  IKQVATRNLLNFNVGSGLQLLLPPAFWNRLRSQFGSIFYLRSHGDDEAIIATINTIDTCI  278

Query  589  R  591
            R
Sbjct  279  R  279



>ref|XP_002290481.1| thylakoid lumen 15.0-kDa protein [Thalassiosira pseudonana CCMP1335]
 gb|EED92233.1| thylakoid lumen 15.0-kDa protein, partial [Thalassiosira pseudonana 
CCMP1335]
Length=193

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 75/117 (64%), Gaps = 4/117 (3%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFW----EVDDRTIVFVADP  420
            L   QEKR+   +  +EKDTG+++RVL Q YP TPGLAI+D+W    EV +R ++  +  
Sbjct  56   LTSGQEKRMNDLLERLEKDTGYRVRVLCQAYPRTPGLAIRDYWDLGKEVRERLLLTSSIA  115

Query  421  TFGNILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLR  591
              GN+LNFNVG  V   +P  FW+RL  KYG  F+ KE G D +I +A+ AI  CLR
Sbjct  116  QHGNVLNFNVGDGVKFALPNVFWTRLTSKYGTTFFVKENGIDIAITNAIEAIVTCLR  172



>ref|WP_026733822.1| hypothetical protein [Fischerella sp. PCC 9605]
Length=268

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE+ L +E+   E +TG+KLRVL Q Y  TPGLA+KDFW++DD++++ VAD + G
Sbjct  52   SLTSVQEENLVKELEQFEAETGWKLRVLTQ-YDRTPGLAVKDFWKLDDKSVLLVADASGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NILNFNVG +V   +PR+FW  L  ++GN+++ +++GED +I  A+ ++  CLR+
Sbjct  111  NILNFNVGDAVYQLLPRTFWVELQTRFGNLYFVRDEGEDEAILQALESVKTCLRQ  165



>ref|WP_035988478.1| methanol dehydrogenase [Leptolyngbya sp. KIOST-1]
Length=263

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE+ L  ++ + E +TG+KLRVL Q Y +TPG A+KDFW +DDR+I+ VADP  G
Sbjct  46   SLTSRQEEDLDSQLNEFETETGWKLRVLTQ-YDQTPGRAVKDFWGLDDRSIMLVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNF+VG +V   +PR+FW  L  +YGN F+ +E GED SI SA+ +I  CLR+
Sbjct  105  NLLNFSVGDAVYDLLPRTFWIELQTRYGNQFFVRENGEDNSILSALESIQECLRQ  159



>ref|WP_016867646.1| hypothetical protein [Fischerella muscicola]
Length=268

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL  +QE+ L +++   E +TG+KLRVL Q Y  TPGLA+K+FW++DD++++ VAD + G
Sbjct  52   SLTSAQEENLVKKLEQFEAETGWKLRVLTQ-YDRTPGLAVKNFWKLDDKSVLLVADASGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NILNFNVG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ +I  CLR+
Sbjct  111  NILNFNVGDAVYKLLPRTFWVELQTRFGNLYFVREEGEDGAIIQALESIETCLRQ  165



>ref|WP_009456528.1| MULTISPECIES: hypothetical protein [Fischerella]
 gb|EHC13815.1| hypothetical protein FJSC11DRAFT_2079 [Fischerella sp. JSC-11]
Length=268

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL  +QE+ L +++   E +TG+KLRVL Q Y  TPGLA+K+FW++DD++++ VAD + G
Sbjct  52   SLTSAQEENLVRKLEQFEAETGWKLRVLTQ-YDRTPGLAVKNFWKLDDKSVLLVADASGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NILNFNVG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ +I  CLR+
Sbjct  111  NILNFNVGDAVYKLLPRTFWVELQTRFGNLYFVREEGEDGAIIQALESIETCLRQ  165



>ref|WP_016873918.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=268

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE+ LAQE+   E +TG+KLRVL Q Y  TPG A+KDFW +DD++++ VAD + G
Sbjct  52   SLTIVQEENLAQELERFEAETGWKLRVLTQ-YDRTPGRAVKDFWGLDDKSVLLVADASGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NILNFNVG +V   +PR+FW  L  ++GN+++ +E+GED +I  ++ +I  CLR+
Sbjct  111  NILNFNVGDAVYKLLPRTFWVELQTRFGNLYFVREQGEDQAILQSLESIETCLRQ  165



>ref|WP_011242771.1| hypothetical protein [Synechococcus elongatus]
 ref|YP_171169.1| hypothetical protein syc0459_d [Synechococcus elongatus PCC 6301]
 ref|YP_400107.1| hypothetical protein Synpcc7942_1090 [Synechococcus elongatus 
PCC 7942]
 dbj|BAD78649.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gb|ABB57120.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
 gb|AJD58363.1| hypothetical protein M744_11215 [Synechococcus sp. UTEX 2973]
Length=265

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 84/124 (68%), Gaps = 5/124 (4%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L  +QE+RLA+E+   E +TG+KLRVL Q +  TPGLA++DFW +D+R+++ +AD   GN
Sbjct  48   LTDTQEQRLARELNQFEDETGWKLRVLTQ-FDRTPGLAVRDFWNLDERSVLLIADQRGGN  106

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            +LNFNVG +    +PR+FW  L  +YGN FY ++ GED +I  ++ +I  CLR+      
Sbjct  107  LLNFNVGEAFYAFMPRTFWVELQTRYGNQFYVRDHGEDGAIFDSLHSIEGCLRQ----GG  162

Query  613  CSEV  624
            CS V
Sbjct  163  CSVV  166



>ref|XP_005718349.1| unnamed protein product [Chondrus crispus]
 emb|CDF38456.1| unnamed protein product [Chondrus crispus]
Length=210

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 78/114 (68%), Gaps = 3/114 (3%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG-  429
            L   + +RL   ++D+EK TGFK+RVL Q +P+TPGLAI+D+W VDD T+V VAD  FG 
Sbjct  83   LATGEVRRLRDRVSDLEKRTGFKVRVLTQRFPQTPGLAIRDYWGVDDDTVVMVAD-YFGG  141

Query  430  -NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
              +L FNVG +VD  +P  FWS L+  YGN FY  + GE A+I ++V +I  CL
Sbjct  142  SQLLKFNVGKNVDKLLPPRFWSNLSANYGNKFYTDKNGEAAAIVNSVESIRVCL  195



>ref|WP_015172682.1| hypothetical protein [Geitlerinema sp. PCC 7407]
 ref|YP_007110170.1| hypothetical protein GEI7407_2645 [Geitlerinema sp. PCC 7407]
 gb|AFY67118.1| hypothetical protein GEI7407_2645 [Geitlerinema sp. PCC 7407]
Length=268

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   QE  LAQEI + E  TG+KLRVL Q Y  TPG A++DFW +++++++ VADP  G
Sbjct  51   ALTQVQEDSLAQEIEEFESGTGWKLRVLTQ-YDRTPGRAVRDFWGLNEKSVLLVADPRGG  109

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG +V   +PR+FW  L  +YGN FY +E GED SI  ++ ++ ACL +
Sbjct  110  NLLNFNVGDAVYELLPRTFWVELQTRYGNQFYVRENGEDRSILDSLHSVKACLSQ  164



>ref|XP_005707417.1| thylakoid lumen 15.0 kDa protein [Galdieria sulphuraria]
 gb|EME30897.1| thylakoid lumen 15.0 kDa protein [Galdieria sulphuraria]
Length=214

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVAD--PTF  426
            L   Q K L ++I D+E+ +GFKLRVL Q YP+TPGLAIKD+W++D R++V VAD     
Sbjct  93   LTSGQLKSLERQIEDLERRSGFKLRVLTQRYPDTPGLAIKDYWQLDSRSVVMVADFFGNS  152

Query  427  GNILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            GN+L FNVG+ +D  +P  +WS L+ KYGN F+ ++ GED +I  A   I +C+
Sbjct  153  GNLLKFNVGSDLDGLLPPRYWSLLSSKYGNKFFVEQYGEDRAILDAADNIFSCI  206



>ref|WP_017313818.1| hypothetical protein [Fischerella sp. PCC 9339]
Length=268

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE+ L +++   E  TG+KLRVL Q Y  TPGLAIK+FW++DD++++ VAD + G
Sbjct  52   SLNSVQEENLVKKLEQFEAQTGWKLRVLTQ-YDRTPGLAIKNFWKLDDKSVLLVADASGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NILNFNVG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ +I  CLR+
Sbjct  111  NILNFNVGDAVYKLLPRTFWVELQTRFGNLYFVREEGEDGAIIQALESIETCLRQ  165



>ref|WP_017711216.1| hypothetical protein [Prochlorothrix hollandica]
Length=265

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 80/125 (64%), Gaps = 5/125 (4%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            S    Q + L QE+ D E +TG+KLRVL Q Y  TPG AIKD+W++D  + + VADP  G
Sbjct  49   SFADGQIQSLVQELEDFEVETGWKLRVLTQ-YDRTPGRAIKDYWDLDAHSFLVVADPRGG  107

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGAN  609
            N+LNFNVG      IPR+FW  L  ++GN++Y ++ GED +I  A+ A+  C+R+    N
Sbjct  108  NLLNFNVGGDFYRIIPRTFWVELQTRFGNLYYVRDNGEDGAILGALRAVETCVRQ----N  163

Query  610  NCSEV  624
             CS V
Sbjct  164  GCSVV  168



>ref|WP_016858494.1| hypothetical protein [Fischerella muscicola]
Length=268

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE+ L +++   E  TG+KLRVL Q Y  TPGLA+K+FW++DD++++ VAD + G
Sbjct  52   SLNSVQEENLVKKLEQFEAQTGWKLRVLTQ-YDRTPGLAVKNFWKLDDKSVLLVADASGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NILNFNVG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ +I  CLR+
Sbjct  111  NILNFNVGDAVYKLLPRTFWVELQTRFGNLYFVREEGEDGAIIQALESIETCLRQ  165



>ref|WP_011613022.1| hypothetical protein [Trichodesmium erythraeum]
 ref|YP_723163.1| hypothetical protein Tery_3619 [Trichodesmium erythraeum IMS101]
 gb|ABG52690.1| conserved hypothetical protein [Trichodesmium erythraeum IMS101]
Length=268

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE  LA+++   E +TG+KLRVL Q +  TPG A+KDFWE+D ++++ VADP  G
Sbjct  52   SLTEIQENLLAKDLEKFETETGWKLRVLTQ-FDRTPGRAVKDFWELDSKSVLLVADPRGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NILNFNVG  +   +PR+FW  L  +YGN F+ +++GED SI  ++ +I  CLR+
Sbjct  111  NILNFNVGRGLYQFLPRTFWVELQTRYGNQFFVRDQGEDQSIIQSLESIKTCLRQ  165



>ref|WP_017322985.1| hypothetical protein [cyanobacterium PCC 7702]
Length=268

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL  +QE+ L +E+   E +TG+KLRVL Q Y  TPG A+KDFW +D+++++ VAD + G
Sbjct  52   SLSSAQEENLIRELEKFEAETGWKLRVLTQ-YDRTPGRAVKDFWGLDEKSVLLVADASGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NILNFNVG +V   +PR+FW  L  ++GN+++ +E+GED +I  ++ +I  CLR+
Sbjct  111  NILNFNVGDAVYKFLPRTFWVELQTRFGNLYFVREQGEDQAILQSLRSIETCLRQ  165



>ref|WP_015108293.1| hypothetical protein [Cyanobium gracile]
 ref|YP_007045180.1| hypothetical protein Cyagr_0650 [Cyanobium gracile PCC 6307]
 gb|AFY27839.1| hypothetical protein Cyagr_0650 [Cyanobium gracile PCC 6307]
Length=287

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   +   L  E+ + E  +G+KLRVL Q Y  TPGLA+K FW++D+R+++ VADP  G
Sbjct  66   ALTDGERGALESELEEFEATSGWKLRVLTQ-YERTPGLAVKGFWDLDERSLLLVADPRGG  124

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+LNFNVG ++   +PR+FW  L  +YGN FY ++ GED SI SA+ A+  CL
Sbjct  125  NLLNFNVGEALFALMPRTFWVELQTRYGNQFYVRDHGEDGSILSAIHAVKGCL  177



>ref|XP_002178007.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC50821.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=249

