BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19594_g1_i1 len=1162 path=[53:0-185 239:186-716 @52@!:717-984
2396:985-985 1036:986-1161]

Length=1162
                                                                      Score     E

ref|XP_006355379.1|  PREDICTED: uncharacterized protein LOC102597885    171   1e-46   
ref|XP_004237404.1|  PREDICTED: uncharacterized protein LOC101263106    169   8e-46   
ref|XP_009770666.1|  PREDICTED: uncharacterized protein LOC104221318    166   2e-44   
ref|XP_009613812.1|  PREDICTED: uncharacterized protein LOC104106868    165   4e-44   
ref|XP_010321464.1|  PREDICTED: uncharacterized protein LOC101247326    164   4e-44   
ref|XP_006366535.1|  PREDICTED: uncharacterized protein LOC102592562    161   1e-42   
ref|XP_011090522.1|  PREDICTED: uncharacterized protein LOC105171189    127   1e-30   
gb|EYU31022.1|  hypothetical protein MIMGU_mgv1a019832mg                127   2e-30   
gb|EPS60132.1|  hypothetical protein M569_14673                         116   2e-26   
ref|XP_007047991.1|  Late embryogenesis abundant hydroxyproline-r...    108   2e-23   
ref|XP_007206701.1|  hypothetical protein PRUPE_ppa023782mg             101   2e-21   
ref|XP_003523826.1|  PREDICTED: uncharacterized protein LOC100790243    101   3e-21   
ref|XP_002533144.1|  conserved hypothetical protein                     101   3e-21   Ricinus communis
ref|XP_004500615.1|  PREDICTED: uncharacterized protein LOC101514274  99.0    2e-20   
ref|XP_003527913.1|  PREDICTED: uncharacterized protein LOC100816505  98.6    3e-20   
ref|XP_002513898.1|  conserved hypothetical protein                   98.2    3e-20   Ricinus communis
ref|XP_008234591.1|  PREDICTED: uncharacterized protein LOC103333518  98.6    4e-20   
ref|XP_002306315.1|  hydroxyproline-rich glycoprotein                 97.8    7e-20   Populus trichocarpa [western balsam poplar]
ref|XP_002306581.1|  hypothetical protein POPTR_0005s16920g           97.4    8e-20   Populus trichocarpa [western balsam poplar]
ref|XP_011030993.1|  PREDICTED: uncharacterized protein LOC105130269  95.5    4e-19   
ref|XP_010102585.1|  hypothetical protein L484_003960                 95.1    4e-19   
gb|ACU23534.1|  unknown                                               93.6    1e-18   Glycine max [soybeans]
gb|KDP46860.1|  hypothetical protein JCGZ_24069                       92.0    7e-18   
ref|XP_008345632.1|  PREDICTED: uncharacterized protein LOC103408570  91.3    1e-17   
ref|XP_008375147.1|  PREDICTED: uncharacterized protein LOC103438373  91.3    1e-17   
ref|XP_010926522.1|  PREDICTED: uncharacterized protein LOC105048772  90.9    2e-17   
ref|XP_004289320.1|  PREDICTED: uncharacterized protein LOC101306764  90.5    2e-17   
ref|XP_007226131.1|  hypothetical protein PRUPE_ppa014613mg           90.5    3e-17   
ref|XP_010664315.1|  PREDICTED: uncharacterized protein LOC104882481  89.7    4e-17   
ref|XP_006293421.1|  hypothetical protein CARUB_v10025210mg           89.4    9e-17   
ref|XP_009615539.1|  PREDICTED: uncharacterized protein LOC104108256  88.6    1e-16   
ref|XP_006580279.1|  PREDICTED: uncharacterized protein LOC102668552  87.4    2e-16   
gb|KHG11950.1|  hypothetical protein F383_17766                       87.4    3e-16   
ref|XP_006404673.1|  hypothetical protein EUTSA_v10000276mg           87.0    6e-16   
ref|XP_009112546.1|  PREDICTED: uncharacterized protein LOC103837908  86.7    6e-16   
ref|XP_010917110.1|  PREDICTED: uncharacterized protein LOC105041779  86.3    6e-16   
emb|CDX76941.1|  BnaC08g35270D                                        85.9    1e-15   
ref|XP_008219666.1|  PREDICTED: uncharacterized protein LOC103319851  85.9    1e-15   
ref|XP_009383601.1|  PREDICTED: uncharacterized protein LOC103971332  85.1    2e-15   
ref|XP_007159643.1|  hypothetical protein PHAVU_002G255000g           84.7    2e-15   
emb|CDX76942.1|  BnaC08g35280D                                        85.1    2e-15   
ref|XP_008782129.1|  PREDICTED: uncharacterized protein LOC103701746  84.7    3e-15   
ref|XP_009787573.1|  PREDICTED: uncharacterized protein LOC104235484  83.2    8e-15   
ref|XP_009140328.1|  PREDICTED: uncharacterized protein LOC103864325  83.6    9e-15   
ref|XP_008445591.1|  PREDICTED: uncharacterized protein LOC103488571  82.0    1e-14   
ref|XP_010510819.1|  PREDICTED: uncharacterized protein LOC104787024  82.4    2e-14   
emb|CDY13776.1|  BnaA09g42780D                                        83.6    2e-14   
ref|XP_002878602.1|  hypothetical protein ARALYDRAFT_900669           82.0    2e-14   
ref|XP_010531390.1|  PREDICTED: uncharacterized protein LOC104807...  82.0    3e-14   
ref|XP_010531389.1|  PREDICTED: uncharacterized protein LOC104807...  82.0    3e-14   
gb|ABK28506.1|  unknown                                               82.0    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008795594.1|  PREDICTED: uncharacterized protein LOC103711288  82.0    3e-14   
ref|NP_179808.1|  hydroxyproline-rich glycoprotein-like protein       81.6    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006586382.1|  PREDICTED: uncharacterized protein LOC102661744  81.3    4e-14   
ref|XP_010429134.1|  PREDICTED: uncharacterized protein LOC104713661  81.6    4e-14   
gb|KDO56608.1|  hypothetical protein CISIN_1g041440mg                 80.5    6e-14   
ref|XP_010472212.1|  PREDICTED: uncharacterized protein LOC104751860  80.9    7e-14   
ref|XP_010416974.1|  PREDICTED: uncharacterized protein LOC104702758  80.9    8e-14   
ref|XP_006428168.1|  hypothetical protein CICLE_v10027435mg           80.5    9e-14   
ref|XP_009339740.1|  PREDICTED: uncharacterized protein LOC103931936  80.5    2e-13   
gb|KFK32835.1|  hypothetical protein AALP_AA6G293300                  79.7    2e-13   
ref|XP_008375273.1|  PREDICTED: uncharacterized protein LOC103438483  79.0    3e-13   
gb|KDP22637.1|  hypothetical protein JCGZ_02795                       78.2    3e-13   
ref|XP_011043567.1|  PREDICTED: uncharacterized protein LOC105138991  77.8    4e-13   
ref|XP_010064203.1|  PREDICTED: uncharacterized protein LOC104451180  77.8    7e-13   
ref|XP_004504122.1|  PREDICTED: uncharacterized protein LOC101495472  77.0    1e-12   
ref|XP_009615252.1|  PREDICTED: uncharacterized protein LOC104108002  74.3    1e-12   
ref|XP_010444899.1|  PREDICTED: uncharacterized protein LOC104727495  77.0    1e-12   
ref|XP_010446533.1|  PREDICTED: uncharacterized protein LOC104729297  77.0    1e-12   
ref|XP_009369674.1|  PREDICTED: uncharacterized protein LOC103959062  77.0    1e-12   
ref|XP_007136234.1|  hypothetical protein PHAVU_009G029700g           76.3    2e-12   
ref|XP_010417852.1|  PREDICTED: uncharacterized protein LOC104703524  76.3    2e-12   
ref|NP_197612.1|  late embryogenesis abundant hydroxyproline-rich...  76.3    2e-12   Arabidopsis thaliana [mouse-ear cress]
gb|KEH20854.1|  late embryogenesis abundant protein                   75.9    3e-12   
ref|XP_010521605.1|  PREDICTED: uncharacterized protein LOC104800491  75.5    3e-12   
ref|XP_010064764.1|  PREDICTED: uncharacterized protein LOC104451904  75.5    4e-12   
ref|NP_565634.1|  late embryogenesis abundant hydroxyproline-rich...  75.5    4e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CDX77067.1|  BnaC04g38620D                                        75.1    5e-12   
ref|XP_004491178.1|  PREDICTED: uncharacterized protein LOC101511...  75.1    6e-12   
gb|KEH34902.1|  late embryogenesis abundant protein                   74.7    6e-12   
gb|KDP42899.1|  hypothetical protein JCGZ_23841                       74.7    7e-12   
ref|XP_004301318.1|  PREDICTED: uncharacterized protein LOC101291153  73.9    2e-11   
ref|XP_006294822.1|  hypothetical protein CARUB_v10023872mg           73.2    2e-11   
ref|XP_009140759.1|  PREDICTED: uncharacterized protein LOC103864750  73.2    3e-11   
ref|XP_002879043.1|  hypothetical protein ARALYDRAFT_481588           73.2    3e-11   
ref|XP_002866881.1|  hypothetical protein ARALYDRAFT_490757           73.2    3e-11   
ref|XP_010473096.1|  PREDICTED: uncharacterized protein LOC104752606  73.2    3e-11   
emb|CDY48196.1|  BnaA04g15600D                                        72.8    3e-11   
ref|XP_006290054.1|  hypothetical protein CARUB_v10003689mg           72.8    4e-11   
ref|XP_004150661.1|  PREDICTED: uncharacterized protein LOC101202802  72.0    4e-11   
emb|CDX88825.1|  BnaA03g08240D                                        72.0    9e-11   
ref|XP_010526649.1|  PREDICTED: uncharacterized protein LOC104804156  71.6    9e-11   
ref|XP_006826947.1|  hypothetical protein AMTR_s00010p00185810        70.5    2e-10   
ref|XP_010646788.1|  PREDICTED: uncharacterized protein LOC104878321  70.5    2e-10   
ref|XP_006360305.1|  PREDICTED: uncharacterized protein LOC102595816  70.9    2e-10   
ref|XP_010520485.1|  PREDICTED: protein YLS9                          70.5    2e-10   
ref|XP_009131838.1|  PREDICTED: uncharacterized protein LOC103856481  70.9    2e-10   
gb|KFK32426.1|  hypothetical protein AALP_AA6G240400                  69.7    3e-10   
ref|XP_010557487.1|  PREDICTED: uncharacterized protein LOC104826475  70.5    3e-10   
ref|XP_004501974.1|  PREDICTED: uncharacterized protein LOC101512221  70.1    3e-10   
ref|XP_002871969.1|  hypothetical protein ARALYDRAFT_489023           69.3    6e-10   
ref|XP_010269329.1|  PREDICTED: uncharacterized protein LOC104606021  68.9    7e-10   
ref|XP_006836205.1|  hypothetical protein AMTR_s00101p00083450        68.9    9e-10   
ref|XP_004144152.1|  PREDICTED: protein NDR1-like                     68.2    1e-09   
ref|XP_002313615.1|  harpin-induced family protein                    68.2    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006400683.1|  hypothetical protein EUTSA_v10015699mg           68.2    2e-09   
ref|XP_007016676.1|  Late embryogenesis abundant (LEA) hydroxypro...  67.4    2e-09   
emb|CDY09100.1|  BnaA02g05260D                                        67.8    3e-09   
ref|XP_009126502.1|  PREDICTED: uncharacterized protein LOC103851399  67.4    4e-09   
ref|XP_009350715.1|  PREDICTED: protein YLS9-like                     67.0    4e-09   
emb|CDX83252.1|  BnaA03g22540D                                        66.2    5e-09   
ref|XP_009386952.1|  PREDICTED: uncharacterized protein LOC103973972  65.9    7e-09   
ref|XP_008665894.1|  PREDICTED: uncharacterized protein LOC103644471  66.2    7e-09   
ref|XP_009133912.1|  PREDICTED: uncharacterized protein LOC103858334  65.5    9e-09   
emb|CDY09101.1|  BnaA02g05270D                                        66.2    9e-09   
ref|XP_008359184.1|  PREDICTED: protein NDR1-like                     65.5    1e-08   
ref|XP_009126503.1|  PREDICTED: uncharacterized protein LOC103851400  65.5    1e-08   
ref|XP_003519484.1|  PREDICTED: uncharacterized protein LOC100789647  65.1    1e-08   
ref|XP_009341739.1|  PREDICTED: protein YLS9-like                     65.1    2e-08   
ref|XP_009413864.1|  PREDICTED: uncharacterized protein LOC103995083  64.3    2e-08   
ref|XP_008366385.1|  PREDICTED: protein NDR1-like                     64.7    2e-08   
emb|CDY38543.1|  BnaC03g26540D                                        64.3    2e-08   
ref|XP_011043555.1|  PREDICTED: protein YLS9-like                     64.3    3e-08   
ref|XP_010031644.1|  PREDICTED: protein YLS9                          63.9    4e-08   
ref|XP_008451090.1|  PREDICTED: protein YLS9-like                     63.2    5e-08   
ref|NP_001275940.1|  protein NDR1-like                                63.2    7e-08   
ref|XP_008360396.1|  PREDICTED: uncharacterized protein LOC103424098  62.8    7e-08   
ref|XP_002879057.1|  predicted protein                                62.4    8e-08   
ref|XP_003617084.1|  Avr9/Cf-9 rapidly elicited protein               62.4    9e-08   
ref|XP_010689396.1|  PREDICTED: uncharacterized protein LOC104903108  63.2    9e-08   
ref|XP_008343664.1|  PREDICTED: uncharacterized protein LOC103406463  60.8    1e-07   
emb|CDP19130.1|  unnamed protein product                              62.8    1e-07   
ref|XP_010424211.1|  PREDICTED: uncharacterized protein LOC104709267  62.0    2e-07   
ref|XP_002468356.1|  hypothetical protein SORBIDRAFT_01g044420        61.6    2e-07   Sorghum bicolor [broomcorn]
ref|XP_010904739.1|  PREDICTED: protein YLS9-like                     61.6    2e-07   
ref|XP_007205722.1|  hypothetical protein PRUPE_ppa010043mg           60.8    4e-07   
ref|XP_008231176.1|  PREDICTED: uncharacterized protein LOC103330379  60.8    4e-07   
ref|XP_009788478.1|  PREDICTED: protein YLS9-like                     60.8    4e-07   
ref|XP_003564453.1|  PREDICTED: protein YLS9-like                     60.5    7e-07   
emb|CDX70963.1|  BnaC03g10470D                                        60.5    8e-07   
ref|XP_009390664.1|  PREDICTED: protein YLS9-like                     59.3    1e-06   
ref|XP_006408666.1|  hypothetical protein EUTSA_v10002079mg           58.5    2e-06   
ref|XP_004291724.1|  PREDICTED: uncharacterized protein LOC101301071  57.4    3e-06   
gb|KFK26363.1|  hypothetical protein AALP_AA8G238900                  58.2    3e-06   
ref|NP_001275943.1|  uncharacterized protein LOC102589097             57.8    4e-06   
ref|XP_010243135.1|  PREDICTED: protein YLS9-like                     57.8    4e-06   
ref|XP_010454436.1|  PREDICTED: uncharacterized protein LOC104736193  57.8    5e-06   
ref|XP_009628620.1|  PREDICTED: protein YLS9                          57.4    6e-06   
ref|XP_004228470.1|  PREDICTED: protein YLS9                          57.0    7e-06   
ref|XP_004246717.1|  PREDICTED: protein YLS9-like                     57.0    8e-06   
ref|XP_003545485.1|  PREDICTED: uncharacterized protein LOC100800...  56.6    1e-05   
ref|XP_009779546.1|  PREDICTED: protein YLS9                          56.6    1e-05   
ref|XP_010093832.1|  hypothetical protein L484_022546                 55.8    2e-05   
ref|XP_008660458.1|  PREDICTED: uncharacterized protein LOC103639486  55.5    3e-05   
ref|XP_008786759.1|  PREDICTED: uncharacterized protein LOC103704991  55.1    3e-05   
dbj|BAK05887.1|  predicted protein                                    55.1    4e-05   
ref|XP_007141573.1|  hypothetical protein PHAVU_008G207300g           55.1    4e-05   
ref|XP_010493233.1|  PREDICTED: uncharacterized protein LOC104770498  55.1    4e-05   
gb|AFK38883.1|  unknown                                               54.7    4e-05   
gb|KEH35108.1|  late embryogenesis abundant hydroxyproline-rich g...  54.7    4e-05   
ref|XP_006470441.1|  PREDICTED: protein YLS9-like                     53.9    6e-05   
ref|XP_004165481.1|  PREDICTED: uncharacterized protein LOC101223891  53.5    6e-05   
ref|XP_004149664.1|  PREDICTED: uncharacterized protein LOC101202799  53.9    7e-05   
ref|XP_006644886.1|  PREDICTED: uncharacterized protein LOC102721597  54.3    7e-05   
ref|XP_010922964.1|  PREDICTED: protein YLS9                          53.9    8e-05   
gb|KHN09129.1|  hypothetical protein glysoja_025590                   51.6    2e-04   
gb|KDO66384.1|  hypothetical protein CISIN_1g025262mg                 52.8    2e-04   
gb|ACJ85044.1|  unknown                                               51.2    2e-04   Medicago truncatula
ref|XP_003561956.1|  PREDICTED: uncharacterized protein LOC100843022  52.8    2e-04   
ref|XP_007018809.1|  Uncharacterized protein TCM_034934               49.3    5e-04   
tpg|DAA57165.1|  TPA: NHL25                                           51.2    7e-04   
ref|XP_006384760.1|  harpin-induced family protein                    50.8    8e-04   



