BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19603_g1_i1 len=624 path=[145:0-89 40:90-295 104:296-553
124:554-623]

Length=624
                                                                      Score     E

ref|XP_009761177.1|  PREDICTED: heparanase-like protein 2               129   3e-31   
gb|KDP31311.1|  hypothetical protein JCGZ_11687                         128   4e-31   
ref|XP_006354764.1|  PREDICTED: heparanase-like protein 2-like is...    128   4e-31   
ref|XP_002468296.1|  hypothetical protein SORBIDRAFT_01g043180          127   1e-30   Sorghum bicolor [broomcorn]
ref|XP_008453243.1|  PREDICTED: heparanase-like protein 1               127   1e-30   
ref|NP_001145968.1|  uncharacterized protein LOC100279495 precursor     127   1e-30   Zea mays [maize]
gb|ACG44916.1|  heparanase-like protein 2 precursor                     127   1e-30   Zea mays [maize]
ref|XP_011072825.1|  PREDICTED: heparanase-like protein 1 isoform X2    127   2e-30   
ref|XP_011072824.1|  PREDICTED: heparanase-like protein 1 isoform X1    127   2e-30   
ref|XP_002514696.1|  Heparanase-2, putative                             126   2e-30   Ricinus communis
ref|XP_003558511.1|  PREDICTED: heparanase-like protein 1               126   2e-30   
ref|XP_004241591.1|  PREDICTED: heparanase-like protein 2               126   3e-30   
ref|XP_004154950.1|  PREDICTED: LOW QUALITY PROTEIN: heparanase-l...    126   3e-30   
gb|KGN63705.1|  hypothetical protein Csa_1G011570                       126   3e-30   
ref|XP_004138183.1|  PREDICTED: heparanase-like protein 1-like          126   3e-30   
ref|XP_010546171.1|  PREDICTED: heparanase-like protein 1 isoform X1    125   3e-30   
gb|AGV40186.2|  heparanase 1-like protein                               125   3e-30   
ref|XP_002284470.1|  PREDICTED: heparanase-like protein 1               125   4e-30   Vitis vinifera
ref|XP_004157460.1|  PREDICTED: heparanase-like protein 1-like          125   4e-30   
ref|XP_008447189.1|  PREDICTED: heparanase-like protein 1               125   4e-30   
emb|CBI15157.3|  unnamed protein product                                125   4e-30   
ref|XP_004137422.1|  PREDICTED: heparanase-like protein 1-like          125   4e-30   
ref|XP_006399265.1|  hypothetical protein EUTSA_v10013186mg             125   4e-30   
gb|KHG13978.1|  hypothetical protein F383_01956                         125   5e-30   
ref|XP_010546175.1|  PREDICTED: heparanase-like protein 1 isoform X2    125   5e-30   
ref|XP_003525455.1|  PREDICTED: heparanase-like protein 1-like is...    125   6e-30   
ref|XP_006649618.1|  PREDICTED: heparanase-like protein 2-like          125   7e-30   
ref|XP_004985229.1|  PREDICTED: heparanase-like protein 1-like is...    125   7e-30   
gb|EPS63505.1|  heparanase-like protein 1                               124   8e-30   
gb|KHN18337.1|  Heparanase-like protein 1                               124   9e-30   
ref|XP_003549557.1|  PREDICTED: heparanase-like protein 1-like is...    124   9e-30   
gb|EYU43518.1|  hypothetical protein MIMGU_mgv1a004063mg                124   1e-29   
ref|XP_009631958.1|  PREDICTED: heparanase-like protein 2               124   1e-29   
gb|ACV84153.1|  heparanase                                              124   1e-29   Oryza sativa Indica Group [Indian rice]
ref|NP_001049350.1|  Os03g0211700                                       124   1e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009801842.1|  PREDICTED: heparanase-like protein 1 isoform X2    122   5e-29   
gb|EMT13371.1|  Heparanase-like protein 1                               122   5e-29   
ref|XP_010259074.1|  PREDICTED: heparanase-like protein 1               122   5e-29   
ref|XP_009595357.1|  PREDICTED: heparanase-like protein 2 isoform X2    122   6e-29   
ref|XP_009595353.1|  PREDICTED: heparanase-like protein 2 isoform X1    122   7e-29   
ref|XP_009801838.1|  PREDICTED: heparanase-like protein 2 isoform X1    122   7e-29   
dbj|BAJ97219.1|  predicted protein                                      122   8e-29   
ref|XP_006345162.1|  PREDICTED: heparanase-like protein 1-like          122   1e-28   
ref|XP_006578556.1|  PREDICTED: heparanase-like protein 1-like is...    122   1e-28   
gb|KHN36951.1|  Heparanase-like protein 1                               121   1e-28   
ref|XP_004235980.1|  PREDICTED: heparanase-like protein 1               121   2e-28   
ref|XP_003527099.1|  PREDICTED: heparanase-like protein 1-like is...    120   3e-28   
gb|KHN04137.1|  Heparanase-like protein 1                               120   3e-28   
ref|XP_007037487.1|  Glucuronidase 2 isoform 1                          120   3e-28   
ref|XP_007157647.1|  hypothetical protein PHAVU_002G087100g             117   6e-28   
ref|XP_010491400.1|  PREDICTED: heparanase-like protein 1               120   6e-28   
ref|XP_010258147.1|  PREDICTED: heparanase-like protein 1 isoform X2    119   7e-28   
ref|XP_010258148.1|  PREDICTED: heparanase-like protein 1 isoform X3    119   7e-28   
ref|XP_010258146.1|  PREDICTED: heparanase-like protein 1 isoform X1    119   7e-28   
ref|XP_010258149.1|  PREDICTED: heparanase-like protein 1 isoform X4    119   7e-28   
ref|XP_010452749.1|  PREDICTED: heparanase-like protein 1               119   8e-28   
gb|ACJ85515.1|  unknown                                                 118   9e-28   Medicago truncatula
ref|XP_010423167.1|  PREDICTED: heparanase-like protein 1 isoform X3    119   1e-27   
ref|XP_010423168.1|  PREDICTED: heparanase-like protein 1 isoform X4    119   1e-27   
ref|XP_010423166.1|  PREDICTED: heparanase-like protein 1 isoform X2    119   1e-27   
ref|XP_010423164.1|  PREDICTED: heparanase-like protein 1 isoform X1    119   1e-27   
ref|XP_006289223.1|  hypothetical protein CARUB_v10002679mg             117   3e-27   
ref|XP_002871291.1|  hypothetical protein ARALYDRAFT_350042             117   3e-27   
emb|CDX99032.1|  BnaC09g48030D                                          117   3e-27   
emb|CDX69989.1|  BnaA10g23380D                                          117   4e-27   
ref|XP_009122405.1|  PREDICTED: heparanase-like protein 1 isoform X1    117   4e-27   
ref|XP_009397277.1|  PREDICTED: heparanase-like protein 1               117   4e-27   
ref|XP_007155261.1|  hypothetical protein PHAVU_003G186600g             117   4e-27   
ref|XP_006374165.1|  hypothetical protein POPTR_0015s03440g             117   5e-27   
ref|XP_006440690.1|  hypothetical protein CICLE_v10019304mg             118   5e-27   
ref|XP_010037191.1|  PREDICTED: heparanase-like protein 2               117   5e-27   
ref|XP_011013079.1|  PREDICTED: heparanase-like protein 1 isoform X1    117   6e-27   
ref|XP_010030437.1|  PREDICTED: heparanase-like protein 1               117   7e-27   
emb|CAB62595.1|  putative protein                                       116   8e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009399121.1|  PREDICTED: heparanase-like protein 1               116   8e-27   
ref|XP_010678425.1|  PREDICTED: heparanase-like protein 2               116   1e-26   
ref|NP_196400.2|  glucuronidase 2                                       116   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004299326.1|  PREDICTED: heparanase-like protein 1-like          116   1e-26   
gb|KDO54584.1|  hypothetical protein CISIN_1g008834mg                   114   1e-26   
emb|CDP17495.1|  unnamed protein product                                116   1e-26   
gb|KDO54583.1|  hypothetical protein CISIN_1g008834mg                   115   1e-26   
gb|KDO54582.1|  hypothetical protein CISIN_1g008834mg                   114   2e-26   
ref|XP_006440691.1|  hypothetical protein CICLE_v10019304mg             115   3e-26   
ref|XP_006477619.1|  PREDICTED: heparanase-like protein 1-like is...    115   3e-26   
ref|XP_006281918.1|  hypothetical protein CARUB_v10028123mg             115   3e-26   
ref|XP_004508698.1|  PREDICTED: heparanase-like protein 2-like is...    115   3e-26   
ref|XP_008785953.1|  PREDICTED: heparanase-like protein 2 isoform X2    115   3e-26   
ref|XP_008785952.1|  PREDICTED: heparanase-like protein 2 isoform X1    115   3e-26   
ref|XP_004508697.1|  PREDICTED: heparanase-like protein 2-like is...    115   4e-26   
ref|XP_010457069.1|  PREDICTED: heparanase-like protein 2               114   4e-26   
gb|KEH31990.1|  glycoside hydrolase family 79 amino-terminal doma...    114   4e-26   
ref|XP_010443938.1|  PREDICTED: heparanase-like protein 2               114   5e-26   
ref|XP_010106651.1|  Heparanase-like protein 1                          114   5e-26   
gb|KEH31988.1|  glycoside hydrolase family 79 amino-terminal doma...    114   5e-26   
dbj|BAB08480.1|  unnamed protein product                                114   6e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200933.2|  glucuronidase 1                                       114   6e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KEH31989.1|  glycoside hydrolase family 79 amino-terminal doma...    114   6e-26   
ref|XP_010936349.1|  PREDICTED: heparanase-like protein 1 isoform X2    114   8e-26   
ref|XP_010936348.1|  PREDICTED: heparanase-like protein 1 isoform X1    114   1e-25   
ref|XP_010483789.1|  PREDICTED: heparanase-like protein 2               113   1e-25   
ref|XP_010923582.1|  PREDICTED: heparanase-like protein 2 isoform X1    113   2e-25   
ref|XP_010923583.1|  PREDICTED: heparanase-like protein 2 isoform X2    113   2e-25   
gb|KHG12946.1|  hypothetical protein F383_07365                         111   3e-25   
emb|CDY02161.1|  BnaA03g40060D                                          112   4e-25   
ref|XP_006394524.1|  hypothetical protein EUTSA_v10003960mg             111   5e-25   
ref|XP_009136454.1|  PREDICTED: heparanase-like protein 2               111   5e-25   
tpg|DAA55153.1|  TPA: hypothetical protein ZEAMMB73_112407              109   8e-25   
gb|KEH33104.1|  glycoside hydrolase family 79 amino-terminal doma...    110   9e-25   
ref|XP_002866422.1|  glycosyl hydrolase family 79 N-terminal doma...    110   1e-24   
ref|XP_008672060.1|  PREDICTED: uncharacterized protein LOC100192...    110   2e-24   
ref|XP_008672059.1|  PREDICTED: uncharacterized protein LOC100192...    110   2e-24   
ref|NP_001130921.1|  uncharacterized protein LOC100192026 precursor     110   2e-24   Zea mays [maize]
ref|XP_007209868.1|  hypothetical protein PRUPE_ppa003813mg             109   3e-24   
ref|XP_007209866.1|  hypothetical protein PRUPE_ppa003804mg             109   3e-24   
gb|EEC69565.1|  hypothetical protein OsI_38868                          110   8e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_008239880.1|  PREDICTED: heparanase-like protein 1               108   1e-23   
ref|XP_006664141.1|  PREDICTED: heparanase-like protein 1-like is...    107   1e-23   
gb|KDO54577.1|  hypothetical protein CISIN_1g008834mg                   107   2e-23   
ref|XP_008661167.1|  PREDICTED: heparanase-like protein 1               107   2e-23   
ref|XP_002862345.1|  hypothetical protein ARALYDRAFT_497509             106   2e-23   
ref|NP_001067122.1|  Os12g0578400                                       107   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|ACR10240.1|  heparanase                                              107   2e-23   Oryza sativa Indica Group [Indian rice]
gb|EYU28837.1|  hypothetical protein MIMGU_mgv1a026758mg                107   2e-23   
ref|XP_003578591.1|  PREDICTED: heparanase-like protein 1               107   2e-23   
gb|EEE53489.1|  hypothetical protein OsJ_36644                          107   2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002442385.1|  hypothetical protein SORBIDRAFT_08g019250          106   3e-23   Sorghum bicolor [broomcorn]
ref|XP_004962990.1|  PREDICTED: heparanase-like protein 2-like          106   4e-23   
tpg|DAA47199.1|  TPA: hypothetical protein ZEAMMB73_798346              107   6e-23   
tpg|DAA47198.1|  TPA: hypothetical protein ZEAMMB73_798346              107   7e-23   
emb|CAD42650.1|  putative heparanase                                    105   7e-23   Hordeum vulgare [barley]
dbj|BAJ96463.1|  predicted protein                                      105   9e-23   
dbj|BAJ84826.1|  predicted protein                                      105   9e-23   
dbj|BAJ97884.1|  predicted protein                                      105   9e-23   
ref|XP_011070961.1|  PREDICTED: heparanase-like protein 1 isoform X2    104   9e-23   
ref|XP_011070960.1|  PREDICTED: heparanase-like protein 2 isoform X1    104   1e-22   
ref|XP_002315010.1|  hypothetical protein POPTR_0010s16820g             104   2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011012392.1|  PREDICTED: heparanase-like protein 2               104   2e-22   
ref|XP_006483691.1|  PREDICTED: heparanase-like protein 2-like          103   3e-22   
ref|XP_009339108.1|  PREDICTED: heparanase-like protein 1 isoform X1    103   4e-22   
emb|CDP00405.1|  unnamed protein product                                103   6e-22   
gb|KDO83095.1|  hypothetical protein CISIN_1g041499mg                   102   6e-22   
ref|XP_011075654.1|  PREDICTED: heparanase-like protein 2               102   6e-22   
gb|KEH33103.1|  glycoside hydrolase family 79 amino-terminal doma...    102   7e-22   
gb|EMT24030.1|  Heparanase-like protein 2                               102   9e-22   
ref|XP_006438800.1|  hypothetical protein CICLE_v10033641mg             102   1e-21   
ref|XP_008374597.1|  PREDICTED: heparanase-like protein 1               102   1e-21   
gb|EMS63819.1|  Heparanase-like protein 2                               101   1e-21   
gb|AES96970.2|  glycoside hydrolase family 79 amino-terminal doma...    101   2e-21   
ref|XP_003614012.1|  Heparanase-like protein                            101   2e-21   
ref|XP_007045929.1|  Heparanase, putative                               101   2e-21   
ref|XP_009338656.1|  PREDICTED: heparanase-like protein 1 isoform X1    101   2e-21   
ref|XP_008393204.1|  PREDICTED: heparanase-like protein 1               101   2e-21   
ref|XP_009395254.1|  PREDICTED: heparanase-like protein 1               101   3e-21   
ref|XP_008792775.1|  PREDICTED: heparanase-like protein 2               101   3e-21   
gb|ACN26863.1|  unknown                                                 100   3e-21   Zea mays [maize]
ref|XP_006348811.1|  PREDICTED: heparanase-like protein 2-like          100   4e-21   
ref|XP_008221534.1|  PREDICTED: heparanase-like protein 2               100   4e-21   
ref|XP_010936395.1|  PREDICTED: heparanase-like protein 2               100   5e-21   
ref|XP_002274743.1|  PREDICTED: heparanase-like protein 2               100   6e-21   Vitis vinifera
emb|CBI27258.3|  unnamed protein product                                100   6e-21   
gb|KHN02016.1|  Heparanase-like protein 2                               100   7e-21   
ref|XP_006574932.1|  PREDICTED: heparanase-like protein 2-like          100   7e-21   
ref|XP_008805083.1|  PREDICTED: heparanase-like protein 2               100   7e-21   
ref|XP_004239465.2|  PREDICTED: heparanase-like protein 2             99.8    8e-21   
ref|XP_006837042.1|  hypothetical protein AMTR_s00110p00045590        99.8    9e-21   
gb|KEH33101.1|  glycoside hydrolase family 79 amino-terminal doma...  99.8    9e-21   
ref|XP_009612848.1|  PREDICTED: heparanase-like protein 2             99.8    9e-21   
ref|XP_009783167.1|  PREDICTED: heparanase-like protein 2             99.4    1e-20   
ref|XP_010904949.1|  PREDICTED: heparanase-like protein 1             99.4    1e-20   
emb|CAN63833.1|  hypothetical protein VITISV_009131                     100   1e-20   Vitis vinifera
emb|CDP13545.1|  unnamed protein product                              99.0    1e-20   
ref|XP_007226518.1|  hypothetical protein PRUPE_ppa025624mg           98.6    2e-20   
ref|XP_010552799.1|  PREDICTED: heparanase-like protein 2             98.6    2e-20   
ref|XP_006658769.1|  PREDICTED: heparanase-like protein 1-like        98.6    2e-20   
ref|XP_007157579.1|  hypothetical protein PHAVU_002G081000g           97.4    6e-20   
ref|XP_008340307.1|  PREDICTED: heparanase-like protein 2             97.1    6e-20   
ref|XP_007011804.1|  Glucuronidase 3 isoform 2                        96.3    1e-19   
ref|XP_007011803.1|  Glucuronidase 3 isoform 1                        96.7    1e-19   
ref|XP_010046621.1|  PREDICTED: heparanase-like protein 2             96.3    1e-19   
ref|XP_006483407.1|  PREDICTED: heparanase-like protein 3-like is...  95.1    2e-19   
ref|XP_006574930.1|  PREDICTED: heparanase-like protein 2-like is...  95.5    3e-19   
gb|KHN02019.1|  Heparanase-like protein 2                             95.5    3e-19   
ref|XP_006450373.1|  hypothetical protein CICLE_v10010401mg           95.5    3e-19   
gb|EEE67528.1|  hypothetical protein OsJ_24994                        95.1    3e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002512114.1|  Heparanase precursor, putative                   95.9    3e-19   Ricinus communis
gb|EAZ04591.1|  hypothetical protein OsI_26741                        95.5    3e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001060182.1|  Os07g0598400                                     95.5    3e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004298393.1|  PREDICTED: heparanase-like protein 2-like        95.1    3e-19   
ref|XP_009355782.1|  PREDICTED: heparanase-like protein 3             95.1    4e-19   
gb|KDO61807.1|  hypothetical protein CISIN_1g037212mg                 95.1    4e-19   
ref|XP_006483406.1|  PREDICTED: heparanase-like protein 3-like is...  95.1    4e-19   
ref|XP_008394121.1|  PREDICTED: heparanase-like protein 3 isoform X2  95.1    5e-19   
ref|XP_004488517.1|  PREDICTED: heparanase-like protein 3-like        94.4    7e-19   
ref|XP_011036604.1|  PREDICTED: heparanase-like protein 3 isoform X2  94.4    8e-19   
ref|XP_006852836.1|  hypothetical protein AMTR_s00033p00188330        94.4    8e-19   
ref|XP_011036603.1|  PREDICTED: heparanase-like protein 3 isoform X1  94.0    1e-18   
ref|XP_002515478.1|  heparanase, putative                             93.6    1e-18   Ricinus communis
ref|XP_002324878.2|  hypothetical protein POPTR_0018s02050g           94.0    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_010665516.1|  PREDICTED: heparanase-like protein 3 isoform X2  93.6    1e-18   
ref|XP_008446419.1|  PREDICTED: heparanase-like protein 1             93.2    2e-18   
gb|ACJ85786.1|  unknown                                               90.1    2e-18   Medicago truncatula
ref|XP_010665510.1|  PREDICTED: heparanase-like protein 3 isoform X1  93.6    2e-18   
ref|XP_007138475.1|  hypothetical protein PHAVU_009G212400g           92.8    2e-18   
ref|XP_010068782.1|  PREDICTED: heparanase-like protein 1             92.4    3e-18   
ref|XP_009623092.1|  PREDICTED: heparanase-like protein 3             92.4    3e-18   
ref|XP_004155378.1|  PREDICTED: probable S-acyltransferase At1g69...  93.2    4e-18   
gb|KGN51965.1|  hypothetical protein Csa_5G606560                     92.0    4e-18   
ref|XP_009757548.1|  PREDICTED: heparanase-like protein 3             92.0    4e-18   
gb|AFK40288.1|  unknown                                               92.0    4e-18   
ref|XP_009792772.1|  PREDICTED: heparanase-like protein 3 isoform X2  91.7    6e-18   
ref|XP_010099859.1|  Heparanase-like protein 3                        91.7    7e-18   
gb|KEH37925.1|  glycoside hydrolase family 79 amino-terminal doma...  91.3    9e-18   
ref|XP_004288767.1|  PREDICTED: heparanase-like protein 3-like        91.3    1e-17   
gb|KDP41275.1|  hypothetical protein JCGZ_15682                       90.1    1e-17   
ref|XP_009394623.1|  PREDICTED: heparanase-like protein 2             90.9    1e-17   
ref|XP_002283260.2|  PREDICTED: heparanase-like protein 3             90.5    1e-17   Vitis vinifera
gb|KDP33563.1|  hypothetical protein JCGZ_07134                       90.5    2e-17   
ref|XP_007224283.1|  hypothetical protein PRUPE_ppa019445mg           90.1    2e-17   
ref|XP_009625836.1|  PREDICTED: heparanase-like protein 3             90.1    2e-17   
ref|XP_004135441.1|  PREDICTED: heparanase-like protein 1-like        90.1    2e-17   
ref|XP_003533856.1|  PREDICTED: heparanase-like protein 3-like        90.1    2e-17   
ref|XP_008219535.1|  PREDICTED: heparanase-like protein 3 isoform X2  90.1    2e-17   
ref|XP_008219534.1|  PREDICTED: heparanase-like protein 3 isoform X1  90.1    2e-17   
gb|EPS67583.1|  hypothetical protein M569_07189                       89.7    3e-17   
gb|EYU34948.1|  hypothetical protein MIMGU_mgv1a004017mg              89.7    3e-17   
gb|EYU34947.1|  hypothetical protein MIMGU_mgv1a004017mg              89.7    3e-17   
ref|XP_006359499.1|  PREDICTED: heparanase-like protein 3-like        89.7    3e-17   
ref|XP_010250274.1|  PREDICTED: heparanase-like protein 3             89.7    3e-17   
ref|XP_010648741.1|  PREDICTED: heparanase-like protein 3             89.7    3e-17   
ref|XP_004146543.1|  PREDICTED: heparanase-like protein 1-like        89.0    3e-17   
ref|XP_011078541.1|  PREDICTED: heparanase-like protein 3             89.7    3e-17   
emb|CDP15923.1|  unnamed protein product                              85.1    4e-17   
ref|XP_006338978.1|  PREDICTED: heparanase-like protein 3-like        89.4    4e-17   
ref|XP_001769830.1|  predicted protein                                89.4    5e-17   
ref|XP_009393723.1|  PREDICTED: heparanase-like protein 3             89.4    5e-17   
ref|XP_004249602.1|  PREDICTED: heparanase-like protein 3             89.0    5e-17   
ref|XP_008438923.1|  PREDICTED: heparanase-like protein 2             88.6    6e-17   
ref|XP_010533116.1|  PREDICTED: heparanase-like protein 3             89.0    6e-17   
gb|KGN53270.1|  hypothetical protein Csa_4G043860                     88.6    7e-17   
ref|XP_004242732.1|  PREDICTED: heparanase-like protein 3             88.6    7e-17   
gb|EYU20239.1|  hypothetical protein MIMGU_mgv1a026019mg              88.6    8e-17   
ref|XP_007013614.1|  Glucuronidase 3 isoform 2                        88.6    8e-17   
emb|CBI21126.3|  unnamed protein product                              89.0    9e-17   
ref|XP_007155083.1|  hypothetical protein PHAVU_003G171800g           88.2    1e-16   
ref|XP_007155084.1|  hypothetical protein PHAVU_003G171800g           88.2    1e-16   
ref|XP_010927353.1|  PREDICTED: heparanase-like protein 3 isoform X1  88.2    1e-16   
ref|XP_007013613.1|  Glucuronidase 3 isoform 1                        88.2    1e-16   
ref|XP_011081531.1|  PREDICTED: heparanase-like protein 3             87.8    1e-16   
gb|KCW81361.1|  hypothetical protein EUGRSUZ_C02742                   87.0    1e-16   
ref|XP_002976895.1|  hypothetical protein SELMODRAFT_105931           87.8    1e-16   
emb|CBI25561.3|  unnamed protein product                              87.8    1e-16   
ref|XP_003546578.1|  PREDICTED: heparanase-like protein 3-like        87.8    1e-16   
ref|XP_002263173.1|  PREDICTED: heparanase-like protein 3             87.8    1e-16   Vitis vinifera
emb|CDP10485.1|  unnamed protein product                              87.4    2e-16   
ref|XP_010048937.1|  PREDICTED: heparanase-like protein 3 isoform X1  87.4    2e-16   
ref|XP_010450341.1|  PREDICTED: heparanase-like protein 3             87.4    2e-16   
ref|XP_010440690.1|  PREDICTED: heparanase-like protein 3             87.4    2e-16   
ref|XP_008385022.1|  PREDICTED: heparanase-like protein 3             87.4    2e-16   
gb|KFK22707.1|  hypothetical protein AALP_AAs49083U000200             87.4    2e-16   
ref|XP_006283483.1|  hypothetical protein CARUB_v10004531mg           87.4    2e-16   
ref|XP_009358543.1|  PREDICTED: heparanase-like protein 3             87.4    2e-16   
ref|NP_851093.1|  glucuronidase 3                                     87.4    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009338385.1|  PREDICTED: heparanase-like protein 3             87.4    2e-16   
ref|XP_008336960.1|  PREDICTED: heparanase-like protein 3             87.0    2e-16   
gb|EAY99897.1|  hypothetical protein OsI_21892                        87.0    2e-16   Oryza sativa Indica Group [Indian rice]
gb|EMT29716.1|  Heparanase-like protein 3                             87.0    2e-16   
gb|EAZ36024.1|  hypothetical protein OsJ_20330                        87.0    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006389405.1|  hypothetical protein POPTR_0025s00410g           87.0    2e-16   
ref|XP_003561019.1|  PREDICTED: heparanase-like protein 3             87.0    3e-16   
ref|XP_011017900.1|  PREDICTED: heparanase-like protein 3 isoform X1  87.0    3e-16   
gb|KDO73428.1|  hypothetical protein CISIN_1g008762mg                 86.3    4e-16   
ref|XP_010906003.1|  PREDICTED: heparanase-like protein 3             86.3    5e-16   
ref|XP_006453123.1|  hypothetical protein CICLE_v10007919mg           86.3    5e-16   
ref|XP_004508419.1|  PREDICTED: heparanase-like protein 3-like        86.3    5e-16   
emb|CDY23075.1|  BnaC07g31120D                                        85.9    5e-16   
gb|KDO73427.1|  hypothetical protein CISIN_1g008762mg                 86.3    5e-16   
ref|XP_006648064.1|  PREDICTED: heparanase-like protein 3-like        86.3    5e-16   
emb|CDY12398.1|  BnaC08g08070D                                        86.3    5e-16   
dbj|BAJ89245.1|  predicted protein                                    86.3    5e-16   
emb|CDY47561.1|  BnaA08g07260D                                        86.3    5e-16   
ref|XP_004954253.1|  PREDICTED: heparanase-like protein 3-like        85.9    6e-16   
ref|XP_008801893.1|  PREDICTED: heparanase-like protein 3 isoform X1  85.9    7e-16   
dbj|BAJ90636.1|  predicted protein                                    85.5    8e-16   
ref|XP_004159389.1|  PREDICTED: LOW QUALITY PROTEIN: heparanase-l...  85.5    8e-16   
ref|XP_004139281.1|  PREDICTED: heparanase-like protein 3-like        85.5    8e-16   
ref|XP_004163115.1|  PREDICTED: heparanase-like protein 1-like        85.5    8e-16   
gb|KGN51001.1|  hypothetical protein Csa_5G390000                     85.5    9e-16   
ref|XP_004140375.1|  PREDICTED: heparanase-like protein 1-like        85.5    9e-16   
ref|XP_001767170.1|  predicted protein                                85.5    9e-16   
ref|XP_009108062.1|  PREDICTED: heparanase-like protein 3             85.1    1e-15   
gb|KCW83013.1|  hypothetical protein EUGRSUZ_C04395                   84.7    1e-15   
ref|XP_002870409.1|  glycosyl hydrolase family 79 N-terminal doma...  85.1    1e-15   
ref|XP_002976894.1|  hypothetical protein SELMODRAFT_32458            84.7    1e-15   
ref|XP_010050122.1|  PREDICTED: heparanase-like protein 3             84.7    2e-15   
ref|XP_009363939.1|  PREDICTED: heparanase-like protein 3             84.7    2e-15   
sp|Q9LRC8.1|BAGLU_SCUBA  RecName: Full=Baicalin-beta-D-glucuronid...  84.3    2e-15   
emb|CAN81917.1|  hypothetical protein VITISV_038549                   84.7    2e-15   
ref|XP_008457259.1|  PREDICTED: LOW QUALITY PROTEIN: heparanase-l...  84.3    2e-15   
ref|XP_006837041.1|  hypothetical protein AMTR_s00110p00044140        84.0    2e-15   
ref|XP_001770123.1|  predicted protein                                84.0    3e-15   
ref|XP_008647415.1|  PREDICTED: uncharacterized protein LOC100193...  82.8    4e-15   
ref|NP_001048420.1|  Os02g0802200                                     83.6    4e-15   
gb|EAY87898.1|  hypothetical protein OsI_09318                        83.6    4e-15   
ref|XP_004964694.1|  PREDICTED: heparanase-like protein 3-like        83.6    5e-15   
ref|XP_002980613.1|  hypothetical protein SELMODRAFT_52894            82.8    5e-15   
gb|EPS66918.1|  hypothetical protein M569_07858                       83.2    5e-15   
gb|KHN15030.1|  Heparanase-like protein 3                             82.8    6e-15   
gb|ACF81144.1|  unknown                                               82.8    7e-15   
ref|NP_001132339.1|  uncharacterized protein LOC100193781 precursor   82.8    7e-15   
gb|KCW86528.1|  hypothetical protein EUGRSUZ_B03174                   82.4    1e-14   
ref|XP_003609474.1|  Heparanase-like protein                          82.0    1e-14   
ref|XP_003542659.1|  PREDICTED: heparanase-like protein 3-like        82.0    1e-14   
ref|XP_004134497.1|  PREDICTED: heparanase-like protein 2-like        81.6    2e-14   
ref|XP_007203617.1|  hypothetical protein PRUPE_ppa003883mg           81.6    2e-14   
ref|NP_001056967.1|  Os06g0179000                                     81.3    2e-14   
ref|NP_001241969.1|  uncharacterized protein LOC100792087 precursor   81.3    2e-14   
ref|XP_008242878.1|  PREDICTED: heparanase-like protein 3             81.3    2e-14   
ref|NP_198344.2|  glucuronidase 3                                     78.6    9e-14   
gb|KCW81359.1|  hypothetical protein EUGRSUZ_C02741                   79.3    1e-13   
ref|XP_005794527.1|  hypothetical protein EMIHUDRAFT_194815           79.3    1e-13   
ref|XP_010048935.1|  PREDICTED: heparanase-like protein 3             79.3    1e-13   
ref|XP_005777839.1|  hypothetical protein EMIHUDRAFT_52085            77.8    1e-13   
ref|XP_008394120.1|  PREDICTED: heparanase-like protein 3 isoform X1  79.0    1e-13   
dbj|BAB10787.1|  unnamed protein product                              78.6    2e-13   
ref|XP_010687865.1|  PREDICTED: heparanase-like protein 3             78.6    2e-13   
ref|NP_001152083.1|  heparanase-like protein 3 precursor              76.6    8e-13   
ref|XP_011020240.1|  PREDICTED: heparanase-like protein 3             76.3    1e-12   
ref|XP_009409980.1|  PREDICTED: heparanase-like protein 3             75.9    1e-12   
emb|CDP18206.1|  unnamed protein product                              73.6    2e-12   
ref|XP_002437942.1|  hypothetical protein SORBIDRAFT_10g005260        75.1    3e-12   
ref|XP_006381083.1|  hypothetical protein POPTR_0006s06100g           74.7    4e-12   
ref|XP_006381082.1|  hypothetical protein POPTR_0006s06100g           74.3    4e-12   
ref|XP_010246686.1|  PREDICTED: heparanase-like protein 3             69.3    9e-12   
ref|NP_001183276.1|  uncharacterized protein LOC100501670 precursor   73.2    9e-12   
gb|AFW73900.1|  hypothetical protein ZEAMMB73_176333                  73.2    1e-11   
gb|KDP30214.1|  hypothetical protein JCGZ_16996                       72.4    2e-11   
ref|XP_002452991.1|  hypothetical protein SORBIDRAFT_04g036200        71.6    3e-11   
ref|XP_002533671.1|  heparanase, putative                             71.6    4e-11   
gb|KHG18442.1|  hypothetical protein F383_07597                       71.6    4e-11   
gb|EWM24999.1|  heparanase-like protein 3                             71.2    6e-11   
gb|KHG18266.1|  hypothetical protein F383_21213                       70.1    1e-10   
gb|KCW81358.1|  hypothetical protein EUGRSUZ_C02740                   69.7    1e-10   
ref|XP_010048933.1|  PREDICTED: heparanase-like protein 3 isoform X1  69.7    1e-10   
ref|XP_006403100.1|  hypothetical protein EUTSA_v10003449mg           69.7    1e-10   
gb|AAC62790.1|  T2L5.7 gene product                                   66.6    2e-10   
ref|XP_003570329.1|  PREDICTED: heparanase-like protein 3             68.9    3e-10   
ref|XP_009792771.1|  PREDICTED: heparanase-like protein 3 isoform X1  68.6    3e-10   
gb|EMS53277.1|  Heparanase-like protein 1                             66.6    1e-09   
gb|EMT08055.1|  Heparanase-like protein 1                             66.2    2e-09   
ref|XP_002991234.1|  hypothetical protein SELMODRAFT_133227           64.3    9e-09   
ref|XP_001774747.1|  predicted protein                                63.5    1e-08   
ref|XP_002991174.1|  hypothetical protein SELMODRAFT_133100           63.5    1e-08   
ref|XP_010258412.1|  PREDICTED: heparanase-like protein 1             59.7    2e-08   
ref|XP_010100865.1|  Heparanase-like protein 3                        61.6    7e-08   
ref|XP_004292974.1|  PREDICTED: heparanase-like protein 3-like        58.5    6e-07   
ref|XP_009036441.1|  hypothetical protein AURANDRAFT_3240             58.2    7e-07   
emb|CBY24752.1|  unnamed protein product                              55.5    8e-06   
emb|CBY37768.1|  unnamed protein product                              55.5    8e-06   
ref|XP_002297572.1|  predicted protein                                52.4    9e-05   
ref|XP_006581996.1|  PREDICTED: heparanase-like protein 1-like is...  50.4    3e-04   
gb|EAZ26032.1|  hypothetical protein OsJ_09885                        50.1    4e-04   
gb|EAY89013.1|  hypothetical protein OsI_10495                        50.1    5e-04   