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 78/121 (64%), Gaps = 8/121 (7%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEV------DDRTIVFVA  414
            L   Q KR+   +  +E+DTGF++RVL Q+YP TPGLAI+D+W++      DD+ +V V 
Sbjct  107  LTSGQAKRMNDLLVALERDTGFRVRVLCQSYPNTPGLAIRDYWDLGKEGQKDDKYVVLVV  166

Query  415  DP--TFGNILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            D     GN+LNFNVG  +   +P  FW+RL+ KYG  FY ++ G D ++ +A+ AI  CL
Sbjct  167  DQFGGRGNVLNFNVGDGLKFALPNVFWNRLSSKYGTTFYVRDNGIDLAVTNAIEAIVTCL  226

Query  589  R  591
            R
Sbjct  227  R  227



>ref|WP_035830152.1| methanol dehydrogenase [Cyanobium sp. CACIAM 14]
 gb|KEF42769.1| hypothetical protein ER33_04320 [Cyanobium sp. CACIAM 14]
Length=267

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   +   L  E+ D E  +G+KLRVL Q Y  TPGLA+K FW++D+R+++ VADP  G
Sbjct  46   ALTDGERGALEAELEDFEASSGWKLRVLTQ-YERTPGLAVKGFWDLDERSLLLVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+LNFNVG ++   +PR+FW  L  +YGN FY ++ GED +I SA+ A+  CL
Sbjct  105  NLLNFNVGDALFALMPRTFWVELQTRYGNQFYVRDHGEDGAILSAIHAVKECL  157



>ref|WP_015147974.1| hypothetical protein [Oscillatoria acuminata]
 ref|YP_007085249.1| hypothetical protein Oscil6304_1632 [Oscillatoria acuminata PCC 
6304]
 gb|AFY81329.1| hypothetical protein Oscil6304_1632 [Oscillatoria acuminata PCC 
6304]
Length=294

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE+ L QE+ + E +TG+KLRVL Q Y  TPG A+KD+W+++D++++ +ADP  G
Sbjct  78   SLTSIQEENLVQELENFEAETGWKLRVLTQ-YDRTPGRAVKDYWDLNDKSVLLIADPRGG  136

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+L FNVG  +   +PR+FW  L  +YGN F+ ++ GED +I SA+ ++  CLR+
Sbjct  137  NLLGFNVGDELYPLLPRTFWIELQTRYGNQFFVRDNGEDQAILSALNSVENCLRQ  191



>ref|WP_017660566.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=266

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L  +QE++L  ++  +E +TG+KLRVL Q +  TPG A+KDFW +DD++++ +ADP  G
Sbjct  51   ALTSTQEEQLVADLERLETETGYKLRVLTQ-FDRTPGRAVKDFWGLDDKSVLLIADPRGG  109

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+L FNVG +V   +PR+FW  L  +YGN F+ ++ GED SI  ++ ++ +CLR+
Sbjct  110  NLLGFNVGDAVYSLLPRTFWIELQTRYGNQFFVRDNGEDQSILQSLKSVESCLRQ  164



>ref|WP_036917803.1| MULTISPECIES: methanol dehydrogenase [Prochlorococcus]
 gb|KGG15335.1| hypothetical protein EV06_1206 [Prochlorococcus sp. MIT 0602]
 gb|KGG17613.1| hypothetical protein EV07_1053 [Prochlorococcus sp. MIT 0603]
Length=265

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL  +Q K L + + D E  TG+K++VL Q Y  +PGLAIKDFW++D+ ++V +ADP  G
Sbjct  49   SLSETQRKELEESLNDYESKTGWKIKVLTQ-YERSPGLAIKDFWQLDETSLVLIADPRGG  107

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+LNFNVG +    +PR FW  L  +YGN F+ KEKGED +I  ++ ++  CL
Sbjct  108  NLLNFNVGDAYFALLPRLFWVELQTRYGNQFFVKEKGEDGAILESIESVRICL  160



>ref|WP_011935841.1| hypothetical protein [Synechococcus sp. RCC307]
 ref|YP_001227680.1| hypothetical protein SynRCC307_1424 [Synechococcus sp. RCC307]
 emb|CAK28327.1| Uncharacterized conserved membrane protein [Synechococcus sp. 
RCC307]
Length=268

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 79/112 (71%), Gaps = 1/112 (1%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L  SQ K L QE+  +E   G+KLRVL Q + +TPGLA++DFW++D+R+++ +ADP  GN
Sbjct  49   LTDSQRKNLEQELDGVEAKVGWKLRVLTQ-FDQTPGLAVRDFWQLDERSLLLIADPRGGN  107

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            +LNFNVG ++   +PR++W  L  ++GN FY ++ GED +I  A+ A+  CL
Sbjct  108  LLNFNVGDALFALMPRTYWVELQTRFGNQFYVRDHGEDGAIFDALEAVEICL  159



>ref|WP_036029719.1| methanol dehydrogenase [Leptolyngbya sp. PCC 6406]
Length=259

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL  +QE+ L Q +AD E +TG+KLRVL Q Y +TPG A+K FW +D  +++ VADP  G
Sbjct  43   SLSSAQEESLDQHLADFEAETGWKLRVLTQ-YDQTPGRAVKAFWGLDKHSVMLVADPRGG  101

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNF+VG  +   +PR+FW  L  ++GN F+ +E GED +I  A+ AI  CLR+
Sbjct  102  NLLNFSVGDDLYDFLPRTFWIELQTRFGNQFFVRENGEDNAILEALGAIEVCLRQ  156



>ref|XP_005537887.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81851.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=224

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 70/106 (66%), Gaps = 2/106 (2%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVAD--PTF  426
            L   Q +RL +EI  +E+  G K R+L Q YPETPGLAIKD+W VD  T+V V D     
Sbjct  102  LVSGQRRRLQREIDALEEACGVKFRILTQRYPETPGLAIKDYWGVDANTVVMVVDYFGGV  161

Query  427  GNILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESA  564
            GN+L FN+GA+VD  I   FWSR++ KYGN FY +E G D +I SA
Sbjct  162  GNVLKFNIGANVDKSISPRFWSRISSKYGNKFYLEENGIDQAILSA  207



>ref|WP_017714887.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=266

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 78/115 (68%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE  L +++   E +TGFKLRVL Q Y  TPG A+K FW +D+R+++ VADP  G
Sbjct  51   SLTAVQEAALDRDLQQFEAETGFKLRVLTQ-YDRTPGRAVKKFWGLDNRSVLLVADPRGG  109

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG  +   +PR+FW  L  ++GN F+ +E+GED +I  ++ +I  CLR+
Sbjct  110  NLLNFNVGDDLYPLLPRTFWVELQTRFGNQFFVREEGEDQAIVQSLESIKTCLRQ  164



>ref|WP_011056104.1| hypothetical protein [Thermosynechococcus elongatus]
 ref|NP_681040.1| hypothetical protein tlr0249 [Thermosynechococcus elongatus BP-1]
 dbj|BAC07802.1| tlr0249 [Thermosynechococcus elongatus BP-1]
Length=269

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L P Q+K L  E+A+ E  TG+KLRVL Q Y  TPGLA++DFW++DDR+I+ VAD   GN
Sbjct  53   LTPVQKKHLDSELAEFEAQTGWKLRVLTQ-YDRTPGLAVRDFWDLDDRSILLVADTRGGN  111

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            +LNFNVG +    + R+FW  L  ++GN ++ ++ GED +I  ++ AI  CL +
Sbjct  112  LLNFNVGDTAYRVLQRTFWVELQTRFGNQYFVRDNGEDQAILQSLHAIETCLAQ  165



>ref|WP_036616135.1| methanol dehydrogenase [Oscillatoriales cyanobacterium JSC-12]
Length=274

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE  LA ++A  E++TG+KLRVL Q +  TPG A+KD+W +DD +++ VADP  GN
Sbjct  59   LTSEQETALASDLAAFEQETGWKLRVLTQ-FDRTPGTAVKDYWGLDDHSLLLVADPRGGN  117

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            ILNF+VG ++   +PR FW  L  +YGN FY +E GED +I  A+ ++  C+R+
Sbjct  118  ILNFSVGDALYPLMPRVFWIELQTRYGNQFYVRENGEDQAIIGALESVKTCIRQ  171



>gb|EKQ71061.1| hypothetical protein OsccyDRAFT_1378 [Oscillatoriales cyanobacterium 
JSC-12]
Length=283

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L   QE  LA ++A  E++TG+KLRVL Q +  TPG A+KD+W +DD +++ VADP  GN
Sbjct  68   LTSEQETALASDLAAFEQETGWKLRVLTQ-FDRTPGTAVKDYWGLDDHSLLLVADPRGGN  126

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            ILNF+VG ++   +PR FW  L  +YGN FY +E GED +I  A+ ++  C+R+
Sbjct  127  ILNFSVGDALYPLMPRVFWIELQTRYGNQFYVRENGEDQAIIGALESVKTCIRQ  180



>ref|WP_015202755.1| hypothetical protein [Crinalium epipsammum]
 ref|YP_007142147.1| hypothetical protein Cri9333_1752 [Crinalium epipsammum PCC 9333]
 gb|AFZ12637.1| hypothetical protein Cri9333_1752 [Crinalium epipsammum PCC 9333]
Length=267

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE+ LA+++ D E  TG+KLRVL Q +  TPG A+K+FW +DD++I+ VAD   G
Sbjct  51   SLTAIQEEALAKDLEDFEAATGWKLRVLTQ-FDRTPGRAVKNFWGLDDKSILLVADSRGG  109

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NILNFNVG +V   +PR+FW  L  ++GN+++ +E GED +I  ++ +I  CLR 
Sbjct  110  NILNFNVGDAVYGLMPRTFWIELQTRFGNLYFVREHGEDQAIIESLESIKTCLRR  164



>ref|WP_015124537.1| hypothetical protein [Synechococcus sp. PCC 6312]
 ref|YP_007061537.1| hypothetical protein Syn6312_1850 [Synechococcus sp. PCC 6312]
 gb|AFY60994.1| hypothetical protein Syn6312_1850 [Synechococcus sp. PCC 6312]
Length=283

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P Q+++L  ++   E DTG+KLRVL Q Y  TPGLA+KDFWE+DD +I+ VAD   G
Sbjct  67   ALTPVQQEKLGAQLEQFEVDTGWKLRVLTQ-YDRTPGLAVKDFWELDDHSILLVADSRGG  125

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            NILNFNVG      + R+FW  L  ++GN ++ +E GED +I  ++ AI  CL
Sbjct  126  NILNFNVGDDAYRVLQRTFWVELQTRFGNQYFVRENGEDQAIIQSLEAIENCL  178



>ref|WP_009789699.1| hypothetical protein [Synechococcus sp. BL107]
 gb|EAU71648.1| hypothetical protein BL107_12610 [Synechococcus sp. BL107]
Length=269

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 78/109 (72%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
            +Q +RL + + ++E+ TG+KLRVL Q Y  TPGLAI++FW +D+R+++ VADP  GN+LN
Sbjct  53   TQRERLEESLGEVEERTGWKLRVLTQ-YERTPGLAIREFWGLDERSLLLVADPRGGNLLN  111

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            FNVG +    +PR++W  L  ++GN +Y K+ GED ++  A+ A+  CL
Sbjct  112  FNVGDAYFAMMPRTYWVELQTRFGNQYYVKDHGEDGAVLDALGAVEICL  160



>ref|WP_011359845.1| hypothetical protein [Synechococcus sp. CC9902]
 ref|YP_377056.1| hypothetical protein Syncc9902_1048 [Synechococcus sp. CC9902]
 gb|ABB26012.1| conserved hypothetical protein [Synechococcus sp. CC9902]
Length=269

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 78/109 (72%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
            +Q +RL + + ++E+ TG+KLRVL Q Y  TPGLAI++FW +D+R+++ VADP  GN+LN
Sbjct  53   TQRERLEESLGEVEERTGWKLRVLTQ-YERTPGLAIREFWGLDERSLLLVADPRGGNLLN  111

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            FNVG +    +PR++W  L  ++GN +Y K+ GED ++  A+ A+  CL
Sbjct  112  FNVGDAYFAMMPRTYWVELQTRFGNQYYVKDHGEDGAVLDALGAVEICL  160