>ref|XP_006355379.1| PREDICTED: uncharacterized protein LOC102597885 [Solanum tuberosum]
Length=259

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 120/264 (45%), Positives = 159/264 (60%), Gaps = 23/264 (9%)
 Frame = -2

Query  843  MDGRVSPV-GGDGRKGDPALTSLTFSLPVQPGEAPE-TYVVQIPRDQVYRVPPPENAKIV  670
            M+ R  P  GG  R    + TSL  SL   P  + + TYVVQIPRDQVYRVPPPENAKIV
Sbjct  1    MEERSPPAAGGKARNLLSSATSLRLSL--TPARSQDHTYVVQIPRDQVYRVPPPENAKIV  58

Query  669  EGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYK  490
            E +   R  + +  R   CC W    L+++GI IG I+  ++ MYTPKSP+FSI  + +K
Sbjct  59   ENH---RQPDTQKKRKCTCCCWIFSALLLIGIAIGIIMLIVHTMYTPKSPEFSIINVHFK  115

Query  489  -----------KSARHPTFHISLHVHNINQRMKVSF--GDGGKSSLVFKNRVIGKGKYps  349
                       KS   P F I L + NIN+RM+ SF  GD G ++L FKN  IG+GKY +
Sbjct  116  NVTQPSNGQKNKSHPVPQFEIDLKIVNINERMEASFGKGDNGIAALNFKNHEIGQGKYTA  175

Query  348  vsvkpkkSTDVDLKMVA-KLSGDLRKELNGRRKKL-MALKISVPMEISSWAKGKKKDISI  175
            +S +PK ST+    + A KL  D +K LN  +K + M L I+ PMEI+SWAK  KK++++
Sbjct  176  ISQEPKDSTNSQFNLDAGKLPADFQKSLNDDKKAIPMTLIINAPMEITSWAKTLKKEVTV  235

Query  174  KCVFKVGSL-AKSTDLSEECQADF  106
             C F V S+  KS   SE+C+ DF
Sbjct  236  TCDFDVESVKGKSKIKSEDCKTDF  259



>ref|XP_004237404.1| PREDICTED: uncharacterized protein LOC101263106 [Solanum lycopersicum]
Length=255

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 119/260 (46%), Positives = 153/260 (59%), Gaps = 19/260 (7%)
 Frame = -2

Query  843  MDGRVSPV-GGDGRKGDPALTSLTFSLPVQPGEAPE-TYVVQIPRDQVYRVPPPENAKIV  670
            M+ R  P  GG  R    + TSL  SL   P  + + TYVVQIPRDQVYRVPPPENAKIV
Sbjct  1    MEERSPPAAGGKARNLLSSATSLRLSL--TPARSTDHTYVVQIPRDQVYRVPPPENAKIV  58

Query  669  EGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYK  490
            E +++  +  K   R   CC W    L++ GI IG IV  +NAMYTPKSP+FSI  + +K
Sbjct  59   ENHRQPETQKK---RKCTCCCWIFSALLLTGIAIGIIVLIVNAMYTPKSPEFSIMNVHFK  115

Query  489  -------KSARHPTFHISLHVHNINQRMKVSF--GDGGKSSLVFKNRVIGKGKYpsvsvk  337
                     +    F I L + NIN+RM  SF  GD G ++L F N  IG GKY ++S K
Sbjct  116  NVTQPQNNKSHTQQFEIDLKIVNINERMDTSFGKGDHGIATLNFNNHEIGHGKYTAISQK  175

Query  336  pkkSTDVDLKMVA-KLSGDLRKELNGRRKKL-MALKISVPMEISSWAKGKKKDISIKCVF  163
            PK ST+    + A KL  D +K LN  +K + M L +  PMEI+SW K  KKD+++ C F
Sbjct  176  PKDSTNSQFNLDAGKLPADFQKTLNDDKKAIPMTLTVKAPMEITSWTKTLKKDVTVTCDF  235

Query  162  KVGSL-AKSTDLSEECQADF  106
             V S+  KS   SE+C+ DF
Sbjct  236  DVQSVKGKSMIKSEDCKTDF  255



>ref|XP_009770666.1| PREDICTED: uncharacterized protein LOC104221318 [Nicotiana sylvestris]
Length=267

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 158/270 (59%), Gaps = 27/270 (10%)
 Frame = -2

Query  843  MDGRVSPVGGD--GRKGDPALTSLTFSLPVQPGEAP-ETYVVQIPRDQVYRVPPPENAKI  673
            M+ R  P  G+  G+  +   ++ +  L + P  +P +TYVVQIPRDQVYRVPPPENA+I
Sbjct  1    MEERSPPAAGNVNGKARNLLSSTTSLRLSLTPSRSPDQTYVVQIPRDQVYRVPPPENARI  60

Query  672  VEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQY  493
            VE +++  S  K       CC W L  L+ L I+IG IV  I A+YTPK P+FSI  I  
Sbjct  61   VENHRKPDSQKKNKC---TCCCWILSVLIGLAIMIGNIVLIIRALYTPKCPEFSITNIHI  117

Query  492  KKSAR---------------HPTFHISLHVHNINQRMKVSFGDG--GKSSLVFKNRVIGK  364
            K                   HP F I L + N N+RM V+FG G  GK++L+FK   IG+
Sbjct  118  KNFTHPSNGHGQNNNIHPQPHPQFEIELKIVNENERMDVAFGKGNNGKATLIFKKHEIGQ  177

Query  363  GKYpsvsvkpkkSTDVDLKM-VAKLSGDLRKELNGRRKK-LMALKISVPMEISSWAKGKK  190
            GKYPS+S KPK ST+V   + V KL+GD+ K L   +K  +M L +  P+EI+SWAK  K
Sbjct  178  GKYPSISQKPKDSTNVHFNLDVGKLAGDIEKGLEDDKKPIMMTLSVHAPLEITSWAKDLK  237

Query  189  KDISIKCVFKVGSLA--KSTDLSEECQADF  106
            K++ + C F V SL   KS   +E CQ DF
Sbjct  238  KNLIVTCDFDVESLMTNKSKIKAEVCQTDF  267



>ref|XP_009613812.1| PREDICTED: uncharacterized protein LOC104106868 [Nicotiana tomentosiformis]
Length=267

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 118/270 (44%), Positives = 159/270 (59%), Gaps = 27/270 (10%)
 Frame = -2

Query  843  MDGRVSPVGGD--GRKGDPALTSLTFSLPVQPGEAP-ETYVVQIPRDQVYRVPPPENAKI  673
            M+ R  P  GD  G+  +P  ++ +  L + P  +P +TYVVQIPRDQVYRVPPPENA+I
Sbjct  1    MEERSPPPAGDVNGKARNPLSSATSLRLSLTPSRSPDQTYVVQIPRDQVYRVPPPENARI  60

Query  672  VEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQY  493
            VE +++  S  K       CC   L  L+ L I+IG +V  I A+YTPK P+FSI  I +
Sbjct  61   VENHRKPDSQKKNKC---TCCCLILAVLLGLAIMIGIVVLIIRALYTPKCPEFSITNIHF  117

Query  492  KKSAR---------------HPTFHISLHVHNINQRMKVSFGDG--GKSSLVFKNRVIGK  364
            K                   +P F + L + N+N+RM V+FG G  GK++L+FK   IG+
Sbjct  118  KNVTHPSNGHGQKNNIHPQPYPQFEMELKIVNVNERMDVAFGKGNNGKAALIFKKHEIGQ  177

Query  363  GKYpsvsvkpkkSTDVDLKM-VAKLSGDLRKELNGRRKK-LMALKISVPMEISSWAKGKK  190
            GKYPS+S KPK ST+V   + V KL+GD  K L   +K  +M L +  P+EI+SWAK  K
Sbjct  178  GKYPSISQKPKDSTNVHFNLDVGKLAGDTEKGLEVDKKPIMMTLSVHAPLEITSWAKDLK  237

Query  189  KDISIKCVFKVGSLA--KSTDLSEECQADF  106
            K++ + C F V SL   KS   SE CQ DF
Sbjct  238  KNLIVTCDFDVESLMTNKSKIKSEICQTDF  267



>ref|XP_010321464.1| PREDICTED: uncharacterized protein LOC101247326 [Solanum lycopersicum]
Length=262

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 114/265 (43%), Positives = 156/265 (59%), Gaps = 22/265 (8%)
 Frame = -2

Query  843  MDGRVSPVGGDGRKGDPALTSLT-FSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVE  667
            M+GR +P+ G+G+K    L+S T F L      + +T+VVQIP+DQVYRVPPPENA IVE
Sbjct  1    MEGR-TPLSGNGKKSINKLSSATSFRLASPSDRSSDTFVVQIPKDQVYRVPPPENATIVE  59

Query  666  GYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYK-  490
                  +   K    R+CC W L+ +++ GI+IG I+  I+ +Y PK PKFS+A++ +K 
Sbjct  60   NRTPKDNVQSKRKMGRRCC-WTLLVILIFGIIIGIIIAIIHMLYIPKCPKFSVASVHFKN  118

Query  489  ----------KSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsv  340
                      +  +HP F   L V+N+N+RM VSFGD GK++ V+K   IG+GKYPS S 
Sbjct  119  VTDPNNRDQGQRNQHPKFEFGLKVNNVNERMDVSFGD-GKTNFVYKKYDIGQGKYPSNSQ  177

Query  339  kpkkSTDVDLKM----VAKLSGDLRKELNGRRKK--LMALKISVPMEISSWAKGKKKDIS  178
            K   + ++ L +      KL  DL K L    KK  +M+L I VPMEI SW K   KD++
Sbjct  178  KGLGTNNIHLNLDVGSNGKLPSDLLKALEDENKKIVIMSLIIHVPMEIKSWVKNLNKDLT  237

Query  177  IKCVFKVGSLA-KSTDLSEECQADF  106
            I C F V  L  KS  +  EC  DF
Sbjct  238  ITCDFDVEDLTKKSKIMPNECITDF  262



>ref|XP_006366535.1| PREDICTED: uncharacterized protein LOC102592562 [Solanum tuberosum]
Length=262

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 110/265 (42%), Positives = 154/265 (58%), Gaps = 22/265 (8%)
 Frame = -2

Query  843  MDGRVSPVGGDGRKGDPALTSLT-FSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVE  667
            M+GR +P+ G+G+K    L+S T   L        +T+VVQIP+DQVYRVPPPENAKIVE
Sbjct  1    MEGR-TPLTGNGKKSINKLSSATSLRLASHSDRTSDTFVVQIPKDQVYRVPPPENAKIVE  59

Query  666  GYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYK-  490
                  +   K    R+CC W L+ +++ GI+IG  +  I+ +Y PK PKFS+  + +K 
Sbjct  60   NRTPKDNVQSKRKIGRRCC-WTLLGILIFGIVIGITIAIIHMLYIPKCPKFSVVNVHFKN  118

Query  489  ----------KSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsv  340
                      +  +HP F   L V+N+N+RM VSFGD GK++ V+K   IG+GKYPS S 
Sbjct  119  VTDPNNRDQGQKNQHPKFEFDLKVNNVNERMDVSFGD-GKTNFVYKKHDIGQGKYPSNSQ  177

Query  339  kpkkSTDVDLKM----VAKLSGDLRKELNGRRKK--LMALKISVPMEISSWAKGKKKDIS  178
            +   + ++ L +      KL  DL K +    KK  +M+L I VPMEI SW K  KK+++
Sbjct  178  RGLGTNNIHLNLDVGSNGKLPSDLLKTIEDENKKIVIMSLMIHVPMEIKSWIKNLKKNLT  237

Query  177  IKCVFKVGSLA-KSTDLSEECQADF  106
            I C F V +L  KS  +  EC  DF
Sbjct  238  ITCDFDVENLTKKSKIMPNECITDF  262



>ref|XP_011090522.1| PREDICTED: uncharacterized protein LOC105171189 [Sesamum indicum]
Length=250

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/218 (40%), Positives = 128/218 (59%), Gaps = 11/218 (5%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYVVQIPRDQ+YRVPPPE+A+IVE ++   S+ K   R    C  F+  +VV  I+   +
Sbjct  31   TYVVQIPRDQIYRVPPPEHARIVEDHKRNSSSKKTGGR-GTVCRIFIPIVVVSVIITVAV  89

Query  558  vgsINAMYTPKSPKFSIAAIQYKK----SARHPTFHISLHVHNINQRMKVSFGDGG-KSS  394
             G    MY  KSPKF++  IQ K       R P + ++L  +N N RM +S+  GG K +
Sbjct  90   YGLRYTMYDAKSPKFTVTGIQAKNLEGSGRRSPHYDVTLLANNPNTRMSISYLQGGKKGT  149

Query  393  LVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSG--DLRKEL-NGRRKKLMALKISVP  223
            L  KN  IGKG    +  +   ++ VD+ +V   +G  D++K L +G   K M L + VP
Sbjct  150  LALKNLEIGKGGIQPMVKQESGTSAVDVHVVLSGNGAADIKKRLKDGTSVKSMVLNVVVP  209

Query  222  MEISSWAKGKKKDISIKCVFKV-GSL-AKSTDLSEECQ  115
            +EI+SW + ++KD+++ C FKV  SL +K+   S+EC 
Sbjct  210  VEITSWVRNERKDLNVTCEFKVRNSLTSKAKIASQECN  247



>gb|EYU31022.1| hypothetical protein MIMGU_mgv1a019832mg, partial [Erythranthe 
guttata]
Length=229

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/210 (36%), Positives = 119/210 (57%), Gaps = 17/210 (8%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligt  562
            ETYVVQIPRDQ+YRVPPPE+A I+E ++   S  +K  R R  C+  L   ++  ++   
Sbjct  21   ETYVVQIPRDQIYRVPPPEHALIIESHKRNSSDQQKTCR-RPICWILLPVFLLFAVVFAA  79

Query  561  ivgsINAMYTPKSPKFSIAAIQYKK----------SARHPTFHISLHVHNINQRMKVSFG  412
            ++ +   +YTP  P+F++  +  +           S   P F ++L   N N RM VS+ 
Sbjct  80   VMIARATLYTPVPPEFTVTRVMGRNLAPPPKGGGGSHHQPEFDVTLRAKNPNARMSVSYL  139

Query  411  DGGKSSLVFKNRVIGKGKYpsvsvkpk-kSTDVDLKMV-----AKLSGDLRKELNGRRKK  250
             GG++SLVFK++ IGKG     +V+ +    DVD  +V     A L+ ++ K L+G  +K
Sbjct  140  AGGQASLVFKSKKIGKGAAVRSAVRQEPGGGDVDFPVVLAGNGASLTAEIEKSLDGAAEK  199

Query  249  LMALKISVPMEISSWAKGKKKDISIKCVFK  160
             M L+I    E++SWA+ +++D+ I C  K
Sbjct  200  SMVLQIQAAAEMNSWARNERRDLKINCELK  229



>gb|EPS60132.1| hypothetical protein M569_14673 [Genlisea aurea]
Length=255

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 113/198 (57%), Gaps = 6/198 (3%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligt  562
            ETYVVQIP+DQ+YRVPPPE+A+IVE Y   +S+ +  TR +  CF  +   ++L +    
Sbjct  41   ETYVVQIPKDQIYRVPPPEHARIVEEYSHRKSSQQNKTRRKSLCFGVIPAALLLLVAALI  100

Query  561  ivgsINA-MYTPKSPKFSIAAIQYKK--SARHPTFHISLHVHNINQRMKVSFGDGGKSSL  391
             V ++ A +Y P+ P F++ +++  +    + P   I+++  N N RM +S+   GKS+L
Sbjct  101  AVLAVRATVYDPRPPNFTLTSVRATRIHPGKKPQLDITINAKNPNPRMSISY-KSGKSAL  159

Query  390  VFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVPMEIS  211
            +FKN+ IG+G +P    +   +      +   LS +         ++ M L +S+PMEIS
Sbjct  160  IFKNKQIGQGSFPLSPAETAPNAATVFHL--SLSRNDVVSPAAAAERSMKLNLSIPMEIS  217

Query  210  SWAKGKKKDISIKCVFKV  157
            SW + +K  + I C F +
Sbjct  218  SWIRTQKMTLKISCDFTL  235



>ref|XP_007047991.1| Late embryogenesis abundant hydroxyproline-rich glycoprotein 
family, putative isoform 1 [Theobroma cacao]
 ref|XP_007047992.1| Late embryogenesis abundant hydroxyproline-rich glycoprotein 
family, putative isoform 1 [Theobroma cacao]
 gb|EOX92148.1| Late embryogenesis abundant hydroxyproline-rich glycoprotein 
family, putative isoform 1 [Theobroma cacao]
 gb|EOX92149.1| Late embryogenesis abundant hydroxyproline-rich glycoprotein 
family, putative isoform 1 [Theobroma cacao]
Length=270

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/269 (31%), Positives = 146/269 (54%), Gaps = 27/269 (10%)
 Frame = -2

Query  843  MDGRVSPVGGDGR----KGDPALTS-------LTFSLPVQPGEAPETYVVQIPRDQVYRV  697
            M+ RV+P   D +    + +P  ++       L   L   P     TYVVQ+P+DQ+YRV
Sbjct  1    MEERVAPSAEDSQWQSSRPEPTPSTNNNDDDDLYLQLARPPSSLLATYVVQVPKDQIYRV  60