>ref|XP_009761177.1| PREDICTED: heparanase-like protein 2 [Nicotiana sylvestris]
 ref|XP_009761178.1| PREDICTED: heparanase-like protein 2 [Nicotiana sylvestris]
Length=541

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            QT+E  EL+I+T+ RI+ TD NYICATIDWWP EKCNY QCPW+ +S++NLDLSHPF   
Sbjct  20   QTVEDTELMIDTSVRIAWTDDNYICATIDWWPKEKCNYKQCPWDLASIINLDLSHPFLEN  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF+ LRLRLGGSLQDQ
Sbjct  80   AIRAFKGLRLRLGGSLQDQ  98



>gb|KDP31311.1| hypothetical protein JCGZ_11687 [Jatropha curcas]
Length=539

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q ++H  ++++ T +I++TD N+ICAT+DWWPH+KCNY+QCPW  SSV+NLDLSHP  AK
Sbjct  20   QDVKHVTIVVDGTVKIAETDDNFICATLDWWPHDKCNYDQCPWHYSSVINLDLSHPLLAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF +LR+R+GGSLQDQ
Sbjct  80   AIQAFRYLRIRIGGSLQDQ  98



>ref|XP_006354764.1| PREDICTED: heparanase-like protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006354765.1| PREDICTED: heparanase-like protein 2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006354766.1| PREDICTED: heparanase-like protein 2-like isoform X3 [Solanum 
tuberosum]
Length=538

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q +E  E LI+ T +I++TD NY+CAT+DWWP EKCNYN+CPW S+S++NLDLSHPF A 
Sbjct  19   QIVEDTEFLIDGTVKIAETDDNYVCATLDWWPKEKCNYNECPWGSASLINLDLSHPFLAN  78

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            +IQAF HLRLRLGGSLQ++
Sbjct  79   SIQAFNHLRLRLGGSLQNR  97



>ref|XP_002468296.1| hypothetical protein SORBIDRAFT_01g043180 [Sorghum bicolor]
 gb|EER95294.1| hypothetical protein SORBIDRAFT_01g043180 [Sorghum bicolor]
Length=543

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  E A ++++ ++RI+ TD NY+CATIDWWP EKCNYNQCPW  +S+LNLDL HPF A+
Sbjct  25   QQPEEATVIVKGSSRIAATDDNYVCATIDWWPPEKCNYNQCPWGQASILNLDLDHPFLAQ  84

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF+HLR+RLGGSLQD+
Sbjct  85   AIQAFDHLRIRLGGSLQDR  103



>ref|XP_008453243.1| PREDICTED: heparanase-like protein 1 [Cucumis melo]
 ref|XP_008453244.1| PREDICTED: heparanase-like protein 1 [Cucumis melo]
 ref|XP_008453245.1| PREDICTED: heparanase-like protein 1 [Cucumis melo]
Length=540

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q+  HA ++++  A +++TD NYICATIDWWPH+KCNYN+CPW  SS +NL+LSHP   K
Sbjct  20   QSATHASIIVDGAAVVAETDNNYICATIDWWPHDKCNYNRCPWGYSSAVNLNLSHPLLIK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAFEHLR+R+GGSLQDQ
Sbjct  80   AIQAFEHLRIRIGGSLQDQ  98



>ref|NP_001145968.1| uncharacterized protein LOC100279495 precursor [Zea mays]
 gb|ACL52953.1| unknown [Zea mays]
Length=541

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  + A ++++ + RI++TD NY+CATIDWWP EKCNYNQCPW  +S+LNLDL HPF A+
Sbjct  23   QQPDEATVIVKGSTRIAETDDNYVCATIDWWPPEKCNYNQCPWGQASILNLDLDHPFLAQ  82

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF+HLR+RLGGSLQD+
Sbjct  83   AIQAFDHLRIRLGGSLQDR  101



>gb|ACG44916.1| heparanase-like protein 2 precursor [Zea mays]
 gb|ACN28738.1| unknown [Zea mays]
 tpg|DAA44037.1| TPA: heparanase-like protein 2 [Zea mays]
Length=541

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  + A ++++ + RI++TD NY+CATIDWWP EKCNYNQCPW  +S+LNLDL HPF A+
Sbjct  23   QQPDEATVIVKGSTRIAETDDNYVCATIDWWPPEKCNYNQCPWGQASILNLDLDHPFLAQ  82

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF+HLR+RLGGSLQD+
Sbjct  83   AIQAFDHLRIRLGGSLQDR  101



>ref|XP_011072825.1| PREDICTED: heparanase-like protein 1 isoform X2 [Sesamum indicum]
 ref|XP_011072826.1| PREDICTED: heparanase-like protein 1 isoform X2 [Sesamum indicum]
Length=540

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  E A ++I+T+  +++TD NYICATIDWWP +KCNYN+CPW SSSV+NLDLSHPF + 
Sbjct  20   QKSEEARVVIDTSTTVAETDVNYICATIDWWPQDKCNYNRCPWGSSSVINLDLSHPFLSN  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF++LR+R+GGSLQDQ
Sbjct  80   AIRAFKNLRIRVGGSLQDQ  98



>ref|XP_011072824.1| PREDICTED: heparanase-like protein 1 isoform X1 [Sesamum indicum]
Length=540

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  E A ++I+T+  +++TD NYICATIDWWP +KCNYN+CPW SSSV+NLDLSHPF + 
Sbjct  20   QKSEEARVVIDTSTTVAETDVNYICATIDWWPQDKCNYNRCPWGSSSVINLDLSHPFLSN  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF++LR+R+GGSLQDQ
Sbjct  80   AIRAFKNLRIRVGGSLQDQ  98



>ref|XP_002514696.1| Heparanase-2, putative [Ricinus communis]
 gb|EEF47802.1| Heparanase-2, putative [Ricinus communis]
Length=539

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q ++HA ++++ T  +++TD N+ICAT+DWWPH+KC+YNQCPW  SSVLNL+LSHP  AK
Sbjct  20   QDVKHATIVVDGTVTVAETDDNFICATLDWWPHDKCDYNQCPWGYSSVLNLNLSHPLLAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            A+QAF HLR+R+GGSLQD+
Sbjct  80   AMQAFRHLRIRIGGSLQDR  98



>ref|XP_003558511.1| PREDICTED: heparanase-like protein 1 [Brachypodium distachyon]
Length=544

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  E A ++++ + RI++TD NY+CATIDWWP EKCNYNQCPW  SS+LNLDL HPF A+
Sbjct  24   QQPEEATVIVKGSNRIAETDENYVCATIDWWPPEKCNYNQCPWGQSSILNLDLDHPFLAQ  83

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF++LR+RLGGSLQD+
Sbjct  84   AIQAFDNLRIRLGGSLQDR  102



>ref|XP_004241591.1| PREDICTED: heparanase-like protein 2 [Solanum lycopersicum]
Length=539

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q +E  E LI+ T +I++TD NY+CAT+DWWP EKCN+N CPW S+S++NLDLSHPF A 
Sbjct  20   QIVEETEFLIDGTVKIAETDNNYVCATLDWWPKEKCNHNDCPWGSTSLINLDLSHPFLAN  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            +IQAF HLRLRLGGSLQ++
Sbjct  80   SIQAFNHLRLRLGGSLQNR  98



>ref|XP_004154950.1| PREDICTED: LOW QUALITY PROTEIN: heparanase-like protein 1-like 
[Cucumis sativus]
Length=540

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q   HA ++++  A +++TD NYICATIDWWPH+KCNYN+CPW  SS +NL+LSHP   K
Sbjct  20   QGATHASIIVDGAAVVAETDDNYICATIDWWPHDKCNYNRCPWGYSSAVNLNLSHPLLIK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAFEHLR+R+GGSLQDQ
Sbjct  80   AIQAFEHLRIRIGGSLQDQ  98



>gb|KGN63705.1| hypothetical protein Csa_1G011570 [Cucumis sativus]
Length=540

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q   HA ++++  A +++TD NYICATIDWWPH+KCNYN+CPW  SS +NL+LSHP   K
Sbjct  20   QGATHASIIVDGAAVVAETDDNYICATIDWWPHDKCNYNRCPWGYSSAVNLNLSHPLLIK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAFEHLR+R+GGSLQDQ
Sbjct  80   AIQAFEHLRIRIGGSLQDQ  98



>ref|XP_004138183.1| PREDICTED: heparanase-like protein 1-like [Cucumis sativus]
Length=540

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q   HA ++++  A +++TD NYICATIDWWPH+KCNYN+CPW  SS +NL+LSHP   K
Sbjct  20   QGATHASIIVDGAAVVAETDDNYICATIDWWPHDKCNYNRCPWGYSSAVNLNLSHPLLIK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAFEHLR+R+GGSLQDQ
Sbjct  80   AIQAFEHLRIRIGGSLQDQ  98



>ref|XP_010546171.1| PREDICTED: heparanase-like protein 1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546172.1| PREDICTED: heparanase-like protein 1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546173.1| PREDICTED: heparanase-like protein 1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546174.1| PREDICTED: heparanase-like protein 1 isoform X1 [Tarenaya hassleriana]
Length=538

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            ++ A ++I+ T R+S+TD N++CATIDWWPH+KCNY+QCPW  SSV+N+DLSHP  AKAI
Sbjct  23   LKRARIIIDGTRRVSETDENFVCATIDWWPHDKCNYDQCPWGYSSVINMDLSHPLLAKAI  82

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF  LR+R+GGSLQDQ
Sbjct  83   QAFGPLRIRIGGSLQDQ  99