>ref|WP_017305625.1| hypothetical protein [Spirulina subsalsa]
Length=270

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 81/110 (74%), Gaps = 1/110 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QE+ L ++I   EK+TG+KLRVL Q Y +TPG ++K++W +DDR+++ VAD   GN+L F
Sbjct  56   QEESLIKQIDSFEKETGWKLRVLTQ-YDQTPGRSVKEYWGLDDRSVLLVADARGGNLLAF  114

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NVG  +   +PR+FW  L  ++GN++Y +E GE+ SI +A+ A+S+CLRE
Sbjct  115  NVGDELYNFLPRTFWVELQTRFGNLYYVRENGENNSIVNALDAVSSCLRE  164



>ref|WP_015179020.1| hypothetical protein [Oscillatoria nigro-viridis]
 ref|YP_007118230.1| hypothetical protein Osc7112_5591 [Oscillatoria nigro-viridis 
PCC 7112]
 gb|AFZ09814.1| hypothetical protein Osc7112_5591 [Oscillatoria nigro-viridis 
PCC 7112]
Length=268

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            +E+ LA+ +   E +TG+KLRVL Q Y  TPGLA+K +W +DD++++ VADP  GN+LNF
Sbjct  56   EEQTLAKNLKAFEAETGWKLRVLTQ-YDRTPGLAVKSYWGLDDKSVLLVADPRGGNLLNF  114

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NVG S+   +PR+FW  L  +YGN F+ ++ GED +I  ++ +I  CLR+
Sbjct  115  NVGDSLYPLLPRTFWVELQTRYGNQFFVRDNGEDRAIIESLESIEGCLRQ  164



>ref|WP_012626394.1| hypothetical protein [Cyanothece sp. PCC 7425]
 ref|YP_002481657.1| hypothetical protein Cyan7425_0910 [Cyanothece sp. PCC 7425]
 gb|ACL43296.1| conserved hypothetical protein [Cyanothece sp. PCC 7425]
Length=277

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 83/125 (66%), Gaps = 5/125 (4%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   Q+++L  E+   E +TG+KLRVL Q Y  TPG A+KDFW++++ +++ VAD   G
Sbjct  61   ALTSVQKEKLEAELTQFETETGWKLRVLTQ-YDRTPGRAVKDFWQLNENSVLLVADSRGG  119

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGAN  609
            NILNF+VG +V   +PR+FW  L  +YGN ++ +++GED SI  ++ AI  CLR+    N
Sbjct  120  NILNFSVGDAVYRLLPRTFWVELQTRYGNQYFVRDEGEDQSILQSLNAIETCLRQ----N  175

Query  610  NCSEV  624
             C  V
Sbjct  176  GCKVV  180



>ref|WP_038554684.1| methanol dehydrogenase [Synechococcus sp. KORDI-52]
Length=269

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
            +Q  +L   + D+E+ TG+KLRVL Q Y  TPGLA+++FW +D+R+++ VADP  GN+LN
Sbjct  53   TQRAQLETSLDDVEERTGWKLRVLTQ-YERTPGLAVREFWGLDERSLLLVADPRGGNLLN  111

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            FNVG +    +PR++W  L  +YGN +Y K+ GED +I  A+ A+  CL
Sbjct  112  FNVGDAYFAMMPRTYWVELQTRYGNQYYVKDHGEDGAIADALNAVEICL  160



>ref|WP_012162823.1| hypothetical protein [Acaryochloris marina]
 ref|YP_001516663.1| hypothetical protein AM1_2339 [Acaryochloris marina MBIC11017]
 gb|ABW27349.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
Length=267

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L  +Q+ +L +++   E+DTG+KLR+L Q Y  TPG A+KDFW +D+++++ VAD   G
Sbjct  51   ALTSTQKSKLDKDLDSFEQDTGWKLRILTQ-YDRTPGRAVKDFWNLDEKSVLLVADSRGG  109

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NILNFNVG SV   +PR+FW  L  ++GN ++ +E GED SI  A+ ++  CL +
Sbjct  110  NILNFNVGDSVYQLLPRTFWVELQTRFGNQYFVQENGEDESIIQAINSVKTCLNQ  164



>gb|EJK58377.1| hypothetical protein THAOC_21502 [Thalassiosira oceanica]
Length=326

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 79/121 (65%), Gaps = 8/121 (7%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEV------DDRTIVFVA  414
            L   QE+R+ + +  +EKDTGF++++L Q YP TPGLAI+++W++      DD+ +V VA
Sbjct  185  LTKGQERRVNEMLTSLEKDTGFRVKLLCQAYPRTPGLAIREYWDLGKEDQKDDKYVVLVA  244

Query  415  DP--TFGNILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            D     GN+LNFNVG      +P  F++RL GK+G  FY +E G D +I +A+ AI  CL
Sbjct  245  DEFGGKGNVLNFNVGEGCKFALPNIFFTRLTGKFGTTFYVRENGVDLAIINALEAIVTCL  304

Query  589  R  591
            R
Sbjct  305  R  305



>gb|AII49311.1| hypothetical protein KR52_09160 [Synechococcus sp. KORDI-52]
Length=308

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
            +Q  +L   + D+E+ TG+KLRVL Q Y  TPGLA+++FW +D+R+++ VADP  GN+LN
Sbjct  92   TQRAQLETSLDDVEERTGWKLRVLTQ-YERTPGLAVREFWGLDERSLLLVADPRGGNLLN  150

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            FNVG +    +PR++W  L  +YGN +Y K+ GED +I  A+ A+  CL
Sbjct  151  FNVGDAYFAMMPRTYWVELQTRYGNQYYVKDHGEDGAIADALNAVEICL  199



>ref|WP_038023196.1| methanol dehydrogenase [Synechococcus sp. RS9916]
Length=268

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   Q   L  +++  E  TG+KLRVL Q Y  TPGLA+KDFW +D+R+++ +ADP  G
Sbjct  48   ALSERQRSELETQLSGFEDRTGWKLRVLTQ-YERTPGLAVKDFWGLDERSLLLIADPRGG  106

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+LNFNVG +    +PR++W  L  +YGN FY ++ GED +I +A+ A+  CL
Sbjct  107  NLLNFNVGDAFFALMPRTWWVELQTRYGNQFYVRDNGEDGAIYAALDAVEVCL  159



>ref|WP_024124479.1| putative thylakoid membrane protein [Thermosynechococcus sp. 
NK55a]
 ref|YP_008899583.1| putative thylakoid membrane protein [Thermosynechococcus sp. 
NK55a]
 gb|AHB88070.1| putative thylakoid membrane protein [Thermosynechococcus sp. 
NK55a]
Length=269

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L P Q++ L  E+A+ E  TG+KLRVL Q Y  TPGLA++DFW++DDR+I+ VAD   GN
Sbjct  53   LTPVQKEHLDSELAEFEAQTGWKLRVLTQ-YDRTPGLAVRDFWDLDDRSILLVADTRGGN  111

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            +LNFNVG +    + R+FW  L  ++GN ++ ++ GED +I  ++ AI  CL +
Sbjct  112  LLNFNVGDTAYRVLQRTFWVELQTRFGNQYFVRDNGEDQAILQSLHAIETCLAQ  165



>gb|EAU73760.1| hypothetical protein RS9916_29664 [Synechococcus sp. RS9916]
Length=262

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   Q   L  +++  E  TG+KLRVL Q Y  TPGLA+KDFW +D+R+++ +ADP  G
Sbjct  42   ALSERQRSELETQLSGFEDRTGWKLRVLTQ-YERTPGLAVKDFWGLDERSLLLIADPRGG  100

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+LNFNVG +    +PR++W  L  +YGN FY ++ GED +I +A+ A+  CL
Sbjct  101  NLLNFNVGDAFFALMPRTWWVELQTRYGNQFYVRDNGEDGAIYAALDAVEVCL  153



>ref|WP_009633625.1| hypothetical protein [Synechocystis sp. PCC 7509]
Length=268

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE++LA E+   + +TG+KLRVL Q Y  TPG A+K FW +D+++I+ VAD   G
Sbjct  52   SLTSVQEEKLAAELDAFQTETGWKLRVLTQ-YDRTPGTAVKSFWGLDEKSILLVADSRGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NILNF++G +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ +I  CLR+
Sbjct  111  NILNFSIGDAVYDLLPRTFWIELQTRFGNLYFVREEGEDQAIIQAIGSIEGCLRQ  165



>ref|WP_036021814.1| methanol dehydrogenase [Leptolyngbya sp. PCC 7375]
Length=264

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L  SQE+ L + + + E +TG+KLRVL Q + +TPG A+KDFW +DD++I+ +ADP  GN
Sbjct  48   LTNSQEEYLNEHLPEFEAETGWKLRVLTQ-FDQTPGRAVKDFWNLDDKSIMLIADPRGGN  106

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            ILNF+VG +V   +PR FW  L  ++GN F+ ++ GED SI  ++ ++  CL
Sbjct  107  ILNFSVGDTVYSLLPRVFWIELQTRFGNQFFVRDNGEDQSIMQSIASLETCL  158



>ref|WP_036532562.1| methanol dehydrogenase [Neosynechococcus sphagnicola]
 gb|KGF72887.1| hypothetical protein DO97_04055 [Neosynechococcus sphagnicola 
sy1]
Length=266

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE  L +++A  E +TG+KLRVL Q +  TPG+A+K+FW +D ++++ VAD   G
Sbjct  50   SLTSIQESALVEDLATFEAETGWKLRVLTQ-FDRTPGIAVKEFWGLDHKSVLLVADARGG  108

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NILNF+VG +V   +PR+FW  L  ++GN F+ +E GED +I +A+ ++ +CLR+
Sbjct  109  NILNFSVGDAVYPLLPRTFWIELQTRFGNQFFVREHGEDQAILAAISSLESCLRQ  163



>ref|WP_012195348.1| hypothetical protein [Prochlorococcus marinus]
 ref|YP_001550680.1| hypothetical protein P9211_07951 [Prochlorococcus marinus str. 
MIT 9211]
 gb|ABX08726.1| conserved hypothetical protein [Prochlorococcus marinus str. 
MIT 9211]
Length=272

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            S  P+Q +RL   I + E +TG+K+RVL Q +  TPG AIK++W++D+RT++ VADP  G
Sbjct  48   SFNPNQIERLESSINEYEANTGWKIRVLTQ-FENTPGKAIKEYWDLDERTLLLVADPRGG  106

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+LNFNVG +    +PR+FW  L  ++GN FY ++ GED +I  AV ++  CL
Sbjct  107  NLLNFNVGDAYFTLMPRTFWVELQTRFGNQFYVRDNGEDLAIIGAVKSVEFCL  159



>ref|WP_011364421.1| hypothetical protein [Synechococcus sp. CC9605]
 ref|YP_381761.1| hypothetical protein Syncc9605_1452 [Synechococcus sp. CC9605]
 gb|ABB35206.1| conserved hypothetical protein [Synechococcus sp. CC9605]
Length=256

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
            +Q  +L   +AD+E+ TG+K+RVL Q Y  TPGLAI++FW +D+ +++ VADP  GN+LN
Sbjct  40   TQRSQLEASLADVEERTGWKMRVLTQ-YERTPGLAIREFWGLDESSLLLVADPRGGNLLN  98

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            FNVG +    +PR++W  L  +YGN +Y K+ GED ++  A+ A+  CL
Sbjct  99   FNVGDAYFAMMPRTYWVELQTRYGNQYYVKDHGEDGAVLDALNAVEICL  147



>gb|EKU97281.1| hypothetical protein Lepto7375DRAFT_6459 [Leptolyngbya sp. PCC 
7375]
Length=272

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L  SQE+ L + + + E +TG+KLRVL Q + +TPG A+KDFW +DD++I+ +ADP  GN
Sbjct  56   LTNSQEEYLNEHLPEFEAETGWKLRVLTQ-FDQTPGRAVKDFWNLDDKSIMLIADPRGGN  114

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            ILNF+VG +V   +PR FW  L  ++GN F+ ++ GED SI  ++ ++  CL
Sbjct  115  ILNFSVGDTVYSLLPRVFWIELQTRFGNQFFVRDNGEDQSIMQSIASLETCL  166



>ref|WP_006910393.1| hypothetical protein [Cyanobium sp. PCC 7001]
 gb|EDY38495.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
Length=273