Query  696  PPPENAKIVEGYQEMRSTNKKDTRLRKC---CFWFlvplvvlgiligtivgsINAMYTPK  526
            PPPENA IVE Y++     K   R R C     W  V LVV+G+++G  +  +   +TPK
Sbjct  61   PPPENALIVESYRQAAGPAK--NRKRTCFKYLIWIAVVLVVIGVMVGVALKILYDSFTPK  118

Query  525  SPKFSIAAIQYKKSARHPT-FHISLHVHNINQRMKVSFGD-GGKSSLVFKNRVIGKGKYp  352
            +P FS++ +Q KK   HP  + ++L VHN N++M + +G     + L+F  + +G G++P
Sbjct  119  APVFSVSMLQVKKFTDHPPKYDVTLKVHNPNEKMGIKYGSVDDDAKLIFWTKTLGAGQFP  178

Query  351  svsvkpkkSTDVDLKMVA----KLSGDLRKELNGRRKK---LMALKISVPMEISSWA-KG  196
            S+      S  V +K++      +  ++++ +N ++ K    +ALK + P+ ++    K 
Sbjct  179  SLYQNSGDSNVVHVKLIGPEDQPVPLNIQRSMNDKKPKHQIFLALKFNSPLLLNVGVFKM  238

Query  195  KKKDISIKCVFKVGSLAK-STDLSEECQA  112
              +D+ ++C F+V ++ + S  LS++C  
Sbjct  239  WSRDMDVECKFRVNTMGEGSKILSQDCNT  267



>ref|XP_007206701.1| hypothetical protein PRUPE_ppa023782mg, partial [Prunus persica]
 gb|EMJ07900.1| hypothetical protein PRUPE_ppa023782mg, partial [Prunus persica]
Length=244

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/245 (30%), Positives = 125/245 (51%), Gaps = 18/245 (7%)
 Frame = -2

Query  795  PALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRK  616
            P    +  + P  PG A  TYV+QIP+DQ+YRVPPPENA IVE +++     +K      
Sbjct  1    PQTQIVPLAPPPFPGAA--TYVIQIPKDQIYRVPPPENALIVERHRKPEKQKQKSLCCGA  58

Query  615  CCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQY--------KKSARHPTFHI  460
             C      L  + ++IG  + +++    PK P FSI  +               HP + +
Sbjct  59   RCLVIGAILFFICLVIGITLLALSLTKKPKEPTFSITHVHVKNPKSKSSSGKNSHPGYEV  118

Query  459  SLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LS  289
            S+ V N N+   + + + G +SL++K + +GKGK+P  +     ST V L +      L 
Sbjct  119  SMKVKNPNEH-GIDYANSGGASLIYKEKTLGKGKFPLKNQGGDDSTAVKLVLDGSKGPLP  177

Query  288  GDLRKELNGRRKKL---MALKISVPMEISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEE  121
             D++K +     ++   +ALK+ + +++  + K    D  ++C FKV +L K T  L ++
Sbjct  178  RDVKKSMEDTDSEVRVSLALKMDLSVKVKGFIKTWNMDTEVECHFKVSTLGKGTRVLDQK  237

Query  120  CQADF  106
            C+A+F
Sbjct  238  CEAEF  242



>ref|XP_003523826.1| PREDICTED: uncharacterized protein LOC100790243 [Glycine max]
Length=255

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/225 (31%), Positives = 120/225 (53%), Gaps = 11/225 (5%)
 Frame = -2

Query  756  PGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTR-LRKCCFWFlvplvvl  580
            P   P TYVVQ+P+DQVYRVPPPENA+I E +++      K +R    C  +F++  V+L
Sbjct  29   PDFNPGTYVVQVPKDQVYRVPPPENARIAESHKKAPPKAAKTSRCCLFCVLFFIIFFVLL  88

Query  579  giligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGK  400
             +L   + G  + + TPK P+FSI   +  ++  HP + ++L VHN+N  + VS+ + G 
Sbjct  89   ILLGAVLGGLFSMLLTPKDPQFSITRFKVVETKPHPKYDVTLEVHNLNSDVGVSYKNKGH  148

Query  399  SSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LSGDLRKELNGRRKKL-----M  244
             SL  + + +  G YPS +      T   + + +    L  ++ + +   +KK+     +
Sbjct  149  VSLSLRRQEVASGAYPSFNQDAHDRTTFGVTLTSSKVGLPKEVEESVTNDKKKVNVTFSL  208

Query  243  ALKISVPMEISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQA  112
            A+     M++     G  K   + C  K+ +LAK+T  LS++C+ 
Sbjct  209  AIHALARMKMGLLRSGTMK-FDVTCNVKLDTLAKTTQVLSQQCET  252



>ref|XP_002533144.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29240.1| conserved hypothetical protein [Ricinus communis]
Length=277

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 121/229 (53%), Gaps = 25/229 (11%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligt  562
            ETYV+QIP++Q++ VPPPENA I E Y+   +T K   R R  C       VV   +IG 
Sbjct  56   ETYVIQIPKEQIFSVPPPENAIIAERYRNPETT-KSPRRKRLLCAII--TFVVFVAMIGL  112

Query  561  ivgsINAMYTPKSPKFSIAAIQ--------YKKSARHPTFHISLHVHNINQRMKVSFGDG  406
             +G+++ ++ P+ P FSI  +         + K   H  + ISL   N N RM+ S+G+ 
Sbjct  113  TIGALHVVFNPEVPSFSIVNVHLINNPHSSHHKKNTHIGYEISLSAKNKNARMQNSYGN-  171

Query  405  GKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LSGDLRKELN---GRRKKLM  244
            G ++L+FK   IG GK+P        S  + L + +    L  D+ + +    G+R   +
Sbjct  172  GHTTLLFKGHKIGTGKFPEFGQDADSSKKIQLSLTSSNGALPHDIEESIGDEKGKRHVTL  231

Query  243  ALKISVPMEISSWAKGKKKDISIKCVFKVGSL---AKSTDLSEECQADF  106
            +LK++ P+++  W+    K I + C FKVGSL    K+  LS+ CQ + 
Sbjct  232  SLKMNFPLKMKLWS----KVIDVVCNFKVGSLGSAGKNNVLSQHCQTNI  276



>ref|XP_004500615.1| PREDICTED: uncharacterized protein LOC101514274 [Cicer arietinum]
Length=251

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 124/233 (53%), Gaps = 20/233 (9%)
 Frame = -2

Query  771  SLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvp  592
            S P  P   P TYVVQ+P+DQ+YRVPPPENA+I E +   RS+  K+T    C  W  V 
Sbjct  23   SKPKLPDIGPGTYVVQVPKDQIYRVPPPENARIAELH---RSSPAKETNRSHC--WCFVF  77

Query  591  lvvlgiligtivgsINAMY----TPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMK  424
            +++  +++  I G +  ++    TPK P+FSI       S  HP + I+L VHN N  + 
Sbjct  78   IIIFLVVVIIIGGLLGGLFSIVLTPKDPRFSIQHFLL-HSKPHPQYKITLEVHNPNSNVG  136

Query  423  VSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKM---VAKLSGDLRKELNGRRK  253
            + + +GG  SL  K + I    YP+ S     ST+ ++ +    +KL  ++ + +   +K
Sbjct  137  ILYKEGGDVSLSLKRQKIASSAYPTFSQDRHNSTEFEITLKSSTSKLPKEVEESMTNDKK  196

Query  252  KL-----MALKISVPMEISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQA  112
            ++     +++ +   M++     G  K   + C  KV +LA+ST  +S++CQ 
Sbjct  197  RVHVTFSLSIHVQAKMKLGLLHSGSMK-YDVSCQVKVDTLAQSTHVVSQQCQT  248



>ref|XP_003527913.1| PREDICTED: uncharacterized protein LOC100816505 [Glycine max]
Length=259

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 71/230 (31%), Positives = 121/230 (53%), Gaps = 18/230 (8%)
 Frame = -2

Query  756  PGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCC----FWFlvpl  589
            P   P TYVVQ+P+DQVYRVPPPENA+I E ++  +S   K+ +  +CC     +F++ L
Sbjct  30   PDLDPGTYVVQVPKDQVYRVPPPENAQIAESHK--KSPPNKEAKTSRCCLCCVLFFIIFL  87

Query  588  vvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSFGD  409
            V+  +L   + G  + + TP+ PKFSI + +  ++  HP + ++L VHN N  + + +  
Sbjct  88   VLAILLGAVLGGLFSMLLTPEDPKFSITSFKVVETKPHPKYDVTLEVHNPNSDVGILYNG  147

Query  408  GGKSSLVFKNRV-IGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKEL-----NGRRKKL  247
             G  SL  + +  I  G YP+       +T   L + +     L KE+     N ++K  
Sbjct  148  KGHVSLSLRRQENIASGAYPTFRQDSHDTTTFGLTLTSSSKAGLPKEVEESVRNDKKKVS  207

Query  246  MALKISV----PMEISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQA  112
            +   +++     M++     G  K   + C  K+ +LAK+T  LS++C+ 
Sbjct  208  VTFSLAIHALAHMKMGLLRSGTMK-FDVTCKVKLDTLAKTTHVLSQQCET  256



>ref|XP_002513898.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48481.1| conserved hypothetical protein [Ricinus communis]
Length=243

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 117/218 (54%), Gaps = 18/218 (8%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTR---LRKCCFWFlvplvvlgili  568
            TYVVQ+P+DQ+YRVPPPENA IVE ++  +   KK TR      CCF  +   V+   L 
Sbjct  35   TYVVQVPKDQIYRVPPPENALIVERHRNPQ--QKKRTRYCSFFCCCFLIVATAVIAIALG  92

Query  567  gtivgsINAMYTPKSPKFSIAAIQYKKSARH--PTFHISLHVHNINQRMKVSFGDGGKSS  394
              +     A +  K+P+F +     K +  H  P + I+L V N N +  + +  GG +S
Sbjct  93   IGLSF---AFFKSKNPEFRVQRFIVKNNTSHHYPDYDITLKVRNPNDKSDILYMQGGVAS  149

Query  393  LVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVP--M  220
            L++K++ +  GK+P+     K ST + +     L G   K    +     +LKI +P  M
Sbjct  150  LLYKDQKMAAGKFPTFHQDNKNSTYIGI----VLKGQSIKGAKPKMHVSFSLKIGIPAKM  205

Query  219  EISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQAD  109
            + SS+  G+ K I +KC F V +LAK T  LS++CQ +
Sbjct  206  KTSSFISGEVK-IVVKCEFMVDTLAKGTRILSQQCQTN  242



>ref|XP_008234591.1| PREDICTED: uncharacterized protein LOC103333518 [Prunus mume]
Length=267

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 77/249 (31%), Positives = 124/249 (50%), Gaps = 24/249 (10%)
 Frame = -2

Query  798  DPALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLR  619
            +P    +  + P  PG A  TYV+QIP+DQ+YRVPPPENA IVE +   R   KK  +  
Sbjct  23   EPQTQIVPLAPPPFPGAA--TYVIQIPKDQIYRVPPPENALIVERH---RKPEKKKQKCP  77

Query  618  KC---CFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQY--------KKSARHP  472
             C   C      L  + ++IG  + +++    PK P FSI  +               HP
Sbjct  78   CCGTRCLVIGAILFFICLVIGITLLALSLTKKPKEPTFSITHVHVKNPKSKSSSGKNSHP  137

Query  471  TFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK-  295
             + +S+ V N N    + + + G +SL++K + +GKGK+P  +     S  V L +    
Sbjct  138  GYEVSMKVKNPNGH-GIDYANSGGASLMYKEKTLGKGKFPLKNQGGDDSAAVKLVLDGSK  196

Query  294  --LSGDLRKELNGRRKKL---MALKISVPMEISSWAKGKKKDISIKCVFKVGSLAKSTD-  133
              L  D++K +     K+   +ALK+ + +++  + K    D  ++C FKV +L K T  
Sbjct  197  GPLPQDVKKSMEDTDSKVRVSLALKMDLSVKVKGFIKTWNMDTEVECHFKVSTLGKGTRV  256

Query  132  LSEECQADF  106
            L ++C+A F
Sbjct  257  LDQKCEAQF  265



>ref|XP_002306315.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE93311.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=278

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 121/229 (53%), Gaps = 22/229 (10%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCF-WFlvplvvlgilig  565
            ETY++QIP+DQ++  P PENA I E +   R   KKD   R CC  W  + + ++ + + 
Sbjct  54   ETYIIQIPKDQIFSTPSPENAIIAERH---RLPQKKDQ--RSCCNRWLCIIVALILLALI  108

Query  564  tivg--sINAMYTPKSPKFSIAAIQYKKSAR-----HPTFHISLHVHNINQRMKVSFGDG  406
              +   + + ++TPK P F++  +  KK        H  + I+    N N R+ +S+ + 
Sbjct  109  IGIIVWTFHILFTPKVPLFTVVNVTVKKPLSTHKKAHLGYQITFETENPNGRLSISYVNK  168

Query  405  GKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LSGDLRKELNGRRKK---LM  244
            G ++L++KN  IG GK+P V      S  ++L +      L  D+   +  +R K    +
Sbjct  169  GDATLLYKNHKIGTGKFPEVDQDADSSKSIELGLSGSSGPLPDDVETSIQDKRGKKHVSL  228

Query  243  ALKISVPMEISSWA--KGKKKDISIKCVFKVGSLAKSTD-LSEECQADF  106
            ++++ VP+ +      K ++K+I++ C FKV SL    D LS++CQ+ F
Sbjct  229  SIRMDVPVTMKGLGGIKLRRKEINVVCTFKVSSLGAGKDVLSQKCQSKF  277



>ref|XP_002306581.1| hypothetical protein POPTR_0005s16920g [Populus trichocarpa]
 gb|EEE93577.1| hypothetical protein POPTR_0005s16920g [Populus trichocarpa]
Length=257

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 78/244 (32%), Positives = 125/244 (51%), Gaps = 20/244 (8%)
 Frame = -2

Query  798  DPALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLR  619
            DP  TS       QP   P TYV+QIPRDQ+YRVPPP NA + +  +       K     
Sbjct  19   DPVATSN------QPFFEPGTYVIQIPRDQIYRVPPPGNASVAQRQRNPHQKKHKSCCGC  72

Query  618  KCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIA--AIQYKKSARH----PTFHIS  457
             C +   + +     +  TIVG    +  PK P+F +    ++  + ++H      + I 
Sbjct  73   SCFWCCFIAIASGIAVAVTIVGLSFILLKPKDPEFQVQRFVVKNPQVSKHKYSYTNYDIR  132

Query  456  LHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LSG  286
            L+VHN N+R  + +  GG  SL F+ + +  GK+P+     K STD+ + +      L  
Sbjct  133  LNVHNSNRRSSILYQQGGAVSLSFRQQNVATGKFPTFHQGHKNSTDIGIVLKGTGVGLPK  192

Query  285  DLRKELNGRRKKL---MALKISVPMEI-SSWAKGKKKDISIKCVFKVGSLAKSTD-LSEE  121
            D++  L  R+ K+    +LK++VP+++ +S  K  + +I + C F V SLA+ T  LS+E
Sbjct  193  DVQNSLRNRKSKVPDSFSLKMNVPVKMKTSGFKTGRAEIVVTCDFTVQSLAQDTHILSQE  252

Query  120  CQAD  109
            CQ +
Sbjct  253  CQTN  256



>ref|XP_011030993.1| PREDICTED: uncharacterized protein LOC105130269 [Populus euphratica]
Length=278

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/229 (30%), Positives = 120/229 (52%), Gaps = 23/229 (10%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCF-WFlvplvvlgilig  565
            ETY++QIP+DQ++  P PENA I E +   R   KK+   R CC  W  + + ++ + + 
Sbjct  55   ETYIIQIPKDQIFNTPSPENAIIAERH---RLPQKKE---RSCCNRWLCIIVALILLALI  108

Query  564  tivg--sINAMYTPKSPKFSIAAIQYKKSAR-----HPTFHISLHVHNINQRMKVSFGDG  406
              +   + + ++TPK P F++  +  KK        H  + I+    N N R+ +S+   
Sbjct  109  IGIIAWTFHILFTPKVPLFTVVNVTVKKPLSTHKKTHLGYQITFETENPNGRLSISYVTK  168

Query  405  GKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LSGDLRKELNGRRKK---LM  244
            G ++L++KN  IG GK+P V      S  ++L +      L  D+   +  +R K    +
Sbjct  169  GDATLLYKNHKIGTGKFPEVDQDADSSKSIELGLSGSSGPLPDDVETSIQDKRGKKHVSL  228

Query  243  ALKISVPMEISSWA--KGKKKDISIKCVFKVGSLAKSTD-LSEECQADF  106
            ++++ VP+ +      K ++K+I++ C FKV SL    D LS++CQ+ F
Sbjct  229  SIRMDVPVTMKGLGGIKLRRKEINVVCTFKVSSLGAGKDVLSQKCQSKF  277



>ref|XP_010102585.1| hypothetical protein L484_003960 [Morus notabilis]
 gb|EXB93688.1| hypothetical protein L484_003960 [Morus notabilis]
Length=247

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 75/258 (29%), Positives = 129/258 (50%), Gaps = 25/258 (10%)
 Frame = -2

Query  843  MDGRVSPVGGD--GRKGDPALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIV  670
            M+GRV     D      DP         P+ P   PETYV+QIP+DQ+YRVPPPENA I 
Sbjct  1    MEGRVPAASADPDTTNDDP---------PLSPPRRPETYVIQIPKDQIYRVPPPENALIA  51