>gb|AGV40186.2| heparanase 1-like protein [Nicotiana tabacum]
Length=541

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            QT E  EL+I+T+ +I+ TD NYICAT+DWWP EKCNY QCPW+ +S++NLDLSHPF   
Sbjct  20   QTGEDTELMIDTSVKIAWTDDNYICATLDWWPKEKCNYKQCPWDLASIINLDLSHPFLEN  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF+ LRLRLGGSLQDQ
Sbjct  80   AIQAFKGLRLRLGGSLQDQ  98



>ref|XP_002284470.1| PREDICTED: heparanase-like protein 1 [Vitis vinifera]
 ref|XP_010663309.1| PREDICTED: heparanase-like protein 1 [Vitis vinifera]
 ref|XP_010663310.1| PREDICTED: heparanase-like protein 1 [Vitis vinifera]
Length=539

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  E A + ++    +++TDAN+ICAT+DWWPH+KCNYN CPW  SSV+N+DLSHP FAK
Sbjct  20   QEFEDAIIKVDGATTVAETDANFICATLDWWPHDKCNYNHCPWGYSSVINMDLSHPLFAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF+HLR+R+GGSLQDQ
Sbjct  80   AIEAFKHLRIRIGGSLQDQ  98



>ref|XP_004157460.1| PREDICTED: heparanase-like protein 1-like [Cucumis sativus]
Length=536

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q IEHA ++I    ++++TD N+ICAT+DWWPH+KC+YNQCPW  SSV+NL+LSHP  +K
Sbjct  20   QDIEHARIIINANEKVAETDYNFICATLDWWPHDKCDYNQCPWGYSSVINLNLSHPLLSK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF +LR+R+GGSLQDQ
Sbjct  80   AIQAFHNLRIRIGGSLQDQ  98



>ref|XP_008447189.1| PREDICTED: heparanase-like protein 1 [Cucumis melo]
 ref|XP_008447267.1| PREDICTED: heparanase-like protein 1 [Cucumis melo]
 ref|XP_008447315.1| PREDICTED: heparanase-like protein 1 [Cucumis melo]
 ref|XP_008447359.1| PREDICTED: heparanase-like protein 1 [Cucumis melo]
 ref|XP_008447434.1| PREDICTED: heparanase-like protein 1 [Cucumis melo]
Length=536

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q IEHA ++I    ++++TD N+ICAT+DWWPH+KC+YNQCPW  SSV+NL+LSHP  +K
Sbjct  20   QDIEHARIIINANEKVAETDYNFICATLDWWPHDKCDYNQCPWGYSSVINLNLSHPLLSK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF +LR+R+GGSLQDQ
Sbjct  80   AIQAFHNLRIRIGGSLQDQ  98



>emb|CBI15157.3| unnamed protein product [Vitis vinifera]
Length=513

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  E A + ++    +++TDAN+ICAT+DWWPH+KCNYN CPW  SSV+N+DLSHP FAK
Sbjct  20   QEFEDAIIKVDGATTVAETDANFICATLDWWPHDKCNYNHCPWGYSSVINMDLSHPLFAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF+HLR+R+GGSLQDQ
Sbjct  80   AIEAFKHLRIRIGGSLQDQ  98



>ref|XP_004137422.1| PREDICTED: heparanase-like protein 1-like [Cucumis sativus]
 gb|KGN64031.1| hypothetical protein Csa_1G038980 [Cucumis sativus]
Length=536

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q IEHA ++I    ++++TD N+ICAT+DWWPH+KC+YNQCPW  SSV+NL+LSHP  +K
Sbjct  20   QDIEHARIIINANEKVAETDYNFICATLDWWPHDKCDYNQCPWGYSSVINLNLSHPLLSK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF +LR+R+GGSLQDQ
Sbjct  80   AIQAFHNLRIRIGGSLQDQ  98



>ref|XP_006399265.1| hypothetical protein EUTSA_v10013186mg [Eutrema salsugineum]
 gb|ESQ40718.1| hypothetical protein EUTSA_v10013186mg [Eutrema salsugineum]
Length=543

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q ++HA ++IE  +RIS+TD N++CAT+DWWPH+KCNY+ CPW  SSV+N+DLS P  AK
Sbjct  24   QDVKHASIVIEGASRISETDENFVCATLDWWPHDKCNYDNCPWGYSSVINMDLSRPLLAK  83

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            A+QAF+ LR+R+GGSLQDQ
Sbjct  84   AVQAFKPLRIRIGGSLQDQ  102



>gb|KHG13978.1| hypothetical protein F383_01956 [Gossypium arboreum]
 gb|KHG22114.1| hypothetical protein F383_09995 [Gossypium arboreum]
Length=497

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q I H  ++++ T  ++ TD N++CATIDWWPH+KCNY+QCPW  +SV+NL+LSHPF AK
Sbjct  20   QDISHGSIVVDGTMTVAQTDDNFVCATIDWWPHDKCNYDQCPWHYTSVMNLNLSHPFLAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF  LR+R+GGSLQDQ
Sbjct  80   AIQAFNRLRIRVGGSLQDQ  98



>ref|XP_010546175.1| PREDICTED: heparanase-like protein 1 isoform X2 [Tarenaya hassleriana]
Length=467

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            ++ A ++I+ T R+S+TD N++CATIDWWPH+KCNY+QCPW  SSV+N+DLSHP  AKAI
Sbjct  23   LKRARIIIDGTRRVSETDENFVCATIDWWPHDKCNYDQCPWGYSSVINMDLSHPLLAKAI  82

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF  LR+R+GGSLQDQ
Sbjct  83   QAFGPLRIRIGGSLQDQ  99



>ref|XP_003525455.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006579525.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Glycine 
max]
Length=547

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q IEH  +L++    I++TD N+ICATIDWWPH+KC+YN CPW  SS +NLDLSHPFFAK
Sbjct  20   QDIEHGSILVDGIQAIAETDDNFICATIDWWPHDKCDYNYCPWGDSSAVNLDLSHPFFAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQA + LR+R+GGSLQDQ
Sbjct  80   AIQALKPLRIRVGGSLQDQ  98



>ref|XP_006649618.1| PREDICTED: heparanase-like protein 2-like [Oryza brachyantha]
Length=542

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  E A ++++ +++I++TD NY+CATIDWWP EKCNYNQCPW  SS+LNLDL HPF A+
Sbjct  23   QPEEAATVIVKGSSKIAETDKNYVCATIDWWPPEKCNYNQCPWGQSSILNLDLDHPFLAQ  82

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF++LR+RLGGSLQD+
Sbjct  83   AIQAFDNLRIRLGGSLQDR  101



>ref|XP_004985229.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Setaria 
italica]
 ref|XP_004985230.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Setaria 
italica]
Length=540

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  E A ++++ + RI++TD +Y+CATIDWWP EKCNYNQCPW  SS+LNLDL HPF A+
Sbjct  24   QQPEEATVIVKGSTRIAETDESYVCATIDWWPPEKCNYNQCPWGQSSILNLDLDHPFLAQ  83

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF++LR+RLGGSLQD+
Sbjct  84   AIQAFDNLRIRLGGSLQDR  102



>gb|EPS63505.1| heparanase-like protein 1, partial [Genlisea aurea]
Length=482

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  E A L I+TTA I++TD++YIC T+DWWP +KCNYN+CPW SSSVLNL+LSHP FAK
Sbjct  29   QNSEDATLTIDTTAAIAETDSSYICVTLDWWPPDKCNYNRCPWGSSSVLNLNLSHPLFAK  88

Query  567  AIQAFEHLRLRLGGSLQD  620
            AIQ F+ LR+R+GGSLQD
Sbjct  89   AIQGFDSLRVRIGGSLQD  106



>gb|KHN18337.1| Heparanase-like protein 1 [Glycine soja]
Length=534

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q +EH  +L++    I++TD N+ICATIDWWPH+KC+YN CPW  SS +NLDLSHPFFAK
Sbjct  5    QDVEHGSVLVDGIQAIAETDDNFICATIDWWPHDKCDYNYCPWGDSSAVNLDLSHPFFAK  64

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQA + LR+R+GGSLQDQ
Sbjct  65   AIQALKPLRIRVGGSLQDQ  83



>ref|XP_003549557.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006600561.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Glycine 
max]
Length=547

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q +EH  +L++    I++TD N+ICATIDWWPH+KC+YN CPW  SS +NLDLSHPFFAK
Sbjct  20   QDVEHGSVLVDGIQAIAETDDNFICATIDWWPHDKCDYNYCPWGDSSAVNLDLSHPFFAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQA + LR+R+GGSLQDQ
Sbjct  80   AIQALKPLRIRVGGSLQDQ  98



>gb|EYU43518.1| hypothetical protein MIMGU_mgv1a004063mg [Erythranthe guttata]
Length=546

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E A L+++T+  +++TDANYICATIDWWP +KCNY+ CPW SSS +NLDLSHPF   AIQ
Sbjct  23   EEARLVVDTSKTVAETDANYICATIDWWPQDKCNYDTCPWGSSSAVNLDLSHPFLGNAIQ  82

Query  576  AFEHLRLRLGGSLQDQ  623
            AF++LR+R+GGSLQDQ
Sbjct  83   AFKNLRVRVGGSLQDQ  98



>ref|XP_009631958.1| PREDICTED: heparanase-like protein 2 [Nicotiana tomentosiformis]
Length=541

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            QT E  EL+I+T+ +I+ TD NYICAT+DWWP EKCNY QCPW+ +S++NLDLSHPF   
Sbjct  20   QTGEDTELMIDTSVKIAWTDDNYICATLDWWPKEKCNYKQCPWDLASIINLDLSHPFLEN  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF+ LRLRLGGSLQDQ
Sbjct  80   AIRAFKGLRLRLGGSLQDQ  98



>gb|ACV84153.1| heparanase [Oryza sativa Indica Group]
Length=542

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  E A ++++ + +I++T+ NYICATIDWWP EKCNYNQCPW  SS+LNLDL HPF A+
Sbjct  23   QQPEEATVIVKGSTKIAETNKNYICATIDWWPPEKCNYNQCPWGQSSILNLDLDHPFLAQ  82

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF++LR+RLGGSLQD+
Sbjct  83   AIQAFDNLRIRLGGSLQDR  101



>ref|NP_001049350.1| Os03g0211700 [Oryza sativa Japonica Group]
 gb|ABF94603.1| Heparanase-like protein 2 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11264.1| Os03g0211700 [Oryza sativa Japonica Group]
Length=541

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  E A ++++ + +I++T+ NYICATIDWWP EKCNYNQCPW  SS+LNLDL HPF A+
Sbjct  23   QQPEEATVIVKGSTKIAETNKNYICATIDWWPPEKCNYNQCPWGQSSILNLDLDHPFLAQ  82

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF++LR+RLGGSLQD+
Sbjct  83   AIQAFDNLRIRLGGSLQDR  101



>ref|XP_009801842.1| PREDICTED: heparanase-like protein 1 isoform X2 [Nicotiana sylvestris]
Length=506

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q +E   LLI+ T +I++TDANY+CAT+DWWP EKC+YN CPW  +S++NLDLSHPF A 
Sbjct  20   QIVEDTALLIDATVKIAETDANYVCATLDWWPKEKCDYNDCPWGYTSLMNLDLSHPFLAN  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            +IQAF  LRLRLGGSLQ++
Sbjct  80   SIQAFNPLRLRLGGSLQNR  98



>gb|EMT13371.1| Heparanase-like protein 1 [Aegilops tauschii]
Length=439

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  E A ++++ + +I+ TD NYICATIDWWP EKCNYNQCPW  SS+LNLDL HPF A+
Sbjct  23   QQPEEATVIVKGSTKIAVTDVNYICATIDWWPPEKCNYNQCPWGQSSILNLDLDHPFLAQ  82

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQ F +LR+RLGGSLQD+
Sbjct  83   AIQEFHNLRIRLGGSLQDR  101



>ref|XP_010259074.1| PREDICTED: heparanase-like protein 1 [Nelumbo nucifera]
 ref|XP_010259082.1| PREDICTED: heparanase-like protein 1 [Nelumbo nucifera]
 ref|XP_010259088.1| PREDICTED: heparanase-like protein 1 [Nelumbo nucifera]
Length=539

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
            A +++  +  I++TD N+ICAT+DWWPH+KCNYNQCPW  SSVLNLDLSHPF AKAIQAF
Sbjct  25   ATIVVRGSKSIAETDHNFICATLDWWPHDKCNYNQCPWGESSVLNLDLSHPFLAKAIQAF  84

Query  582  EHLRLRLGGSLQDQ  623
              LR+R+GGSLQD+
Sbjct  85   NPLRIRIGGSLQDR  98



>ref|XP_009595357.1| PREDICTED: heparanase-like protein 2 isoform X2 [Nicotiana tomentosiformis]
Length=539

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q +E   L+I+ T +I++TDANY+CAT+DWWP EKCNYN+CPW  +S++NLDLSHPF A 
Sbjct  20   QIVEDTALVIDGTVKIAETDANYVCATLDWWPKEKCNYNECPWGYTSLMNLDLSHPFLAN  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            +I+AF  LRLRLGGSLQ++
Sbjct  80   SIKAFNPLRLRLGGSLQNR  98



>ref|XP_009595353.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009595354.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009595355.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009595356.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana tomentosiformis]
Length=556

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q +E   L+I+ T +I++TDANY+CAT+DWWP EKCNYN+CPW  +S++NLDLSHPF A 
Sbjct  20   QIVEDTALVIDGTVKIAETDANYVCATLDWWPKEKCNYNECPWGYTSLMNLDLSHPFLAN  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            +I+AF  LRLRLGGSLQ++
Sbjct  80   SIKAFNPLRLRLGGSLQNR  98



>ref|XP_009801838.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009801839.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009801840.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009801841.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=539

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q +E   LLI+ T +I++TDANY+CAT+DWWP EKC+YN CPW  +S++NLDLSHPF A 
Sbjct  20   QIVEDTALLIDATVKIAETDANYVCATLDWWPKEKCDYNDCPWGYTSLMNLDLSHPFLAN  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            +IQAF  LRLRLGGSLQ++
Sbjct  80   SIQAFNPLRLRLGGSLQNR  98



>dbj|BAJ97219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  E   ++++ + +I++TD NYICATIDWWP EKCNYNQCPW  SS+LNLDL HPF A+
Sbjct  25   QQPEEVTVIVKGSTKIAETDVNYICATIDWWPPEKCNYNQCPWGQSSILNLDLDHPFLAQ  84

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQ F +LR+RLGGSLQD+
Sbjct  85   AIQEFHNLRIRLGGSLQDR  103



>ref|XP_006345162.1| PREDICTED: heparanase-like protein 1-like [Solanum tuberosum]
Length=540

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            QT++   L I+ + +++ TDANYICATIDWWP EKCNY QCPW S+S++NLDL+HP+   
Sbjct  20   QTVKEIVLTIDASTKVAWTDANYICATIDWWPKEKCNYKQCPWGSASIINLDLTHPYLEN  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF+ LRLRLGGSLQDQ
Sbjct  80   AIRAFKGLRLRLGGSLQDQ  98



>ref|XP_006578556.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006578557.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Glycine 
max]
Length=547

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q IEH  LL++     ++T  N+ICATIDWWPH+KC+YN CPW  SSV+NLDLSHPF AK
Sbjct  20   QDIEHGSLLVDGAQTKAETGDNFICATIDWWPHDKCDYNHCPWGYSSVVNLDLSHPFLAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQA   LR+RLGGSLQDQ
Sbjct  80   AIQALRPLRIRLGGSLQDQ  98



>gb|KHN36951.1| Heparanase-like protein 1 [Glycine soja]
Length=545

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q IEH  LL++     ++T  N+ICATIDWWPH+KC+YN CPW  SSV+NLDLSHPF AK
Sbjct  20   QDIEHGSLLVDGAQTKAETGDNFICATIDWWPHDKCDYNHCPWGYSSVVNLDLSHPFLAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQA   LR+RLGGSLQDQ
Sbjct  80   AIQALRPLRIRLGGSLQDQ  98



>ref|XP_004235980.1| PREDICTED: heparanase-like protein 1 [Solanum lycopersicum]
 ref|XP_010318834.1| PREDICTED: heparanase-like protein 1 [Solanum lycopersicum]
 ref|XP_010318835.1| PREDICTED: heparanase-like protein 1 [Solanum lycopersicum]
 ref|XP_010318836.1| PREDICTED: heparanase-like protein 1 [Solanum lycopersicum]
Length=540

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q ++   L I+ + +++ TDANYICATIDWWP EKCNY QCPW S+S+LNLDL+HP+   
Sbjct  20   QIVKQIVLTIDASTKVAWTDANYICATIDWWPKEKCNYKQCPWGSASILNLDLTHPYLVN  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF+ LRLRLGGSLQDQ
Sbjct  80   AIRAFKGLRLRLGGSLQDQ  98



>ref|XP_003527099.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006581995.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Glycine 
max]
Length=547

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q IEH  LL++     ++T  N+ICATIDWWPH+KC+YN CPW  SSV+NLDLSHPF AK
Sbjct  20   QDIEHGSLLVDGAQTKAETGDNFICATIDWWPHDKCDYNHCPWGYSSVVNLDLSHPFLAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQA + LR+RLGGSLQD+
Sbjct  80   AIQALKPLRIRLGGSLQDR  98



>gb|KHN04137.1| Heparanase-like protein 1 [Glycine soja]
Length=547

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q IEH  LL++     ++T  N+ICATIDWWPH+KC+YN CPW  SSV+NLDLSHPF AK
Sbjct  20   QDIEHGSLLVDGAQTKAETGDNFICATIDWWPHDKCDYNHCPWGYSSVVNLDLSHPFLAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQA + LR+RLGGSLQD+
Sbjct  80   AIQALKPLRIRLGGSLQDR  98



>ref|XP_007037487.1| Glucuronidase 2 isoform 1 [Theobroma cacao]
 ref|XP_007037488.1| Glucuronidase 2 isoform 1 [Theobroma cacao]
 gb|EOY21988.1| Glucuronidase 2 isoform 1 [Theobroma cacao]
 gb|EOY21989.1| Glucuronidase 2 isoform 1 [Theobroma cacao]
Length=538

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            + I H  ++++ T  ++ TD N+ICATIDWWPH+KC+Y QCPW  +S +NLDL+HPF AK
Sbjct  20   EEISHGTIVVDGTTTVAQTDDNFICATIDWWPHDKCDYKQCPWHYTSAINLDLTHPFLAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            A+QAF  LR+R+GGSLQDQ
Sbjct  80   AVQAFNRLRIRIGGSLQDQ  98



>ref|XP_007157647.1| hypothetical protein PHAVU_002G087100g [Phaseolus vulgaris]
 ref|XP_007157648.1| hypothetical protein PHAVU_002G087100g [Phaseolus vulgaris]
 ref|XP_007157649.1| hypothetical protein PHAVU_002G087100g [Phaseolus vulgaris]
 gb|ESW29641.1| hypothetical protein PHAVU_002G087100g [Phaseolus vulgaris]
 gb|ESW29642.1| hypothetical protein PHAVU_002G087100g [Phaseolus vulgaris]
 gb|ESW29643.1| hypothetical protein PHAVU_002G087100g [Phaseolus vulgaris]
Length=276

 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q IEH  LL++     ++T  N+ICATIDWWPH+KC+YN CPW  SSV+NLDLS PF +K
Sbjct  20   QDIEHGSLLVDGAQTKAETGDNFICATIDWWPHDKCDYNHCPWGYSSVVNLDLSLPFLSK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQA + LR+RLGGSLQDQ
Sbjct  80   AIQALKPLRIRLGGSLQDQ  98



>ref|XP_010491400.1| PREDICTED: heparanase-like protein 1 [Camelina sativa]
Length=551

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q ++   ++IE   R+S+TD N++CAT+DWWPH+KCNY QCPW  SSV+N+DL+ P  +K
Sbjct  32   QEMKRVSIVIEGARRVSETDENFVCATLDWWPHDKCNYQQCPWGYSSVINMDLTRPLLSK  91

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF+ LR+R+GGSLQDQ
Sbjct  92   AIQAFKPLRIRIGGSLQDQ  110



>ref|XP_010258147.1| PREDICTED: heparanase-like protein 1 isoform X2 [Nelumbo nucifera]
Length=543

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q    A ++++ +  I++TD N+ICATIDWWPH+KCNYNQCPW  SS+LNLDLSHP  A 
Sbjct  23   QETADATIVVKGSTIIAETDHNFICATIDWWPHDKCNYNQCPWGESSILNLDLSHPSLAN  82

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF  LR+R+GGSLQDQ
Sbjct  83   AIQAFNPLRIRIGGSLQDQ  101



>ref|XP_010258148.1| PREDICTED: heparanase-like protein 1 isoform X3 [Nelumbo nucifera]
Length=540

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q    A ++++ +  I++TD N+ICATIDWWPH+KCNYNQCPW  SS+LNLDLSHP  A 
Sbjct  20   QETADATIVVKGSTIIAETDHNFICATIDWWPHDKCNYNQCPWGESSILNLDLSHPSLAN  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF  LR+R+GGSLQDQ
Sbjct  80   AIQAFNPLRIRIGGSLQDQ  98



>ref|XP_010258146.1| PREDICTED: heparanase-like protein 1 isoform X1 [Nelumbo nucifera]
Length=544

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q    A ++++ +  I++TD N+ICATIDWWPH+KCNYNQCPW  SS+LNLDLSHP  A 
Sbjct  24   QETADATIVVKGSTIIAETDHNFICATIDWWPHDKCNYNQCPWGESSILNLDLSHPSLAN  83

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF  LR+R+GGSLQDQ
Sbjct  84   AIQAFNPLRIRIGGSLQDQ  102



>ref|XP_010258149.1| PREDICTED: heparanase-like protein 1 isoform X4 [Nelumbo nucifera]
Length=537

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q    A ++++ +  I++TD N+ICATIDWWPH+KCNYNQCPW  SS+LNLDLSHP  A 
Sbjct  17   QETADATIVVKGSTIIAETDHNFICATIDWWPHDKCNYNQCPWGESSILNLDLSHPSLAN  76

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF  LR+R+GGSLQDQ
Sbjct  77   AIQAFNPLRIRIGGSLQDQ  95