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   Q   L + +   E +TG+KLRVL Q Y  TPGLA+K+FW +D+R+++ VADP  G
Sbjct  53   ALTDGQRAELEEHLTRFEAETGWKLRVLTQ-YERTPGLAVKEFWNLDERSLLLVADPRGG  111

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+LNFNVG ++   +PR++W  L  ++GN +Y ++ GED +I  A+ A+  CL
Sbjct  112  NLLNFNVGDALFALMPRTYWVELQTRFGNQYYVRDHGEDGAIVDALAAVETCL  164



>ref|WP_036000360.1| methanol dehydrogenase [Leptolyngbya sp. JSC-1]
Length=266

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   Q   L +++ + E +TG+KLRVL Q Y  TPG A+K+FW +DD +++ VADP  G
Sbjct  51   SLTTIQRDALEKDLNEFEAETGWKLRVLTQ-YDRTPGRAVKEFWGLDDHSVMLVADPRGG  109

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNF+VG  +   +PR+FW  L  ++GN FY +E GEDASI  A+ +I +C+R+
Sbjct  110  NLLNFSVGDDLFELMPRTFWIELQTRFGNQFYVRENGEDASILGALESIKSCIRQ  164



>ref|WP_036054017.1| methanol dehydrogenase [Leptolyngbya sp. Heron Island J]
Length=264

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 81/124 (65%), Gaps = 5/124 (4%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L  SQE+ L + + + E +TG+KLRVL Q + +TPG A+KDFW +DD++++ +ADP  GN
Sbjct  48   LTNSQEEYLNEHLPEFESETGWKLRVLTQ-FDQTPGRAVKDFWGLDDKSVMLIADPRGGN  106

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANN  612
            ILNF+VG SV   +PR FW  L  ++GN F+ ++ GED S+  ++ ++  CL        
Sbjct  107  ILNFSVGDSVYPLLPRVFWIELQTRFGNQFFVRDHGEDQSVMQSIASLETCLAR----GG  162

Query  613  CSEV  624
            CS V
Sbjct  163  CSVV  166



>ref|WP_010467786.1| hypothetical protein [Acaryochloris sp. CCMEE 5410]
Length=267

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L  +Q+ +L +++   E+DTG+KLR+L Q Y  TPG A+KDFW +D+++++ VAD   G
Sbjct  51   ALTSTQKSKLDKDLDSFEQDTGWKLRILTQ-YDRTPGRAVKDFWNLDEKSVLLVADSRGG  109

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NILNFNVG +V   +PR+FW  L  ++GN ++ +E GED SI  A+ ++  CL +
Sbjct  110  NILNFNVGDAVYQLLPRTFWVELQTRFGNQYFVQENGEDESIIQAINSVKTCLNQ  164



>gb|AHF63588.1| hypothetical protein Syncc8109_1218 [Synechococcus sp. WH 8109]
Length=269

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
            +Q  +L   +AD+E+ TG+K+RVL Q Y  TPGLAI++FW +D+ +++ VADP  GN+LN
Sbjct  53   TQRAQLEASLADVEERTGWKMRVLTQ-YERTPGLAIREFWGLDESSLLLVADPRGGNLLN  111

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            FNVG +    +PR++W  L  +YGN +Y K+ GED ++  A+ A+  CL
Sbjct  112  FNVGDAYFAMMPRTYWVELQTRYGNQYYVKDHGEDGAVLDALNAVEICL  160



>gb|ESA34484.1| hypothetical protein N836_16445 [Leptolyngbya sp. Heron Island 
J]
Length=272

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L  SQE+ L + + + E +TG+KLRVL Q + +TPG A+KDFW +DD++++ +ADP  GN
Sbjct  56   LTNSQEEYLNEHLPEFESETGWKLRVLTQ-FDQTPGRAVKDFWGLDDKSVMLIADPRGGN  114

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            ILNF+VG SV   +PR FW  L  ++GN F+ ++ GED S+  ++ ++  CL
Sbjct  115  ILNFSVGDSVYPLLPRVFWIELQTRFGNQFFVRDHGEDQSVMQSIASLETCL  166



>ref|WP_008233981.1| Cell division protein FtsI/penicillin-binding protein 2 [Richelia 
intracellularis]
 emb|CCH67433.1| Cell division protein FtsI/penicillin-binding protein 2 [Richelia 
intracellularis HH01]
Length=267

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE +L  E+   E DTG+KLR+L Q Y  TPG A+ +FW +DDR+++ VAD   G
Sbjct  52   SLTDLQESKLVNELEQFETDTGWKLRILTQ-YDRTPGRAVINFWGLDDRSVMLVADTRGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+  + +CL++
Sbjct  111  NILSFSVGDAVYQLLPRTFWIELQTRFGNLYFVRERGEDEAILEAISTVKSCLKQ  165



>ref|WP_037224612.1| methanol dehydrogenase [Richelia intracellularis]
Length=267

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE +L +E+   E DTG+KLRVL Q Y  TPG A+ +FW +DD++++ VAD   G
Sbjct  52   SLTDLQENKLVKELEQFETDTGWKLRVLTQ-YDRTPGRAVINFWGLDDKSVLLVADARGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+  +  CL+E
Sbjct  111  NILSFSVGDAVYQLLPRTFWIELQTRFGNLYFVRERGEDEAILEAIGTVKGCLQE  165



>emb|CDN17143.1| Cell division protein FtsI/penicillin-binding protein 2 [Richelia 
intracellularis]
Length=280

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE +L +E+   E DTG+KLRVL Q Y  TPG A+ +FW +DD++++ VAD   G
Sbjct  65   SLTDLQENKLVKELEQFETDTGWKLRVLTQ-YDRTPGRAVINFWGLDDKSVLLVADARGG  123

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+  +  CL+E
Sbjct  124  NILSFSVGDAVYQLLPRTFWIELQTRFGNLYFVRERGEDEAILEAIGTVKGCLQE  178



>ref|WP_027845979.1| hypothetical protein [Mastigocoleus testarum]
Length=273

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   QE  L QE+   E DTG+KLRVL Q Y  TPG A+ +FW +DDR+I+FV+D   G
Sbjct  56   TLNSVQENNLVQELEKFEADTGWKLRVLTQ-YDRTPGRAVINFWGLDDRSILFVSDARGG  114

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E+GED ++ +AV  +  CL +
Sbjct  115  NILSFSVGDAVYELLPRTFWIELQTRFGNLYFVREEGEDQAVLTAVRTVENCLSQ  169



>ref|WP_007355134.1| MULTISPECIES: hypothetical protein [Kamptonema]
 emb|CBN55919.1| conserved membrane hypothetical protein [ [[Oscillatoria] sp. 
PCC 6506]
Length=267

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   QE+ LA+++   E +TG+KLRVL Q Y  TPGLA+KD+W +D ++++ VAD   G
Sbjct  51   ALTEIQEQTLAKDLEQFEAETGWKLRVLTQ-YDRTPGLAVKDYWGLDQKSVLLVADQRGG  109

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG  +   +PR+FW  L  ++GN F+ ++ GED SI  ++ +I  CLR+
Sbjct  110  NLLNFNVGDDLYPLLPRTFWVELQTRFGNQFFIRDNGEDQSILESLESIKLCLRQ  164



>ref|WP_006632962.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK88180.1| hypothetical protein MicvaDRAFT_3282 [Microcoleus vaginatus FGP-2]
Length=268

 Score =   108 bits (271),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            +E+ L + +   E +TG+KLRVL Q Y  TPGLA+K +W +D+++++ VADP  GN+LNF
Sbjct  56   EEESLTKNLNAFEAETGWKLRVLTQ-YDRTPGLAVKSYWGLDNKSVLLVADPRGGNLLNF  114

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NVG S+   +PR+FW  L  +YGN F+ ++ GED +I  ++ +I  CLR+
Sbjct  115  NVGDSLYPLLPRTFWVELQTRYGNQFFVRDNGEDRAIIESLESIEGCLRQ  164



>ref|WP_006170717.1| hypothetical protein [Synechococcus sp. WH 5701]
 gb|EAQ73921.1| hypothetical protein WH5701_09800 [Synechococcus sp. WH 5701]
Length=279

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   Q   L + +   E  +G+KLRVL Q Y  TPGLA+K FW +D+R+++ VADP  G
Sbjct  56   ALTDGQRANLEEHLEAFEASSGWKLRVLTQ-YERTPGLAVKQFWGLDERSLLLVADPRGG  114

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+LNFNVG ++   +PR+FW  L  ++GN +Y ++ GED +I  A+ A+  CL
Sbjct  115  NLLNFNVGDALFALMPRTFWVELQTRFGNQYYVRDHGEDGAIVDALTAVETCL  167



>gb|AII43358.1| hypothetical protein KR100_08290 [Synechococcus sp. KORDI-100]
Length=261

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
            +Q   L Q +   E +TG+KLRVL Q Y  TPGLAI++FW +D+R+++ VADP  GN+LN
Sbjct  44   NQRAGLEQSLDQFEANTGWKLRVLTQ-YERTPGLAIREFWGLDERSLLLVADPRGGNLLN  102

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            FNVG +    +PR++W  L  ++GN +Y K+ GED +I  A+ A+  CL
Sbjct  103  FNVGDAFFALMPRTYWVELQTRFGNQYYVKDHGEDGAILDALNAVEICL  151



>ref|WP_038544557.1| methanol dehydrogenase [Synechococcus sp. KORDI-100]
Length=273

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
            +Q   L Q +   E +TG+KLRVL Q Y  TPGLAI++FW +D+R+++ VADP  GN+LN
Sbjct  56   NQRAGLEQSLDQFEANTGWKLRVLTQ-YERTPGLAIREFWGLDERSLLLVADPRGGNLLN  114

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            FNVG +    +PR++W  L  ++GN +Y K+ GED +I  A+ A+  CL
Sbjct  115  FNVGDAFFALMPRTYWVELQTRFGNQYYVKDHGEDGAILDALNAVEICL  163



>ref|YP_002048781.1| hypothetical protein PCC_0119 [Paulinella chromatophora]
 gb|ACB42571.1| hypothetical protein PCC_0119 [Paulinella chromatophora]
Length=282

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
             Q + L Q +   E DT +K+RVL Q Y  TPGLAIK FW +D+R+++ VADP  GN+LN
Sbjct  63   GQRETLEQRLEKFEADTEWKIRVLTQ-YDLTPGLAIKGFWGLDERSLLLVADPRGGNLLN  121

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLR  591
            FN+G ++   +PR++W  L  ++GN +Y +E GED +I  A+ A+ +CL+
Sbjct  122  FNIGDALFALMPRTYWVELQTRFGNQYYVREHGEDGAIIDALTAVESCLK  171



>ref|WP_015122581.1| methanol dehydrogenase [Rivularia sp. PCC 7116]
 ref|YP_007059579.1| methanol dehydrogenase [Rivularia sp. PCC 7116]
 gb|AFY59032.1| beta-propeller domain-containing protein, methanol dehydrogenase 
[Rivularia sp. PCC 7116]
Length=268

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 77/115 (67%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE+ L QE+ D E++TG++LRVL Q Y  TPG A+  FW ++D +I+ VAD   G
Sbjct  52   SLNVVQEQNLVQELYDFEEETGWQLRVLTQ-YDRTPGRAVIKFWGLNDHSILLVADSRGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NIL+F VG  V   +PR+FW  L  ++GN+++ +EKGED +I  A+  +  CLR+
Sbjct  111  NILSFAVGDDVYELLPRTFWIELQTRFGNLYFVREKGEDQAIIQALHTVENCLRQ  165



>ref|WP_039728078.1| methanol dehydrogenase [Lyngbya confervoides]
 gb|KIF15826.1| methanol dehydrogenase [Aphanocapsa montana BDHKU210001]
 gb|KIF40750.1| methanol dehydrogenase [Lyngbya confervoides BDU141951]
Length=274

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 82/125 (66%), Gaps = 5/125 (4%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   +E+RL   I   E ++G+KLRVL Q Y  TPG A+K++W +DD +++ +ADP  G
Sbjct  56   SLSSFEEERLNDRIQTFEDESGWKLRVLTQ-YDRTPGRAVKEYWGLDDHSVLLIADPRGG  114

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGAN  609
            N+LNF+VG ++   +PR+FW  L  +YGN F+ ++ GE+ +I  A+ +I  CLR+    N
Sbjct  115  NLLNFSVGDALFDLLPRTFWIELQTRYGNQFFVRDNGENGAILEALGSIETCLRQ----N  170