Query  669  EGYQEMRSTNKKDTRLRK-CCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQY  493
            E ++   +  +  +  R   C   ++  + L  +  T+     A+ +P++P  SI  +  
Sbjct  52   ERFRNPETKGRNPSLPRSLLCVGIILFALCLIFIGITLSTLFFAL-SPEAPTISILHV-V  109

Query  492  KKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVD  313
              + +H  + I L  +N N R  + +  GG ++L+F  + +G+G++P +  +      V 
Sbjct  110  VTNPKH--YDIYLKTNNANSRTGIYYEKGGSATLLFGEKNVGEGEFPMLYQQESSFATVQ  167

Query  312  LKMVAK--LSGDLRKELNGRRKKL---MALKISVPMEIS-SWAKGKKKDISIKCVFKVGS  151
            L +     L  ++ K +N  +  L   +ALK+ VP+ ++  + K  K +I + C FK+ +
Sbjct  168  LVIDGNKSLPREMEKSINETKSDLPVPLALKMEVPVTMNLGFLKIWKNEILVDCKFKLSA  227

Query  150  LAKSTD---LSEECQADF  106
            L  +     LS+EC+  F
Sbjct  228  LRTNGGFQLLSQECETTF  245



>gb|ACU23534.1| unknown [Glycine max]
Length=227

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 103/206 (50%), Gaps = 20/206 (10%)
 Frame = -2

Query  756  PGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTR-LRKCCFWFlvplvvl  580
            P   P TYVVQ+P+DQVYRVPPPENA+I E +++      K +R    C  +F++  V+L
Sbjct  29   PDFNPGTYVVQVPKDQVYRVPPPENARIAESHKKAPPKAAKTSRCCLFCVLFFIIFFVLL  88

Query  579  giligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGK  400
             +L   + G  + + TPK P+FSI   +  ++  HP + ++L VHN+N  + VS+ + G 
Sbjct  89   ILLGAVLGGLFSMLLTPKDPQFSITRFKVVETKPHPKYDVTLEVHNLNSDVGVSYKNKGH  148

Query  399  SSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVPM  220
             SL  + + +  G YPS +      T   + + +                    K+ +P 
Sbjct  149  VSLSLRRQEVASGAYPSFNQDAHDRTTFGVTLTSS-------------------KVGLPK  189

Query  219  EISSWAKGKKKDISIKCVFKVGSLAK  142
            E+       KK +++     + +LA+
Sbjct  190  EVEESVTNDKKKVNVTFSLAIHALAR  215



>gb|KDP46860.1| hypothetical protein JCGZ_24069 [Jatropha curcas]
Length=271

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 124/223 (56%), Gaps = 18/223 (8%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKD-TRLRKCCFWFlvplvvlgilig  565
            ETYVVQIP+DQ++ VPPPE+A I E +   R+  K+D T  R C    L+ L VL +L+ 
Sbjct  55   ETYVVQIPKDQIFSVPPPEHAIIAERH---RNPEKEDNTGRRSCLICVLITLTVLAVLMC  111

Query  564  tivgsINAMYTPKSPKFSIAAIQYKK-SARHPTFHISLHVHNINQRMKVSFGDGGKSSLV  388
             I+G +  +Y PK+P+FSI  +  +  S++   + + L V N N++MK  +   G + L+
Sbjct  112  LILGILRILYNPKAPRFSIVQVHVENISSKQLRYEMKLKVKNKNKKMKNIYRSDGDAILL  171

Query  387  FKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELN-------GRRKKLMALKIS  229
            +K+  IG GK P         T++   +  K +G L KE+        G+R   + LK++
Sbjct  172  YKSYKIGTGKPPQFVQAAGSLTNIGFGISGKKNGSLAKEIEKSIGDRKGKRHVALVLKMN  231

Query  228  VPMEISSWAKGKKKDISIKCVFKVGSLAKS--TDLSEECQADF  106
            VP+++    K  KK I++ C FKV SL  S    LS+ CQ  F
Sbjct  232  VPVKM----KSSKKVINVVCNFKVSSLGASGRNVLSQRCQTKF  270



>ref|XP_008345632.1| PREDICTED: uncharacterized protein LOC103408570 [Malus domestica]
Length=266

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 116/230 (50%), Gaps = 25/230 (11%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKC----CFWFlvplvvlgil  571
            TYVVQIP+DQ+YRVPPPENA IVE     R  N ++ +   C    C      +  L ++
Sbjct  41   TYVVQIPKDQIYRVPPPENALIVE-----RHRNPENKKKSPCCTIRCLIIGAIVFSLCLI  95

Query  570  igtivgsINAMYTPKSPKFSIAAIQYKK--------SARHPTFHISLHVHNINQRMKVSF  415
            +   + S++    PK PKFSI+ +  K            HP + +S+ V+N N    +++
Sbjct  96   LFITLLSLSLTVKPKEPKFSISNVHVKNPKSKSDXGKNSHPGYEVSVKVNNPNGH-GINY  154

Query  414  GDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKM---VAKLSGDLRKELNGRRKKL-  247
                 +SL+ K + IGKGK+P    +   S  V L +      L  ++ K +     K+ 
Sbjct  155  EGSEGASLLLKEKSIGKGKFPLKKQEKDSSATVKLVLDGSKGALPREVEKSIENTNSKMH  214

Query  246  --MALKISVPMEISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQADF  106
              + LK+ + +++  + K  K +  ++C F+V +L K T  L ++C+A F
Sbjct  215  LPLTLKMDLSVKVKGFIKTWKMETEVECHFQVSTLGKGTKVLQQKCEAKF  264



>ref|XP_008375147.1| PREDICTED: uncharacterized protein LOC103438373 [Malus domestica]
Length=266

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 116/230 (50%), Gaps = 25/230 (11%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKC----CFWFlvplvvlgil  571
            TYVVQIP+DQ+YRVPPPENA IVE     R  N ++ +   C    C      +  L ++
Sbjct  41   TYVVQIPKDQIYRVPPPENALIVE-----RHRNPENKKKSPCCTIRCLIIGAIVFSLCLI  95

Query  570  igtivgsINAMYTPKSPKFSIAAIQYKK--------SARHPTFHISLHVHNINQRMKVSF  415
            +   + S++    PK PKFSI+ +  K            HP + +S+ V+N N    +++
Sbjct  96   LFITLLSLSLTVKPKEPKFSISNVHVKNPKSKSDIGKNSHPGYEVSVKVNNPNGH-GINY  154

Query  414  GDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKM---VAKLSGDLRKELNGRRKKL-  247
                 +SL+ K + IGKGK+P    +   S  V L +      L  ++ K +     K+ 
Sbjct  155  EGSEGASLLLKEKSIGKGKFPLKKQEKDSSATVKLVLDGSKGALPREVEKSIENTNSKMH  214

Query  246  --MALKISVPMEISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQADF  106
              + LK+ + +++  + K  K +  ++C F+V +L K T  L ++C+A F
Sbjct  215  LPLTLKMDLSVKVKGFIKTWKMETEVECHFQVSTLGKGTKVLQQKCEAKF  264



>ref|XP_010926522.1| PREDICTED: uncharacterized protein LOC105048772 [Elaeis guineensis]
Length=276

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 109/232 (47%), Gaps = 18/232 (8%)
 Frame = -2

Query  756  PGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlg  577
            P    ETYVVQ P++Q+YRVPPPENAK+VE Y+   +   +   +  C  W +   +VL 
Sbjct  47   PRRPTETYVVQFPKEQIYRVPPPENAKLVEQYRNNHNNRHQRRPIVPCLKWTIGIALVLS  106

Query  576  iligtivgsINAMYTPKSPKFSIAAIQYKK------SARHPTFHISLHVHNINQRMKVSF  415
            IL   +      +  P  P FS++ +  +       S   P +H ++ V N + RM  S+
Sbjct  107  ILAAIVAIIYLLVVGPADPSFSVSRLVLRNPNPRAGSPWKPEYHFTMRVENPSLRMGYSY  166

Query  414  GDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDL-----KMVAKLSGDLRKELNGRRKK  250
            G GGK+ L      I  GK  +     + +T   L     +MV  L   +++ L G +  
Sbjct  167  GAGGKAVLAHDGADIAVGKTKAFDQGYQNTTTFQLVLRRSRMV--LPKQIQRSLKGSKDV  224

Query  249  L---MALKISVPMEISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQADF  106
            +   + ++ SV   I     G  K++ + C  K   LAK    +S+ECQ  F
Sbjct  225  IPMSLVIEFSVGKTIGGMVMG-SKNMDVTCDIKASGLAKEARVVSQECQTKF  275



>ref|XP_004289320.1| PREDICTED: uncharacterized protein LOC101306764 [Fragaria vesca 
subsp. vesca]
Length=277

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 86/261 (33%), Positives = 130/261 (50%), Gaps = 20/261 (8%)
 Frame = -2

Query  849  SSMDGRVSP-VGGDGRKGDPALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKI  673
            ++M+ R  P  G D    DPA  S T  +P  P    +TYV+  P+DQ+YRVPPPENA +
Sbjct  19   ATMEERGPPATGADDINDDPAPASETQLVPYGPTPN-DTYVIHFPKDQIYRVPPPENAIL  77

Query  672  VEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQY  493
            VE +   R   KK T  +  C  FLV  +VL  + G  V +   + +PK+P FSI  +  
Sbjct  78   VEKH---RPVTKKKTSCKTWCLAFLVIFLVLFFIAGITVVTWYFVLSPKTPTFSITQMNV  134

Query  492  KKSARHPT---FHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkST  322
            KK + + +   + I L   N N +M + F +  ++SL    + I KGKYPS  +   +S 
Sbjct  135  KKPSSNDSDVGYEIFLRAVNPNDKMSIRF-ESDETSLSNGEKGIAKGKYPSNELDGDQSD  193

Query  321  DVDLKM---VAKLSGDLRKEL-----NGRRKKLMALKIS-VPMEIS-SWAKGKKKDISIK  172
            DV L +   +  L  D++  +     N      + LK+S +P+ I   + K   K   ++
Sbjct  194  DVKLVLSGAITALPDDVQDSIGDTSSNKTSPLSLNLKMSDLPLHIKYGFFKSWDKKAEVE  253

Query  171  CVFKVGSLAKSTD-LSEECQA  112
            C FKV     ST  L ++C  
Sbjct  254  CKFKVDKFGSSTKILEQDCDT  274



>ref|XP_007226131.1| hypothetical protein PRUPE_ppa014613mg [Prunus persica]
 gb|EMJ27330.1| hypothetical protein PRUPE_ppa014613mg [Prunus persica]
Length=272

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 116/223 (52%), Gaps = 18/223 (8%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TY+VQ+P+DQ+YR+PPPE+A IVE +++    NKK      CC   +  +V+L I +  +
Sbjct  53   TYIVQVPKDQIYRMPPPEHATIVERHRD-SGVNKKSCSY--CCLGIIAFIVLLIITLVAV  109

Query  558  vgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKN  379
            +     +     PKFS+  +  K  +  P + ++L   N N R+ + + DGG +SL FK 
Sbjct  110  IL--TMLAKSGDPKFSVERVVVKGKSGRPDYDLTLEARNPNSRVAIVYKDGGGASLYFKQ  167

Query  378  RVIGKGKYpsvsvkpkkSTDV-------DLKMVAKLSGDLRKELNGRRKKLMALKISVPM  220
            + I  GKYPS+     KS +V       ++K+  ++   L+   +   KK   + +S+ M
Sbjct  168  KKIANGKYPSLYQGSGKSKEVALVLHGSNMKLPKEIEKSLKSSYSSTYKKGHRVSLSLNM  227

Query  219  EISSWAK-----GKKKDISIKCVFKVGSLAKSTD-LSEECQAD  109
            +I +  +      + +   + C   V +LAK T  L +ECQ +
Sbjct  228  DIPARMRIGTLNSRSRKFHVTCDITVDTLAKGTKVLKQECQTE  270



>ref|XP_010664315.1| PREDICTED: uncharacterized protein LOC104882481 [Vitis vinifera]
Length=244

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 75/223 (34%), Positives = 112/223 (50%), Gaps = 21/223 (9%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYVVQ+P+DQ+YRVPPPENA I E +   RS  +K    R  CF   + + ++ +++   
Sbjct  29   TYVVQVPKDQIYRVPPPENALIAERH---RSPAQKKKSYRSRCFILCILICIIAVIVAIA  85

Query  558  vgsINAMYTPKSPKFSIAAIQYKKSAR-HPTFHISLHVHNINQRMKVSFGDGGKSSLVFK  382
                + +  PKSP F I  +   KS+   P + I+L   N N    +++  GG +SL FK
Sbjct  86   AAVSSRVLHPKSPIFHIQHLVVTKSSHSRPQYKITLKAKNPNSHTGITYEAGGHASLSFK  145

Query  381  NRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGD---LRKEL-------NGRRKKLMALKI  232
            N  I  G  P+ S   K ST      V  LSG    L KE+       N      ++L +
Sbjct  146  NHEIADGDCPTFSQGQKDST----VFVVPLSGSKSALPKEIERSIKSQNSTAHTSLSLSL  201

Query  231  SV--PMEISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQA  112
            S+  P++   W   + K +++ C   V +LAK T  LS+EC +
Sbjct  202  SMDYPIKRRVWLFKRGKRLAVLCNVTVDTLAKGTRVLSQECHS  244



>ref|XP_006293421.1| hypothetical protein CARUB_v10025210mg [Capsella rubella]
 gb|EOA26319.1| hypothetical protein CARUB_v10025210mg [Capsella rubella]
Length=292

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 118/240 (49%), Gaps = 18/240 (8%)
 Frame = -2

Query  789  LTSLTFSLPVQPGEAPE--TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRK  616
            L + T S  + P   PE  TYVVQ+PRDQVY  PPPENAK    Y E RS N +  + + 
Sbjct  61   LPTTTPSPLLHPDSIPELETYVVQVPRDQVYWTPPPENAK----YIEKRSNNPEKNKKKG  116

Query  615  CC---FWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVH  445
            C     WF + LVV G ++G I   ++  + P  P F++  +  K S    TF +++   
Sbjct  117  CSKRLMWFFIILVVFGFILGAITLILHLAFKPTLPVFAVEGVTVKPS----TFEVTMRAD  172

Query  444  NINQRMKVSF--GDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKE  271
            N    M V +     G  SL +KN+ +G GK+P +S     S  V++K+       + + 
Sbjct  173  NPTSNMGVRYVMKKNGVVSLTYKNKSLGTGKFPGLSQAASGSDKVNVKLNGSTKNAVVQP  232

Query  270  LNGRRKKLMALKISVPMEISSWAKGKKKDISIKCVFKVGSLA---KSTDLSEECQADF*N  100
               ++   M L + +  E  +    + K++S+ C  KV  L    K   +SE C+++F N
Sbjct  233  RGSKQPLAMMLTMELKAEYEAGPIKRNKEVSVSCDVKVKGLLDGKKVEIVSENCESEFKN  292



>ref|XP_009615539.1| PREDICTED: uncharacterized protein LOC104108256 [Nicotiana tomentosiformis]
Length=273

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 125/235 (53%), Gaps = 26/235 (11%)
 Frame = -2

Query  762  VQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCF----WFlv  595
             QP  A  TYVVQ+P+DQ+YR+PPPENA IVE +   R+ N+K    R CC+     ++V
Sbjct  38   TQPPFASGTYVVQVPKDQIYRIPPPENALIVESH---RNQNRKPR--RSCCYSRRCIYIV  92

Query  594  plvvlgiligtivgsINAMYTPK-SPKFSIAAI-------QYKKSARHPTFHISLHVHNI  439
             ++V   +I  ++  +  ++T    P+FS+  +       Q+K+      + I++   N 
Sbjct  93   VMLVFIGVIIGLIIGLTKLFTKHDDPQFSVKQVLLKKLQLQHKRPQYQYEYDITIEAKNP  152

Query  438  NQRMKV-SFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKM----VAKLSGDLRK  274
            NQR ++  + + G  SL FK + I +G +P +   PK STD+ + +    + +L  ++ K
Sbjct  153  NQRSRILYYEEDGDVSLYFKQKKIAQGNFPDLDQGPKSSTDIKVILHNGKIDQLPKEVEK  212

Query  273  ELNGRRKKL---MALKISVPMEISSWA-KGKKKDISIKCVFKVGSLAKSTDLSEE  121
             +N         ++L + VP++   W    K+K+I + C   V +L K++ ++ +
Sbjct  213  NMNSTNSNQHLSLSLSMDVPIKFKVWGISSKRKNIELCCSLTVNTLTKNSHVNNQ  267



>ref|XP_006580279.1| PREDICTED: uncharacterized protein LOC102668552 [Glycine max]
Length=246

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 133/241 (55%), Gaps = 22/241 (9%)
 Frame = -2

Query  780  LTFSLPVQPGE-APETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFW  604
            ++ + P  PG    +TY+VQ+P+DQVYRVPP ENA IVE Y+   +  K+      CC  
Sbjct  9    VSATFPPPPGHHGADTYIVQLPKDQVYRVPPRENALIVEQYRNPATAKKRRGGCCCCCSR  68

Query  603  --FlvplvvlgiligtivgsINAMY---TPKSPKFSIA--AIQYKKSAR-HPTFHISLHV  448
              FL   +++  ++  +  ++  +Y   +P  PKF+++  A+   KS+R  P + +SL  
Sbjct  69   RVFLTVALIVVAIVAVVGITLATLYFIFSPSGPKFTVSHVAVNRNKSSRAAPQYEVSLRA  128