>ref|XP_010452749.1| PREDICTED: heparanase-like protein 1 [Camelina sativa]
 ref|XP_010452750.1| PREDICTED: heparanase-like protein 1 [Camelina sativa]
Length=551

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q ++   ++IE   R+S+TD N++CAT+DWWPH+KCNY QCPW  SSV+N+DL+ P  +K
Sbjct  32   QELKRVSIVIEGARRVSETDENFVCATLDWWPHDKCNYEQCPWGYSSVINMDLTRPLLSK  91

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF+ LR+R+GGSLQDQ
Sbjct  92   AIQAFKPLRIRIGGSLQDQ  110



>gb|ACJ85515.1| unknown [Medicago truncatula]
Length=372

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q IEH  LL+  T   ++T  N+ICATIDWWPH+KC+Y  C W  SSV+NLDLSHPF AK
Sbjct  20   QDIEHGSLLVNGTQAKAETGDNFICATIDWWPHDKCDYGHCSWGYSSVVNLDLSHPFLAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQA + LR+RLGGSLQDQ
Sbjct  80   AIQALKPLRIRLGGSLQDQ  98



>ref|XP_010423167.1| PREDICTED: heparanase-like protein 1 isoform X3 [Camelina sativa]
Length=530

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q ++   ++IE   R+S+TD N++CAT+DWWPH+KCNY QCPW  SSV+N+DL+ P  +K
Sbjct  11   QELKRVSIVIEGARRVSETDENFVCATLDWWPHDKCNYEQCPWGYSSVINMDLTRPLLSK  70

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            A+QAF+ LR+R+GGSLQDQ
Sbjct  71   AVQAFKPLRIRIGGSLQDQ  89



>ref|XP_010423168.1| PREDICTED: heparanase-like protein 1 isoform X4 [Camelina sativa]
Length=522

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q ++   ++IE   R+S+TD N++CAT+DWWPH+KCNY QCPW  SSV+N+DL+ P  +K
Sbjct  3    QELKRVSIVIEGARRVSETDENFVCATLDWWPHDKCNYEQCPWGYSSVINMDLTRPLLSK  62

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            A+QAF+ LR+R+GGSLQDQ
Sbjct  63   AVQAFKPLRIRIGGSLQDQ  81



>ref|XP_010423166.1| PREDICTED: heparanase-like protein 1 isoform X2 [Camelina sativa]
Length=543

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q ++   ++IE   R+S+TD N++CAT+DWWPH+KCNY QCPW  SSV+N+DL+ P  +K
Sbjct  24   QELKRVSIVIEGARRVSETDENFVCATLDWWPHDKCNYEQCPWGYSSVINMDLTRPLLSK  83

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            A+QAF+ LR+R+GGSLQDQ
Sbjct  84   AVQAFKPLRIRIGGSLQDQ  102



>ref|XP_010423164.1| PREDICTED: heparanase-like protein 1 isoform X1 [Camelina sativa]
Length=547

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q ++   ++IE   R+S+TD N++CAT+DWWPH+KCNY QCPW  SSV+N+DL+ P  +K
Sbjct  28   QELKRVSIVIEGARRVSETDENFVCATLDWWPHDKCNYEQCPWGYSSVINMDLTRPLLSK  87

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            A+QAF+ LR+R+GGSLQDQ
Sbjct  88   AVQAFKPLRIRIGGSLQDQ  106



>ref|XP_006289223.1| hypothetical protein CARUB_v10002679mg [Capsella rubella]
 gb|EOA22121.1| hypothetical protein CARUB_v10002679mg [Capsella rubella]
Length=542

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q ++   +++E   R+S+TD N++CAT+DWWPH+KCNY QCPW  SSV+N+DL+ P  +K
Sbjct  24   QEMKRVSIVVEGARRVSETDENFVCATLDWWPHDKCNYEQCPWGYSSVINMDLTRPLLSK  83

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF+ LR+R+GGSLQDQ
Sbjct  84   AIKAFKPLRIRIGGSLQDQ  102



>ref|XP_002871291.1| hypothetical protein ARALYDRAFT_350042 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47550.1| hypothetical protein ARALYDRAFT_350042 [Arabidopsis lyrata subsp. 
lyrata]
Length=528

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  + A +++E   R+ +TD N++CAT+DWWPH+KCNY+QCPW  SSV+N+DL+ P   K
Sbjct  3    QETKRASIVVEGARRVCETDENFVCATLDWWPHDKCNYDQCPWGYSSVINMDLTRPLLTK  62

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF+ LR+R+GGSLQDQ
Sbjct  63   AIQAFKPLRIRIGGSLQDQ  81



>emb|CDX99032.1| BnaC09g48030D [Brassica napus]
Length=543

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            ++ A ++I+  +RI++TD N++CAT+DWWPH+KCNY+ CPW  SSV+N+DLS P   KAI
Sbjct  26   MKRASIVIQGASRITETDENFVCATLDWWPHDKCNYDNCPWGYSSVINMDLSRPLLTKAI  85

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF+ LR+R+GGSLQDQ
Sbjct  86   QAFKPLRIRIGGSLQDQ  102



>emb|CDX69989.1| BnaA10g23380D [Brassica napus]
Length=519

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            ++ A ++I+  +RI++TD N++CAT+DWWPH+KCNY+ CPW  SSV+N+DLS P   KAI
Sbjct  27   MKRASIVIQGASRIAETDENFVCATLDWWPHDKCNYDNCPWGYSSVINMDLSRPLLTKAI  86

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF+ LR+R+GGSLQDQ
Sbjct  87   QAFKPLRIRIGGSLQDQ  103



>ref|XP_009122405.1| PREDICTED: heparanase-like protein 1 isoform X1 [Brassica rapa]
 ref|XP_009122406.1| PREDICTED: heparanase-like protein 1 isoform X2 [Brassica rapa]
Length=544

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            ++ A ++I+  +RI++TD N++CAT+DWWPH+KCNY+ CPW  SSV+N+DLS P   KAI
Sbjct  27   MKRASIVIQGASRIAETDENFVCATLDWWPHDKCNYDNCPWGYSSVINMDLSRPLLTKAI  86

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF+ LR+R+GGSLQDQ
Sbjct  87   QAFKPLRIRIGGSLQDQ  103



>ref|XP_009397277.1| PREDICTED: heparanase-like protein 1 [Musa acuminata subsp. malaccensis]
Length=538

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +3

Query  399  HAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQA  578
            +  ++++ +  +++TD +++CAT+DWWP +KCNYNQCPW  SSVLNLDL+HPF + AIQA
Sbjct  23   YVTIIVKGSDIVAETDDSFVCATLDWWPPQKCNYNQCPWGQSSVLNLDLTHPFLSNAIQA  82

Query  579  FEHLRLRLGGSLQDQ  623
            FEHLR+R+GGSLQDQ
Sbjct  83   FEHLRIRIGGSLQDQ  97



>ref|XP_007155261.1| hypothetical protein PHAVU_003G186600g [Phaseolus vulgaris]
 ref|XP_007155262.1| hypothetical protein PHAVU_003G186600g [Phaseolus vulgaris]
 gb|ESW27255.1| hypothetical protein PHAVU_003G186600g [Phaseolus vulgaris]
 gb|ESW27256.1| hypothetical protein PHAVU_003G186600g [Phaseolus vulgaris]
Length=546

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q +EH  +L+E    I++TD N+ICATIDWW H+KC+Y  CPW  SS +NLDLSHPF AK
Sbjct  20   QDVEHGLILVEGIQAIAETDDNFICATIDWWTHDKCDYKYCPWGDSSAVNLDLSHPFLAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQA + LR+R+GGSLQDQ
Sbjct  80   AIQALKPLRIRVGGSLQDQ  98



>ref|XP_006374165.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
 ref|XP_002321464.2| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
 ref|XP_006374167.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
 gb|ERP51962.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
 gb|EEF05591.2| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
 gb|ERP51964.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
Length=539

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q    A + I+ T  ++  D N+ICAT+DWWPH+KCNYNQCPW  SSV NLDLSHP  AK
Sbjct  20   QEGTRATISIDGTIAVAVIDDNFICATLDWWPHDKCNYNQCPWSYSSVTNLDLSHPLLAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF +LR+R+GGSLQDQ
Sbjct  80   AIQAFRNLRIRIGGSLQDQ  98



>ref|XP_006440690.1| hypothetical protein CICLE_v10019304mg [Citrus clementina]
 gb|ESR53930.1| hypothetical protein CICLE_v10019304mg [Citrus clementina]
Length=628

 Score =   118 bits (295),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +    + ++ T  ++  D ++ICAT+DWWPH+KCNYN CPW +SSV+NLDLSHP  A AI
Sbjct  108  VTRVTIFVDATKTVATNDEHFICATVDWWPHDKCNYNHCPWGNSSVINLDLSHPLLANAI  167

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF+ LR+R+GGSLQDQ
Sbjct  168  QAFQSLRIRIGGSLQDQ  184



>ref|XP_010037191.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
 ref|XP_010037192.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
 ref|XP_010037193.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
 ref|XP_010037194.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
 ref|XP_010037195.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
 ref|XP_010037196.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
 ref|XP_010037197.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
 ref|XP_010037198.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
 ref|XP_010037199.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
 ref|XP_010037200.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
 ref|XP_010037202.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
 ref|XP_010037203.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
 ref|XP_010037204.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
 ref|XP_010037205.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
 gb|KCW48871.1| hypothetical protein EUGRSUZ_K02497 [Eucalyptus grandis]
Length=540

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q + +++L+++ +  ++ TD N+ICAT+DWWPH+KCNYN CPW  +SV+NL+LSHP    
Sbjct  21   QKVAYSKLIVDGSNTVAQTDDNFICATLDWWPHDKCNYNMCPWGYTSVINLNLSHPVLGN  80

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF+ LR+R+GGSLQDQ
Sbjct  81   AIQAFKRLRIRIGGSLQDQ  99



>ref|XP_011013079.1| PREDICTED: heparanase-like protein 1 isoform X1 [Populus euphratica]
Length=539

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q    A + I+ T  ++  D N+ICAT+DWWPH+KCNYNQCPW  SSV NLDLSHP  AK
Sbjct  20   QEGTRATISIDGTIAVAVIDDNFICATLDWWPHDKCNYNQCPWGYSSVTNLDLSHPLLAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF +LR+R+GGSLQDQ
Sbjct  80   AIQAFRNLRIRIGGSLQDQ  98



>ref|XP_010030437.1| PREDICTED: heparanase-like protein 1 [Eucalyptus grandis]
 ref|XP_010030444.1| PREDICTED: heparanase-like protein 1 [Eucalyptus grandis]
 ref|XP_010030449.1| PREDICTED: heparanase-like protein 1 [Eucalyptus grandis]
 gb|KCW83688.1| hypothetical protein EUGRSUZ_B00567 [Eucalyptus grandis]
 gb|KCW83689.1| hypothetical protein EUGRSUZ_B00567 [Eucalyptus grandis]
Length=540

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q +  + L+I  +  I++TD N+ICAT+DWWPH+KCNY+QCPW  SSV+NL+LSHP   K
Sbjct  21   QDVARSTLIIHGSEAIAETDDNFICATLDWWPHDKCNYDQCPWGYSSVINLNLSHPVLGK  80

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF+ LR+R+GGSLQD+
Sbjct  81   AIQAFKSLRIRIGGSLQDR  99



>emb|CAB62595.1| putative protein [Arabidopsis thaliana]
Length=521

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q ++ A ++I+   R+ +TD N++CAT+DWWPH+KCNY+QCPW  SSV+N+DL+ P   K
Sbjct  3    QEMKRASIVIQGARRVCETDENFVCATLDWWPHDKCNYDQCPWGYSSVINMDLTRPLLTK  62

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF+ LR+R+GGSLQDQ
Sbjct  63   AIKAFKPLRIRIGGSLQDQ  81



>ref|XP_009399121.1| PREDICTED: heparanase-like protein 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009399122.1| PREDICTED: heparanase-like protein 1 [Musa acuminata subsp. malaccensis]
Length=538

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            ++++ +   ++TD  ++CAT+DWWPH+KCNYNQCPW  SSVLNLDLSHPF A AIQAF+ 
Sbjct  26   IIVKGSDLAAETDDTFVCATLDWWPHDKCNYNQCPWGQSSVLNLDLSHPFLANAIQAFDR  85

Query  588  LRLRLGGSLQDQ  623
            LR+R+GGSLQDQ
Sbjct  86   LRIRVGGSLQDQ  97



>ref|XP_010678425.1| PREDICTED: heparanase-like protein 2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010678426.1| PREDICTED: heparanase-like protein 2 [Beta vulgaris subsp. vulgaris]
Length=544

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q I  A L +     +++TD NY+CAT+DWWPH KC+YNQCPW  +S++NL+LSHP  AK
Sbjct  23   QEIAGAILRVNGGHVMAETDENYVCATVDWWPHTKCDYNQCPWGYASIMNLNLSHPLLAK  82

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            A+QAF HLR+RLGGSL+DQ
Sbjct  83   AVQAFTHLRVRLGGSLEDQ  101



>ref|NP_196400.2| glucuronidase 2 [Arabidopsis thaliana]
 sp|Q9FF10.1|HPSE1_ARATH RecName: Full=Heparanase-like protein 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB09947.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05468.1| At5g07830 [Arabidopsis thaliana]
 gb|AAU93572.1| At5g07830 [Arabidopsis thaliana]
 gb|AED91209.1| glucuronidase 2 [Arabidopsis thaliana]
Length=543

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q ++ A ++I+   R+ +TD N++CAT+DWWPH+KCNY+QCPW  SSV+N+DL+ P   K
Sbjct  25   QEMKRASIVIQGARRVCETDENFVCATLDWWPHDKCNYDQCPWGYSSVINMDLTRPLLTK  84

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF+ LR+R+GGSLQDQ
Sbjct  85   AIKAFKPLRIRIGGSLQDQ  103



>ref|XP_004299326.1| PREDICTED: heparanase-like protein 1-like [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            + + HA ++++ T  I+  D N++CAT+DWW HEKC+YN CPW S+SVLNL+LSHP  AK
Sbjct  20   KEVGHASVVVDGTVAIAHIDNNFVCATLDWWNHEKCDYNHCPWGSASVLNLNLSHPLLAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            +IQAF  LR+R+GGSLQDQ
Sbjct  80   SIQAFNQLRIRIGGSLQDQ  98



>gb|KDO54584.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
Length=337

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            + +    + ++ T  ++  D ++ICAT+DWWPH+KCNYN CPW +SSV+NLDLSHP  A 
Sbjct  21   RDVTRVTIFVDATKTVATNDEHFICATVDWWPHDKCNYNHCPWGNSSVINLDLSHPLLAN  80

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF+ LR+R+GGSLQDQ
Sbjct  81   AIQAFQSLRIRIGGSLQDQ  99



>emb|CDP17495.1| unnamed protein product [Coffea canephora]
Length=547

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q I  A LLI++TA+ ++TD NYICATIDWWP EKCNYNQCPW SSS+LNLDLSHPF + 
Sbjct  20   QNIGSAVLLIDSTAKFAETDTNYICATIDWWPKEKCNYNQCPWGSSSLLNLDLSHPFLSN  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF++LRLRLGGSLQDQ
Sbjct  80   AIQAFKNLRLRLGGSLQDQ  98



>gb|KDO54583.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
Length=425

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            + +    + ++ T  ++  D ++ICAT+DWWPH+KCNYN CPW +SSV+NLDLSHP  A 
Sbjct  21   RDVTRVTIFVDATKTVATNDEHFICATVDWWPHDKCNYNHCPWGNSSVINLDLSHPLLAN  80

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF+ LR+R+GGSLQDQ
Sbjct  81   AIQAFQSLRIRIGGSLQDQ  99



>gb|KDO54582.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
Length=435

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            + +    + ++ T  ++  D ++ICAT+DWWPH+KCNYN CPW +SSV+NLDLSHP  A 
Sbjct  21   RDVTRVTIFVDATKTVATNDEHFICATVDWWPHDKCNYNHCPWGNSSVINLDLSHPLLAN  80

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF+ LR+R+GGSLQDQ
Sbjct  81   AIQAFQSLRIRIGGSLQDQ  99



>ref|XP_006440691.1| hypothetical protein CICLE_v10019304mg [Citrus clementina]
 gb|ESR53931.1| hypothetical protein CICLE_v10019304mg [Citrus clementina]
Length=543

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +    + ++ T  ++  D ++ICAT+DWWPH+KCNYN CPW +SSV+NLDLSHP  A AI
Sbjct  23   VTRVTIFVDATKTVATNDEHFICATVDWWPHDKCNYNHCPWGNSSVINLDLSHPLLANAI  82

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF+ LR+R+GGSLQDQ
Sbjct  83   QAFQSLRIRIGGSLQDQ  99



>ref|XP_006477619.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006477620.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Citrus 
sinensis]
 gb|KDO54578.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
 gb|KDO54579.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
 gb|KDO54580.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
 gb|KDO54581.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
Length=543

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +    + ++ T  ++  D ++ICAT+DWWPH+KCNYN CPW +SSV+NLDLSHP  A AI
Sbjct  23   VTRVTIFVDATKTVATNDEHFICATVDWWPHDKCNYNHCPWGNSSVINLDLSHPLLANAI  82

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF+ LR+R+GGSLQDQ
Sbjct  83   QAFQSLRIRIGGSLQDQ  99



>ref|XP_006281918.1| hypothetical protein CARUB_v10028123mg [Capsella rubella]
 gb|EOA14816.1| hypothetical protein CARUB_v10028123mg [Capsella rubella]
Length=539

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E A ++I+   RI++TD N++CAT+DWWP EKCNY+QCPW  +S++NL+LS P  AKAI
Sbjct  24   MERAIMVIDGARRIAETDENFVCATLDWWPPEKCNYDQCPWGYASLINLNLSSPLLAKAI  83

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF  LR+R+GGSLQDQ
Sbjct  84   QAFRTLRIRIGGSLQDQ  100



>ref|XP_004508698.1| PREDICTED: heparanase-like protein 2-like isoform X2 [Cicer arietinum]
 ref|XP_004508699.1| PREDICTED: heparanase-like protein 2-like isoform X3 [Cicer arietinum]
 ref|XP_004508700.1| PREDICTED: heparanase-like protein 2-like isoform X4 [Cicer arietinum]
 ref|XP_004508701.1| PREDICTED: heparanase-like protein 2-like isoform X5 [Cicer arietinum]
Length=558

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q IEH  ++++    I++ D N+ICATIDWWPH+KC+YN CPW  SSV+NLDLS+P  AK
Sbjct  29   QDIEHGLIVVDGVQAIAENDDNFICATIDWWPHDKCDYNYCPWGYSSVVNLDLSNPILAK  88

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQ  + LR+R+GGSLQDQ
Sbjct  89   AIQGLKPLRIRIGGSLQDQ  107



>ref|XP_008785953.1| PREDICTED: heparanase-like protein 2 isoform X2 [Phoenix dactylifera]
Length=539

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++  ++ ++ TD +++CAT+DWWP EKCNYNQCPW  SS+LNLDL+HPF AK+IQAF  
Sbjct  27   VIVRGSSTVAKTDDHFVCATLDWWPPEKCNYNQCPWGQSSILNLDLTHPFLAKSIQAFNS  86

Query  588  LRLRLGGSLQDQ  623
            LR+R+GGSLQDQ
Sbjct  87   LRIRVGGSLQDQ  98



>ref|XP_008785952.1| PREDICTED: heparanase-like protein 2 isoform X1 [Phoenix dactylifera]
Length=540

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++  ++ ++ TD +++CAT+DWWP EKCNYNQCPW  SS+LNLDL+HPF AK+IQAF  
Sbjct  27   VIVRGSSTVAKTDDHFVCATLDWWPPEKCNYNQCPWGQSSILNLDLTHPFLAKSIQAFNS  86

Query  588  LRLRLGGSLQDQ  623
            LR+R+GGSLQDQ
Sbjct  87   LRIRVGGSLQDQ  98



>ref|XP_004508697.1| PREDICTED: heparanase-like protein 2-like isoform X1 [Cicer arietinum]
Length=572

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q IEH  ++++    I++ D N+ICATIDWWPH+KC+YN CPW  SSV+NLDLS+P  AK
Sbjct  43   QDIEHGLIVVDGVQAIAENDDNFICATIDWWPHDKCDYNYCPWGYSSVVNLDLSNPILAK  102

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQ  + LR+R+GGSLQDQ
Sbjct  103  AIQGLKPLRIRIGGSLQDQ  121



>ref|XP_010457069.1| PREDICTED: heparanase-like protein 2 [Camelina sativa]
Length=538

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E A ++I+   RIS+TD N++CAT+DWWP EKCNY+QCPW  +S++NL+L+ P  AKAI
Sbjct  23   MERAIMVIDGARRISETDDNFVCATLDWWPPEKCNYDQCPWGYASLINLNLASPLLAKAI  82

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF  LR+R+GGSLQDQ
Sbjct  83   QAFRTLRIRIGGSLQDQ  99



>gb|KEH31990.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=548

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q IEH  + +     I++ D N+ICATIDWWP EKC+YN CPW SSSVLNLDLS+P  AK
Sbjct  20   QDIEHGSIEVNGVQGIAENDDNFICATIDWWPQEKCDYNYCPWGSSSVLNLDLSNPILAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
             IQA   LR+R+GGSLQDQ
Sbjct  80   VIQALRPLRIRVGGSLQDQ  98



>ref|XP_010443938.1| PREDICTED: heparanase-like protein 2 [Camelina sativa]
Length=538

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E A ++I+   RI++TD N++CAT+DWWP EKCNY+QCPW  +S++NL+LS P  AKAI
Sbjct  23   MERAIMVIDGARRIAETDDNFVCATLDWWPPEKCNYDQCPWAYASLINLNLSSPLLAKAI  82

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF  LR+R+GGSLQDQ
Sbjct  83   QAFRTLRIRIGGSLQDQ  99



>ref|XP_010106651.1| Heparanase-like protein 1 [Morus notabilis]
 gb|EXC11030.1| Heparanase-like protein 1 [Morus notabilis]
Length=524

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q    A ++++ T R ++ D N+ICAT+DWWPH+KCNYNQCPW  +S +NL+LSHP   K
Sbjct  22   QDTADANIVVDGTERAAEVDENFICATMDWWPHDKCNYNQCPWGYTSAINLNLSHPLLTK  81