Query  610  NCSEV  624
             C+ V
Sbjct  171  GCAVV  175



>ref|WP_025782567.1| hypothetical protein [Candidatus Synechococcus spongiarum]
Length=263

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 78/123 (63%), Gaps = 5/123 (4%)
 Frame = +1

Query  256  CPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNI  435
             P Q + L +E+  +E  +G+KLRVL Q Y  +PGLA+KDFW VD+R++V +AD   GN+
Sbjct  46   TPIQRQDLVEELDAVEARSGWKLRVLTQ-YDRSPGLAVKDFWGVDERSLVLIADSRGGNL  104

Query  436  LNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANNC  615
            LNF+VG  +   +PR++W  L  ++GN +Y ++ GED +I  A+ A+  CL    G   C
Sbjct  105  LNFSVGDDMFALMPRNYWVELQTRFGNQYYVRDHGEDGAIRDALAAVETCL----GRGGC  160

Query  616  SEV  624
              V
Sbjct  161  RVV  163



>ref|WP_035154977.1| methanol dehydrogenase [Calothrix sp. 336/3]
 gb|KFB84617.1| hypothetical protein IJ00_18425 [Calothrix sp. 336/3]
Length=266

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 83/125 (66%), Gaps = 5/125 (4%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE++L +++   E +TG+KLRVL Q Y  TPG A+ +FW +DD++I+ VAD   G
Sbjct  50   SLTGVQEEKLVKDLEQFETETGWKLRVLTQ-YDRTPGRAVINFWGLDDKSILLVADSRGG  108

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGAN  609
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+  +  CLR+    N
Sbjct  109  NILSFSVGDAVYEYLPRTFWIELQTRFGNLYFVREEGEDQAIIQALDTVKNCLRQ----N  164

Query  610  NCSEV  624
             C  V
Sbjct  165  GCRVV  169



>ref|WP_028951952.1| hypothetical protein [Synechococcus sp. CC9616]
Length=271

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
            +Q   L + +   E++TG+KLRVL Q Y  TPGLAI++FW +D+R+++ VADP  GN+LN
Sbjct  56   NQRAGLEKSLDQFEQNTGWKLRVLTQ-YERTPGLAIREFWGLDERSLLVVADPRGGNLLN  114

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            FNVG ++   +PR++W  L  ++GN +Y K+ GED +I  A+ A+  CL
Sbjct  115  FNVGDALFALMPRTYWVELQTRFGNQYYVKDHGEDGAILDALNAVEICL  163



>ref|WP_011826194.1| hypothetical protein [Prochlorococcus marinus]
 ref|YP_001017568.1| hypothetical protein P9303_15591 [Prochlorococcus marinus str. 
MIT 9303]
 gb|ABM78303.1| conserved hypothetical protein [Prochlorococcus marinus str. 
MIT 9303]
Length=269

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
             Q   L + + D E  TG+KLRVL Q Y  TPGLA++++W +D+R+++ VADP  GN+LN
Sbjct  53   GQLTNLEKSLDDFETRTGWKLRVLTQ-YERTPGLAVREYWGLDERSLLVVADPRGGNLLN  111

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            FNVG ++   +PR++W  L  +YGN FY K+ GED +I  ++ A+  CL
Sbjct  112  FNVGDALYALMPRTYWVELQTRYGNQFYVKDHGEDIAILDSLNAVETCL  160



>ref|WP_036915242.1| MULTISPECIES: methanol dehydrogenase [Prochlorococcus]
 gb|KGG24797.1| hypothetical protein EV12_2669 [Prochlorococcus sp. MIT 0701]
 gb|KGG25947.1| hypothetical protein EV13_2721 [Prochlorococcus sp. MIT 0702]
 gb|KGG30878.1| hypothetical protein EV14_2817 [Prochlorococcus sp. MIT 0703]
Length=269

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 75/109 (69%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
            +Q   L + + + E  TG+KLRVL Q Y  TPGLA+++FW +D+R+++ VADP  GN+LN
Sbjct  53   NQLTNLEKSLDEFETRTGWKLRVLTQ-YERTPGLAVREFWGLDERSLLVVADPRGGNLLN  111

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            FNVG ++   +PR++W  L  +YGN FY K+ GED +I  ++ A+  CL
Sbjct  112  FNVGDALYALMPRTYWVELQTRYGNQFYVKDHGEDIAILDSLNAVETCL  160



>ref|WP_011130044.1| hypothetical protein [Prochlorococcus marinus]
 ref|NP_894497.1| hypothetical protein PMT0665 [Prochlorococcus marinus str. MIT 
9313]
 emb|CAE20840.1| conserved hypothetical protein [Prochlorococcus marinus str. 
MIT 9313]
Length=260

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            Q   L + + D E  TG+KLRVL Q Y  TPGLA++++W +D+R+++ VADP  GN+LNF
Sbjct  45   QLTNLEKSLDDYETRTGWKLRVLTQ-YERTPGLAVREYWGLDERSLLIVADPRGGNLLNF  103

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            NVG ++   +PR++W  L  +YGN FY K+ GED +I  ++ A+  CL
Sbjct  104  NVGDALYALMPRTYWVELQTRYGNQFYVKDHGEDIAILDSLNAVETCL  151



>ref|WP_015138114.1| hypothetical protein [Nostoc sp. PCC 7524]
 ref|YP_007075259.1| hypothetical protein Nos7524_1796 [Nostoc sp. PCC 7524]
 gb|AFY47662.1| hypothetical protein Nos7524_1796 [Nostoc sp. PCC 7524]
Length=269

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 81/120 (68%), Gaps = 5/120 (4%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QE++L +EI   E DTG+KLRVL Q Y  TPG A+ ++W +DD++I+ VAD   GNIL+F
Sbjct  57   QEEKLVEEIEQFETDTGWKLRVLTQ-YDRTPGRAVINYWGLDDKSILLVADSRGGNILSF  115

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLREPVGANNCSEV  624
            +VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ ++  CL +      CS V
Sbjct  116  SVGDAVYELLPRTFWIELQTRFGNLYFVREQGEDQAILQALSSVKGCLLK----GGCSVV  171



>ref|WP_015210123.1| hypothetical protein [Cylindrospermum stagnale]
 ref|YP_007149566.1| hypothetical protein Cylst_4830 [Cylindrospermum stagnale PCC 
7417]
 gb|AFZ26886.1| hypothetical protein Cylst_4830 [Cylindrospermum stagnale PCC 
7417]
Length=269

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE++L Q++A  E DTG+KLRVL Q Y  TPG A+  +W +DD++I+ VAD   G
Sbjct  52   SLPDLQEEQLVQDLAQFEADTGWKLRVLTQ-YDRTPGRAVIKYWGLDDKSILLVADSRGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ ++  CL
Sbjct  111  NILSFSVGDAVYELLPRTFWIELQTRFGNLYFVREQGEDQAILQALGSVKGCL  163



>ref|WP_011128176.1| hypothetical protein [Synechococcus sp. WH 8102]
 ref|NP_897405.1| hypothetical protein SYNW1312 [Synechococcus sp. WH 8102]
 emb|CAE07827.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
Length=268

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 72/108 (67%), Gaps = 1/108 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            Q   L + + D+E  TG+KLRVL Q Y  TPG A+K+FW +D+ +++ VADP  GN+LNF
Sbjct  53   QRSSLEKRLNDVEASTGWKLRVLTQ-YERTPGRAVKEFWGLDESSLLLVADPRGGNLLNF  111

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            NVG +    +PR++W  L  ++GN +Y KE GED +I  A+ A+  CL
Sbjct  112  NVGDAFFALMPRTYWVELQTRFGNQYYVKEHGEDGAIVDALNAVEVCL  159



>ref|WP_036907138.1| methanol dehydrogenase [Prochlorococcus marinus]
Length=250

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   Q   L   +   EK+TG+K+RVL+Q Y +TPGLA+KD+W++D+ +++ +ADP  G
Sbjct  30   TLSEKQRLELENSLNTYEKETGWKIRVLSQ-YEKTPGLAVKDYWDLDETSLLIIADPRGG  88

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+L+FNVG +    +PR FW  L  ++GN FY ++ GED +I +++ A+  CL
Sbjct  89   NLLSFNVGDAYFALMPRIFWVELQTRFGNQFYVRDNGEDGAILASIQAVETCL  141



>gb|KGG19520.1| hypothetical protein EV03_1904 [Prochlorococcus marinus str. 
PAC1]
Length=247

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   Q   L   +   EK+TG+K+RVL+Q Y +TPGLA+KD+W++D+ +++ +ADP  G
Sbjct  27   TLSEKQRLELENSLNTYEKETGWKIRVLSQ-YEKTPGLAVKDYWDLDETSLLIIADPRGG  85

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+L+FNVG +    +PR FW  L  ++GN FY ++ GED +I +++ A+  CL
Sbjct  86   NLLSFNVGDAYFALMPRIFWVELQTRFGNQFYVRDNGEDGAILASIQAVETCL  138



>ref|WP_011132314.1| hypothetical protein [Prochlorococcus marinus]
 ref|NP_892798.1| hypothetical protein PMM0680 [Prochlorococcus marinus subsp. 
pastoris str. CCMP1986]
 emb|CAE19139.1| conserved hypothetical protein [Prochlorococcus marinus subsp. 
pastoris str. CCMP1986]
 gb|KGF85960.1| hypothetical protein PROCH_1464 [Prochlorococcus marinus str. 
EQPAC1]
Length=265

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L + + ++EK++G+K++ L+Q +   PG+AIKD+W++D+ +++ +ADP  G
Sbjct  46   TLSPNQKKSLEENLNNLEKESGWKIKYLSQ-FESVPGIAIKDYWDLDETSLLVIADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL
Sbjct  105  NLLNFNVGEAYFAFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAINSVKICL  157



>ref|WP_015128736.1| hypothetical protein [Calothrix sp. PCC 7507]
 ref|YP_007065757.1| hypothetical protein Cal7507_2494 [Calothrix sp. PCC 7507]
 gb|AFY32923.1| hypothetical protein Cal7507_2494 [Calothrix sp. PCC 7507]
Length=269

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE++L Q++   E  TG+KLRVL Q Y  TPG A+ +FW +DD++I+ VAD   G
Sbjct  52   SLTDIQEQKLVQDLESFETATGWKLRVLTQ-YDRTPGRAVINFWGLDDKSILLVADSRGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ ++  CL +
Sbjct  111  NILSFSVGDAVYELLPRTFWIELQTRFGNLYFVREQGEDQAILQALDSVKGCLLQ  165



>ref|WP_015198990.1| hypothetical protein [Calothrix parietina]
 ref|YP_007138335.1| hypothetical protein Cal6303_3428 [Calothrix sp. PCC 6303]
 gb|AFZ02363.1| hypothetical protein Cal6303_3428 [Calothrix sp. PCC 6303]
Length=293

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 78/115 (68%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   QE+ L +E+ D + +TG+KLRVL Q +  TPG A+ +FW +DD++I+ VAD   G
Sbjct  76   TLTDVQEENLVKELNDFQTETGWKLRVLTQ-FDRTPGRAVINFWGLDDKSILLVADARGG  134

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E GED SI   +  +  CLR+
Sbjct  135  NILSFSVGDAVYELLPRTFWIELQTRFGNLYFVRENGEDQSIFQTMKTVETCLRQ  189



>ref|WP_026100417.1| hypothetical protein [Microchaete sp. PCC 7126]
Length=269

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE++L +++   E +TG+KLRVL Q Y  TPG A+ +FW +DD++I+ VAD   G
Sbjct  52   SLTDVQEEKLVEDLKSFETETGWKLRVLTQ-YDRTPGRAVINFWGLDDKSILLVADSRGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ ++  CL +
Sbjct  111  NILSFSVGDAVYEFLPRTFWIELQTRFGNLYFVREQGEDQAILQALNSVKGCLLQ  165



>ref|WP_038018052.1| methanol dehydrogenase [Synechococcus sp. PCC 7335]
Length=263

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 75/109 (69%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
            +QE  L  E+ + E  TG+KLRVL Q + +TPG A+K+FW +++R+I+ VADP  GN+LN
Sbjct  49   AQEDYLNTELPEFEASTGWKLRVLTQ-FDQTPGRAVKEFWGLNERSIMMVADPRGGNLLN  107