Query  447  HNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKEL  268
             N N+++ + + D G  SL+F +  + +GK+P++     ++++V +++    SG L + +
Sbjct  129  RNPNEKLAIEYQD-GDVSLLFDDTKVAEGKFPTLEQGRGEASEVTVELTGS-SGALPRRM  186

Query  267  NGRRKKL---MALKISVPME---ISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQAD  109
            NG    +   + +K+++ +    + +WA   + D++  C FKV +L   T  LS++C   
Sbjct  187  NGGDAAVDLKLEMKLAIRIRTAGLETWA--MRSDVA--CEFKVSALGNDTRVLSQQCDTK  242

Query  108  F  106
            F
Sbjct  243  F  243



>gb|KHG11950.1| hypothetical protein F383_17766 [Gossypium arboreum]
Length=263

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/221 (30%), Positives = 123/221 (56%), Gaps = 14/221 (6%)
 Frame = -2

Query  735  YVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligtiv  556
            +VVQ+P++Q+YRVPPPENA+I E Y   R   KK  R   C  +F+  L+VL ++   I 
Sbjct  45   FVVQVPKNQIYRVPPPENAQIQEKY---RMAAKKPKRKLPCLKYFICFLLVLLVIGLIIG  101

Query  555  gsINAMY---TPKSPKFSIAAIQYKKS-ARHPTFHISLHVHNINQRMKVSFG-DGGKSSL  391
             +I  +Y   +PK P FSI+++  K+     PT+ + L + N N++M +++  +     L
Sbjct  102  TAILVVYFCFSPKGPVFSISSLIVKQQKGSPPTYDVKLKIKNPNEKMGITYASEEDDLKL  161

Query  390  VFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA----KLSGDLRKELNGRRKKLMALKISVP  223
             +  + +G G++PS+  K   S +V++K+       L  +++K ++G+R   + + +  P
Sbjct  162  TYWRKTLGWGEFPSLGQKKGNSNEVNIKVNGVKDKPLPQNVKKSMSGKRPISLEMNVETP  221

Query  222  MEISSWA-KGKKKDISIKCVFKVGSLAKSTDL-SEECQADF  106
            +  + W  K  ++ + +KC F+V S+ + T + S+ C    
Sbjct  222  LVFNVWILKMWRRTMEVKCKFRVSSMGEGTKIVSQVCNTKL  262



>ref|XP_006404673.1| hypothetical protein EUTSA_v10000276mg [Eutrema salsugineum]
 gb|ESQ46126.1| hypothetical protein EUTSA_v10000276mg [Eutrema salsugineum]
Length=288

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 114/219 (52%), Gaps = 10/219 (5%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligt  562
            ETYVVQ+PRDQVY  PPPE+AK VE  + +   NKK+    K   WF + LVV G L+G 
Sbjct  75   ETYVVQVPRDQVYWTPPPEHAKYVEKRRNIPKKNKKNG-CSKRLMWFFIILVVFGCLLGA  133

Query  561  ivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSF--GDGGKSSLV  388
            I   ++  ++P  P F++  +  K S     F ++L   N    M VS+     G  SL 
Sbjct  134  ITLILHFAFSPTLPVFAVERLTIKPS----NFEVTLRAENPTSNMGVSYLMKKNGVVSLT  189

Query  387  FKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVPMEISS  208
            +KN+ +G+GK+P +S    +S  V++K+       +      ++   + L + +  E  +
Sbjct  190  YKNKSLGRGKFPKMSQAASESNKVNVKLDGSTKNAVLPPRGSKQPVSLVLMMELKAEYEA  249

Query  207  WAKGKKKDISIKCVFKVGSL--AKSTDL-SEECQADF*N  100
                K K++ + C  KV  L  AK  ++ SE C+++F N
Sbjct  250  GPVKKNKEVLVTCDVKVKGLLDAKKVEIVSENCESEFKN  288



>ref|XP_009112546.1| PREDICTED: uncharacterized protein LOC103837908 [Brassica rapa]
Length=288

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 111/217 (51%), Gaps = 10/217 (5%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligt  562
            ETYVVQ+PRDQ+Y  PPPE+AK VE  +     NKK+    K   WF + L+  G ++G 
Sbjct  75   ETYVVQVPRDQIYWTPPPEHAKYVEKLRNNPERNKKNG-CSKRLMWFFIILIAFGSILGA  133

Query  561  ivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSF--GDGGKSSLV  388
            I   ++ ++ P  P F++  +  K S    +F ++L   N    M VS+     G  SL 
Sbjct  134  ITLILHLVFNPALPIFAVERLNVKTS----SFEVTLRAENPTSNMGVSYVMKPNGVVSLT  189

Query  387  FKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVPMEISS  208
            +KN+ +G+GK+P +      S  V++K+       +      ++   + LK+ +  +  +
Sbjct  190  YKNKRLGRGKFPKMFQAASGSDKVNVKLDGSTKNAVMPPRGSKQAVSLVLKMELKADYEA  249

Query  207  WAKGKKKDISIKCVFKVGSL--AKSTDL-SEECQADF  106
                K K++ + C  KV  L  AK  ++ SE C+++F
Sbjct  250  GPVKKNKEVVVTCDVKVKGLLDAKKVEIVSENCESEF  286



>ref|XP_010917110.1| PREDICTED: uncharacterized protein LOC105041779 [Elaeis guineensis]
Length=253

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 106/226 (47%), Gaps = 14/226 (6%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            PETYVVQ+PR+Q+YR+PPPENAK+VE Y+      ++   +  C  W +   +V GIL  
Sbjct  28   PETYVVQVPREQIYRIPPPENAKLVEQYRNDHDNRRERRPIIPCLKWTISIALVAGILAA  87

Query  564  tivgsINAMYTPKSPKFSIAAIQYKK------SARHPTFHISLHVHNINQRMKVSFGDGG  403
            TI      +  P  P FS+  +  K       S   P +  ++ V N + RM  S+  GG
Sbjct  88   TITIIYFLVVRPADPFFSVTRLVLKNPNPRGGSPPKPEYDFTMRVDNPSLRMGYSYEAGG  147

Query  402  KSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LSGDLRKELNGRRKKL---MA  241
            K+ L      I  GK  +     + +T   L +      L   ++  L G +  +   + 
Sbjct  148  KAILAHHGAGIAVGKTKAFHQGYQNTTTFQLALKGSHVLLPKQIQSSLKGSKDVIPLSLM  207

Query  240  LKISVPMEISSWAKGKKKDISIKCVFKVGSLAKSTDL-SEECQADF  106
            ++ SV   +     G  K + + C  KV  LAK   + S+EC++ F
Sbjct  208  IEFSVRKTVGELEMG-NKSMDVTCDIKVSGLAKEARIASQECKSKF  252



>emb|CDX76941.1| BnaC08g35270D [Brassica napus]
Length=288

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 119/237 (50%), Gaps = 13/237 (5%)
 Frame = -2

Query  795  PALTSLTFSLPVQPGEAPE--TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRL  622
            P L + + SLP  P   PE  TYVVQ+PRDQ+Y  PPPE+AK VE  +     NKK+   
Sbjct  56   PILDTPSRSLP-PPDSIPELETYVVQVPRDQIYWTPPPEHAKYVEKLRNNPEKNKKNG-C  113

Query  621  RKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHN  442
             K   WF + L+  G ++G I   ++ ++ P  P F++  +  K S    +F ++L   N
Sbjct  114  SKRLMWFFIILIAFGFILGAITLILHLVFNPALPVFAVEKLNLKPS----SFEVTLRAEN  169

Query  441  INQRMKVSF--GDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKEL  268
                M VS+     G   L +KN+ +G+GK+P +      S  V++K+       +    
Sbjct  170  PTSNMGVSYVMKPNGVVWLTYKNKRLGRGKFPKMFQAASGSDKVNVKLDGSTKNAVMPPR  229

Query  267  NGRRKKLMALKISVPMEISSWAKGKKKDISIKCVFKVGSL--AKSTDL-SEECQADF  106
              ++   + LK+ +  +  +    K K++ + C  KV  L  AK  ++ SE C+++F
Sbjct  230  GSKQAVSLVLKMELKADYEAGPVKKNKEVVVTCDVKVKGLLDAKKVEIVSENCESEF  286



>ref|XP_008219666.1| PREDICTED: uncharacterized protein LOC103319851 [Prunus mume]
Length=272

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 111/224 (50%), Gaps = 20/224 (9%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TY+VQ+P+DQ+YR+PPPE+A IVE +++    NKK      CC        ++ ++I  +
Sbjct  53   TYIVQVPKDQIYRMPPPEHATIVERHRD-SGVNKKSCSY--CCLGI--IAFIVLLIITPV  107

Query  558  vgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKN  379
               +  +     PKFS+  +  K  +    + ++L   N N R+ + + DGG +SL FK 
Sbjct  108  AVILTMLAKSGDPKFSVKRVVVKGKSGLSDYDLTLEARNPNSRVAIVYKDGGGASLYFKQ  167

Query  378  RVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKEL---------NGRRKKL-MAL  238
            + I  GKYPS+     KS +V L +     KL  ++ K L          G R  L + +
Sbjct  168  KKIANGKYPSLYQGSGKSKEVALVLHGSNMKLPNEIEKSLKSSHSSTYKKGNRVSLSLNM  227

Query  237  KISVPMEISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQAD  109
             I V M I +    + +   + C   V +LAK T  L +ECQ +
Sbjct  228  DIPVRMRIGTL-NSRSRKFHVTCDITVDTLAKGTKVLKQECQTE  270



>ref|XP_009383601.1| PREDICTED: uncharacterized protein LOC103971332 [Musa acuminata 
subsp. malaccensis]
Length=264

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/226 (29%), Positives = 109/226 (48%), Gaps = 21/226 (9%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCF----WFlvplvvlgil  571
            TYVVQ+P+DQVYRVPPPENA + E Y+     NK  TR +  C     W L   +++  L
Sbjct  43   TYVVQVPKDQVYRVPPPENAYLAERYR-----NKDKTRRKSPCVGLLKWILGAALLIFFL  97

Query  570  igtivgsINAMYTPKSPKFSIAAIQYKKSA---RHPTFHISLHVHNINQRMKVSFGDGGK  400
            +  IV        P +P F++  +  K S    R P + +++ VHN +Q+M  ++  GG 
Sbjct  98   LIVIVVVFFVTVKPATPTFAVERLSVKSSGTSHRKPEYDLTMRVHNPSQKMGYAYEAGGT  157

Query  399  SSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK----LSGDLRKELNGRRKKLMALKI  232
            + +   N  I  GK P +    + +T   L +       L   + + LNG  K ++ L++
Sbjct  158  AVMAHSNVDIAAGKTPGLHQGYQNTTTFRLVLHGSNTDGLPKTIDRSLNG-SKDVVPLEV  216

Query  231  SVPMEISSWAKGK---KKDISIKCVFKVGSLAKSTDL-SEECQADF  106
            +    ++  A G       + + C  +   L K   + S+EC+++ 
Sbjct  217  TARFVVTPRAMGLDLWSTSLDMACAVRASGLGKEARIVSQECKSNL  262



>ref|XP_007159643.1| hypothetical protein PHAVU_002G255000g [Phaseolus vulgaris]
 gb|ESW31637.1| hypothetical protein PHAVU_002G255000g [Phaseolus vulgaris]
Length=249

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 130/255 (51%), Gaps = 29/255 (11%)
 Frame = -2

Query  816  GDGRKGDPALTSLTFSLPVQPG-EAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTN  640
            G  +  DP + +   SLP  PG ++ ETY+VQ P++QVYRVPP ENA IVE Y+      
Sbjct  3    GQAKAADPTVVA---SLPPPPGRKSHETYIVQFPKNQVYRVPPRENALIVEQYRN--PAA  57

Query  639  KKDTRLRKCCFW-------FlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSA  481
             K TR   CC           +  V +  ++G  + ++  ++ P  P FS++ +  K   
Sbjct  58   PKKTR-GACCLCERRVLLTLGLIAVSIIAIVGITLATLYLIFDPTGPTFSVSNLIVKSGG  116

Query  480  ----RHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVD  313
                  P + +SL V+N N+R+ + + + G+ SL+F+   I  G++P +    ++S+ V 
Sbjct  117  ADRNSRPQYKVSLIVNNPNERLGIQY-EAGEVSLLFEGTRIAGGRFPRLDQCREESSAV-  174

Query  312  LKMVAKLS--GDLRKELNGRRKKLMALKISVPMEISSWAKGKKKDI---SIKCVFKVGSL  148
               VA LS  G L + ++      +AL++ + + +     G +  +   ++ C F V  L
Sbjct  175  ---VANLSGPGGLFRWVSSSGDGPVALELEMNLAVRIRTAGIETWLMTSNVFCHFMVTGL  231

Query  147  AKSTD-LSEECQADF  106
              +T  LS+EC ADF
Sbjct  232  RSNTRILSQECDADF  246



>emb|CDX76942.1| BnaC08g35280D [Brassica napus]
Length=288

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 119/237 (50%), Gaps = 13/237 (5%)
 Frame = -2

Query  795  PALTSLTFSLPVQPGEAPE--TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRL  622
            P L + + SLP Q    PE  TYVVQ+PRDQ+Y  PPPE+AK VE  +     NKK+   
Sbjct  56   PILDTPSRSLPPQ-DSIPELETYVVQVPRDQIYWTPPPEHAKYVEKLRNNPDRNKKNG-C  113

Query  621  RKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHN  442
             K   WF + L+  G ++G I   ++ ++ P  P F++  +  K S    +F ++L   N
Sbjct  114  SKRLMWFFIILIAFGFILGAITLILHLVFNPALPVFAVEKLNLKPS----SFEVTLRAEN  169

Query  441  INQRMKVSF--GDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKEL  268
                M VS+     G   L +KN+ +G+GK+P +      S  V++K+       +    
Sbjct  170  PTSNMGVSYVMKPNGVVWLTYKNKRLGRGKFPKMFQAASGSDKVNVKLDGSTKNAVMPPR  229

Query  267  NGRRKKLMALKISVPMEISSWAKGKKKDISIKCVFKVGSL--AKSTDL-SEECQADF  106
              ++   + LK+ +  +  +    K K++ + C  KV  L  AK  ++ SE C+++F
Sbjct  230  GSKQAVSLVLKMELKADYEAGPVKKNKEVVVTCDVKVKGLLDAKKVEIVSENCESEF  286



>ref|XP_008782129.1| PREDICTED: uncharacterized protein LOC103701746, partial [Phoenix 
dactylifera]
Length=281

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 106/226 (47%), Gaps = 15/226 (7%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligt  562
            ETYVVQ+P++Q+YRVPPPENAKIVE Y+      ++   +  C  W +   +VLGIL   
Sbjct  56   ETYVVQVPKEQIYRVPPPENAKIVEQYRNNHIDRRQRRPIVPCLKWAIGIALVLGILAAI  115

Query  561  ivgsINAMYTPKSPKFSIAAIQYKKSARH-------PTFHISLHVHNINQRMKVSFGDGG  403
            I      +  P  P FS+  +  K            P + +++ V N + RM  S+G GG
Sbjct  116  IAIIYLLVVRPADPSFSVIRLVLKNPNPRAGSLIPKPEYDLTMRVENPSLRMGYSYGAGG  175

Query  402  KSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LSGDLRKELNGRRKKLMALKI  232
            K+ L  +   I  GK  ++    + +T   L +      L   ++  L G  K ++ + +
Sbjct  176  KAILAHQGANIAVGKTQALDQGYENTTTFHLVLQGSHIVLPKQIQSSLQG-SKDVIPMSL  234

Query  231  SVPMEISSWAKG---KKKDISIKCVFKVGSLAKSTD-LSEECQADF  106
             +   +     G     K + + C  +V  LAK    +S+EC+  F
Sbjct  235  MIEFSVGKTIGGMVMASKSMDVACDIEVSGLAKEARVVSQECETKF  280



>ref|XP_009787573.1| PREDICTED: uncharacterized protein LOC104235484 [Nicotiana sylvestris]
Length=276

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 74/256 (29%), Positives = 131/256 (51%), Gaps = 29/256 (11%)
 Frame = -2

Query  828  SPVGGDGRKGDP-ALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEM  652
            SP   D    +P A++  T   P   G    TYVVQ+P+DQ+YR+PPPENA IVE +   
Sbjct  24   SPTHNDISHYEPLAISVCTTLFPFASG----TYVVQVPKDQIYRIPPPENALIVESH---  76

Query  651  RSTNKKDTRLRKCCF----WFlvplvvlgiligtivgsINAMYTPK-SPKFSIAAIQYKK  487
            R+ N+K    R CC+      +V ++V+   I  ++     ++T    P+FS+  +  KK
Sbjct  77   RNQNRKPR--RSCCYSRRCLCIVVMLVVIGSIIGLIIGPTKLFTKHDDPQFSVKQVLLKK  134

Query  486  ---SARHPTFH--ISLHVHNINQRMKV-SFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkS  325
                 + P +   I++   N NQR ++  + + G  SL FK + I +G +P++   PK+S
Sbjct  135  LQLQHKRPQYEYDITIEAKNPNQRSRILYYEEEGGVSLYFKQKKIAQGNFPNLDQNPKRS  194