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF+ LR+R+GGSLQD+
Sbjct  82   AIQAFKPLRIRVGGSLQDR  100



>gb|KEH31988.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=564

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q IEH  + +     I++ D N+ICATIDWWP EKC+YN CPW SSSVLNLDLS+P  AK
Sbjct  20   QDIEHGSIEVNGVQGIAENDDNFICATIDWWPQEKCDYNYCPWGSSSVLNLDLSNPILAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
             IQA   LR+R+GGSLQDQ
Sbjct  80   VIQALRPLRIRVGGSLQDQ  98



>dbj|BAB08480.1| unnamed protein product [Arabidopsis thaliana]
Length=516

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E   L+I+ + RI++TD N+ICAT+DWWP EKCNY+QCPW  +S++NL+L+ P  AKAI
Sbjct  1    MERTTLVIDGSRRIAETDENFICATLDWWPPEKCNYDQCPWGYASLINLNLASPLLAKAI  60

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF  LR+R+GGSLQDQ
Sbjct  61   QAFRTLRIRIGGSLQDQ  77



>ref|NP_200933.2| glucuronidase 1 [Arabidopsis thaliana]
 ref|NP_851238.1| glucuronidase 1 [Arabidopsis thaliana]
 sp|Q8L608.1|HPSE2_ARATH RecName: Full=Heparanase-like protein 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM20587.1| putative protein [Arabidopsis thaliana]
 gb|AAO00963.1| putative protein [Arabidopsis thaliana]
 dbj|BAH20116.1| AT5G61250 [Arabidopsis thaliana]
 gb|AED97442.1| glucuronidase 1 [Arabidopsis thaliana]
 gb|AED97443.1| glucuronidase 1 [Arabidopsis thaliana]
Length=539

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E   L+I+ + RI++TD N+ICAT+DWWP EKCNY+QCPW  +S++NL+L+ P  AKAI
Sbjct  24   MERTTLVIDGSRRIAETDENFICATLDWWPPEKCNYDQCPWGYASLINLNLASPLLAKAI  83

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF  LR+R+GGSLQDQ
Sbjct  84   QAFRTLRIRIGGSLQDQ  100



>gb|KEH31989.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=582

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q IEH  + +     I++ D N+ICATIDWWP EKC+YN CPW SSSVLNLDLS+P  AK
Sbjct  20   QDIEHGSIEVNGVQGIAENDDNFICATIDWWPQEKCDYNYCPWGSSSVLNLDLSNPILAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
             IQA   LR+R+GGSLQDQ
Sbjct  80   VIQALRPLRIRVGGSLQDQ  98



>ref|XP_010936349.1| PREDICTED: heparanase-like protein 1 isoform X2 [Elaeis guineensis]
Length=576

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q    A ++++ +A +++TD N++CATIDWWP EKCNY+QCPW  SS LNLD+ HPF A 
Sbjct  57   QESAEATVIVKGSATVAETDKNFVCATIDWWPPEKCNYDQCPWGESSALNLDVDHPFLAN  116

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF+ LR+R+GGSLQD+
Sbjct  117  AIKAFKSLRIRVGGSLQDK  135



>ref|XP_010936348.1| PREDICTED: heparanase-like protein 1 isoform X1 [Elaeis guineensis]
Length=601

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q    A ++++ +A +++TD N++CATIDWWP EKCNY+QCPW  SS LNLD+ HPF A 
Sbjct  82   QESAEATVIVKGSATVAETDKNFVCATIDWWPPEKCNYDQCPWGESSALNLDVDHPFLAN  141

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF+ LR+R+GGSLQD+
Sbjct  142  AIKAFKSLRIRVGGSLQDK  160



>ref|XP_010483789.1| PREDICTED: heparanase-like protein 2 [Camelina sativa]
Length=539

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E A ++I+   RI++TD N++CAT+DWWP EKCNY+QCPW  +S++N++LS P  AKAI
Sbjct  24   MERAIMVIDGARRIAETDDNFVCATLDWWPPEKCNYDQCPWGYASLINVNLSSPLLAKAI  83

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF  LR+R+GGSLQDQ
Sbjct  84   QAFRTLRIRIGGSLQDQ  100



>ref|XP_010923582.1| PREDICTED: heparanase-like protein 2 isoform X1 [Elaeis guineensis]
Length=540

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++  +A ++ T+ +++CAT+DWWP EKCNYNQCPW  SS+LNLDL+HP  AKAIQAF  
Sbjct  27   VIVRGSATVAKTNDHFVCATLDWWPPEKCNYNQCPWGQSSILNLDLTHPLLAKAIQAFNS  86

Query  588  LRLRLGGSLQDQ  623
            LR+R+GGSLQDQ
Sbjct  87   LRIRVGGSLQDQ  98



>ref|XP_010923583.1| PREDICTED: heparanase-like protein 2 isoform X2 [Elaeis guineensis]
Length=539

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++  +A ++ T+ +++CAT+DWWP EKCNYNQCPW  SS+LNLDL+HP  AKAIQAF  
Sbjct  27   VIVRGSATVAKTNDHFVCATLDWWPPEKCNYNQCPWGQSSILNLDLTHPLLAKAIQAFNS  86

Query  588  LRLRLGGSLQDQ  623
            LR+R+GGSLQDQ
Sbjct  87   LRIRVGGSLQDQ  98



>gb|KHG12946.1| hypothetical protein F383_07365 [Gossypium arboreum]
Length=481

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            + I +  ++++ T  I+ TD N++CATIDWWPH+KC+Y QCPW  +S + LDL HP   K
Sbjct  20   EDISYGTIVVDGTTSIAQTDDNFVCATIDWWPHDKCDYKQCPWHYTSAITLDLCHPILTK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQAF  LR+R+GGSLQDQ
Sbjct  80   AIQAFNRLRIRIGGSLQDQ  98



>emb|CDY02161.1| BnaA03g40060D [Brassica napus]
Length=532

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E   ++I+ T +I++ D N++CAT+DWWP EKCNY+QCPW  +S++NL+LS P  AKAI
Sbjct  25   MEQTTIVIDGTRQIAEIDENFVCATLDWWPPEKCNYDQCPWGYASLINLNLSSPLLAKAI  84

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF+ LR+R+GGSLQDQ
Sbjct  85   QAFKTLRIRIGGSLQDQ  101



>ref|XP_006394524.1| hypothetical protein EUTSA_v10003960mg [Eutrema salsugineum]
 gb|ESQ31810.1| hypothetical protein EUTSA_v10003960mg [Eutrema salsugineum]
Length=540

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E   ++I+   RI++ D N++CAT+DWWP EKCNY+QCPW  +S++NL+LS P  AKAI
Sbjct  25   MEQTTIVIDGEHRIAEIDENFVCATLDWWPPEKCNYDQCPWGYASLINLNLSSPLLAKAI  84

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF+ LR+RLGGSLQDQ
Sbjct  85   QAFKTLRIRLGGSLQDQ  101



>ref|XP_009136454.1| PREDICTED: heparanase-like protein 2 [Brassica rapa]
 ref|XP_009136456.1| PREDICTED: heparanase-like protein 2 [Brassica rapa]
Length=541

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E   ++I+ T +I++ D N++CAT+DWWP EKCNY+QCPW  +S++NL+LS P  AKAI
Sbjct  25   MEQTTIVIDGTRQIAEIDENFVCATLDWWPPEKCNYDQCPWGYASLINLNLSSPLLAKAI  84

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF+ LR+R+GGSLQDQ
Sbjct  85   QAFKTLRIRIGGSLQDQ  101



>tpg|DAA55153.1| TPA: hypothetical protein ZEAMMB73_112407 [Zea mays]
Length=385

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
            A +++  +  I+ T   ++CATIDWWP EKCNY+QCPWE +SVLNLDL++P  AKAIQAF
Sbjct  26   ATVIVRGSETIASTSDEFVCATIDWWPPEKCNYDQCPWERASVLNLDLTNPLLAKAIQAF  85

Query  582  EHLRLRLGGSLQDQ  623
              LR+R+GGSLQDQ
Sbjct  86   SPLRIRVGGSLQDQ  99



>gb|KEH33104.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=528

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            + IEH  LL+      ++T  N+ICATIDWWPH+KCN   C W  SS++NLDLSHPF AK
Sbjct  20   KDIEHGLLLVNGAQAKAETGDNFICATIDWWPHDKCNDGYCSWGHSSIVNLDLSHPFLAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQA + LR+RLGGSLQDQ
Sbjct  80   AIQALKPLRIRLGGSLQDQ  98



>ref|XP_002866422.1| glycosyl hydrolase family 79 N-terminal domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH42681.1| glycosyl hydrolase family 79 N-terminal domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
Length=537

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E   L+I+    I++TD N++CAT+DWWP EKCNY+QCPW  +S++NL+LS P  AKAI
Sbjct  22   MERTTLVIDGAHGIAETDENFVCATLDWWPPEKCNYDQCPWGYASLINLNLSSPLLAKAI  81

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF  LR+R+GGSLQDQ
Sbjct  82   QAFRTLRIRIGGSLQDQ  98



>ref|XP_008672060.1| PREDICTED: uncharacterized protein LOC100192026 isoform X2 [Zea 
mays]
 gb|ACG27548.1| heparanase-like protein 2 precursor [Zea mays]
 gb|ACR37728.1| unknown [Zea mays]
 tpg|DAA55154.1| TPA: heparanase-like protein 2 [Zea mays]
Length=540

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
            A +++  +  I+ T   ++CATIDWWP EKCNY+QCPWE +SVLNLDL++P  AKAIQAF
Sbjct  26   ATVIVRGSETIASTSDEFVCATIDWWPPEKCNYDQCPWERASVLNLDLTNPLLAKAIQAF  85

Query  582  EHLRLRLGGSLQDQ  623
              LR+R+GGSLQDQ
Sbjct  86   SPLRIRVGGSLQDQ  99



>ref|XP_008672059.1| PREDICTED: uncharacterized protein LOC100192026 isoform X1 [Zea 
mays]
 gb|ACR34666.1| unknown [Zea mays]
 tpg|DAA55155.1| TPA: heparanase-like protein 2 [Zea mays]
Length=575

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
            A +++  +  I+ T   ++CATIDWWP EKCNY+QCPWE +SVLNLDL++P  AKAIQAF
Sbjct  61   ATVIVRGSETIASTSDEFVCATIDWWPPEKCNYDQCPWERASVLNLDLTNPLLAKAIQAF  120

Query  582  EHLRLRLGGSLQDQ  623
              LR+R+GGSLQDQ
Sbjct  121  SPLRIRVGGSLQDQ  134



>ref|NP_001130921.1| uncharacterized protein LOC100192026 precursor [Zea mays]
 gb|ACF79309.1| unknown [Zea mays]
 tpg|DAA55156.1| TPA: heparanase-like protein 2 [Zea mays]
Length=566

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
            A +++  +  I+ T   ++CATIDWWP EKCNY+QCPWE +SVLNLDL++P  AKAIQAF
Sbjct  52   ATVIVRGSETIASTSDEFVCATIDWWPPEKCNYDQCPWERASVLNLDLTNPLLAKAIQAF  111

Query  582  EHLRLRLGGSLQDQ  623
              LR+R+GGSLQDQ
Sbjct  112  SPLRIRVGGSLQDQ  125



>ref|XP_007209868.1| hypothetical protein PRUPE_ppa003813mg [Prunus persica]
 gb|EMJ11067.1| hypothetical protein PRUPE_ppa003813mg [Prunus persica]
Length=547

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +3

Query  399  HAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQA  578
            + ++++     I+  D N+ICATIDWW HEKC+YNQCPW S+S LNL+LSHP  AK+IQA
Sbjct  30   NVKVVVNGILAIARVDNNFICATIDWWNHEKCDYNQCPWGSASALNLNLSHPLLAKSIQA  89

Query  579  FEHLRLRLGGSLQDQ  623
            F  LR+R+GGSL+DQ
Sbjct  90   FNQLRIRIGGSLEDQ  104



>ref|XP_007209866.1| hypothetical protein PRUPE_ppa003804mg [Prunus persica]
 gb|EMJ11065.1| hypothetical protein PRUPE_ppa003804mg [Prunus persica]
Length=547

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +3

Query  399  HAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQA  578
            + ++++     I+  D N+ICATIDWW HEKC+YNQCPW S+S LNL+LSHP  AK+IQA
Sbjct  30   NVKVVVNGILAIARVDNNFICATIDWWNHEKCDYNQCPWGSASALNLNLSHPLLAKSIQA  89

Query  579  FEHLRLRLGGSLQDQ  623
            F  LR+R+GGSL+DQ
Sbjct  90   FNQLRIRIGGSLEDQ  104



>gb|EEC69565.1| hypothetical protein OsI_38868 [Oryza sativa Indica Group]
Length=1237

 Score =   110 bits (274),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++     I+ T   +ICATIDWWP EKCNY+QCPW  +S+LNLDL++P  AKAIQAF  
Sbjct  697  IVVRGAETIASTSNEFICATIDWWPPEKCNYDQCPWGQASILNLDLTNPLLAKAIQAFSP  756

Query  588  LRLRLGGSLQDQ  623
            LR+RLGGSLQDQ
Sbjct  757  LRIRLGGSLQDQ  768



>ref|XP_008239880.1| PREDICTED: heparanase-like protein 1 [Prunus mume]
 ref|XP_008239881.1| PREDICTED: heparanase-like protein 1 [Prunus mume]
Length=547

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  432  ISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLRLRLGGS  611
            I+  D N+ICATIDWW HEKC+YNQCPW S+S LNL+LSHP  AK+IQAF  LR+R+GGS
Sbjct  41   IAQVDNNFICATIDWWNHEKCDYNQCPWGSASALNLNLSHPLLAKSIQAFNQLRIRIGGS  100

Query  612  LQDQ  623
            L+DQ
Sbjct  101  LEDQ  104



>ref|XP_006664141.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Oryza brachyantha]
 ref|XP_006664142.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Oryza brachyantha]
Length=539

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++  +  I+ T   +ICATIDWWP EKCNY+QCPW  +S+LNLDL++P  AKAIQAF  
Sbjct  27   IVVRGSETIASTSDEFICATIDWWPPEKCNYDQCPWGQASILNLDLTNPLLAKAIQAFSP  86

Query  588  LRLRLGGSLQDQ  623
            LR+RLGGSLQDQ
Sbjct  87   LRIRLGGSLQDQ  98



>gb|KDO54577.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
Length=551

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 8/85 (9%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNL--------DLS  548
            +    + ++ T  ++  D ++ICAT+DWWPH+KCNYN CPW +SSV+NL        DLS
Sbjct  23   VTRVTIFVDATKTVATNDEHFICATVDWWPHDKCNYNHCPWGNSSVINLLHAIWYFQDLS  82

Query  549  HPFFAKAIQAFEHLRLRLGGSLQDQ  623
            HP  A AIQAF+ LR+R+GGSLQDQ
Sbjct  83   HPLLANAIQAFQSLRIRIGGSLQDQ  107



>ref|XP_008661167.1| PREDICTED: heparanase-like protein 1 [Zea mays]
Length=540

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++  +  I+ T   ++CATIDWWP EKCNY+QCPW  +SVLNLDL++P  AKAIQAF  
Sbjct  28   VIVRGSETIASTSGEFVCATIDWWPPEKCNYDQCPWGRASVLNLDLTNPLLAKAIQAFSP  87

Query  588  LRLRLGGSLQDQ  623
            LR+R+GGSLQDQ
Sbjct  88   LRIRVGGSLQDQ  99



>ref|XP_002862345.1| hypothetical protein ARALYDRAFT_497509 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38603.1| hypothetical protein ARALYDRAFT_497509 [Arabidopsis lyrata subsp. 
lyrata]
Length=442

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E   L+I+    I++TD N++CAT+DWWP EKCNY+QCPW  +S++NL+LS P  AKA 
Sbjct  22   MERTTLVIDGGHGIAETDENFVCATLDWWPPEKCNYDQCPWGYASLINLNLSSPLLAKAF  81

Query  573  QAFEHLRLRLGGSLQDQ  623
            QAF  LR+R+G SLQDQ
Sbjct  82   QAFRTLRIRIGASLQDQ  98



>ref|NP_001067122.1| Os12g0578400 [Oryza sativa Japonica Group]
 gb|ABA99069.1| Heparanase-like protein 2 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF30141.1| Os12g0578400 [Oryza sativa Japonica Group]
 dbj|BAG93793.1| unnamed protein product [Oryza sativa Japonica Group]
Length=539

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++     I+ T   +ICATIDWWP EKCNY+QCPW  +S+LNLDL++P  AKAIQAF  
Sbjct  27   IVVRGAETIASTSNEFICATIDWWPPEKCNYDQCPWGQASILNLDLTNPLLAKAIQAFSP  86

Query  588  LRLRLGGSLQDQ  623
            LR+RLGGSLQDQ
Sbjct  87   LRIRLGGSLQDQ  98



>gb|ACR10240.1| heparanase [Oryza sativa Indica Group]
Length=539

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++     I+ T   +ICATIDWWP EKCNY+QCPW  +S+LNLDL++P  AKAIQAF  
Sbjct  27   IVVRGAETIASTSNEFICATIDWWPPEKCNYDQCPWGQASILNLDLTNPLLAKAIQAFSP  86

Query  588  LRLRLGGSLQDQ  623
            LR+RLGGSLQDQ
Sbjct  87   LRIRLGGSLQDQ  98



>gb|EYU28837.1| hypothetical protein MIMGU_mgv1a026758mg, partial [Erythranthe 
guttata]
Length=503

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E  +L ++    I+ TD N+ICAT+DWWP  KC+YNQCPW  S +LNLDL +     AI+
Sbjct  2    EEVKLTVKGVNSIAKTDDNFICATLDWWPQNKCDYNQCPWAKSGILNLDLENKILTNAIK  61

Query  576  AFEHLRLRLGGSLQDQ  623
            AF+HLR+R+GGSLQDQ
Sbjct  62   AFDHLRIRVGGSLQDQ  77



>ref|XP_003578591.1| PREDICTED: heparanase-like protein 1 [Brachypodium distachyon]
Length=538

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            ++I  +  I+ T   +ICATIDWWP EKCNY+QCPW  +SVLN+DL++P  AKAIQAF  
Sbjct  27   VIIRGSETIAATSDEFICATIDWWPPEKCNYDQCPWGKASVLNMDLTNPLLAKAIQAFSP  86

Query  588  LRLRLGGSLQDQ  623
            LR+R+GGSLQDQ
Sbjct  87   LRIRVGGSLQDQ  98



>gb|EEE53489.1| hypothetical protein OsJ_36644 [Oryza sativa Japonica Group]
Length=567

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++     I+ T   +ICATIDWWP EKCNY+QCPW  +S+LNLDL++P  AKAIQAF  
Sbjct  27   IVVRGAETIASTSNEFICATIDWWPPEKCNYDQCPWGQASILNLDLTNPLLAKAIQAFSP  86

Query  588  LRLRLGGSLQDQ  623
            LR+RLGGSLQDQ
Sbjct  87   LRIRLGGSLQDQ  98



>ref|XP_002442385.1| hypothetical protein SORBIDRAFT_08g019250 [Sorghum bicolor]
 gb|EES16223.1| hypothetical protein SORBIDRAFT_08g019250 [Sorghum bicolor]
Length=540

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++  +  I+ T   ++CATIDWWP EKCNY+QCPW  +SVLNLDL++P  AKAIQAF  
Sbjct  28   VIVRGSETIASTSDEFVCATIDWWPPEKCNYDQCPWGRASVLNLDLTNPLLAKAIQAFSP  87

Query  588  LRLRLGGSLQDQ  623
            LR+R+GGSLQDQ
Sbjct  88   LRIRVGGSLQDQ  99



>ref|XP_004962990.1| PREDICTED: heparanase-like protein 2-like [Setaria italica]
Length=540

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++  +  I+ T   ++CATIDWWP EKCNY+QCPW  +SVLNLDL++P  AKAIQAF  
Sbjct  28   VIVRGSETIASTSDEFVCATIDWWPPEKCNYDQCPWGRASVLNLDLTNPLLAKAIQAFSP  87

Query  588  LRLRLGGSLQDQ  623
            LR+R+GGSLQDQ
Sbjct  88   LRIRVGGSLQDQ  99



>tpg|DAA47199.1| TPA: hypothetical protein ZEAMMB73_798346 [Zea mays]
Length=924

 Score =   107 bits (267),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++  +  I+ T   ++CATIDWWP EKCNY+QCPW  +SVLNLDL++P  AKAIQAF  
Sbjct  501  VIVRGSETIASTSGEFVCATIDWWPPEKCNYDQCPWGRASVLNLDLTNPLLAKAIQAFSP  560

Query  588  LRLRLGGSLQDQ  623
            LR+R+GGSLQDQ
Sbjct  561  LRIRVGGSLQDQ  572



>tpg|DAA47198.1| TPA: hypothetical protein ZEAMMB73_798346 [Zea mays]
Length=1013

 Score =   107 bits (267),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++  +  I+ T   ++CATIDWWP EKCNY+QCPW  +SVLNLDL++P  AKAIQAF  
Sbjct  501  VIVRGSETIASTSGEFVCATIDWWPPEKCNYDQCPWGRASVLNLDLTNPLLAKAIQAFSP  560

Query  588  LRLRLGGSLQDQ  623
            LR+R+GGSLQDQ
Sbjct  561  LRIRVGGSLQDQ  572



>emb|CAD42650.1| putative heparanase [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++  +  I+ T   +ICAT+DWWP EKCNY+QCPW  +S+LN+DL++P  AKAIQAF  
Sbjct  27   VIVRGSKTIAATSDEFICATVDWWPPEKCNYDQCPWGKASILNMDLTNPLLAKAIQAFSP  86

Query  588  LRLRLGGSLQDQ  623
            LR+R+GGSLQDQ
Sbjct  87   LRIRVGGSLQDQ  98



>dbj|BAJ96463.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++  +  I+ T   +ICAT+DWWP EKCNY+QCPW  +SVLN+DL++P  AKAIQAF  
Sbjct  27   VIVRGSRTIAATSDEFICATLDWWPPEKCNYDQCPWGKASVLNMDLTNPLLAKAIQAFSP  86