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            F+VG  +   +PR+FW  L  ++GN FY ++ GED ++  A+ A+  CL
Sbjct  108  FSVGDELYPLLPRTFWIELQTRFGNQFYVRDNGEDGAVLGAINALETCL  156



>ref|WP_007102413.1| hypothetical protein [Synechococcus sp. RS9917]
 gb|EAQ69227.1| hypothetical protein RS9917_12325 [Synechococcus sp. RS9917]
Length=267

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
             Q   L   + D E+ +G+KLRVL Q Y  TPGLA+K FW +D R+++ VADP  GN+LN
Sbjct  52   QQRADLETSLDDFEQRSGWKLRVLTQ-YERTPGLAVKSFWGLDARSLLLVADPRGGNLLN  110

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            FNVG +    +PR++W  L  +YGN +Y ++ GED +I +A+ A+  CL
Sbjct  111  FNVGDAFFALMPRTWWVELQTRYGNQYYVRDNGEDGAILAAIGAVELCL  159



>ref|WP_010996701.1| hypothetical protein [Nostoc sp. PCC 7120]
 ref|NP_486585.1| hypothetical protein all2545 [Nostoc sp. PCC 7120]
 dbj|BAB74244.1| all2545 [Nostoc sp. PCC 7120]
Length=269

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE++L ++I   E DTG+KLRVL Q Y  TPG A+ ++W +DD++I+ VAD   G
Sbjct  52   SLPDPQEEKLVEDIEQFEADTGWKLRVLTQ-YDRTPGRAVINYWGLDDKSILLVADSRGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ ++  CL
Sbjct  111  NILSFSVGDAVYELLPRTFWIELQTRFGNLYFVREQGEDQAILQALDSVKGCL  163



>gb|EDX86838.1| hypothetical protein S7335_4545 [Synechococcus sp. PCC 7335]
Length=280

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 75/109 (69%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
            +QE  L  E+ + E  TG+KLRVL Q + +TPG A+K+FW +++R+I+ VADP  GN+LN
Sbjct  66   AQEDYLNTELPEFEASTGWKLRVLTQ-FDQTPGRAVKEFWGLNERSIMMVADPRGGNLLN  124

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            F+VG  +   +PR+FW  L  ++GN FY ++ GED ++  A+ A+  CL
Sbjct  125  FSVGDELYPLLPRTFWIELQTRFGNQFYVRDNGEDGAVLGAINALETCL  173



>ref|WP_008189123.1| hypothetical protein [Moorea producens]
 gb|EGJ29729.1| hypothetical protein LYNGBM3L_60700 [Moorea producens 3L]
Length=267

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QE+RL Q++   E++TG+KLRVL Q Y  TPG A+K+FW ++D++++ +AD   GNIL F
Sbjct  56   QEQRLIQDLESFEEETGWKLRVLTQ-YDRTPGRAVKEFWGLNDKSMLLIADARGGNILGF  114

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NVG ++   +PR+FW  L  ++GN+++ ++ GE+ SI  ++  +  CLR+
Sbjct  115  NVGDALYEFLPRTFWVELQTRFGNLYFVRDNGENQSIIESLNTVKQCLRQ  164



>ref|WP_011619354.1| hypothetical protein [Synechococcus sp. CC9311]
 ref|YP_730637.1| hypothetical protein sync_1432 [Synechococcus sp. CC9311]
 gb|ABI47209.1| Uncharacterized membrane protein [Synechococcus sp. CC9311]
Length=269

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
            +Q K L   +   E+ +G+KLRVL Q Y +TPGLAIK+FW +D+R+++ V DP  GN+LN
Sbjct  53   NQLKELETSLDAFEERSGWKLRVLTQ-YEKTPGLAIKEFWGLDERSLLIVGDPRGGNLLN  111

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            FNVG +    +PR++W  L  +YGN +Y ++ GED SI + V A+  CL
Sbjct  112  FNVGDAFFALMPRTWWVELQTRYGNQYYVRDNGEDGSILATVGAVELCL  160



>ref|WP_011317357.1| hypothetical protein [Anabaena variabilis]
 ref|YP_320996.1| hypothetical protein Ava_0477 [Anabaena variabilis ATCC 29413]
 gb|ABA20101.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
Length=269

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE++L ++I   E DTG+KLRVL Q Y  TPG A+ ++W +DD++I+ VAD   G
Sbjct  52   SLPDPQEEKLVEDIEQFEADTGWKLRVLTQ-YDRTPGRAVINYWGLDDKSILLVADSRGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ ++  CL
Sbjct  111  NILSFSVGDAVYELLPRTFWIELQTRFGNLYFVREQGEDQAILQALDSVKGCL  163



>ref|WP_015212856.1| hypothetical protein [Anabaena cylindrica]
 ref|YP_007155113.1| hypothetical protein Anacy_0610 [Anabaena cylindrica PCC 7122]
 gb|AFZ56203.1| hypothetical protein Anacy_0610 [Anabaena cylindrica PCC 7122]
Length=269

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QE++L QE+   E DTG+KLRVL Q Y  TPG A+  +W +DD++I+ VAD   GNIL+F
Sbjct  57   QEEKLVQELEQFETDTGWKLRVLTQ-YDRTPGRAVIKYWGLDDKSILLVADARGGNILSF  115

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            +VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ ++  CL
Sbjct  116  SVGDAVYEFLPRTFWIELQTRFGNLYFVREQGEDQAILQALDSVKGCL  163



>ref|WP_015181427.1| hypothetical protein [Microcoleus sp. PCC 7113]
 ref|YP_007120673.1| hypothetical protein Mic7113_1384 [Microcoleus sp. PCC 7113]
 gb|AFZ17267.1| hypothetical protein Mic7113_1384 [Microcoleus sp. PCC 7113]
Length=267

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QE+ L +++ + E +TG+KLRVL Q Y  TPG A+KDFW ++D++++ +AD   GNIL F
Sbjct  56   QEEELVKDLENFETETGWKLRVLTQ-YDRTPGRAVKDFWGLNDKSVLLIADSRGGNILGF  114

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NVG  +   +PR+FW  L  ++GN++Y +E GE+ +I  ++  I  CLR+
Sbjct  115  NVGDDLYQFLPRTFWVELQTRFGNLYYVRENGENRAIVDSLDTIKTCLRQ  164



>ref|WP_011293648.1| hypothetical protein [Prochlorococcus marinus]
 ref|YP_291309.1| hypothetical protein PMN2A_0114 [Prochlorococcus marinus str. 
NATL2A]
 gb|AAZ57606.1| conserved hypothetical protein [Prochlorococcus marinus str. 
NATL2A]
Length=249

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   Q   L   +   E++TG+K+RVL+Q Y +TPGLA+KD+W +D+ +++ +ADP  G
Sbjct  30   TLSEKQRLELENSLNSYEQETGWKIRVLSQ-YEKTPGLAVKDYWNLDETSLLIIADPRGG  88

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+L+FNVG +    +PR FW  L  ++GN FY ++ GED +I +++ A+  CL
Sbjct  89   NLLSFNVGDAYFALMPRIFWVELQTRFGNQFYVRDNGEDGAILASIQAVETCL  141



>ref|WP_011434237.1| hypothetical protein [Synechococcus sp. JA-2-3B'a(2-13)]
 ref|YP_478882.1| hypothetical protein CYB_2694 [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD03619.1| conserved hypothetical protein [Synechococcus sp. JA-2-3B'a(2-13)]
Length=231

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 75/115 (65%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
             L  +QE +LAQ +  +E+DTG+KLRVL Q + +TPG  +K++W +++R+++ VADP  G
Sbjct  16   QLTSNQEAQLAQHLNKLEQDTGWKLRVLTQ-FDQTPGRQVKEYWGLNERSVLMVADPRGG  74

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+L FNVG +V   +PR+FW  L  ++GN FY +E G   +I   V  +  C  +
Sbjct  75   NLLAFNVGDAVREILPRTFWIELQSRFGNQFYVREHGTQRAILETVDVLDRCFHQ  129



>ref|WP_025952625.1| hypothetical protein [Prochlorococcus sp. scB243_495P20]
Length=265

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L  ++ ++EK++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  46   TLSPNQKKSLEDKLNNLEKESGWKIKYLSQ-FESSPGSAIKDYWDLDETSLLIVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL  
Sbjct  105  NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAINSVKICLER  159



>ref|WP_029956855.1| hypothetical protein, partial [Prochlorococcus sp. scB241_527L16]
Length=181

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 80/114 (70%), Gaps = 1/114 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L +++ ++E ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  21   TLSPNQKKSLEEKLNNLEIESGWKIKYLSQ-FESSPGSAIKDYWDLDETSLLIVADPRGG  79

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLR  591
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL 
Sbjct  80   NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAINSVKICLE  133



>ref|WP_029552971.1| hypothetical protein [Synechococcus sp. CB0101]
Length=276

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L  +Q   L  E+ + E  +G+KLRVL Q Y  TPGLA+KDFW +D+R+++ +AD   GN
Sbjct  57   LTDNQRAALEAELNNFEAVSGWKLRVLTQ-YDRTPGLAVKDFWGLDERSLLLIADERGGN  115

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            +LNFNVG ++   +PR++W  L  ++GN++Y ++ G+DA+I  ++  +  CL
Sbjct  116  LLNFNVGDALFALMPRTYWVELQTRFGNVYYVRDHGQDAAILDSLHTVEGCL  167



>ref|WP_025930130.1| hypothetical protein [Prochlorococcus sp. scB241_528O2]
Length=265

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L +++ +IE ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  46   TLSPNQKKSLEEKLNNIETESGWKIKYLSQ-FESSPGRAIKDYWDLDETSLLIVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL +
Sbjct  105  NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAINSVKICLEK  159



>ref|WP_016949206.1| hypothetical protein [Anabaena sp. PCC 7108]
Length=269

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE++L +E+   E DTG+KLRVL Q Y  TPG A+  +W +DD++I+ VAD   G
Sbjct  52   SLPDPQEEKLVRELEQFETDTGWKLRVLTQ-YDRTPGRAVIKYWGLDDKSILLVADSRGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ ++  CL
Sbjct  111  NILSFSVGDAVYEFLPRTFWIELQTRFGNLYFVREQGEDQAILQALDSVKGCL  163



>ref|WP_036920503.1| methanol dehydrogenase [Prochlorococcus marinus]
Length=264

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P Q++ L + + + E ++G+K++ L+Q +  +PGLAIKDFW++D+ +++ +ADP  G
Sbjct  46   TLSPIQKENLEKTLNNFELESGWKIKYLSQ-FESSPGLAIKDFWKLDETSLLIIADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG +    +PR FW  L  +YGN +Y +E GED ++  A+ ++  CL +
Sbjct  105  NLLNFNVGDAYFSFLPRLFWVELQTRYGNQYYVREHGEDGAVLDAINSVKICLEK  159



>ref|WP_025888080.1| hypothetical protein, partial [Prochlorococcus sp. scB241_526B17]
Length=194

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 80/114 (70%), Gaps = 1/114 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L +++ ++E ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  46   TLSPNQKKSLEEKLNNLEIESGWKIKYLSQ-FESSPGSAIKDYWDLDETSLLIVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLR  591
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL 
Sbjct  105  NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAINSVKICLE  158



>ref|WP_010317325.1| hypothetical protein [Synechococcus sp. CB0205]
Length=283

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L  +Q   L  EI D E  +G+KLRVL Q Y  TPGLA+KDFW +D+R+++ +AD   GN
Sbjct  63   LTDNQRAALEAEIDDFEAVSGWKLRVLTQ-YDRTPGLAVKDFWGLDERSLLLIADERGGN  121

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            +LNFNVG ++   +PR++W  L  ++GN +Y ++ G+DA+I  ++  +  CL
Sbjct  122  LLNFNVGDALFALMPRTYWVELQTRFGNQYYVRDHGQDAAILDSLHTVKGCL  173



>ref|WP_036892251.1| MULTISPECIES: methanol dehydrogenase [Prochlorococcus]
 gb|KGG23474.1| hypothetical protein EV09_1098 [Prochlorococcus marinus str. 
SS35]
 gb|KGG32290.1| hypothetical protein EV10_1405 [Prochlorococcus marinus str. 
SS51]
Length=255