Query  324  TDVDLKM----VAKLSGDLRKELNGRRKKL---MALKISVPMEISSWA-KGKKKDISIKC  169
            TD  + +    + +L  ++ K +N         ++L + VP++   W    K+++I + C
Sbjct  195  TDFKVILHNGKIDQLPKEVEKNMNSTNSNQHLSLSLSMDVPIKFKVWGISSKRRNIELSC  254

Query  168  VFKVGSLAKSTDLSEE  121
               V +L K + ++ +
Sbjct  255  SLTVNTLTKLSHVNNQ  270



>ref|XP_009140328.1| PREDICTED: uncharacterized protein LOC103864325 [Brassica rapa]
Length=288

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 119/240 (50%), Gaps = 13/240 (5%)
 Frame = -2

Query  798  DPALTSLTFSLPVQPGEAPE--TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTR  625
             P L +   SLP  P   PE  TYVVQ+PRDQVY  PPPE+AK VE  +     NKK+  
Sbjct  55   SPILATPPRSLP-PPHSIPELETYVVQVPRDQVYWTPPPEHAKYVEERRNNPEKNKKNG-  112

Query  624  LRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVH  445
              K   WF + L+  G +IG I   ++ ++ P  P F++  +  K S       I+L   
Sbjct  113  CSKRLMWFFIILIFFGFIIGAITLILHFVFNPTLPAFAVERLTVKPS----NIEITLRAE  168

Query  444  NINQRMKVSF--GDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKE  271
            N    M VS+     G  SL +KN+ +G+GK+P +S     S +V++K+       +   
Sbjct  169  NPTSNMGVSYMMEKTGMISLTYKNKSLGRGKFPKMSQAASGSDNVNVKLNGSTKNAVMPP  228

Query  270  LNGRRKKLMALKISVPMEISSWAKGKKKDISIKCVFKVGSL--AKSTDL-SEECQADF*N  100
               ++   + L + +  +  +    K K++ + C  KV  L  AK  ++ SE C+++F N
Sbjct  229  RGSKQPVSLVLMMELKADYEAGPLKKNKEVVVTCDVKVKGLLDAKKVEIVSENCESEFKN  288



>ref|XP_008445591.1| PREDICTED: uncharacterized protein LOC103488571 [Cucumis melo]
Length=240

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 112/219 (51%), Gaps = 14/219 (6%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCF-WFlvplvvlgiligt  562
            TYVVQIP+DQ+YR+PPPENA IV+ ++         +R R CCF  FL   +VL ++I  
Sbjct  25   TYVVQIPKDQIYRIPPPENALIVQRHRNPSVVT--SSRRRSCCFRIFLPIFIVLLLIIIL  82

Query  561  ivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFK  382
             +     +  PK P F +   +   S R+  F+I+L + N N    +SF    + SL F+
Sbjct  83   ALLIPPLIALPKPPVFKLTKFKLTPSTRN--FNINLDILNPNSAGSISFKSPSRVSLSFR  140

Query  381  NRVIGKGKYpsvsvkpkkSTDVDLKMVAK--LSGDLRKELNGRRKKLMALKISVPMEISS  208
               +   K+P +        +V L + AK     +L++ +   + KL    +S+ M + +
Sbjct  141  KSQLATTKFPLIRQDHGSKKNVALSLRAKSAFPKELQRRMKSSKTKLHT-SLSLKMNLLA  199

Query  207  WAKGKKKD-----ISIKCVFKVGSLAKSTD-LSEECQAD  109
              KG+  +       + C F V +L K++  LS++C+++
Sbjct  200  ETKGRLSNRRNVKFVVTCSFTVNTLGKTSRILSQDCESE  238



>ref|XP_010510819.1| PREDICTED: uncharacterized protein LOC104787024 [Camelina sativa]
Length=262

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 79/263 (30%), Positives = 128/263 (49%), Gaps = 21/263 (8%)
 Frame = -2

Query  843  MDGRVSPVGGDGRKGDPALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEG  664
            M  RV P       G  +    +   P +P   P TYV+Q+P+DQ+YR+PPPENA  ++ 
Sbjct  1    MAERVYPADSPPESGQFSGNFSSGEFPRKPAPPPSTYVIQVPKDQIYRIPPPENAHRLQ-  59

Query  663  YQEMRSTNKKDTRLRKCCFW-FlvplvvlgiligtivgsINAMYTPKSPK-----FSIAA  502
            Y   +  N+ + R   CCF  FL  +  + +L G     +  +Y P++PK     FS++ 
Sbjct  60   YLSRKKPNRSNCR---CCFCSFLAVVFTIAVLAGLSFSVLYLIYRPEAPKYSVEGFSVSG  116

Query  501  IQYKKSAR-HPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRV-IGKGKYpsvsvkpkk  328
            I    S+   P F++++   N N ++ V + + G S  V+ N V +  G  P+     K 
Sbjct  117  INLNSSSPISPRFNVTVRSRNGNGKIGVYYHEVGSSVDVYYNGVDLCNGVLPAFYQPAKN  176

Query  327  STDVDLKMVA----KLSGDLRKEL-NGRRKKLMA--LKISVPMEISSWA-KGKKKDISIK  172
             T V LK+      +L+  +RKE+ N   KK +   LK+  P+ I   + K     + ++
Sbjct  177  VTVVKLKLSGSSKIQLTSGMRKEMRNDVSKKTLPFRLKVKAPVRIKVGSVKTWTMIVKVE  236

Query  171  CVFKVGSL-AKSTDLSEECQADF  106
            C   V  L A S  +S +C+ DF
Sbjct  237  CDVTVDKLTAPSRIVSRKCRHDF  259



>emb|CDY13776.1| BnaA09g42780D [Brassica napus]
Length=358

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 118/234 (50%), Gaps = 13/234 (6%)
 Frame = -2

Query  795  PALTSLTFSLPVQPGEAPE--TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRL  622
            P L + + SLP Q    PE  TYVVQ+PRDQ+Y  PPPE+AK VE  +     NKK+   
Sbjct  56   PILDTPSRSLPPQ-DSIPELETYVVQVPRDQIYWTPPPEHAKYVEKLRNNPDRNKKNG-C  113

Query  621  RKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHN  442
             K   WF + LV  G ++G I   ++ ++ P  P F++  +  K S    +F ++L   N
Sbjct  114  SKRLMWFFIILVAFGFILGAITLILHFIFNPALPIFAVERLNVKPS----SFEVTLRAEN  169

Query  441  INQRMKVSF--GDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKEL  268
                M VS+     G  SL +KN+ +G+GK+P +      S  V++K+       +    
Sbjct  170  PTSNMGVSYVMKPNGVVSLTYKNKRLGRGKFPKMFQAASGSDKVNVKLDGSTKNAVMPPR  229

Query  267  NGRRKKLMALKISVPMEISSWAKGKKKDISIKCVFKVGSL--AKSTDL-SEECQ  115
              ++   + LK+ +  +  +    K K++++ C  KV  L  AK  ++ SE C+
Sbjct  230  GSKQAVSLVLKMELKADYEAGPVKKNKEVAVTCDVKVKGLLDAKKVEIVSENCE  283



>ref|XP_002878602.1| hypothetical protein ARALYDRAFT_900669 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54861.1| hypothetical protein ARALYDRAFT_900669 [Arabidopsis lyrata subsp. 
lyrata]
Length=288

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/219 (32%), Positives = 111/219 (51%), Gaps = 10/219 (5%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligt  562
            ETYVVQ+PRDQVY  PPPE+AK VE  ++    NKK     K   WF + LV+ G ++G 
Sbjct  75   ETYVVQVPRDQVYWTPPPEHAKYVEKRRKNPEKNKKKG-CSKRLLWFFIILVIFGFILGA  133

Query  561  ivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSF--GDGGKSSLV  388
            I+  ++  + P  P F++  +  K S     F ++L   N    M V +     G  SL 
Sbjct  134  IILILHFAFNPTLPVFAVERLTVKPS----NFEVTLRAENPTSNMGVRYMMKKNGVVSLT  189

Query  387  FKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVPMEISS  208
            +KN+ +G G +P +S     S  V++K+       + +    +   +M LK+ +  E  +
Sbjct  190  YKNKSLGGGTFPGLSQAASGSDKVNVKLNGSTKNAVVQPRGSKLPLVMMLKMELNAEYEA  249

Query  207  WAKGKKKDISIKCVFKVGSL--AKSTDL-SEECQADF*N  100
                + K++ + C  KV  L  AK  ++ SE C+++F N
Sbjct  250  GPVKRNKEVVVTCDLKVKGLLDAKKVEIVSENCESEFKN  288



>ref|XP_010531390.1| PREDICTED: uncharacterized protein LOC104807704 isoform X2 [Tarenaya 
hassleriana]
Length=291

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 116/222 (52%), Gaps = 21/222 (9%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCC---FWFlvplvvlgil  571
            ETYVVQ+PRDQVY VPPPE+AKI E     R    +  +   CC    WFL  L+VLGI+
Sbjct  75   ETYVVQVPRDQVYWVPPPEHAKIAE-----RRRKPEKAKKGGCCKRLAWFLFVLIVLGII  129

Query  570  igtivgsINAMYTPKSPKFSIA--AIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKS  397
             G I   +N ++ P  P F+I   A++ +KS R  +F I+L   N    M V +      
Sbjct  130  AGVIALVVNFVFRPVPPLFTIENFAVKTQKS-RILSFDITLRAENPTSNMGVDYMQSAGV  188

Query  396  SLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVPME  217
            S+ +KN+ +G+G++P +S     S  V L    KL G     L    K+ + L ++  ++
Sbjct  189  SISYKNKNLGRGRFPKLSQSASGSDKVRL----KLDGSKNASLPPESKQPVKLVLTADLD  244

Query  216  ISSWAKG---KKKDISIKCVFKVGSL--AKSTDLSEECQADF  106
             + +  G   + K +++ C  KV  L   K   +SE C+++F
Sbjct  245  -AKYGVGPLKRNKGVTVTCYVKVKGLDAKKVQIVSENCESEF  285



>ref|XP_010531389.1| PREDICTED: uncharacterized protein LOC104807704 isoform X1 [Tarenaya 
hassleriana]
Length=291

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 116/222 (52%), Gaps = 21/222 (9%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCC---FWFlvplvvlgil  571
            ETYVVQ+PRDQVY VPPPE+AKI E     R    +  +   CC    WFL  L+VLGI+
Sbjct  75   ETYVVQVPRDQVYWVPPPEHAKIAE-----RRRKPEKAKKGGCCKRLAWFLFVLIVLGII  129

Query  570  igtivgsINAMYTPKSPKFSIA--AIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKS  397
             G I   +N ++ P  P F+I   A++ +KS R  +F I+L   N    M V +      
Sbjct  130  AGVIALVVNFVFRPVPPLFTIENFAVKTQKS-RILSFDITLRAENPTSNMGVDYMQSAGV  188

Query  396  SLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVPME  217
            S+ +KN+ +G+G++P +S     S  V L    KL G     L    K+ + L ++  ++
Sbjct  189  SISYKNKNLGRGRFPKLSQSASGSDKVRL----KLDGSKNASLPPESKQPVKLVLTADLD  244

Query  216  ISSWAKG---KKKDISIKCVFKVGSL--AKSTDLSEECQADF  106
             + +  G   + K +++ C  KV  L   K   +SE C+++F
Sbjct  245  -AKYGVGPLKRNKGVTVTCYVKVKGLDAKKVQIVSENCESEF  285



>gb|ABK28506.1| unknown [Arabidopsis thaliana]
Length=292

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 68/222 (31%), Positives = 112/222 (50%), Gaps = 16/222 (7%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKC---CFWFlvplvvlgil  571
            ETYVVQ+PRDQVY  PPPE+AK    Y E RS N +  + + C     WF + LV+ G L
Sbjct  78   ETYVVQVPRDQVYWTPPPEHAK----YVEKRSKNPEKNKKKGCSKRLLWFFIILVIFGFL  133

Query  570  igtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSF--GDGGKS  397
            +G I+  ++  + P  P F++  +    S     F ++L   N    M V +     G  
Sbjct  134  LGAIILILHFAFNPTLPVFAVERLTVNPS----NFEVTLRAENPTSNMGVRYMMEKNGVV  189

Query  396  SLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVPME  217
            SL +KN+ +G GK+P +S     S  V++K+       + +    ++  ++ L + +  E
Sbjct  190  SLTYKNKSLGSGKFPGLSQAASGSDKVNVKLNGSTKNAVVQPRGSKQPVVLMLNMELKAE  249

Query  216  ISSWAKGKKKDISIKCVFKVGSL--AKSTDL-SEECQADF*N  100
              +    + K++ + C  KV  L  AK  ++ SE C+++F N
Sbjct  250  YEAGPVKRNKEVVVTCDVKVKGLLDAKKVEIVSENCESEFKN  291



>ref|XP_008795594.1| PREDICTED: uncharacterized protein LOC103711288 [Phoenix dactylifera]
Length=299

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 104/226 (46%), Gaps = 15/226 (7%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligt  562
            ETYVVQ+P++Q+YR+PPPENAK+VE Y+   +   +   +  C  W +   VV GIL  T
Sbjct  74   ETYVVQVPKEQIYRIPPPENAKLVEQYRNNHNNRHQRRPIIPCLKWTIGVAVVAGILAAT  133

Query  561  ivgsINAMYTPKSPKFSIAAIQYKK-------SARHPTFHISLHVHNINQRMKVSFGDGG  403
            I      +  P  P FS+  +  K        S   P +H ++ V N + RM  S+  GG
Sbjct  134  IAIIYFLVVRPADPSFSVTRLVLKNIPNPRGGSPPKPEYHFTMSVDNPSLRMGYSYAAGG  193

Query  402  KSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LSGDLRKELNGRRKKL---MA  241
            K+ L      I  GK  +     + +T   L +      L   ++  L G +  +   + 
Sbjct  194  KAILAHHGVEIAVGKTQAFHQGYQNTTTYQLVLQGSHILLPKQIQSSLKGSKDVIPLSLM  253

Query  240  LKISVPMEISSWAKGKKKDISIKCVFKVGSLAKSTDL-SEECQADF  106
            ++ SV   I     G  K + + C  KV  L K   + S+ C++ F
Sbjct  254  IEFSVRKTIGVLEMG-NKSMDVTCDIKVSGLTKEARIVSQGCKSKF  298



>ref|NP_179808.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
 gb|AAD23622.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABE65847.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
 gb|AEC07275.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
Length=291

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 68/222 (31%), Positives = 112/222 (50%), Gaps = 16/222 (7%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKC---CFWFlvplvvlgil  571
            ETYVVQ+PRDQVY  PPPE+AK    Y E RS N +  + + C     WF + LV+ G L
Sbjct  78   ETYVVQVPRDQVYWTPPPEHAK----YVEKRSKNPEKNKKKGCSKRLLWFFIILVIFGFL  133

Query  570  igtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSF--GDGGKS  397
            +G I+  ++  + P  P F++  +    S     F ++L   N    M V +     G  
Sbjct  134  LGAIILILHFAFNPTLPVFAVERLTVNPS----NFEVTLRAENPTSNMGVRYMMEKNGVV  189

Query  396  SLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVPME  217
            SL +KN+ +G GK+P +S     S  V++K+       + +    ++  ++ L + +  E
Sbjct  190  SLTYKNKSLGSGKFPGLSQAASGSDKVNVKLNGSTKNAVVQPRGSKQPVVLMLNMELKAE  249

Query  216  ISSWAKGKKKDISIKCVFKVGSL--AKSTDL-SEECQADF*N  100
              +    + K++ + C  KV  L  AK  ++ SE C+++F N
Sbjct  250  YEAGPVKRNKEVVVTCDVKVKGLLDAKKVEIVSENCESEFKN  291



>ref|XP_006586382.1| PREDICTED: uncharacterized protein LOC102661744 [Glycine max]
Length=250

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 119/238 (50%), Gaps = 19/238 (8%)
 Frame = -2

Query  768  LPVQPGE---APETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNK-----KDTRLRKC  613
            LP  PG    A  TY+VQ P+DQVYRVPP ENA IVE Y+   +  K          R+ 
Sbjct  12   LPPPPGRHAPAAGTYIVQFPKDQVYRVPPRENALIVEQYRNPATAKKRRGGCCCCCNRRV  71

Query  612  CFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSARH-----PTFHISLHV  448
               F + +  +  ++G  + ++  +++P  PKF+++ +   ++ ++       + +SL  
Sbjct  72   LITFALVVTTIVAVVGITLATLYFIFSPAGPKFTVSHVAVNRNNKNSQGAAAQYEVSLRA  131

Query  447  HNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKEL  268
             N N+++ + + +G  S L+F    + +GK+P++     ++++V L++    SG   + +
Sbjct  132  RNPNEKLAIQYQEGDVSLLLFDESKVAEGKFPTLEQGGGEASEVKLELTGS-SGAFPRGM  190

Query  267  NGRRKKLMALKISVPMEISSWAKGKKK---DISIKCVFKVGSLAKSTD-LSEECQADF  106
            +G     + LK+ + + I     G +      ++ C FKV  L   T  LS++C   F
Sbjct  191  HG-GDAAVDLKLEIKLAIRIRTAGLETWGMSSNVACQFKVSGLGNDTRILSQQCDTKF  247



>ref|XP_010429134.1| PREDICTED: uncharacterized protein LOC104713661 [Camelina sativa]
Length=288

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 116/240 (48%), Gaps = 13/240 (5%)
 Frame = -2