Query  588  LRLRLGGSLQDQ  623
            LR+R+GGSLQDQ
Sbjct  87   LRIRVGGSLQDQ  98



>dbj|BAJ84826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++  +  I+ T   +ICAT+DWWP EKCNY+QCPW  +SVLN+DL++P  AKAIQAF  
Sbjct  27   VIVRGSRTIAATSDEFICATLDWWPPEKCNYDQCPWGKASVLNMDLTNPLLAKAIQAFSP  86

Query  588  LRLRLGGSLQDQ  623
            LR+R+GGSLQDQ
Sbjct  87   LRIRVGGSLQDQ  98



>dbj|BAJ97884.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++  +  I+ T   +ICAT+DWWP EKCNY+QCPW  +SVLN+DL++P  AKAIQAF  
Sbjct  27   VIVRGSRTIAATSDEFICATLDWWPPEKCNYDQCPWGKASVLNMDLTNPLLAKAIQAFSP  86

Query  588  LRLRLGGSLQDQ  623
            LR+R+GGSLQDQ
Sbjct  87   LRIRVGGSLQDQ  98



>ref|XP_011070961.1| PREDICTED: heparanase-like protein 1 isoform X2 [Sesamum indicum]
Length=489

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E  +L +     I+ TD N+ICAT+DWWP  KCNYNQCPW  + +LNLDL +   A AI+
Sbjct  21   EEVKLTVRGVTSIAKTDENFICATLDWWPETKCNYNQCPWGKAGILNLDLENKILANAIK  80

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  LR+R+GGSLQDQ
Sbjct  81   AFSPLRIRIGGSLQDQ  96



>ref|XP_011070960.1| PREDICTED: heparanase-like protein 2 isoform X1 [Sesamum indicum]
Length=514

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E  +L +     I+ TD N+ICAT+DWWP  KCNYNQCPW  + +LNLDL +   A AI+
Sbjct  21   EEVKLTVRGVTSIAKTDENFICATLDWWPETKCNYNQCPWGKAGILNLDLENKILANAIK  80

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  LR+R+GGSLQDQ
Sbjct  81   AFSPLRIRIGGSLQDQ  96



>ref|XP_002315010.1| hypothetical protein POPTR_0010s16820g [Populus trichocarpa]
 gb|EEF01181.1| hypothetical protein POPTR_0010s16820g [Populus trichocarpa]
Length=518

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            +  ++ ++    I+ TD N+ICAT+DWWP EKC+YNQCPW  + +LNLDL++   A AI+
Sbjct  24   DDVKVFVQGVTSIAKTDDNFICATLDWWPSEKCDYNQCPWGKAGLLNLDLNNKILANAIK  83

Query  576  AFEHLRLRLGGSLQDQ  623
            AF+ LR+RLGGSLQDQ
Sbjct  84   AFDPLRIRLGGSLQDQ  99



>ref|XP_011012392.1| PREDICTED: heparanase-like protein 2 [Populus euphratica]
Length=520

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            +  ++ ++    I+ TD N+ICAT+DWWP EKC+YNQCPW  + +LNLDL++   A AI+
Sbjct  24   DDVKVFVKGVTSIAKTDDNFICATLDWWPSEKCDYNQCPWGKAGLLNLDLNNKILANAIK  83

Query  576  AFEHLRLRLGGSLQDQ  623
            AF+ LR+RLGGSLQDQ
Sbjct  84   AFDPLRIRLGGSLQDQ  99



>ref|XP_006483691.1| PREDICTED: heparanase-like protein 2-like [Citrus sinensis]
Length=521

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E  ++ ++    I++TD N++CATIDWWP  KC+YNQCPW  S VLNLDL +   + AI+
Sbjct  23   EDVKVTVQGATSIANTDDNFVCATIDWWPINKCDYNQCPWGKSGVLNLDLKNKILSNAIK  82

Query  576  AFEHLRLRLGGSLQDQ  623
            AF+ LR+R+GGSLQDQ
Sbjct  83   AFQPLRIRVGGSLQDQ  98



>ref|XP_009339108.1| PREDICTED: heparanase-like protein 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009339109.1| PREDICTED: heparanase-like protein 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009339110.1| PREDICTED: heparanase-like protein 1 isoform X2 [Pyrus x bretschneideri]
Length=546

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  432  ISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLRLRLGGS  611
            ++  D N++CATIDWW HEKC+Y QCPW ++S LNL+LSHP  AK+IQAF  LR+R+GGS
Sbjct  41   VARVDNNFVCATIDWWNHEKCDYGQCPWGNASALNLNLSHPLLAKSIQAFNQLRIRIGGS  100

Query  612  LQDQ  623
            L+DQ
Sbjct  101  LEDQ  104



>emb|CDP00405.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E  ++ ++    I+ TD N+ICAT+DWWP +KC+YNQCPW  + +LNLDL +   A AI+
Sbjct  31   EQVKVKVKGVTSIAKTDGNFICATLDWWPEDKCDYNQCPWGKAGILNLDLKNKILANAIK  90

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  LR+R+GGSL+DQ
Sbjct  91   AFNPLRIRIGGSLEDQ  106



>gb|KDO83095.1| hypothetical protein CISIN_1g041499mg, partial [Citrus sinensis]
Length=512

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +3

Query  390  TIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKA  569
            T +  ++ ++    I++TD N++CATIDWWP  KC+YNQCPW  S VLNLDL +   + A
Sbjct  12   TGKDVKVTVQGVTSIANTDDNFVCATIDWWPINKCDYNQCPWGKSGVLNLDLKNKILSNA  71

Query  570  IQAFEHLRLRLGGSLQDQ  623
            I+AF+ LR+R+GGSLQDQ
Sbjct  72   IKAFQPLRIRVGGSLQDQ  89



>ref|XP_011075654.1| PREDICTED: heparanase-like protein 2 [Sesamum indicum]
Length=522

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            +  +L ++    I  TD N++CAT+DWWP  KCNYNQCPW  + + NLDL++   A AI+
Sbjct  22   DEVKLTVKGVTSIGKTDDNFVCATLDWWPETKCNYNQCPWGKAGIFNLDLNNKILANAIR  81

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  LRLR+GGSLQDQ
Sbjct  82   AFNPLRLRIGGSLQDQ  97



>gb|KEH33103.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=520

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            + +EH  +L+      ++   N+ICATIDWWP E CN+  C W  SS++NLDLSHP  AK
Sbjct  20   KDVEHGLILVNGAQAKAEIGDNFICATIDWWPPELCNFGVCSWGHSSIVNLDLSHPLLAK  79

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQA + LR+RLGGSLQDQ
Sbjct  80   AIQALKPLRIRLGGSLQDQ  98



>gb|EMT24030.1| Heparanase-like protein 2 [Aegilops tauschii]
Length=507

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E A + +     IS TD ++ICAT+DWWP +KCNY  CPW +SS++NLDL  P    A++
Sbjct  27   EKATVSVRAVTAISHTDDDFICATLDWWPRDKCNYGMCPWHNSSIINLDLYSPILYNAVK  86

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  LR+RLGGSLQDQ
Sbjct  87   AFNSLRIRLGGSLQDQ  102



>ref|XP_006438800.1| hypothetical protein CICLE_v10033641mg, partial [Citrus clementina]
 gb|ESR52040.1| hypothetical protein CICLE_v10033641mg, partial [Citrus clementina]
Length=498

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
             ++ ++    I++TD N++CATIDWWP  KC+YNQCPW  S VLNLDL +   + AI+AF
Sbjct  2    VKVTVQGVTSIANTDDNFVCATIDWWPINKCDYNQCPWGKSGVLNLDLKNKILSNAIKAF  61

Query  582  EHLRLRLGGSLQDQ  623
            + LR+R+GGSLQDQ
Sbjct  62   QPLRIRVGGSLQDQ  75



>ref|XP_008374597.1| PREDICTED: heparanase-like protein 1 [Malus domestica]
 ref|XP_008374598.1| PREDICTED: heparanase-like protein 1 [Malus domestica]
Length=546

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  432  ISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLRLRLGGS  611
            ++  D N++CATIDWW HEKC+Y  CPW ++S LNL+LSHP  AK+IQAF+ LR+R+GGS
Sbjct  41   VAQVDNNFVCATIDWWNHEKCDYGHCPWGNASALNLNLSHPLLAKSIQAFDQLRIRIGGS  100

Query  612  LQDQ  623
            L+DQ
Sbjct  101  LEDQ  104



>gb|EMS63819.1| Heparanase-like protein 2 [Triticum urartu]
Length=504

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E A + +     IS TD ++ICAT+DWWP +KCNY  CPW +SS++NLDL  P    A++
Sbjct  28   EKATVSVRAVTAISHTDDDFICATLDWWPRDKCNYGMCPWHNSSIINLDLYSPILYNAVK  87

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  LR+RLGGSLQDQ
Sbjct  88   AFNSLRIRLGGSLQDQ  103



>gb|AES96970.2| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=504

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 3/81 (4%)
 Frame = +3

Query  390  TIEHAE---LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFF  560
            TI  AE   L ++    I+ TD N+ICAT+DWWP  KC+YNQCPW  + +LNLDL +   
Sbjct  15   TISSAEDVLLNVKGVTNIATTDNNFICATLDWWPENKCDYNQCPWGKAGILNLDLGNRIL  74

Query  561  AKAIQAFEHLRLRLGGSLQDQ  623
            + A++AF  LR+RLGGSLQDQ
Sbjct  75   SNAVKAFNPLRIRLGGSLQDQ  95



>ref|XP_003614012.1| Heparanase-like protein [Medicago truncatula]
Length=505

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 3/81 (4%)
 Frame = +3

Query  390  TIEHAE---LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFF  560
            TI  AE   L ++    I+ TD N+ICAT+DWWP  KC+YNQCPW  + +LNLDL +   
Sbjct  15   TISSAEDVLLNVKGVTNIATTDNNFICATLDWWPENKCDYNQCPWGKAGILNLDLGNRIL  74

Query  561  AKAIQAFEHLRLRLGGSLQDQ  623
            + A++AF  LR+RLGGSLQDQ
Sbjct  75   SNAVKAFNPLRIRLGGSLQDQ  95



>ref|XP_007045929.1| Heparanase, putative [Theobroma cacao]
 gb|EOY01761.1| Heparanase, putative [Theobroma cacao]
Length=523

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E  ++ I     I+ TD N++CAT+DWWP EKCNYNQCPW  + + NLDL +   A AI+
Sbjct  24   EDVKVSIRGATTIARTDDNFVCATLDWWPTEKCNYNQCPWGKAGLFNLDLENKILASAIK  83

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  LR+R+GGSLQDQ
Sbjct  84   AFNPLRVRIGGSLQDQ  99



>ref|XP_009338656.1| PREDICTED: heparanase-like protein 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009338663.1| PREDICTED: heparanase-like protein 1 isoform X2 [Pyrus x bretschneideri]
Length=546

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  432  ISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLRLRLGGS  611
            ++  D N++CATIDWW +EKCNY  CPW  SS LNL+LSHP  AK+IQAF+ LR+R+GGS
Sbjct  41   VARVDNNFVCATIDWWNNEKCNYGHCPWGHSSALNLNLSHPLLAKSIQAFDQLRIRIGGS  100

Query  612  LQDQ  623
            L+DQ
Sbjct  101  LEDQ  104



>ref|XP_008393204.1| PREDICTED: heparanase-like protein 1 [Malus domestica]
Length=546

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  432  ISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLRLRLGGS  611
            ++  D N++CATIDWW +EKCNY  CPW  SS LNL+LSHP  AK+IQAF+ LR+R+GGS
Sbjct  41   VARVDNNFVCATIDWWNNEKCNYGHCPWGHSSALNLNLSHPLLAKSIQAFDQLRIRIGGS  100

Query  612  LQDQ  623
            L+DQ
Sbjct  101  LEDQ  104



>ref|XP_009395254.1| PREDICTED: heparanase-like protein 1, partial [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +3

Query  390  TIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKA  569
            T+    + I+    I+ TD N++CAT+DWWP +KCNY  CPW ++S+LNLDL++P    A
Sbjct  8    TLGATVVSIKAVTTIAKTDDNFVCATMDWWPPDKCNYGMCPWGNASILNLDLNNPILVNA  67

Query  570  IQAFEHLRLRLGGSLQDQ  623
            ++AF  LR+R+GGSLQDQ
Sbjct  68   LKAFGSLRIRIGGSLQDQ  85



>ref|XP_008792775.1| PREDICTED: heparanase-like protein 2 [Phoenix dactylifera]
Length=536

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            +   + ++    I+ TD N+ICATIDWWP EKCNY+ CPW S+S++NLDL++     AI+
Sbjct  35   DKVTVAVKAVTTIAKTDDNFICATIDWWPKEKCNYDICPWYSASIINLDLNNTIVFNAIK  94

Query  576  AFEHLRLRLGGSLQDQ  623
            AF+ LR+RLGGSLQDQ
Sbjct  95   AFKSLRIRLGGSLQDQ  110



>gb|ACN26863.1| unknown [Zea mays]
 tpg|DAA44038.1| TPA: hypothetical protein ZEAMMB73_735117 [Zea mays]
Length=431

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q  + A ++++ + RI++TD NY+CATIDWWP EKCNYNQCPW  +S+LNLDL HPF A+
Sbjct  23   QQPDEATVIVKGSTRIAETDDNYVCATIDWWPPEKCNYNQCPWGQASILNLDLDHPFLAQ  82

Query  567  AIQAFE  584
            AIQ  E
Sbjct  83   AIQGNE  88



>ref|XP_006348811.1| PREDICTED: heparanase-like protein 2-like [Solanum tuberosum]
Length=552

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +3

Query  405  ELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFE  584
            +++++    I+ TD N+ICAT+DWWP  KC+YNQCPW  + +LNLDL +   A A++AF 
Sbjct  49   KVMVKGVTSIAQTDDNFICATLDWWPENKCDYNQCPWGKAGLLNLDLKNRILANAVKAFN  108

Query  585  HLRLRLGGSLQDQ  623
             LRLR+GGSLQDQ
Sbjct  109  PLRLRIGGSLQDQ  121



>ref|XP_008221534.1| PREDICTED: heparanase-like protein 2 [Prunus mume]
Length=526

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E+ E+ +E    I+ TD N+ICAT+DWWP  KC+YNQCPW  + + NLDL +     AI+
Sbjct  26   EYVEVSVEGVTSIASTDDNFICATLDWWPTNKCDYNQCPWGKAGIFNLDLDNKILNNAIK  85

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  +R+R+GGSLQDQ
Sbjct  86   AFNPMRIRVGGSLQDQ  101



>ref|XP_010936395.1| PREDICTED: heparanase-like protein 2 [Elaeis guineensis]
Length=527

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +3

Query  414  IETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLR  593
            ++    I+ TD ++ICATIDWWP EKCNY+ CPW SSS+LNLDL++     AI+AF+ LR
Sbjct  32   VKAVTTIAKTDDSFICATIDWWPKEKCNYDMCPWYSSSILNLDLNNTILFNAIKAFKALR  91

Query  594  LRLGGSLQDQ  623
            +RLGGSL+DQ
Sbjct  92   IRLGGSLEDQ  101



>ref|XP_002274743.1| PREDICTED: heparanase-like protein 2 [Vitis vinifera]
Length=522

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E  ++ +     I++TD N+ICATIDWWP +KC+YNQCPW  + + NLDL +     AI+
Sbjct  23   EDVKVTVGGVTSIAETDDNFICATIDWWPADKCDYNQCPWGLAGIFNLDLQNIILVNAIK  82

Query  576  AFEHLRLRLGGSLQDQ  623
            AF++LR+R+GGSLQDQ
Sbjct  83   AFDNLRIRMGGSLQDQ  98



>emb|CBI27258.3| unnamed protein product [Vitis vinifera]
Length=524

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E  ++ +     I++TD N+ICATIDWWP +KC+YNQCPW  + + NLDL +     AI+
Sbjct  25   EDVKVTVGGVTSIAETDDNFICATIDWWPADKCDYNQCPWGLAGIFNLDLQNIILVNAIK  84

Query  576  AFEHLRLRLGGSLQDQ  623
            AF++LR+R+GGSLQDQ
Sbjct  85   AFDNLRIRMGGSLQDQ  100



>gb|KHN02016.1| Heparanase-like protein 2 [Glycine soja]
Length=518

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E  +L ++  A I++TD N+ICAT+DWWP  KC+Y+QCPW  + +LNLDL +     A++
Sbjct  22   EDVKLEVKGVASIANTDDNFICATLDWWPANKCDYDQCPWGQAGILNLDLDNKILTNAVK  81

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  LR+RLGGSL+DQ
Sbjct  82   AFNPLRIRLGGSLEDQ  97



>ref|XP_006574932.1| PREDICTED: heparanase-like protein 2-like [Glycine max]
Length=519

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E  +L ++  A I++TD N+ICAT+DWWP  KC+Y+QCPW  + +LNLDL +     A++
Sbjct  22   EDVKLEVKGVASIANTDDNFICATLDWWPANKCDYDQCPWGQAGILNLDLDNKILTNAVK  81

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  LR+RLGGSL+DQ
Sbjct  82   AFNPLRIRLGGSLEDQ  97



>ref|XP_008805083.1| PREDICTED: heparanase-like protein 2 [Phoenix dactylifera]
 ref|XP_008805084.1| PREDICTED: heparanase-like protein 2 [Phoenix dactylifera]
 ref|XP_008805085.1| PREDICTED: heparanase-like protein 2 [Phoenix dactylifera]
Length=528

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  432  ISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLRLRLGGS  611
            I+ TD N+ICATIDWWP EKCNYN CPW +SS++NLDL++     AI+AF+ LR+RLGGS
Sbjct  39   IAQTDDNFICATIDWWPKEKCNYNMCPWYNSSIINLDLNNTILFNAIKAFKSLRVRLGGS  98

Query  612  LQD  620
            LQD
Sbjct  99   LQD  101



>ref|XP_004239465.2| PREDICTED: heparanase-like protein 2, partial [Solanum lycopersicum]
Length=513

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  405  ELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFE  584
            +++++    I+ TD N+ICAT+DWWP  KC+YNQCPW  + +LNLDL +     A++AF 
Sbjct  10   KVVVKGVTSIAQTDDNFICATLDWWPENKCDYNQCPWGKAGILNLDLKNRILTNAVKAFN  69

Query  585  HLRLRLGGSLQDQ  623
             LRLR+GGSLQDQ
Sbjct  70   PLRLRIGGSLQDQ  82



>ref|XP_006837042.1| hypothetical protein AMTR_s00110p00045590 [Amborella trichopoda]
 gb|ERM99895.1| hypothetical protein AMTR_s00110p00045590 [Amborella trichopoda]
Length=524

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E   + +++   I+ TD N++CAT+DWWP +KCNY +CPW  + +LNLDL +P   KAI+
Sbjct  22   EEVLVKVKSVNTIAHTDDNFVCATLDWWPSDKCNYGECPWIEAGILNLDLENPNLGKAIK  81

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  LR+R+GGSLQDQ
Sbjct  82   AFNPLRVRVGGSLQDQ  97



>gb|KEH33101.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=516

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            + IEH  LL+      ++T  N+ICATIDWWP E CN+  C W  SS++NLDLS P  AK
Sbjct  20   KDIEHGLLLVNGAKAKAETGDNFICATIDWWPPE-CNFGVCSWGHSSIVNLDLSRPLLAK  78

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AIQA + LR+RLGGSLQDQ
Sbjct  79   AIQALKPLRIRLGGSLQDQ  97



>ref|XP_009612848.1| PREDICTED: heparanase-like protein 2 [Nicotiana tomentosiformis]
Length=516

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            +  +++++    I+ TD N+ICAT+DWWP  KC+YNQCPW  + +LNLDL +     A++
Sbjct  24   DELKVMVKGVTSIAKTDDNFICATLDWWPENKCDYNQCPWGKAGILNLDLKNKILTNAVK  83

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  LR+R+GGSLQDQ
Sbjct  84   AFNPLRIRIGGSLQDQ  99



>ref|XP_009783167.1| PREDICTED: heparanase-like protein 2 [Nicotiana sylvestris]
Length=516

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            +  +++++    I+ TD N+ICAT+DWWP  KC+YNQCPW  + +LNLDL +     A++
Sbjct  24   DELKVIVKGVTSIAKTDDNFICATLDWWPENKCDYNQCPWGKAGILNLDLKNKILTNAVK  83

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  LR+R+GGSLQDQ
Sbjct  84   AFNPLRIRIGGSLQDQ  99



>ref|XP_010904949.1| PREDICTED: heparanase-like protein 1 [Elaeis guineensis]
Length=520

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
            A + ++   +I+ TD N+ICATIDWWP EKCNYN  PW +SS++NLDL++     A++AF
Sbjct  24   ATVSVKAVTKIAKTDINFICATIDWWPKEKCNYNMSPWYNSSIINLDLNNTILFNAVKAF  83

Query  582  EHLRLRLGGSLQDQ  623
            + LR+RLGG+LQD+
Sbjct  84   KCLRIRLGGTLQDR  97



>emb|CAN63833.1| hypothetical protein VITISV_009131 [Vitis vinifera]
Length=851

 Score =   100 bits (249),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E  ++ +     I++TD N+ICATIDWWP +KC+YNQCPW  + + NLDL +     AI+
Sbjct  25   EDVKVTVGGVTSIAETDDNFICATIDWWPADKCDYNQCPWGLAGIFNLDLQNIILVNAIK  84

Query  576  AFEHLRLRLGGSLQDQ  623
            AF++LR+R+GGSLQDQ
Sbjct  85   AFDNLRIRMGGSLQDQ  100



>emb|CDP13545.1| unnamed protein product [Coffea canephora]
Length=514

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q I    L I+ +A +  TD N+ICAT+DWWP EKC+Y  C W ++S+LNLDLS+     
Sbjct  27   QNITQGSLFIDGSASVGSTDENFICATLDWWPPEKCDYGSCSWGNASLLNLDLSNKVLLN  86

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            A++AF  L++RLGG+LQD+
Sbjct  87   AVKAFSPLKIRLGGTLQDK  105



>ref|XP_007226518.1| hypothetical protein PRUPE_ppa025624mg, partial [Prunus persica]
 gb|EMJ27717.1| hypothetical protein PRUPE_ppa025624mg, partial [Prunus persica]
Length=501

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E+ E+ +     I+ TD N+ICAT+DWWP  KC+YNQCPW  + + NLDL +     AI+
Sbjct  1    EYVEVSVGGVTSIASTDDNFICATLDWWPTNKCDYNQCPWGKAGIFNLDLDNKILNNAIK  60