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   +   L + + + E  TG+K+RVL Q Y ++PG+A+K FW++D+R++V VADP  G
Sbjct  40   SLSEVKRINLEKSLNEYENKTGWKIRVLTQ-YEKSPGIAVKKFWDLDERSLVLVADPRGG  98

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+LNFNVG +    +PR FW  L  +YGN FY ++ GE+ SI  ++ ++  CL
Sbjct  99   NLLNFNVGEAYFALMPRIFWVELQTRYGNQFYVRDNGEEMSIIDSINSVKECL  151



>ref|WP_011125163.1| hypothetical protein [Prochlorococcus marinus]
 ref|NP_875403.1| Uncharacterized membrane protein [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gb|AAQ00056.1| Uncharacterized membrane protein [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gb|KGG13853.1| hypothetical protein EV04_0338 [Prochlorococcus marinus str. 
LG]
 gb|KGG18986.1| hypothetical protein EV08_1473 [Prochlorococcus marinus str. 
SS2]
 gb|KGG35018.1| hypothetical protein EV11_1420 [Prochlorococcus sp. SS52]
Length=263

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   +   L + + + E  TG+K+RVL Q Y ++PG+A+K FW++D+R++V VADP  G
Sbjct  48   SLSEVKRINLEKSLNEYENKTGWKIRVLTQ-YEKSPGIAVKKFWDLDERSLVLVADPRGG  106

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+LNFNVG +    +PR FW  L  +YGN FY ++ GE+ SI  ++ ++  CL
Sbjct  107  NLLNFNVGEAYFALMPRIFWVELQTRYGNQFYVRDNGEEMSIIDSINSVKECL  159



>ref|WP_038081678.1| methanol dehydrogenase [Tolypothrix bouteillei]
 gb|KIE13223.1| methanol dehydrogenase [Tolypothrix bouteillei VB521301]
Length=269

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE++L +++   E DTG+KLRVL Q Y  TPG A+ +FW +DD++++ VAD   G
Sbjct  52   SLNSIQEEKLVKDLDKFEADTGWKLRVLTQ-YDRTPGRAVINFWGLDDKSVLLVADSRGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+  +  CL +
Sbjct  111  NILSFSVGDAVYELLPRTFWIELQTRFGNLYFVREQGEDQAILQAMETVKTCLVQ  165



>gb|AIQ96875.1| hypothetical protein EW15_0783 [Prochlorococcus sp. MIT 0801]
Length=246

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   Q   L   +   E++TG+K+RVL+Q Y +TPGLA+KD+W +D+ +++ +ADP  G
Sbjct  27   TLSEKQRLDLENSLNSYEQETGWKIRVLSQ-YEKTPGLAVKDYWNLDETSLLIIADPRGG  85

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+L+FNVG +    +PR FW  L  ++GN FY ++ GED +I +++ A+  CL
Sbjct  86   NLLSFNVGDAYFALMPRIFWVELQTRFGNQFYVRDNGEDGAILASIQAVETCL  138



>ref|WP_039753557.1| methanol dehydrogenase [Hassallia byssoidea]
 gb|KIF29753.1| methanol dehydrogenase [Hassallia byssoidea VB512170]
Length=269

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   QE++L Q++   + +TG+KLRVL Q Y  TPG A+  FW +DD++I+ VAD   G
Sbjct  52   TLTDIQEQQLVQDLNQFQAETGWKLRVLTQ-YDRTPGRAVIKFWGLDDKSILLVADSRGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ ++  CL
Sbjct  111  NILSFSVGDAVYELLPRTFWIELQTRFGNLYFVREEGEDQAILQALQSVKGCL  163



>ref|WP_013189814.1| hypothetical protein [Trichormus azollae]
 ref|YP_003719917.1| hypothetical protein Aazo_0158 ['Nostoc azollae' 0708]
 gb|ADI62794.1| conserved hypothetical protein ['Nostoc azollae' 0708]
Length=269

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QE++L QE+   E +TG+KLRVL Q Y  TPG A+  +W +DD++I+ VAD   GNIL+F
Sbjct  57   QEEKLVQELEQFETNTGWKLRVLTQ-YDRTPGRAVIKYWGLDDKSILLVADARGGNILSF  115

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            +VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ ++  CL
Sbjct  116  SVGEAVYELLPRTFWIELQTRFGNLYFVREQGEDQAILQALDSVKGCL  163



>ref|WP_038652049.1| methanol dehydrogenase [Prochlorococcus sp. MIT 0801]
Length=249

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   Q   L   +   E++TG+K+RVL+Q Y +TPGLA+KD+W +D+ +++ +ADP  G
Sbjct  30   TLSEKQRLDLENSLNSYEQETGWKIRVLSQ-YEKTPGLAVKDYWNLDETSLLIIADPRGG  88

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+L+FNVG +    +PR FW  L  ++GN FY ++ GED +I +++ A+  CL
Sbjct  89   NLLSFNVGDAYFALMPRIFWVELQTRFGNQFYVRDNGEDGAILASIQAVETCL  141



>ref|WP_026103252.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=269

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QE  L +E+   E+ TG+KLRVL Q    TPG A+KDFW +++R+++ VAD +  N+LNF
Sbjct  56   QEAELDKELTKFEQKTGWKLRVLTQ-VDRTPGRAVKDFWGLNERSVMLVADSSRRNLLNF  114

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            NVG SV   +PR FW  L  +YGN FY +++G D SI S++ AI  CL
Sbjct  115  NVGDSVYDLLPRVFWIELQSRYGNQFYVRDEGYDRSILSSINAIETCL  162



>ref|WP_012411221.1| hypothetical protein [Nostoc punctiforme]
 ref|YP_001868208.1| hypothetical protein Npun_R4920 [Nostoc punctiforme PCC 73102]
 gb|ACC83265.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
Length=245

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE++L +++   E DTG+KLRVL Q Y  TPG A+  +W +DD++I+ VAD   G
Sbjct  28   SLPVLQEEKLVKDLEQFEADTGWKLRVLTQ-YDRTPGRAVIKYWGLDDKSILLVADSRGG  86

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ ++  CL
Sbjct  87   NILSFSVGDAVYELLPRTFWIELQTRFGNLYFVREQGEDQAILQALESVKGCL  139



>ref|WP_038026411.1| methanol dehydrogenase [Synechococcus sp. PCC 7336]
Length=264

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 77/115 (67%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
             L P+QE +L +++  +E DTG+KLRVL Q   ++PG  +KD+W +++++++ VA+P  G
Sbjct  45   QLTPNQEAKLDRQLKQLEADTGWKLRVLTQ-ADKSPGRQVKDYWGLNEKSVLMVANPRGG  103

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+L FNVG  V   +PR+FW  L  +YGN F+ ++ G   +I++ V A+  C RE
Sbjct  104  NLLAFNVGDRVREVLPRTFWIELQSRYGNQFFVRDNGNADAIQTTVSALDGCFRE  158



>ref|WP_009785794.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW35667.1| hypothetical protein L8106_08361 [Lyngbya sp. PCC 8106]
Length=244

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L  +QE+ +A EI   E +TG+KLRVL Q +  TPG A+K +W +DD++++ VAD   GN
Sbjct  29   LSDTQEQLIASEIQQFESETGWKLRVLTQ-FDRTPGRAVKGYWGLDDKSVLLVADQRGGN  87

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            ILNFNVG  +   + R+FW  L  +YGN ++ ++ GED SI  ++ A+ +CL
Sbjct  88   ILNFNVGRDLYALLSRTFWVELQTRYGNQYFVRDNGEDQSIIQSLDAVKSCL  139



>ref|WP_015167594.1| methanol dehydrogenase [Synechococcus sp. PCC 7502]
 ref|YP_007105070.1| methanol dehydrogenase [Synechococcus sp. PCC 7502]
 gb|AFY72935.1| beta-propeller domain-containing protein, methanol dehydrogenase 
[Synechococcus sp. PCC 7502]
Length=268

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QE +L ++I + E  TG+KLRVL Q    TPG A+KDFW++++R+++ VAD    N+LNF
Sbjct  56   QETKLNKDITEFEAKTGWKLRVLTQ-VDLTPGRAVKDFWDLNERSVLLVADSRDRNLLNF  114

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NVG  V   +PR FW  L  +YGN F+ +E+G+D +I +++ AI+ CL +
Sbjct  115  NVGDEVYSLLPRGFWIELQSRYGNQFFVREQGQDQAILASLAAITTCLAQ  164



>ref|WP_023065898.1| repair family protein [Lyngbya aestuarii]
 gb|ERT07941.1| repair family protein [Lyngbya aestuarii BL J]
Length=244

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 76/114 (67%), Gaps = 1/114 (1%)
 Frame = +1

Query  253  LCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGN  432
            L  +QE+ +A EI   E +TG+KLRVL Q +  TPG A+K +W +DD++++ VAD   GN
Sbjct  29   LTDTQEQLIASEIQQFESETGWKLRVLTQ-FDRTPGRAVKGYWGLDDKSVLLVADQRGGN  87

Query  433  ILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            ILNFNVG  +   + R+FW  L  +YGN ++ ++ GED SI  ++ A+ +CL +
Sbjct  88   ILNFNVGRDLYALLSRTFWVELQTRYGNQYFVRDNGEDQSIIQSLDAVKSCLVQ  141



>ref|WP_027403263.1| hypothetical protein [Aphanizomenon flos-aquae]
Length=269

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QE++L +E+   E DTG+KLRVL Q Y  TPG A+  +W +DD++I+ VAD   GNIL+F
Sbjct  57   QEEKLVKELEQFETDTGWKLRVLTQ-YDRTPGRAVIKYWGLDDKSILLVADARGGNILSF  115

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            +VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ ++  CL
Sbjct  116  SVGDAVYEFLPRTFWIELQTRFGNLYFVREEGEDQAILQALNSVKGCL  163



>ref|WP_017746667.1| hypothetical protein [Scytonema hofmanni]
Length=269

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 78/115 (68%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            SL   QE++L ++    E DTG+KLRVL Q Y  TPG A+ +FW +DD++++ VAD   G
Sbjct  52   SLNSIQEEKLVKDFDKFEADTGWKLRVLTQ-YDRTPGRAVINFWGLDDKSVLLVADSRGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+  +  CL +
Sbjct  111  NILSFSVGDAVYELLPRTFWIELQTRFGNLYFVREQGEDQAILQAMETVKTCLLQ  165



>ref|WP_006103642.1| hypothetical protein [Coleofasciculus chthonoplastes]
 gb|EDX73179.1| hypothetical protein MC7420_4426 [Coleofasciculus chthonoplastes 
PCC 7420]
Length=266

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QE+ L Q+I   E  TG+KLRVL Q Y  TPGLA++D+W ++D++++ +ADP  GN+L F
Sbjct  55   QEEALIQDIETFEAQTGWKLRVLTQ-YDRTPGLAVRDYWGLNDKSVLLIADPRGGNLLGF  113

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NVG  +   +PR+FW  L  ++GN+++ ++ GE+ +I  A+  +  CL +
Sbjct  114  NVGDDLYQFLPRTFWVELQTRFGNLYFVRDNGENQAIVQALDTVKTCLNK  163



>ref|WP_015079048.1| hypothetical protein [Anabaena sp. 90]
 ref|YP_006995697.1| hypothetical protein ANA_C11101 [Anabaena sp. 90]
 gb|AFW93884.1| hypothetical protein ANA_C11101 [Anabaena sp. 90]
Length=269

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QE++L +E+   E DTG+KLRVL Q Y  TPG A+  +W +DD++I+ VAD   GNIL+F
Sbjct  57   QEEKLVKELEQFETDTGWKLRVLTQ-YDRTPGRAVIKYWGLDDKSILLVADARGGNILSF  115

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            +VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ ++  CL
Sbjct  116  SVGDAVYEFLPRTFWIELQTRFGNLYFVREEGEDQAILQALNSVKGCL  163



>ref|WP_039204881.1| methanol dehydrogenase [Aphanizomenon flos-aquae]
 gb|KHG39128.1| methanol dehydrogenase [Aphanizomenon flos-aquae 2012/KM/D3]
Length=269

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QE++L +E+   E DTG+KLRVL Q Y  TPG A+  +W +DD++I+ VAD   GNIL+F
Sbjct  57   QEEKLVKELEQFETDTGWKLRVLTQ-YDRTPGRAVIKYWGLDDKSILLVADARGGNILSF  115