Query  798  DPALTSLTFSLPVQPGEAPE--TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTR  625
             P  T+   SLP  P   PE  TYVV++PRDQVY  PPPE+AK VE  ++    NKK   
Sbjct  55   SPLPTTTLSSLP-PPDTIPELETYVVRVPRDQVYWTPPPEHAKYVEKRRKNPEKNKKKG-  112

Query  624  LRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVH  445
              K   WF + LVV G ++G I   ++  + P  P F++  +  K S     F + L   
Sbjct  113  CSKRLMWFFIILVVFGFILGAITIILHFAFNPTLPLFAVERLTAKPS----NFEVMLRAE  168

Query  444  NINQRMKVSF--GDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKE  271
            N    M V +     G  SL +KN+ +G GK+P +S     S  V++K+         + 
Sbjct  169  NPTSNMGVRYVMKKNGVVSLTYKNKRLGSGKFPGLSQAASGSDKVNVKLDGSTKNAAVQP  228

Query  270  LNGRRKKLMALKISVPMEISSWAKGKKKDISIKCVFKVGSLA---KSTDLSEECQADF*N  100
               ++  +M L + +  E  +    + KD+++ C  KV  L    K   +SE C+++F N
Sbjct  229  RGSKQPLVMILTMELKAEYEAGPVKRNKDVAVTCDVKVKGLLDGKKVEIVSENCESEFKN  288



>gb|KDO56608.1| hypothetical protein CISIN_1g041440mg, partial [Citrus sinensis]
Length=237

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 70/237 (30%), Positives = 129/237 (54%), Gaps = 27/237 (11%)
 Frame = -2

Query  771  SLPVQPGEA--PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCC---F  607
            SL + P E     TYVVQ+P+DQ+YRVPPPENA+IVE Y+     N  + R   CC    
Sbjct  8    SLDLTPEEDYDSNTYVVQVPKDQIYRVPPPENARIVEKYR-----NPMNKRRNSCCTRVC  62

Query  606  WFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRM  427
            W ++ L V+GI IG  +  ++ +Y+PK     IA +  K  +R P +  ++ V N N+ +
Sbjct  63   WIILVLFVIGISIGITLVILHKVYSPKGAILFIADVHVKNQSR-PRYEFTMKVKNPNENV  121

Query  426  KVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LSGDLRKELNGRR  256
             +S+ + G + L+ K + +  GK+P +  +   S +V + +      +  ++ K ++ ++
Sbjct  122  AISYENDGDAFLLLKKKKLASGKFPQLEQEGGDSRNVRITLTGSNTVVPDEVSKSMHDKK  181

Query  255  -KKLMALKISVPME-------ISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQA  112
             ++ ++L++ + ++       ++ W+    KD+ + C FKV +L   T  LS++C  
Sbjct  182  TERAVSLQLEMNLKGEMNIGFLNLWS----KDMHVVCDFKVSTLRTGTKVLSQKCDT  234



>ref|XP_010472212.1| PREDICTED: uncharacterized protein LOC104751860 [Camelina sativa]
Length=288

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 76/239 (32%), Positives = 116/239 (49%), Gaps = 13/239 (5%)
 Frame = -2

Query  795  PALTSLTFSLPVQPGEAPE--TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRL  622
            P  T+   SLP  P   PE  TYVV++PRDQVY  PPPE+AK VE  ++    NKK    
Sbjct  56   PLPTTTLSSLP-PPDTIPELETYVVRVPRDQVYWTPPPEHAKYVEKRRKNPEKNKKKG-C  113

Query  621  RKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHN  442
             K   WF + LVV G ++G I   ++  + P  P F++  +  K S     F + L   N
Sbjct  114  SKRLMWFFIILVVFGFILGAITIILHFAFNPTLPIFAVERLTAKSS----NFEVMLRAEN  169

Query  441  INQRMKVSF--GDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKEL  268
                M V +     G  SL +KN+ +G GK+P +S     S  V++K+         +  
Sbjct  170  PTSNMGVRYVMKKDGVVSLTYKNKRLGSGKFPGLSQAAFGSDKVNVKLDGSTKNAAVQPR  229

Query  267  NGRRKKLMALKISVPMEISSWAKGKKKDISIKCVFKVGSLA---KSTDLSEECQADF*N  100
              ++  +M L + +  E  +    + KD+++ C  KV  L    K   +SE C+++F N
Sbjct  230  GSKQPLVMILTMELKAEYEAGPVKRNKDVAVTCDVKVKGLLDGKKVEIVSENCESEFKN  288



>ref|XP_010416974.1| PREDICTED: uncharacterized protein LOC104702758 [Camelina sativa]
Length=288

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 69/219 (32%), Positives = 108/219 (49%), Gaps = 10/219 (5%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligt  562
            ETYVV++PRDQVY  PPPE+AK VE  ++    NKK     K   WF + LVV G ++G 
Sbjct  75   ETYVVRVPRDQVYWTPPPEHAKYVEKRRKNPEKNKKKG-CSKRLMWFFIILVVFGFILGA  133

Query  561  ivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSF--GDGGKSSLV  388
            I   ++  + P  P F++  +  K S     F + L   N    M V +     G  SL 
Sbjct  134  ITIILHFAFNPTLPLFAVERLTAKPS----NFEVMLRAENPTSNMGVRYVMKKNGVVSLT  189

Query  387  FKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVPMEISS  208
            +KN+ +G GK+P +S     S  V++K+         +    ++  +M L + +  E  +
Sbjct  190  YKNKRLGSGKFPGLSQAASGSDKVNVKLDGSTKNAAVQPRGSKQPLVMILTMELKAEYEA  249

Query  207  WAKGKKKDISIKCVFKVGSLA---KSTDLSEECQADF*N  100
                + KD+++ C  KV  L    K   +SE C+++F N
Sbjct  250  GPVKRNKDVAVTCDVKVKGLLDGKKVEIVSENCESEFKN  288



>ref|XP_006428168.1| hypothetical protein CICLE_v10027435mg [Citrus clementina]
 ref|XP_006464251.1| PREDICTED: uncharacterized protein LOC102625937 [Citrus sinensis]
 gb|ESR41408.1| hypothetical protein CICLE_v10027435mg [Citrus clementina]
Length=278

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 70/237 (30%), Positives = 130/237 (55%), Gaps = 27/237 (11%)
 Frame = -2

Query  771  SLPVQPGEAPE--TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCF---  607
            SL + P E  +  TYVVQ+P+DQ+YRVPPPENA+IVE Y+     N  + R   CC    
Sbjct  49   SLDLTPEEDYDSNTYVVQVPKDQIYRVPPPENARIVEKYR-----NPMNKRRNSCCTRVC  103

Query  606  WFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRM  427
            W ++ L V+GI IG  +  ++ +Y+PK     IA +  K  +R P +  ++ V N N+ +
Sbjct  104  WIILVLFVIGISIGITLVILHKVYSPKGAILFIADVHVKNQSR-PRYEFTMKVKNPNENV  162

Query  426  KVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LSGDLRKELNGRR  256
             +S+ + G + L+ K + +  GK+P +  +   S +V + +      +  ++ K ++ ++
Sbjct  163  AISYENDGDAFLLLKKKKLASGKFPQLEQEGGDSRNVRITLTGSNTVVPDEVSKSMHDKK  222

Query  255  -KKLMALKISVPME-------ISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQA  112
             ++ ++L++ + ++       ++ W+    KD+ + C FKV +L   T  LS++C  
Sbjct  223  TERAVSLQLEMNLKGEMNIGFLNLWS----KDMHVVCDFKVSTLRTGTKVLSQKCDT  275



>ref|XP_009339740.1| PREDICTED: uncharacterized protein LOC103931936 [Pyrus x bretschneideri]
Length=326

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 104/207 (50%), Gaps = 17/207 (8%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYVVQIP+DQ+YRVPPPENA IVE ++     NKK +     C      +  L +++   
Sbjct  41   TYVVQIPKDQIYRVPPPENALIVERHR--NPENKKSSCCTIRCLIIGAIVFSLCLILSIT  98

Query  558  vgsINAMYTPKSPKFSIAAIQYKKSAR--------HPTFHISLHVHNINQRMKVSFGDGG  403
            + S++    PK PKFSI+ +  K            HP + +SL V+N N    +++    
Sbjct  99   LLSLSLTVKPKEPKFSISNVHVKNPKSKSDTGKNLHPGYEVSLKVNNPNGH-GINYEGSE  157

Query  402  KSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LSGDLRKELNGRRKKL---MA  241
             +SL+ K + IGKGK+P    +   S  V L +      L  ++ K +     K+   + 
Sbjct  158  GASLLLKEKRIGKGKFPLKKQEKDSSATVKLVLDGSKGALPREVEKSIENTNSKMHLPLT  217

Query  240  LKISVPMEISSWAKGKKKDISIKCVFK  160
            LK+ + +++  + K  K +  ++C F+
Sbjct  218  LKMDLSVKVKGFIKTWKMETEVECHFQ  244



>gb|KFK32835.1| hypothetical protein AALP_AA6G293300 [Arabis alpina]
Length=288

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 118/239 (49%), Gaps = 13/239 (5%)
 Frame = -2

Query  795  PALTSLTFSLPVQPGEAPE--TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRL  622
            P  T+   SLP  P   PE  TYVVQ+PRDQVY  PPPE+AK +E  +     NKK +  
Sbjct  56   PVPTTPFSSLP-PPDSIPELETYVVQVPRDQVYWTPPPEHAKFLEKRRNNPEKNKK-SGC  113

Query  621  RKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHN  442
             K   WF + LV+ G+ +G ++  ++ ++ P  P F++     K S     F ++L   N
Sbjct  114  SKRLMWFFIILVLFGLTLGALILILHFVFNPALPVFAVEKFSVKPS----NFEVTLRADN  169

Query  441  INQRMKVSF--GDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKEL  268
                M VS+     G  SL +K++ +G+GK+P +S     +  + +K+            
Sbjct  170  PTSNMGVSYMMKKNGVVSLTYKDKSLGRGKFPRLSQVASGTDRIHVKLEGSTKNAAMPPR  229

Query  267  NGRRKKLMALKISVPMEISSWAKGKKKDISIKCVFKVGSL--AKSTDL-SEECQADF*N  100
              +    + LKI +  +  +    + K++ + C  KV  L  AK  ++ SE C+++F N
Sbjct  230  GSKLPVSLVLKIELKADYEAGPVKRNKELVVTCDVKVKGLLDAKKVEIVSENCESEFKN  288



>ref|XP_008375273.1| PREDICTED: uncharacterized protein LOC103438483 [Malus domestica]
Length=282

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 124/242 (51%), Gaps = 22/242 (9%)
 Frame = -2

Query  780  LTFSLPVQPGEAP---ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCC  610
            L  S P  P  A     TYVVQ+P+DQ+Y VPPPENA IVE +Q+    ++K  R   C 
Sbjct  43   LVISQPQNPSVATFRSGTYVVQVPKDQIYHVPPPENAYIVERHQD---PSRKRKRPLCCN  99

Query  609  FWFlvplvvlgiligtivgsINAMYT-PKSPKFSIA-AIQYKKSARHPTFHISLHVHNIN  436
             + +  L  + +L+  +V   + M+   ++PKFS+   + + KS   P + ++L V N N
Sbjct  100  LYCIGILAFIVLLVVMLVTIFSVMFAKSENPKFSVERVVVHSKSNGRPDYSLTLRVRNPN  159

Query  435  QRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LSGDLRKELN  265
             R+ + + +GG  SL FK + I  GKYPS++    KS +V + +      L  +++K L 
Sbjct  160  SRVAIVY-NGGGXSLHFKQKTIANGKYPSLTQGTGKSKEVTIVVHGANVILPKEIKKSLG  218

Query  264  ----GRRKKLMALKISVPMEISSWAK-GKKKDISIK----CVFKVGSLAKSTD-LSEECQ  115
                    K + + +S+ M I +  + G  K  S+K    C   V  L+K T  L +EC+
Sbjct  219  VSESSSSTKKVQVSLSLNMNIPARLRIGTLKSRSMKFHATCDITVDELSKRTKVLKQECE  278

Query  114  AD  109
              
Sbjct  279  TQ  280



>gb|KDP22637.1| hypothetical protein JCGZ_02795 [Jatropha curcas]
 gb|KDP41361.1| hypothetical protein JCGZ_15768 [Jatropha curcas]
Length=242

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 66/216 (31%), Positives = 107/216 (50%), Gaps = 15/216 (7%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFl--vplvvlgilig  565
            TY+VQIP+DQ+YR+PPPENA+I E +++   + ++ +     C WF   + + ++ I +G
Sbjct  33   TYIVQIPKDQIYRIPPPENAEIFERHRKPEQSKRRSS----ICSWFSCFIIIALIIIAVG  88

Query  564  tivgsINAMYTPKSPKFSIAAIQYKKSARH--PTFHISLHVHNINQRMKVSFGDGGKSSL  391
              +G   +   PK+PKF I    +  S  H  P + I L V+N N +  + +   G  SL
Sbjct  89   LALGLSFSFPEPKNPKFKIQRFVFVNSTSHSQPFYDIRLQVYNPNAKSDILYKKEGVISL  148

Query  390  VFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVP--ME  217
             FK + +   K+P        ST    K +     +       R K  ++LK+ +P  M+
Sbjct  149  FFKQQKLAAAKFPHFLQNDNTST---AKRILLKGSNTNWSSRTRGKVSLSLKMDIPVRMK  205

Query  216  ISSWAKGKKKDISIKCVFKVGSLAKSTDL-SEECQA  112
            IS +  G    ++I C   V  L K   L SE+C+ 
Sbjct  206  ISRFKTGDAV-LAIACDLTVDKLGKGLKLVSEKCKT  240



>ref|XP_011043567.1| PREDICTED: uncharacterized protein LOC105138991 [Populus euphratica]
Length=229

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 102/207 (49%), Gaps = 14/207 (7%)
 Frame = -2

Query  771  SLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvp  592
            + P QP   P TYV+QIPRDQ+YRVPPP NA + +  +       K      C +   + 
Sbjct  22   ATPNQPFFEPGTYVIQIPRDQIYRVPPPGNASVSQRQRNPHQKKHKSCCGCSCFWCCFIA  81

Query  591  lvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSA------RHPTFHISLHVHNINQR  430
            +V    +  TIVG    +  PK P+F +     KK         +  + I L+VHN N+R
Sbjct  82   IVSGIAVAVTIVGLSFILLKPKDPEFQVQRFVVKKPQVSKNKYSYTNYDIRLNVHNSNRR  141

Query  429  MKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSG---DLRKELNGR  259
              + +  GG  SL F+ + +  GK+P+     K STD+ + +     G   D++  L  R
Sbjct  142  SSILYQQGGAVSLSFRQQNVATGKFPTFHQGHKNSTDIGIVLKGTRVGLPKDVQNSLRNR  201

Query  258  RKKL---MALKISVP--MEISSWAKGK  193
            + K+    +LK++VP  M+ S +  G+
Sbjct  202  KSKVPHSFSLKMNVPVKMKTSGFKTGR  228



>ref|XP_010064203.1| PREDICTED: uncharacterized protein LOC104451180 [Eucalyptus grandis]
 gb|KCW66493.1| hypothetical protein EUGRSUZ_F00299 [Eucalyptus grandis]
Length=267

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 70/237 (30%), Positives = 116/237 (49%), Gaps = 19/237 (8%)
 Frame = -2

Query  765  PVQPGEAPE-----TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWF  601
            P++P E  E     TYVVQ+P+DQVYR+PPPENA IV+ Y+   + +K+      C    
Sbjct  29   PLRPNEPREGFPRGTYVVQVPKDQVYRIPPPENAMIVKRYRTPIAKSKRSCCCCCCILCL  88

Query  600  lvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSAR------HPTFHISLHVHNI  439
            L+  + + I++G +V   +     + P F I     K + R         F I     N 
Sbjct  89   LLIFIAVLIVLGVLVSISSIFIKTEDPVFCIDHFLVKNTPRSSQGNVEHEFDIRTRAKNP  148

Query  438  NQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSG---DLRKEL  268
            N R  + F +GGKSSL+F  + +  G +P+     K +T   L +     G   ++ + +
Sbjct  149  NGRSGILFKEGGKSSLLFDQKEVAAGTFPTFYQSKKNTTTSQLILHDSSDGSSKEIEESM  208

Query  267  NGRRKK---LMALKISVPMEIS-SWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQA  112
             G + K    ++L I VP  ++    + +  +I + C F+V +L K T  LS++C+ 
Sbjct  209  KGTKSKPNLALSLAIKVPARMTVGLFRKQDVNIVVSCNFEVDTLVKGTRILSQQCRT  265



>ref|XP_004504122.1| PREDICTED: uncharacterized protein LOC101495472 [Cicer arietinum]
Length=266

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/229 (28%), Positives = 113/229 (49%), Gaps = 24/229 (10%)
 Frame = -2

Query  735  YVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCC------FWFlvplvvlgi  574
            Y+VQ P+DQ+YRVPP ENA IVE Y++ R+TN K+     CC          + L  +  
Sbjct  40   YIVQFPKDQIYRVPPRENALIVERYRKPRNTNDKNGGRGCCCRCPRVLLTIALILFAIIA  99

Query  573  ligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKSS  394
            ++G  + ++  ++ P  P FSI     K  +R P + ISL   N N+++ +++ +  + +
Sbjct  100  VVGITLATLFFIFNPTGPTFSITHFDVKNISRPPHYEISLRAKNPNEKLGITY-ENSEVN  158