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  +R+R+GGSLQDQ
Sbjct  61   AFNPMRIRVGGSLQDQ  76



>ref|XP_010552799.1| PREDICTED: heparanase-like protein 2, partial [Tarenaya hassleriana]
Length=516

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  414  IETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLR  593
            IE    I+ TD ++ICAT+DWWP +KCNY QCPW  + ++NLDLS+     AI+AF  LR
Sbjct  34   IEGVTSIARTDDDFICATLDWWPTDKCNYGQCPWGKAGLINLDLSNSILQNAIKAFSPLR  93

Query  594  LRLGGSLQDQ  623
            +RLGGSLQDQ
Sbjct  94   IRLGGSLQDQ  103



>ref|XP_006658769.1| PREDICTED: heparanase-like protein 1-like [Oryza brachyantha]
Length=511

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  432  ISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLRLRLGGS  611
            I+ TD N++CAT+DWWP +KCNY  CPW +SS++NLDL +P    A++AF  LR+RLGGS
Sbjct  43   IARTDDNFVCATLDWWPSDKCNYGMCPWYNSSIINLDLDNPILHNAVKAFNSLRIRLGGS  102

Query  612  LQDQ  623
            LQDQ
Sbjct  103  LQDQ  106



>ref|XP_007157579.1| hypothetical protein PHAVU_002G081000g [Phaseolus vulgaris]
 gb|ESW29573.1| hypothetical protein PHAVU_002G081000g [Phaseolus vulgaris]
Length=515

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            +   L ++    I+ TD N+ICATIDWWP  KC+YNQCPW  + +LNLDL +     AI+
Sbjct  21   KDVNLEVKGVTHIATTDENFICATIDWWPPNKCDYNQCPWGEAGILNLDLFNDILINAIK  80

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  LR+RLGGSL+DQ
Sbjct  81   AFSPLRIRLGGSLEDQ  96



>ref|XP_008340307.1| PREDICTED: heparanase-like protein 2 [Malus domestica]
Length=507

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E+ E+ ++    I+ TD N+ICAT+DWWP +KC+Y+QCPW  +   NLDLS+     A++
Sbjct  22   EYVEVRVKGVTFIATTDDNFICATLDWWPADKCDYDQCPWGKAGTFNLDLSNKILHNAVK  81

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  +R+R+GGSLQDQ
Sbjct  82   AFNPMRIRVGGSLQDQ  97



>ref|XP_007011804.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
 gb|EOY29423.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
Length=513

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +    ++I  TA I  TD N+ICAT+DWWP EKC+Y  C W  +S+LNLDL++P    AI
Sbjct  35   VISGTVVINGTASIGKTDDNFICATLDWWPPEKCDYGTCSWGRASLLNLDLANPILLNAI  94

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  L++R+GG+LQD 
Sbjct  95   KAFSPLKIRMGGTLQDN  111



>ref|XP_007011803.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
 gb|EOY29422.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
Length=549

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +    ++I  TA I  TD N+ICAT+DWWP EKC+Y  C W  +S+LNLDL++P    AI
Sbjct  35   VISGTVVINGTASIGKTDDNFICATLDWWPPEKCDYGTCSWGRASLLNLDLANPILLNAI  94

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  L++R+GG+LQD 
Sbjct  95   KAFSPLKIRMGGTLQDN  111



>ref|XP_010046621.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
Length=526

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            ++ ++ ++  A I+ TD ++ICAT+DWWP +KC+Y QCPW  + VLNLDL +   + AI+
Sbjct  27   DNVKVAVKGGASIAATDDSFICATLDWWPSDKCDYGQCPWGLAGVLNLDLDNKILSNAIK  86

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  LR+R+GGSLQDQ
Sbjct  87   AFNPLRIRVGGSLQDQ  102



>ref|XP_006483407.1| PREDICTED: heparanase-like protein 3-like isoform X2 [Citrus 
sinensis]
Length=430

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +    + I  T  I+ TD N+ICAT+DWWP +KC+Y  C W  +S+LNLDL +P   KA+
Sbjct  45   VIEGTVFINGTVAIAKTDDNFICATLDWWPPDKCDYGTCSWGRASLLNLDLGNPILLKAV  104

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  L++R+GG+LQD+
Sbjct  105  KAFSPLKIRMGGTLQDK  121



>ref|XP_006574930.1| PREDICTED: heparanase-like protein 2-like isoform X1 [Glycine 
max]
Length=513

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            +  +L ++    I+ TD N+ICAT+DWWP  KC+YN CPW ++ +LNLDL +  F  A++
Sbjct  21   KDVDLRVKGVTSIATTDENFICATLDWWPPNKCDYNDCPWGNAGILNLDLYNDIFLNAVK  80

Query  576  AFEHLRLRLGGSLQD  620
            AF  LR+RLGGSL+D
Sbjct  81   AFNPLRIRLGGSLED  95



>gb|KHN02019.1| Heparanase-like protein 2 [Glycine soja]
Length=513

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            +  +L ++    I+ TD N+ICAT+DWWP  KC+YN CPW ++ +LNLDL +  F  A++
Sbjct  21   KDVDLRVKGVTSIATTDENFICATLDWWPPNKCDYNDCPWGNAGILNLDLYNDIFLNAVK  80

Query  576  AFEHLRLRLGGSLQD  620
            AF  LR+RLGGSL+D
Sbjct  81   AFNPLRIRLGGSLED  95



>ref|XP_006450373.1| hypothetical protein CICLE_v10010401mg [Citrus clementina]
 gb|ESR63613.1| hypothetical protein CICLE_v10010401mg [Citrus clementina]
Length=551

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  390  TIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKA  569
            ++    + I  T  I+ TD N+ICAT+DWWP +KC+Y  C W  +S+LNLDL +P   KA
Sbjct  34   SVIEGTVFINGTVAIAKTDDNFICATLDWWPPDKCDYGTCSWGRASLLNLDLGNPILLKA  93

Query  570  IQAFEHLRLRLGGSLQDQ  623
            ++AF  L++R+GG+LQD+
Sbjct  94   VKAFSPLKIRMGGTLQDK  111



>gb|EEE67528.1| hypothetical protein OsJ_24994 [Oryza sativa Japonica Group]
Length=490

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +3

Query  435  SDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLRLRLGGSL  614
            S TD N++CAT+DWWP +KCNY  CPW ++S++NLDL++     A++AF  LR+RLGGSL
Sbjct  44   SRTDDNFVCATLDWWPRDKCNYGMCPWYNASIINLDLNNTILNNAVKAFNSLRIRLGGSL  103

Query  615  QDQ  623
            QDQ
Sbjct  104  QDQ  106



>ref|XP_002512114.1| Heparanase precursor, putative [Ricinus communis]
 gb|EEF50783.1| Heparanase precursor, putative [Ricinus communis]
Length=596

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E  ++ +      + TD N+ICAT+DWWP  KC+Y QCPW  + +LNLDL +   A AI+
Sbjct  29   EVVQVTVRGLTSRASTDENFICATLDWWPDTKCDYGQCPWGQAGILNLDLENKILANAIK  88

Query  576  AFEHLRLRLGGSLQDQ  623
            AF+ LR+R+GGSLQDQ
Sbjct  89   AFDPLRIRIGGSLQDQ  104


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  486  EKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLRLRLGGSLQDQ  623
             KC YNQCPW  S +  LD+ +     A++AF  LR+R+GGSLQDQ
Sbjct  540  SKCRYNQCPWGHSGLFTLDVKNKILWNAVKAFNPLRIRVGGSLQDQ  585



>gb|EAZ04591.1| hypothetical protein OsI_26741 [Oryza sativa Indica Group]
Length=529

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +3

Query  435  SDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLRLRLGGSL  614
            S TD N++CAT+DWWP +KCNY  CPW ++S++NLDL++     A++AF  LR+RLGGSL
Sbjct  44   SRTDDNFVCATLDWWPRDKCNYGMCPWYNASIINLDLNNTILNNAVKAFNSLRIRLGGSL  103

Query  615  QDQ  623
            QDQ
Sbjct  104  QDQ  106



>ref|NP_001060182.1| Os07g0598400 [Oryza sativa Japonica Group]
 dbj|BAC83217.1| putative beta-glucuronidase precursor [Oryza sativa Japonica 
Group]
 dbj|BAF22096.1| Os07g0598400 [Oryza sativa Japonica Group]
Length=529

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +3

Query  435  SDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLRLRLGGSL  614
            S TD N++CAT+DWWP +KCNY  CPW ++S++NLDL++     A++AF  LR+RLGGSL
Sbjct  44   SRTDDNFVCATLDWWPRDKCNYGMCPWYNASIINLDLNNTILNNAVKAFNSLRIRLGGSL  103

Query  615  QDQ  623
            QDQ
Sbjct  104  QDQ  106



>ref|XP_004298393.1| PREDICTED: heparanase-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=525

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  390  TIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKA  569
            + E+ ++ I     I++TD N+ICAT+DWWP +KC+Y QCPW  + + NLDL +     A
Sbjct  20   SAEYVDVRIRGVVSIANTDDNFICATLDWWPTDKCDYGQCPWGKAGIFNLDLENKTLINA  79

Query  570  IQAFEHLRLRLGGSLQD  620
            ++AF  +RLR+GGSLQD
Sbjct  80   VKAFGSIRLRIGGSLQD  96



>ref|XP_009355782.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=533

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            L +  TA I  TD ++ICATIDWWP +KC+Y  C W S+S+LNLDL +  F  AI+AF  
Sbjct  40   LFVNKTAAIGATDDDFICATIDWWPPQKCDYGTCSWGSASLLNLDLDNAIFLNAIKAFSP  99

Query  588  LRLRLGGSLQDQ  623
            L++RLGG+LQD+
Sbjct  100  LKIRLGGTLQDK  111



>gb|KDO61807.1| hypothetical protein CISIN_1g037212mg [Citrus sinensis]
Length=551

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +    + I  T  I+ TD N+ICAT+DWWP +KC+Y  C W  +S+LNLDL +P   KA+
Sbjct  35   VIEGTVFINGTVAIAKTDDNFICATLDWWPPDKCDYGTCSWGRASLLNLDLGNPILLKAV  94

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  L++R+GG+LQD+
Sbjct  95   KAFSPLKIRMGGTLQDK  111



>ref|XP_006483406.1| PREDICTED: heparanase-like protein 3-like isoform X1 [Citrus 
sinensis]
Length=561

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +    + I  T  I+ TD N+ICAT+DWWP +KC+Y  C W  +S+LNLDL +P   KA+
Sbjct  45   VIEGTVFINGTVAIAKTDDNFICATLDWWPPDKCDYGTCSWGRASLLNLDLGNPILLKAV  104

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  L++R+GG+LQD+
Sbjct  105  KAFSPLKIRMGGTLQDK  121



>ref|XP_008394121.1| PREDICTED: heparanase-like protein 3 isoform X2 [Malus domestica]
Length=533

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            L +  TA I  TD ++ICATIDWWP +KC+Y  C W S+S+LNLDL +  F  AI+AF  
Sbjct  40   LFVNKTAAIGATDDDFICATIDWWPPQKCDYGTCSWGSASLLNLDLDNAIFLNAIKAFAP  99

Query  588  LRLRLGGSLQDQ  623
            L++RLGG+LQD+
Sbjct  100  LKIRLGGTLQDK  111



>ref|XP_004488517.1| PREDICTED: heparanase-like protein 3-like [Cicer arietinum]
Length=536

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            +T+    ++I+  + I + D +++CAT+DWWP EKC+Y +C W  +S+LNLDL++  F  
Sbjct  31   KTVMKGSVIIDGNSVIGNIDDDFVCATLDWWPPEKCDYGRCSWGLASLLNLDLNNKIFLN  90

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            A++AF  L+LRLGGSLQD+
Sbjct  91   AVKAFSPLKLRLGGSLQDK  109



>ref|XP_011036604.1| PREDICTED: heparanase-like protein 3 isoform X2 [Populus euphratica]
Length=520

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            + I    + I  TA I  TD ++ICAT+DWWP +KC+Y  C W  +S LNLDL++P    
Sbjct  8    RNIVQGTVFINGTAPIGRTDHDFICATLDWWPPDKCDYGTCSWGKASFLNLDLTNPILLN  67

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF  L++RLGG+LQD+
Sbjct  68   AIKAFAPLKIRLGGTLQDK  86



>ref|XP_006852836.1| hypothetical protein AMTR_s00033p00188330 [Amborella trichopoda]
 gb|ERN14303.1| hypothetical protein AMTR_s00033p00188330 [Amborella trichopoda]
Length=544

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
             ++   E+LI  ++ I++TD ++ICAT+DWWP EKC+Y  C W+ +S+LNLDL++     
Sbjct  31   SSVVEGEVLINGSSVIAETDGSFICATMDWWPPEKCDYGTCSWDHASLLNLDLNNTILHN  90

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            A++AF  L++RLGG+LQD+
Sbjct  91   AVKAFSPLKIRLGGTLQDK  109



>ref|XP_011036603.1| PREDICTED: heparanase-like protein 3 isoform X1 [Populus euphratica]
Length=563

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            + I    + I  TA I  TD ++ICAT+DWWP +KC+Y  C W  +S LNLDL++P    
Sbjct  51   RNIVQGTVFINGTAPIGRTDHDFICATLDWWPPDKCDYGTCSWGKASFLNLDLTNPILLN  110

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF  L++RLGG+LQD+
Sbjct  111  AIKAFAPLKIRLGGTLQDK  129



>ref|XP_002515478.1| heparanase, putative [Ricinus communis]
 gb|EEF46927.1| heparanase, putative [Ricinus communis]
Length=527

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            Q++E   + I  TA I  TD ++ICAT+DWWP +KC+Y  C W  +S LNLDL +P    
Sbjct  11   QSVE-GTVFINGTASIGTTDNDFICATLDWWPTDKCDYGTCSWGRASFLNLDLRNPILLN  69

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF  L++R+GG+LQD+
Sbjct  70   AIKAFSPLKIRMGGTLQDK  88



>ref|XP_002324878.2| hypothetical protein POPTR_0018s02050g [Populus trichocarpa]
 gb|EEF03443.2| hypothetical protein POPTR_0018s02050g [Populus trichocarpa]
Length=563

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            + I    + I  TA I  TD ++ICAT+DWWP +KC+Y  C W  +S LNLDL++P    
Sbjct  51   RNIVEGTVFINGTAPIGTTDHDFICATLDWWPPDKCDYGTCSWGKASFLNLDLTNPILLN  110

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            AI+AF  L++R+GG+LQD+
Sbjct  111  AIKAFSPLKIRMGGTLQDK  129



>ref|XP_010665516.1| PREDICTED: heparanase-like protein 3 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            +  ++   TTA I +TD +YICAT+DWWP +KC+Y+ C W  +S+LNLDL++   + A++
Sbjct  39   QMVDVYFNTTAEIGETDDDYICATLDWWPSDKCDYDSCSWGMASLLNLDLNNIILSNAVK  98

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  L++R+GG+LQD+
Sbjct  99   AFSPLKIRMGGTLQDK  114



>ref|XP_008446419.1| PREDICTED: heparanase-like protein 1 [Cucumis melo]
Length=517

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = +3

Query  390  TIEHAELL---IETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFF  560
            TI  AE +   ++    I+ TD ++ICAT+DWWP  KC+Y QCPW  + + NLDL +   
Sbjct  18   TISSAEFVKVSVKGVTTIAQTDDDFICATLDWWPPNKCDYGQCPWGLAGIPNLDLQNIIL  77

Query  561  AKAIQAFEHLRLRLGGSLQDQ  623
            AKAI+ F  LR+R+GGSLQDQ
Sbjct  78   AKAIKEFNPLRIRIGGSLQDQ  98



>gb|ACJ85786.1| unknown [Medicago truncatula]
Length=224

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            + ++   ++I+ ++ I + D ++ICAT+DWWP +KC+Y  C W  +S+LNLDL++  F  
Sbjct  32   EDVKKGNVVIDGSSVIGNIDDDFICATLDWWPPQKCDYGTCSWGLASLLNLDLNNKIFLN  91

Query  567  AIQAFEHLRLRLGGSLQD  620
            A++AF  L+LRLGGSLQD
Sbjct  92   AVKAFSPLKLRLGGSLQD  109



>ref|XP_010665510.1| PREDICTED: heparanase-like protein 3 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=604

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            +  ++   TTA I +TD +YICAT+DWWP +KC+Y+ C W  +S+LNLDL++   + A++
Sbjct  39   QMVDVYFNTTAEIGETDDDYICATLDWWPSDKCDYDSCSWGMASLLNLDLNNIILSNAVK  98

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  L++R+GG+LQD+
Sbjct  99   AFSPLKIRMGGTLQDK  114



>ref|XP_007138475.1| hypothetical protein PHAVU_009G212400g [Phaseolus vulgaris]
 gb|ESW10469.1| hypothetical protein PHAVU_009G212400g [Phaseolus vulgaris]
Length=536

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
              + I+  A I  TDA+++CAT+DWWP +KC+Y +C W  +S+LNLDL++  F  A++AF
Sbjct  37   GTVAIDDKAVIGTTDADFVCATLDWWPPQKCDYGKCSWGLASLLNLDLNNKIFLNAVKAF  96

Query  582  EHLRLRLGGSLQDQ  623
              L+LRLGGSLQD+
Sbjct  97   SPLKLRLGGSLQDK  110



>ref|XP_010068782.1| PREDICTED: heparanase-like protein 1 [Eucalyptus grandis]
 gb|KCW64898.1| hypothetical protein EUGRSUZ_G02460 [Eucalyptus grandis]
Length=521

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +3

Query  402  AELLIETTARISD---TDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            A+ +  T A ++D   TD N++CAT+DWWP +KC+Y QCPW  + ++NLDL +   + AI
Sbjct  22   AKDVTVTVAGVTDVARTDDNFVCATLDWWPVDKCDYGQCPWGMAGIINLDLKNKILSNAI  81

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  LR+R+GGSLQDQ
Sbjct  82   KAFNPLRIRVGGSLQDQ  98



>ref|XP_009623092.1| PREDICTED: heparanase-like protein 3 [Nicotiana tomentosiformis]
Length=537

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E   L I+ +A I+  D ++ICAT+DWWP  KC+Y  C W +SS+LNLDLS+     AI+
Sbjct  29   EEGTLYIDGSAAIAKIDEDFICATLDWWPSNKCDYGTCSWGNSSLLNLDLSNKVLLNAIR  88

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  L++RLGG+LQD+
Sbjct  89   AFSPLKIRLGGTLQDK  104



>ref|XP_004155378.1| PREDICTED: probable S-acyltransferase At1g69420-like [Cucumis 
sativus]
Length=1028

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = +3

Query  390  TIEHAELL---IETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFF  560
            TI  AE +   ++    I+ TD ++ICAT+DWWP  KC+Y QCPW  + + NLDL +   
Sbjct  15   TISSAEFVKVSVKGVTTIAQTDDDFICATLDWWPPNKCDYGQCPWGKAGITNLDLQNIIL  74

Query  561  AKAIQAFEHLRLRLGGSLQDQ  623
            A+AI+ F  LR+R+GGSLQDQ
Sbjct  75   AEAIKEFNPLRIRVGGSLQDQ  95



>gb|KGN51965.1| hypothetical protein Csa_5G606560 [Cucumis sativus]
Length=517

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = +3

Query  390  TIEHAELL---IETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFF  560
            TI  AE +   ++    I+ TD ++ICAT+DWWP  KC+Y QCPW  + + NLDL +   
Sbjct  18   TISSAEFVKVSVKGVTTIAQTDDDFICATLDWWPPNKCDYGQCPWGKAGIPNLDLQNIIL  77

Query  561  AKAIQAFEHLRLRLGGSLQDQ  623
            A+AI+ F  LR+R+GGSLQDQ
Sbjct  78   AEAIKEFNPLRIRVGGSLQDQ  98



>ref|XP_009757548.1| PREDICTED: heparanase-like protein 3 [Nicotiana sylvestris]
Length=538

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +    + I+    I  TD N+ICAT+DWWP EKC+Y  C W+ +S LNLDL++  F  AI
Sbjct  28   VAQGSVFIDGKNAIGRTDNNFICATLDWWPPEKCDYGTCAWDHASFLNLDLNNIIFLNAI  87

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  L++RLGG+LQD+
Sbjct  88   KAFSPLKIRLGGTLQDK  104



>gb|AFK40288.1| unknown [Lotus japonicus]
Length=529

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            E   + I+  + I + D +++CAT+DWWP EKC+Y +C W  +S+LNLDL++  F  A++
Sbjct  25   EKGTVTIDGKSAIGNIDDDFVCATLDWWPPEKCDYGRCSWGLASLLNLDLNNKIFLNAVK  84

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  L+LRLGGSLQD+
Sbjct  85   AFSPLKLRLGGSLQDK  100



>ref|XP_009792772.1| PREDICTED: heparanase-like protein 3 isoform X2 [Nicotiana sylvestris]
Length=546

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
             E   + I+ +A I+  D ++ICAT+DWWP  KC+Y  C W +SS+LNLDLS+     AI
Sbjct  37   FEKGSIYIDGSAAIAKIDEDFICATLDWWPSNKCDYGTCSWGNSSLLNLDLSNKVLLNAI  96

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  L++RLGG+LQD+
Sbjct  97   RAFSPLKIRLGGTLQDK  113



>ref|XP_010099859.1| Heparanase-like protein 3 [Morus notabilis]
 gb|EXB80736.1| Heparanase-like protein 3 [Morus notabilis]
Length=536

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  396  EHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQ  575
            +   + +  TA I   D +++CATIDWWP +KC++  C W ++S+LNLDL+ P    AI+
Sbjct  28   QRGTVFVNGTAPIGRIDDDFVCATIDWWPPDKCDFGTCSWGTASLLNLDLNDPILVNAIR  87

Query  576  AFEHLRLRLGGSLQDQ  623
            AF  L++RLGG+LQD+
Sbjct  88   AFSSLKIRLGGTLQDK  103



>gb|KEH37925.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=537

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            + ++   ++I+ ++ I + D ++ICAT+DWWP +KC+Y  C W  +S+LNLDL++  F  
Sbjct  32   EDVKKGNVVIDGSSVIGNIDDDFICATLDWWPPQKCDYGTCSWGLASLLNLDLNNKIFLN  91