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            +VG +V   +PR+FW  L  ++GN+++ +E+GED +I  A+ ++  CL
Sbjct  116  SVGDAVYEFLPRTFWIELQTRFGNLYFVREEGEDQAILQALNSVKGCL  163



>ref|WP_011823454.1| hypothetical protein [Prochlorococcus marinus]
 ref|YP_001014563.1| hypothetical protein NATL1_07401 [Prochlorococcus marinus str. 
NATL1A]
 gb|ABM75298.1| conserved hypothetical protein [Prochlorococcus marinus str. 
NATL1A]
Length=250

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   Q   L   +   E +TG+K+RVL+Q Y +TPGLA+KD+W +D+ +++ +ADP  G
Sbjct  30   TLSEKQRLELENSLNSYEVETGWKIRVLSQ-YEKTPGLAVKDYWNLDETSLLIIADPRGG  88

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+L+FNVG +    +PR FW  L  ++GN FY ++ GED +I +++ A+  CL
Sbjct  89   NLLSFNVGDAYFALMPRIFWVELQTRFGNQFYVRDNGEDGAILASIQAVETCL  141



>gb|EHA63464.1| hypothetical protein Syn8016DRAFT_0505 [Synechococcus sp. WH 
8016]
Length=250

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
            +Q K L   +   E+ +G+KLRVL Q Y +TPGLA+K+FW +D+R+++ V DP  GN+LN
Sbjct  34   NQLKELETSLDAFEERSGWKLRVLTQ-YEKTPGLAVKEFWGLDERSLLIVGDPRGGNLLN  92

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            FNVG +    +PR++W  L  +YGN +Y ++ GED S+ + + A+  CL
Sbjct  93   FNVGDAFFALMPRTWWVELQTRYGNQYYVRDNGEDGSLLATIGAVELCL  141



>ref|WP_029955945.1| hypothetical protein, partial [Prochlorococcus sp. scB241_527G5]
Length=229

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L +++ ++E ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  21   TLSPNQKKSLEEKLNNLEIESGWKIKYLSQ-FESSPGSAIKDYWDLDETSLLIVADPRGG  79

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL  
Sbjct  80   NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAINSVKICLER  134



>gb|AII45181.1| hypothetical protein KR49_01715 [Synechococcus sp. KORDI-49]
Length=268

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 72/108 (67%), Gaps = 1/108 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            Q   L + +   E +TG+KLRVL Q Y  TPGLA+++FW +D+ +++ VADP  GN+LNF
Sbjct  53   QRTELERSLERFETETGWKLRVLTQ-YERTPGLAVREFWGLDESSLLLVADPRGGNLLNF  111

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            NVG +    +PR++W  L  ++GN +Y K+ GED ++  A+ A+  CL
Sbjct  112  NVGDAFFALMPRTYWVELQTRFGNQYYVKDNGEDGAVLDALNAVEICL  159



>ref|WP_025893086.1| hypothetical protein, partial [Prochlorococcus sp. scB241_527N11]
Length=235

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L +++ ++E ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  16   TLSPNQKKSLEEKLNNLEIESGWKIKYLSQ-FESSPGSAIKDYWDLDETSLLIVADPRGG  74

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL
Sbjct  75   NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAINSVKICL  127



>ref|WP_008274011.1| hypothetical protein [Cyanothece sp. CCY0110]
 gb|EAZ92867.1| hypothetical protein CY0110_22262 [Cyanothece sp. CCY0110]
Length=270

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 75/108 (69%), Gaps = 1/108 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QE+ L QEI + E DTG+++RVL Q Y  +PG A+ +FW +DD++I+ VAD   GNIL+F
Sbjct  57   QEESLIQEIENFEFDTGWRIRVLTQ-YDRSPGRAVINFWGLDDKSILLVADSRGGNILSF  115

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            ++G  V   +PR+FW  L  ++GN++Y +E GE+ SI +A+  +  CL
Sbjct  116  SIGDDVYELLPRTFWIELQARFGNMYYVRENGENTSIMNALDTVKGCL  163



>ref|WP_025973242.1| hypothetical protein [Prochlorococcus sp. scB241_528P18]
Length=265

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L +++ ++E ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  46   TLSPNQKKSLEEKLNNLEIESGWKIKYLSQ-FESSPGSAIKDYWDLDETSLLIVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NILNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL  
Sbjct  105  NILNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAIDSVKICLER  159



>ref|WP_011862721.1| hypothetical protein [Prochlorococcus marinus]
 ref|YP_001090957.1| hypothetical protein P9301_07331 [Prochlorococcus marinus str. 
MIT 9301]
 gb|ABO17356.1| conserved hypothetical protein [Prochlorococcus marinus str. 
MIT 9301]
Length=265

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L +++ ++E ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  46   TLSPNQKKSLEEKLNNLETESGWKIKYLSQ-FESSPGSAIKDYWDLDETSLLIVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL  
Sbjct  105  NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAIDSVKICLER  159



>ref|WP_006276082.1| hypothetical protein [Cylindrospermopsis raciborskii]
 gb|EFA70899.1| conserved hypothetical protein [Cylindrospermopsis raciborskii 
CS-505]
Length=269

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 78/115 (68%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   QE++L +E+   E DTG+KLRVL Q Y  TPG A+  +W +DD++I+ VAD   G
Sbjct  52   TLPDPQEEKLVKELEQFEVDTGWKLRVLTQ-YDRTPGRAVIKYWGLDDKSILLVADARGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E GED +I  A+ ++  CL +
Sbjct  111  NILSFSVGDAVYELLPRTFWIELQTRFGNLYFVRENGEDQAILQALNSVKGCLAQ  165



>ref|WP_025974560.1| hypothetical protein [Prochlorococcus sp. scB241_529J16]
Length=265

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L +++ ++E ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  46   TLSPNQKKSLEEKLNNLEIESGWKIKYLSQ-FESSPGSAIKDYWDLDETSLLIVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL  
Sbjct  105  NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAINSVKICLER  159



>ref|WP_009344647.1| hypothetical protein [Raphidiopsis brookii]
 gb|EFA71571.1| conserved hypothetical protein [Raphidiopsis brookii D9]
Length=269

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 78/115 (68%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L   QE++L +E+   E DTG+KLRVL Q Y  TPG A+  +W +DD++I+ VAD   G
Sbjct  52   TLPDPQEEKLVKELEQFEVDTGWKLRVLTQ-YDRTPGRAVIKYWGLDDKSILLVADARGG  110

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            NIL+F+VG +V   +PR+FW  L  ++GN+++ +E GED +I  A+ ++  CL +
Sbjct  111  NILSFSVGDAVYELLPRTFWIELQTRFGNLYFVRENGEDQAILQALNSVKGCLAQ  165



>ref|WP_038013171.1| methanol dehydrogenase [Synechococcus sp. WH 8016]
Length=269

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +1

Query  262  SQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILN  441
            +Q K L   +   E+ +G+KLRVL Q Y +TPGLA+K+FW +D+R+++ V DP  GN+LN
Sbjct  53   NQLKELETSLDAFEERSGWKLRVLTQ-YEKTPGLAVKEFWGLDERSLLIVGDPRGGNLLN  111

Query  442  FNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            FNVG +    +PR++W  L  +YGN +Y ++ GED S+ + + A+  CL
Sbjct  112  FNVGDAFFALMPRTWWVELQTRYGNQYYVRDNGEDGSLLATIGAVELCL  160



>ref|WP_025964719.1| hypothetical protein [Prochlorococcus sp. scB243_498P15]
Length=265

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L +++ ++E ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  46   TLSPNQKKSLEEKLNNLEIESGWKIKYLSQ-FESSPGSAIKDYWDLDETSLLIVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL  
Sbjct  105  NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAINSVKICLER  159



>ref|WP_028090054.1| hypothetical protein [Dolichospermum circinale]
Length=269

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QE++L +E+   E DTG+KLRVL Q Y  TPG A+  +W +DD++I+ VAD   GNIL+F
Sbjct  57   QEEKLVKELEQFETDTGWKLRVLTQ-YDRTPGRAVIKYWGLDDKSILLVADARGGNILSF  115

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            +VG +V   +PR+FW  L  ++GN+++ +E+GED +I  ++ ++  CL
Sbjct  116  SVGDAVYQFLPRTFWIELQTRFGNLYFVREQGEDQAILQSLDSVKGCL  163



>ref|WP_028084895.1| hypothetical protein [Dolichospermum circinale]
Length=269

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = +1

Query  265  QEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFGNILNF  444
            QE++L +E+   E DTG+KLRVL Q Y  TPG A+  +W +DD++I+ VAD   GNIL+F
Sbjct  57   QEEKLVKELEQFETDTGWKLRVLTQ-YDRTPGRAVIKYWGLDDKSILLVADARGGNILSF  115

Query  445  NVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACL  588
            +VG +V   +PR+FW  L  ++GN+++ +E+GED +I  ++ ++  CL
Sbjct  116  SVGDAVYQFLPRTFWIELQTRFGNLYFVREQGEDQAILQSLDSVKGCL  163



>ref|WP_025944577.1| hypothetical protein [Prochlorococcus sp. scB241_529C4]
Length=265

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L +++ ++E ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  46   TLSPNQKKSLEEKLNNLEIESGWKIKYLSQ-FESSPGSAIKDYWDLDETSLLIVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL  
Sbjct  105  NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAINSVKICLER  159



>ref|WP_025971990.1| hypothetical protein [Prochlorococcus sp. scB241_527L22]
Length=265

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L +++ ++E ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  46   TLSPNQKKSLEEKLNNLEIESGWKIKYLSQ-FESSPGTAIKDYWDLDETSLLIVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL  
Sbjct  105  NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAIDSVKICLER  159



>ref|WP_025972922.1| hypothetical protein [Prochlorococcus sp. scB241_527P5]
Length=265

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L +++ ++E ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  46   TLSPNQKKSLEEKLNNLEIESGWKIKYLSQ-FESSPGSAIKDYWDLDETSLLIVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL  
Sbjct  105  NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAINSVKICLER  159



>ref|WP_025962338.1| hypothetical protein [Prochlorococcus sp. scB245a_521K15]
Length=265

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L +++ ++E ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  46   TLSPNQKKSLEEKLNNLEIESGWKIKYLSQ-FESSPGSAIKDYWDLDETSLLIVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL  
Sbjct  105  NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAINSVKICLER  159



>ref|WP_025961024.1| hypothetical protein [Prochlorococcus sp. scB245a_519L21]
Length=265

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L +++ ++E ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  46   TLSPNQKKSLEEKLNNLEIESGWKIKYLSQ-FESSPGSAIKDYWDLDETSLLIVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL  
Sbjct  105  NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAINSVKICLER  159



>ref|WP_025890608.1| MULTISPECIES: hypothetical protein [Prochlorococcus]
Length=265

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L +++ ++E ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  46   TLSPNQKKSLEEKLNNLEIESGWKIKYLSQ-FESSPGSAIKDYWDLDETSLLIVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL  
Sbjct  105  NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAINSVKICLER  159



>ref|WP_025959766.1| hypothetical protein [Prochlorococcus sp. scB245a_519C7]
Length=265

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L +++ ++E ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  46   TLSPNQKKSLEEKLNNLEIESGWKIKYLSQ-FESSPGSAIKDYWDLDETSLLIVADPRGG  104

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL  
Sbjct  105  NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAINSVKICLER  159



>gb|AIQ94774.1| hypothetical protein EW14_0754 [Prochlorococcus sp. MIT 0604]
Length=257

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +1

Query  250  SLCPSQEKRLAQEIADIEKDTGFKLRVLAQNYPETPGLAIKDFWEVDDRTIVFVADPTFG  429
            +L P+Q+K L + + ++E ++G+K++ L+Q +  +PG AIKD+W++D+ +++ VADP  G
Sbjct  38   TLSPNQKKSLEENLNNLETESGWKIKYLSQ-FESSPGSAIKDYWDLDETSLLIVADPRGG  96

Query  430  NILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKGEDASIESAVMAISACLRE  594
            N+LNFNVG +    +PR FW  L  ++GN +Y K+ GED ++  A+ ++  CL  
Sbjct  97   NLLNFNVGEAYFNFMPRLFWVELQTRFGNQYYVKDHGEDGAVLDAIDSVKICLER  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2327078598528