Query  567  AIQAFEHLRLRLGGSLQD  620
            A++AF  L+LRLGGSLQD
Sbjct  92   AVKAFSPLKLRLGGSLQD  109



>ref|XP_004288767.1| PREDICTED: heparanase-like protein 3-like [Fragaria vesca subsp. 
vesca]
Length=600

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
            A + I+    I+  D ++ICAT+DWWP EKC+Y  C W  +S+LNLDLS+   + AI+AF
Sbjct  81   ALIRIDGKEAIAKVDEDFICATLDWWPPEKCDYGTCSWGKTSLLNLDLSNTILSNAIKAF  140

Query  582  EHLRLRLGGSLQDQ  623
              L+LRLGG+LQDQ
Sbjct  141  SPLKLRLGGTLQDQ  154



>gb|KDP41275.1| hypothetical protein JCGZ_15682 [Jatropha curcas]
Length=449

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +3

Query  432  ISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLRLRLGGS  611
            I+ TD  ++CAT+DWWP  KCNY QCPW  + +LNLDL +     A++AF  LR+R+GGS
Sbjct  6    IARTDDTFVCATLDWWPSTKCNYQQCPWGKAGLLNLDLKNKILINALKAFGDLRIRIGGS  65

Query  612  LQDQ  623
            LQDQ
Sbjct  66   LQDQ  69



>ref|XP_009394623.1| PREDICTED: heparanase-like protein 2 [Musa acuminata subsp. malaccensis]
Length=527

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +3

Query  399  HAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQA  578
            H  + ++    ++ TD N+ICAT+DWWP EKC++  C W ++S+ NLDLS+     AI A
Sbjct  29   HVNVSVQADYVVARTDGNFICATVDWWPPEKCDFGDCSWGNTSIKNLDLSNKILRNAITA  88

Query  579  FEHLRLRLGGSLQDQ  623
            F  +R+RLGG+LQDQ
Sbjct  89   FGTMRVRLGGTLQDQ  103



>ref|XP_002283260.2| PREDICTED: heparanase-like protein 3 [Vitis vinifera]
Length=532

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E   + I     I  TD ++ICAT+DWWP +KC+Y  C W  +S+LNLDLS+     AI
Sbjct  19   VEEGSVFINGRVAIGSTDDDFICATLDWWPPDKCDYGTCSWGRASLLNLDLSNKILLNAI  78

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  L++R+GG+LQD+
Sbjct  79   KAFSPLKVRMGGTLQDK  95



>gb|KDP33563.1| hypothetical protein JCGZ_07134 [Jatropha curcas]
Length=539

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
              + I     I +TD ++ICAT+DWWP +KC+Y  C W  +S+LN+DLS+P    A++AF
Sbjct  33   GTVFINGRDSIGETDEDFICATLDWWPPDKCDYGTCSWGKASLLNVDLSNPILVNAVRAF  92

Query  582  EHLRLRLGGSLQDQ  623
              L++R+GG+LQD+
Sbjct  93   SPLKIRMGGTLQDK  106



>ref|XP_007224283.1| hypothetical protein PRUPE_ppa019445mg, partial [Prunus persica]
 gb|EMJ25482.1| hypothetical protein PRUPE_ppa019445mg, partial [Prunus persica]
Length=511

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
              L +  TA I   D +++CATIDWWP +KC+Y  C W S+S+LNLDL +     AI+AF
Sbjct  14   GTLFVNGTAAIGFIDDDFVCATIDWWPPQKCDYGTCSWGSASLLNLDLDNAILLNAIKAF  73

Query  582  EHLRLRLGGSLQDQ  623
              L++RLGG+LQD+
Sbjct  74   SPLKIRLGGTLQDK  87



>ref|XP_009625836.1| PREDICTED: heparanase-like protein 3 [Nicotiana tomentosiformis]
Length=538

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +    + I+    I   D N+ICAT+DWWP EKC+Y  C W+ +S LNLDL++  F  AI
Sbjct  28   VAQGSVFIDGKNAIGRIDNNFICATLDWWPPEKCDYGTCAWDHASFLNLDLNNIIFLNAI  87

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  L++RLGG+LQD+
Sbjct  88   KAFSPLKIRLGGTLQDK  104



>ref|XP_004135441.1| PREDICTED: heparanase-like protein 1-like [Cucumis sativus]
Length=496

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
             ++ ++    I+ TD ++ICAT+DWWP  KC+Y QCPW  + + NLDL +   A+AI+ F
Sbjct  4    VKVSVKGVTTIAQTDDDFICATLDWWPPNKCDYGQCPWGKAGIPNLDLQNIILAEAIKEF  63

Query  582  EHLRLRLGGSLQDQ  623
              LR+R+GGSLQDQ
Sbjct  64   NPLRIRVGGSLQDQ  77



>ref|XP_003533856.1| PREDICTED: heparanase-like protein 3-like [Glycine max]
 gb|KHN48130.1| Heparanase-like protein 3 [Glycine soja]
Length=538

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
              + I+  A I   D +++CAT+DWWP EKC+Y +C W  +S+LNLDL++  F  A++AF
Sbjct  37   GSVAIDGKAVIGTIDEDFVCATLDWWPPEKCDYGRCSWGLASLLNLDLNNKIFLNAVKAF  96

Query  582  EHLRLRLGGSLQDQ  623
              L+LRLGGSLQD+
Sbjct  97   SPLKLRLGGSLQDK  110



>ref|XP_008219535.1| PREDICTED: heparanase-like protein 3 isoform X2 [Prunus mume]
Length=534

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
              L +  TA I   D +++CATIDWWP +KC+Y  C W S+S+LNLDL +     AI+AF
Sbjct  38   GTLFVNGTAAIGFIDDDFVCATIDWWPPQKCDYGTCSWGSASLLNLDLDNAILLNAIKAF  97

Query  582  EHLRLRLGGSLQDQ  623
              L++RLGG+LQD+
Sbjct  98   SPLKIRLGGTLQDK  111



>ref|XP_008219534.1| PREDICTED: heparanase-like protein 3 isoform X1 [Prunus mume]
Length=535

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
              L +  TA I   D +++CATIDWWP +KC+Y  C W S+S+LNLDL +     AI+AF
Sbjct  38   GTLFVNGTAAIGFIDDDFVCATIDWWPPQKCDYGTCSWGSASLLNLDLDNAILLNAIKAF  97

Query  582  EHLRLRLGGSLQDQ  623
              L++RLGG+LQD+
Sbjct  98   SPLKIRLGGTLQDK  111



>gb|EPS67583.1| hypothetical protein M569_07189, partial [Genlisea aurea]
Length=534

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            +++   + ++ TD +++CAT+DWWP EKC+Y  C W+ +S+LNLDL +P    A++AF  
Sbjct  29   VVVGGLSPVAVTDEDFVCATLDWWPPEKCDYGTCAWDHASILNLDLKNPLLVNAVKAFSP  88

Query  588  LRLRLGGSLQDQ  623
            L++RLGG+LQD+
Sbjct  89   LKIRLGGTLQDK  100



>gb|EYU34948.1| hypothetical protein MIMGU_mgv1a004017mg [Erythranthe guttata]
Length=540

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
              ++I+  + I++TD N++CAT+DWWP  KC+Y  C W ++S+ NLDL +  F  A++AF
Sbjct  29   GTVVIDGESPIAETDENFVCATLDWWPSAKCDYGNCSWGNASLFNLDLKNVVFLNAVKAF  88

Query  582  EHLRLRLGGSLQDQ  623
              L++RLGG+LQD+
Sbjct  89   SPLKIRLGGTLQDK  102



>gb|EYU34947.1| hypothetical protein MIMGU_mgv1a004017mg [Erythranthe guttata]
Length=549

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
              ++I+  + I++TD N++CAT+DWWP  KC+Y  C W ++S+ NLDL +  F  A++AF
Sbjct  29   GTVVIDGESPIAETDENFVCATLDWWPSAKCDYGNCSWGNASLFNLDLKNVVFLNAVKAF  88

Query  582  EHLRLRLGGSLQDQ  623
              L++RLGG+LQD+
Sbjct  89   SPLKIRLGGTLQDK  102



>ref|XP_006359499.1| PREDICTED: heparanase-like protein 3-like [Solanum tuberosum]
Length=536

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +3

Query  390  TIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKA  569
            T     + I+    I   D ++ICAT+DWWP EKC+Y  C W+ SS LNLDL++  F  A
Sbjct  25   TTAQGTVFIDGKIAIGRIDKHFICATLDWWPPEKCDYGTCAWDHSSFLNLDLNNIIFLNA  84

Query  570  IQAFEHLRLRLGGSLQDQ  623
            I+AF  L++RLGG+LQD+
Sbjct  85   IKAFSPLKIRLGGTLQDK  102



>ref|XP_010250274.1| PREDICTED: heparanase-like protein 3 [Nelumbo nucifera]
Length=551

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +3

Query  390  TIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKA  569
            TIE   +LI  +A I   D ++ICAT+DWWP EKC+Y  C W  +S+LNLDL++     A
Sbjct  34   TIE-GTVLINGSASIGRIDDDFICATMDWWPPEKCDYGTCSWGHASMLNLDLNNTVLLNA  92

Query  570  IQAFEHLRLRLGGSLQDQ  623
            ++AF  L+LRLGG+LQD+
Sbjct  93   VKAFSPLKLRLGGTLQDK  110



>ref|XP_010648741.1| PREDICTED: heparanase-like protein 3 [Vitis vinifera]
Length=567

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E   + I     I  TD +++CAT+DWWP +KC+Y  C W  +S+LNLDL++     AI
Sbjct  35   VEEGRVFINGRVAIGSTDDDFVCATLDWWPPDKCDYGTCSWGRASLLNLDLTNKILFNAI  94

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  L++R+GG+LQD+
Sbjct  95   KAFSSLKIRMGGTLQDK  111



>ref|XP_004146543.1| PREDICTED: heparanase-like protein 1-like [Cucumis sativus]
 ref|XP_004168067.1| PREDICTED: heparanase-like protein 1-like [Cucumis sativus]
Length=464

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNY-NQCPWES-SSVLNLDLSHPFF  560
            Q +   ++++E   +I++TD N+IC T+D WPH++C+  N C W+S +SVLN+DLS P  
Sbjct  22   QNVTMGKIVVEGITKIAETDENFICFTLDIWPHDECSQPNLCVWDSHASVLNVDLSLPII  81

Query  561  AKAIQAFEHLRLRLGGSLQDQ  623
             KA+QAF+ LR+R+GG+LQD+
Sbjct  82   NKAVQAFKTLRIRVGGTLQDR  102



>ref|XP_011078541.1| PREDICTED: heparanase-like protein 3 [Sesamum indicum]
Length=537

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAK  566
            +T+E   + ++  + I+ TD ++ICAT+DWWP EKC+Y  C W  +S+LNLDL +  F  
Sbjct  27   ETVE-GIVFVDGKSPIAKTDEDFICATLDWWPPEKCDYGTCSWGHASLLNLDLKNSVFLN  85

Query  567  AIQAFEHLRLRLGGSLQDQ  623
            A++AF  L++RLGG+LQD+
Sbjct  86   AVKAFSPLKIRLGGTLQDK  104



>emb|CDP15923.1| unnamed protein product [Coffea canephora]
Length=155

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            + ++  + I + D ++ICAT+DWWP EKC+Y  C W+ +S+LNLDL++     A++AF  
Sbjct  52   VFVDGLSAIGEIDDDFICATLDWWPPEKCDYGTCSWDHASLLNLDLNNIILLNAVKAFSP  111

Query  588  LRLRLGGSLQDQ  623
            L++RLGG+LQD 
Sbjct  112  LKIRLGGTLQDN  123



>ref|XP_006338978.1| PREDICTED: heparanase-like protein 3-like [Solanum tuberosum]
Length=541

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E   L I+  + I+  D ++ICAT+DWWP  KC+Y  C W ++S+LNLDLS+  F  AI
Sbjct  31   VEEGILYIDGFSSIAKIDEDFICATLDWWPPSKCDYGTCSWGNASLLNLDLSNKVFFNAI  90

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  L +RLGG+LQD+
Sbjct  91   RAFSPLTIRLGGTLQDR  107



>ref|XP_001769830.1| predicted protein [Physcomitrella patens]
 gb|EDQ65392.1| predicted protein [Physcomitrella patens]
Length=562

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  414  IETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLR  593
            +E +A ++ TD  +ICAT+DWWP +KC+Y  C W  SS+LNLDL++P   K+++A +  R
Sbjct  54   VEGSAILATTDEAFICATLDWWPPDKCDYGTCSWGQSSLLNLDLANPLLEKSLKALQPFR  113

Query  594  LRLGGSLQD  620
            +RLGG+LQD
Sbjct  114  IRLGGTLQD  122



>ref|XP_009393723.1| PREDICTED: heparanase-like protein 3 [Musa acuminata subsp. malaccensis]
Length=548

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  441  TDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLRLRLGGSLQD  620
            TD +++CAT+DWWP EKC+Y  C W  +S+LNLDLS+P    A++AF  L+LRLGGSLQD
Sbjct  73   TDEDFVCATLDWWPPEKCDYGTCSWGLASMLNLDLSNPILLNAVKAFSPLKLRLGGSLQD  132

Query  621  Q  623
            +
Sbjct  133  K  133



>ref|XP_004249602.1| PREDICTED: heparanase-like protein 3 [Solanum lycopersicum]
Length=542

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E   L I+  + I+  D ++ICAT+DWWP  KC+Y  C W ++S+LNLDLS+     AI
Sbjct  32   VEEGILYIDGVSSIAKIDKDFICATLDWWPPTKCDYGTCSWGNASLLNLDLSNKVLVNAI  91

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  L +RLGG+LQD+
Sbjct  92   RAFSPLTIRLGGTLQDK  108



>ref|XP_008438923.1| PREDICTED: heparanase-like protein 2 [Cucumis melo]
Length=516

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWES-SSVLNLDLSHPFFA  563
            + +    ++++ T RI++TD NYIC TID+WP  +C+   C W+  +S LNL+LS P   
Sbjct  21   KNVTMGNIVVDGTTRITETDENYICMTIDYWPFNECSTIPCLWDGNASALNLNLSLPTLT  80

Query  564  KAIQAFEHLRLRLGGSLQDQ  623
            KA+QAF+ LR+R+GGSLQD+
Sbjct  81   KAVQAFKTLRIRVGGSLQDK  100



>ref|XP_010533116.1| PREDICTED: heparanase-like protein 3 [Tarenaya hassleriana]
Length=547

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +3

Query  402  AELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAF  581
              + ++  A +  TD++++CAT+DWWP EKC+Y  C W+ +S+LNLDLS+     AI+AF
Sbjct  35   GTVYVDGRAAVGRTDSDFVCATLDWWPPEKCDYGTCSWDHASLLNLDLSNNILQNAIKAF  94

Query  582  EHLRLRLGGSLQD  620
              L++RLGG+LQD
Sbjct  95   APLKIRLGGTLQD  107



>gb|KGN53270.1| hypothetical protein Csa_4G043860 [Cucumis sativus]
Length=531

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +3

Query  387  QTIEHAELLIETTARISDTDANYICATIDWWPHEKCNY-NQCPWES-SSVLNLDLSHPFF  560
            Q +   ++++E   +I++TD N+IC T+D WPH++C+  N C W+S +SVLN+DLS P  
Sbjct  22   QNVTMGKIVVEGITKIAETDENFICFTLDIWPHDECSQPNLCVWDSHASVLNVDLSLPII  81

Query  561  AKAIQAFEHLRLRLGGSLQDQ  623
             KA+QAF+ LR+R+GG+LQD+
Sbjct  82   NKAVQAFKTLRIRVGGTLQDR  102



>ref|XP_004242732.1| PREDICTED: heparanase-like protein 3 [Solanum lycopersicum]
Length=536

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +3

Query  390  TIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKA  569
            T     + I+    I   D ++ICAT+DWWP EKC+Y  C W+ SS LNLDL++  F  A
Sbjct  25   TKAQGTVFIDGKIAIGRIDRHFICATLDWWPPEKCDYGTCAWDYSSFLNLDLNNIIFLNA  84

Query  570  IQAFEHLRLRLGGSLQDQ  623
            I+AF  L++RLGG+LQD+
Sbjct  85   IKAFSPLKIRLGGTLQDK  102



>gb|EYU20239.1| hypothetical protein MIMGU_mgv1a026019mg [Erythranthe guttata]
Length=544

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  414  IETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHLR  593
            I+ ++ I  TD ++ICAT+DWWP  KC+Y  C W ++S+LNLDLS+     AI+AF  L+
Sbjct  36   IDVSSSIGFTDEDFICATMDWWPPTKCDYGTCSWGTASLLNLDLSNKILVNAIRAFSPLK  95

Query  594  LRLGGSLQDQ  623
            +R+GG+LQD+
Sbjct  96   IRIGGTLQDK  105



>ref|XP_007013614.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
 gb|EOY31233.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
Length=554

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +3

Query  390  TIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKA  569
            T+E   + I+  A I   D ++ICAT+DWWP EKC+Y  C W  + +LNLDLS+  F  A
Sbjct  38   TVE-GTVFIDGKAPIGSIDDDFICATLDWWPPEKCDYGTCSWGLAGLLNLDLSNNIFLNA  96

Query  570  IQAFEHLRLRLGGSLQDQ  623
            ++AF  L++RLGG+LQD+
Sbjct  97   VKAFSPLKIRLGGTLQDK  114



>emb|CBI21126.3| unnamed protein product [Vitis vinifera]
Length=887

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E   + I     I  TD +++CAT+DWWP +KC+Y  C W  +S+LNLDL++     AI
Sbjct  19   VEEGRVFINGRVAIGSTDDDFVCATLDWWPPDKCDYGTCSWGRASLLNLDLTNKILFNAI  78

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  L++R+GG+LQD+
Sbjct  79   KAFSSLKIRMGGTLQDK  95


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E   + I     I  TD ++ICAT+DWWP +KC+Y  C W  +S+LNLDLS+     AI
Sbjct  443  VEEGSVFINGRVAIGSTDDDFICATLDWWPPDKCDYGTCSWGRASLLNLDLSNKILLNAI  502

Query  573  QAFEHLRLRLG  605
            +AF  L++R+ 
Sbjct  503  KAFSPLKVRMA  513



>ref|XP_007155083.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
 gb|ESW27077.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
Length=512

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E   +L+   + I   D ++ICAT+DWWP +KC+Y +C W  +S+LNLDL+      AI
Sbjct  34   VEKGIVLVHGKSAIGRIDNDFICATLDWWPPQKCDYGKCSWGQASLLNLDLNSKTLLNAI  93

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  L+LRLGG+LQD+
Sbjct  94   KAFSSLKLRLGGTLQDK  110



>ref|XP_007155084.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
 gb|ESW27078.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
Length=524

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            +E   +L+   + I   D ++ICAT+DWWP +KC+Y +C W  +S+LNLDL+      AI
Sbjct  34   VEKGIVLVHGKSAIGRIDNDFICATLDWWPPQKCDYGKCSWGQASLLNLDLNSKTLLNAI  93

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  L+LRLGG+LQD+
Sbjct  94   KAFSSLKLRLGGTLQDK  110



>ref|XP_010927353.1| PREDICTED: heparanase-like protein 3 isoform X1 [Elaeis guineensis]
Length=543

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  411  LIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEHL  590
            +++ T  I+ TD ++ICAT+DWWP EKC+Y  C W  +S+LNLDLS+     A++ F  L
Sbjct  42   VVDGTTPIAVTDDDFICATLDWWPPEKCDYGTCSWGLASLLNLDLSNKVLLNAVKEFSPL  101

Query  591  RLRLGGSLQDQ  623
            +LRLGGSLQD+
Sbjct  102  KLRLGGSLQDK  112



>ref|XP_007013613.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
 gb|EOY31232.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
Length=615

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +3

Query  390  TIEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKA  569
            T+E   + I+  A I   D ++ICAT+DWWP EKC+Y  C W  + +LNLDLS+  F  A
Sbjct  38   TVE-GTVFIDGKAPIGSIDDDFICATLDWWPPEKCDYGTCSWGLAGLLNLDLSNNIFLNA  96

Query  570  IQAFEHLRLRLGGSLQDQ  623
            ++AF  L++RLGG+LQD+
Sbjct  97   VKAFSPLKIRLGGTLQDK  114



>ref|XP_011081531.1| PREDICTED: heparanase-like protein 3 [Sesamum indicum]
Length=549

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            + +  + I+  + I   D ++ICAT+DWWP  KC+Y  C W S+S+LNLDLS+     AI
Sbjct  47   VANGTVHIDGASSIGMIDDDFICATMDWWPPTKCDYGTCSWGSASLLNLDLSNKILLNAI  106

Query  573  QAFEHLRLRLGGSLQDQ  623
            +AF  L+LRLGG+LQD+
Sbjct  107  KAFSPLKLRLGGTLQDK  123



>gb|KCW81361.1| hypothetical protein EUGRSUZ_C02742 [Eucalyptus grandis]
Length=435

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  408  LLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAIQAFEH  587
            L I  TA ++ TD +YICAT+DWWP EKC+Y  C W  +++  LDL +     A++AF  
Sbjct  36   LFINGTASVAKTDDDYICATLDWWPPEKCDYGTCSWGRATLQTLDLKNTLLLNAVKAFSP  95

Query  588  LRLRLGGSLQDQ  623
            LR+R+GG+LQD+
Sbjct  96   LRIRIGGTLQDK  107



>ref|XP_002976895.1| hypothetical protein SELMODRAFT_105931 [Selaginella moellendorffii]
 gb|EFJ22005.1| hypothetical protein SELMODRAFT_105931 [Selaginella moellendorffii]
Length=505

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = +3

Query  393  IEHAELLIETTARISDTDANYICATIDWWPHEKCNYNQCPWESSSVLNLDLSHPFFAKAI  572
            ++   L I TT+ ++    N+ICAT+DWWP EKC+Y  C W  +S+LNLDL +P    A+
Sbjct  1    MQRVVLQINTTSPVARISENFICATLDWWPPEKCDYGYCSWGRASLLNLDLWNPRLVNAV  60

Query  573  QAFEHLRLRLGGSLQDQ  623
            +    L LRLGGSLQDQ
Sbjct  61   KGLSPLLLRLGGSLQDQ  77



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 846268560720