Query  393  LVFKNRVIGKGKYpsvsvkpkkSTD---VDL--------KMVAKLSGDLRKELNGRRKKL  247
            ++F+   +  GK+P +  + + ++    VD+        K +AK  GD +          
Sbjct  159  MLFEGTKVAAGKFPMLLEQRRDASTMFKVDVMGMNRALPKKMAKSMGDAKSNTPLTFDLD  218

Query  246  MALKISV-PMEISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQADF  106
            M L I +   E+++W        ++ C F+V  L      LS++C  +F
Sbjct  219  MRLWIRITAAELNTWVMKS----NVVCRFEVNDLGSDPRILSQQCDTNF  263



>ref|XP_009615252.1| PREDICTED: uncharacterized protein LOC104108002 [Nicotiana tomentosiformis]
Length=116

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 69/116 (59%), Gaps = 8/116 (7%)
 Frame = -2

Query  429  MKVSFGDG--GKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKM----VAKLSGDLRKEL  268
            M VSFG+G  GK++L+FK   IG+GKYPS+S K + S ++ L +      KL GD+ K L
Sbjct  1    MDVSFGEGKEGKATLIFKKHDIGQGKYPSISQKAEVSNNIHLNLDFGSNGKLPGDIMKSL  60

Query  267  NGRRKKL-MALKISVPMEISSWAKGKKKDISIKCVFKVGSLA-KSTDLSEECQADF  106
               +K + M L I   MEI SW K  KKD++I C F V  L  KS  L+ EC  DF
Sbjct  61   EDEKKPIIMTLMIHAKMEIKSWVKNMKKDLTITCDFDVEGLTKKSKILANECITDF  116



>ref|XP_010444899.1| PREDICTED: uncharacterized protein LOC104727495 [Camelina sativa]
 ref|XP_010444900.1| PREDICTED: uncharacterized protein LOC104727496 [Camelina sativa]
 ref|XP_010444901.1| PREDICTED: uncharacterized protein LOC104727497 [Camelina sativa]
Length=280

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 65/218 (30%), Positives = 119/218 (55%), Gaps = 20/218 (9%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligt  562
            ETYVVQ+PRDQVY  PPP+NA+IVE  +             K C W  + +VV+G++I  
Sbjct  75   ETYVVQVPRDQVYWTPPPDNARIVERRRNSEPGKNNKRFCSKRCMWIFISVVVIGLIICA  134

Query  561  ivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFK  382
            I   +  ++ P+ P F++  ++    +RH  F I L   N    M V++   G  SL++K
Sbjct  135  IAFIVGFVFKPEPPVFNVNKLE---KSRH--FEIMLTSKNPTSTMWVTY--KGLVSLMYK  187

Query  381  NRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVPMEISSWA  202
            N+ +G+G +P +S+    S  V+L++    + D+         ++++L +++ +  + + 
Sbjct  188  NKNLGQGNFPELSLAVSGSHTVNLELEGSKNADVLP------PEVVSLVLTMGLN-AGFG  240

Query  201  KG---KKKDISIKCVFKVGSL--AKSTDL-SEECQADF  106
             G   + K++++ C  KV  L  AK+ ++ SE C+++F
Sbjct  241  TGLVKRDKEVAVTCYIKVKGLLDAKNVEIVSESCESEF  278



>ref|XP_010446533.1| PREDICTED: uncharacterized protein LOC104729297 [Camelina sativa]
Length=283

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 65/218 (30%), Positives = 118/218 (54%), Gaps = 20/218 (9%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligt  562
            ETYVVQ+PRDQVY  PPP+NA+IVE  +       K     K C W  + +V +G++I  
Sbjct  78   ETYVVQVPRDQVYWTPPPDNARIVERRRNSEPGKNKKRLCSKRCMWIFISVVFIGLIICA  137

Query  561  ivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFK  382
            I   +  ++ P+ P F++  ++    +RH  F I L   N    M V++   G  SL++K
Sbjct  138  IAFIVGFVFKPEPPVFNVNKLE---KSRH--FEIMLTSKNPTSTMWVTY--KGLVSLMYK  190

Query  381  NRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVPMEISSWA  202
            N+ +G+G +P +S+    S  V+L++    + D+         ++++L +++ +  + + 
Sbjct  191  NKNLGQGNFPELSLAVSGSHTVNLELEGSKNADMLP------PEVVSLVLTMGLN-AGFG  243

Query  201  KG---KKKDISIKCVFKVGSL--AKSTDL-SEECQADF  106
             G   + K +++ C  KV  L  AK+ ++ SE C+++F
Sbjct  244  TGLVKRDKKVAVTCDIKVKGLLDAKNVEIVSESCESEF  281



>ref|XP_009369674.1| PREDICTED: uncharacterized protein LOC103959062 [Pyrus x bretschneideri]
Length=269

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 107/186 (58%), Gaps = 13/186 (7%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYV+Q+P+DQ+Y VPPPENA IVE +Q+    ++K  R   C  + +  L  + +L+  +
Sbjct  59   TYVIQVPKDQIYHVPPPENAYIVERHQD---PSRKRKRPLCCNLYCIGILAFIVLLVVML  115

Query  558  vgsINAMYT-PKSPKFSIA-AIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVF  385
            +   + M+   ++PKFS+   + + KS   P + ++L V N N R+ + + +GG +SL F
Sbjct  116  ITIFSVMFAKSENPKFSVERVVVHSKSNGRPDYSLTLRVRNPNSRVAIMY-NGGGASLHF  174

Query  384  KNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LSGDLRKEL----NGRRKKLMALKISV  226
            K + I +GKYPS +    KS +V + + +    L  +++K L    +   KK + + +S+
Sbjct  175  KQKTIAEGKYPSFTQGTGKSKEVTIVVHSANIILPKEIKKSLGVSESNSSKKKVQVSLSL  234

Query  225  PMEISS  208
             M IS+
Sbjct  235  NMNISA  240



>ref|XP_007136234.1| hypothetical protein PHAVU_009G029700g [Phaseolus vulgaris]
 gb|ESW08228.1| hypothetical protein PHAVU_009G029700g [Phaseolus vulgaris]
Length=250

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/220 (30%), Positives = 114/220 (52%), Gaps = 14/220 (6%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            P T+VV++P+DQVYR P PENA + E ++       K +R   CC    +    L IL+G
Sbjct  33   PSTFVVRVPKDQVYRFPNPENAHLAELHKNSPPKKAKTSRCCLCCILLSIVFFFLLILLG  92

Query  564  tivgsINAM-YTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLV  388
             ++G + +M ++PK PKFS+   ++  +   P + I+L V+N N  + +S+      +L 
Sbjct  93   GLLGGLFSMFFSPKDPKFSVE--RFNVAETKPKYDITLKVYNSNSGVGISYKSNSHVTLS  150

Query  387  FKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVPMEISS  208
               + I  G YPS+S  P+ +T   + +    +G   K L   + K   + ++  + I+S
Sbjct  151  QNGKEIANGDYPSLSQDPRDTTSFGVTLKGSTTGLANKALKNTKTK---VPLAYSLAINS  207

Query  207  WAKGK-----KKDIS--IKCVFKVGSLAKSTDL-SEECQA  112
             A+ K      + I+  + C  K+  L K+T + S++CQ 
Sbjct  208  RARMKMGLLRSRTITFHVSCNIKLDKLPKTTQIVSQQCQT  247



>ref|XP_010417852.1| PREDICTED: uncharacterized protein LOC104703524 [Camelina sativa]
Length=262

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 76/263 (29%), Positives = 122/263 (46%), Gaps = 21/263 (8%)
 Frame = -2

Query  843  MDGRVSPVGGDGRKGDPALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEG  664
            M  RV P       G  +    +   P +P   P TYV+Q+P+DQ+YR+PPPENA  ++ 
Sbjct  1    MAERVYPADSPPESGQFSGNFSSGEFPRKPAPPPSTYVIQVPKDQIYRIPPPENAHRLQ-  59

Query  663  YQEMRSTNKKDTRLRKCCFW-FlvplvvlgiligtivgsINAMYTPKSPK-----FSIAA  502
            Y   +  N+ + R   CCF  FL  +  L +L G     +  +Y P++PK     FS++ 
Sbjct  60   YLSRKKPNRSNCR---CCFCSFLAVVFTLAVLAGLSFAVLYLVYRPEAPKYSVEGFSVSG  116

Query  501  IQYKKSAR-HPTFHISLHVHNINQRMKVSFGDGGKSSLV-FKNRVIGKGKYpsvsvkpkk  328
            I    S+   P F++++   N N ++ V + + G S  V +K   +  G  P+     K 
Sbjct  117  INLNSSSLISPRFNVTVRSRNGNGKIGVYYHEKGSSVGVHYKGVDLCNGVLPAFYQPAKN  176

Query  327  STDVDLKMVA----KLSGDLRKELNGRRKK---LMALKISVPMEISSWA-KGKKKDISIK  172
             T V L++      +L+  +RKE+     K      LK+  P+EI   + K     + + 
Sbjct  177  VTVVKLRLSGSSKIQLTSGMRKEMRNEVSKETLPFRLKVKAPVEIKVGSLKTWTMFVKVV  236

Query  171  CVFKVGSLA-KSTDLSEECQADF  106
            C   V  L   S  +S +C  DF
Sbjct  237  CDVTVDKLTPPSRIVSRKCTHDF  259



>ref|NP_197612.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
 gb|AAO73890.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAU44554.1| hypothetical protein AT5G21130 [Arabidopsis thaliana]
 gb|AED92938.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
Length=281

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/232 (28%), Positives = 107/232 (46%), Gaps = 25/232 (11%)
 Frame = -2

Query  753  GEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgi  574
            G  P TYV+++P+DQ+YRVPPPENA   E Y   R TNK  +  R+C  + L  L+++ +
Sbjct  52   GPPPGTYVIKLPKDQIYRVPPPENAHRYE-YLSRRKTNK--SCCRRCLCYSLSALLIIIV  108

Query  573  ligtivgsINAMYTPKSPKFSIAAIQY------KKSARHPTFHISLHVHNINQRMKVSFG  412
            L     G    +Y P  P+FS++ +          S   P   I L   N+  ++ + + 
Sbjct  109  LAAIAFGFFYLVYQPHKPQFSVSGVSVTGINLTSSSPFSPVIRIKLRSQNVKGKLGLIYE  168

Query  411  DGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKM---VAKLSGDLRKELNGRRKK---  250
             G ++ + F    +G G++ +        T +   +     KL    RKEL   +KK   
Sbjct  169  KGNEADVFFNGTKLGNGEFTAFKQPAGNVTVIVTVLKGSSVKLKSSSRKELTESQKKGKV  228

Query  249  LMALKISVPME-----ISSWAKGKKKDISIKCVFKVGSL-AKSTDLSEECQA  112
               L+I  P++     +++W       I++ C   V  L A +T  +E C+ 
Sbjct  229  PFGLRIKAPVKFKVGSVTTWT----MTITVDCKITVDKLTASATVKTENCET  276



>gb|KEH20854.1| late embryogenesis abundant protein [Medicago truncatula]
Length=259

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 62/209 (30%), Positives = 110/209 (53%), Gaps = 11/209 (5%)
 Frame = -2

Query  735  YVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligtiv  556
            Y+VQ P+DQVYRVPP ENA IVE Y+   +  KK  +   CC  FL+ +V++ + I  +V
Sbjct  43   YIVQFPKDQVYRVPPSENAFIVESYRNTTNDKKKKKQRGCCCPRFLLTIVLILVTIVAVV  102

Query  555  gsINA----MYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLV  388
            G   A    ++ P+ P F+I   + K   R P + I L   N N+R+ + + +  ++S++
Sbjct  103  GITLATLFFVFNPEGPTFTITRFEVKNVTRPPHYEIYLKAKNPNKRLGIVYVN-SEASML  161

Query  387  FKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVPMEISS  208
            F + V+ KGK+  +  +   ++     +V + S  L K++    K  +  ++ + + +  
Sbjct  162  FDDTVVAKGKFTKLMEQSVDASTQFKVVVTRTSKALPKKM---AKMPVNFELDMNLGVRM  218

Query  207  WAKGKKKDI---SIKCVFKVGSLAKSTDL  130
             A G K  +    + C FKV +L K + +
Sbjct  219  TASGLKTWVMTSHVVCKFKVNNLGKDSKI  247



>ref|XP_010521605.1| PREDICTED: uncharacterized protein LOC104800491 [Tarenaya hassleriana]
Length=263

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/236 (28%), Positives = 109/236 (46%), Gaps = 21/236 (9%)
 Frame = -2

Query  768  LPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLR-KCCFW-Flv  595
             P +P   P TYV+Q+P+DQ+YR+PPPENA     +Q +  + KK  R R +CCF  FL 
Sbjct  29   FPRKPSPPPGTYVIQVPKDQIYRIPPPENA---HRFQYL--SRKKPNRNRCRCCFCSFLA  83

Query  594  plvvlgiligtivgsINAMYTPKSPKFSIAAIQY------KKSARHPTFHISLHVHNINQ  433
             ++ L +L G     +  +Y P+SP++S+  +          S   P F +++   N N 
Sbjct  84   GIITLAVLAGISAAVLYLVYRPESPRYSVEGVSISGFNVTSTSPISPRFDVTVRSRNGNG  143

Query  432  RMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKELNG  262
            ++ + +  G    + + +  +  G  P         T     +     +L+  +RKEL  
Sbjct  144  KIGIYYEKGSSVDVYYNDLDLCNGALPVFYQPTNNVTVFKTALTGAKIQLTSSMRKELRD  203

Query  261  RRKKLMA---LKISVPMEISSWA-KGKKKDISIKCVFKVGSLAKSTDL-SEECQAD  109
            R+ K      LKI VP+ I   + K     + + C   V  L  ++ + S +C  D
Sbjct  204  RQSKKTVPFKLKIKVPVRIKVGSVKSWTVSVKVNCELTVDKLTTASRIVSTKCSQD  259



>ref|XP_010064764.1| PREDICTED: uncharacterized protein LOC104451904 [Eucalyptus grandis]
 gb|KCW68838.1| hypothetical protein EUGRSUZ_F02438 [Eucalyptus grandis]
Length=278

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 106/227 (47%), Gaps = 14/227 (6%)
 Frame = -2

Query  747  APETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgili  568
            A +TYVVQIP+DQ+YRVPPPENA IV+ +++     K+      CC W  + ++V+ +++
Sbjct  48   ASDTYVVQIPKDQIYRVPPPENALIVKRHRKPTEPKKRSFCCSSCCCWLFLAIIVIVLVV  107

Query  567  gtivgsINAMYTPKSPKFSIAAIQYK---KSARHPT---FHISLHVHNINQRMKVSFGDG  406
            G +    +     K+P F +     K   KS    T   + + L V N N     ++  G
Sbjct  108  GILAIVSSVFLKLKNPNFHVDHFVVKDLTKSHDKNTKLVYDVKLKVENPNTYSSFTYKQG  167

Query  405  GKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKM---VAKLSGDLRKELNGRRKK---LM  244
            G  SL FK + I  GK+ +     K S  VD+ +      L  +++K L  ++ K     
Sbjct  168  GAVSLAFKQKAIAMGKFVAFDQDRKTSKAVDIVLKGSNTALPKEMQKSLRSKKTKNHLTF  227

Query  243  ALKISVPMEIS-SWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQAD  109
            AL +  P        KG        C F V  L K    LS++CQ +
Sbjct  228  ALHVDAPARRKIGIIKGSSSRFVASCQFTVDKLGKDARVLSQKCQTE  274



>ref|NP_565634.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
 ref|NP_973540.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
 gb|AAK43910.1|AF370591_1 Unknown protein [Arabidopsis thaliana]
 gb|AAC77866.1| expressed protein [Arabidopsis thaliana]
 gb|AAK96484.1| At2g27080/T20P8.13 [Arabidopsis thaliana]
 gb|AAL31248.1| At2g27080/T20P8.13 [Arabidopsis thaliana]
 dbj|BAE99782.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07933.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
 gb|AEC07934.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
Length=260

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 75/260 (29%), Positives = 119/260 (46%), Gaps = 19/260 (7%)
 Frame = -2

Query  843  MDGRVSPVGGDGRKGDPALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEG  664
            M  RV P     + G  +    +   P +P   P TYV+Q+P+DQ+YR+PPPENA   E 
Sbjct  1    MAERVYPADSPPQSGQFSGNFSSGEFPKKPAPPPSTYVIQVPKDQIYRIPPPENAHRFEQ  60

Query  663  YQEMRSTNKKDTRLRKCCFW-FlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQY--  493
                + TN+ + R   CCF  FL  + +L +L G     +  +Y P++PK+SI       
Sbjct  61   LSR-KKTNRSNCR---CCFCSFLAAVFILIVLAGISFAVLYLIYRPEAPKYSIEGFSVSG  116

Query  492  ----KKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkS  325
                  S   P+F++++   N N ++ V +       + + +  I  G  P      K  
Sbjct  117  INLNSTSPISPSFNVTVRSRNGNGKIGVYYEKESSVDVYYNDVDISNGVMPVFYQPAKNV  176

Query  324  TDVDLKMVA---KLSGDLRKEL-NGRRKKLMA--LKISVPMEIS-SWAKGKKKDISIKCV  166
            T V L +     +L+  +RKE+ N   KK +   LKI  P++I     K     +++ C 
Sbjct  177  TVVKLVLSGSKIQLTSGMRKEMRNEVSKKTVPFKLKIKAPVKIKFGSVKTWTMIVNVDCD  236

Query  165  FKVGSL-AKSTDLSEECQAD  109
              V  L A S  +S +C  D
Sbjct  237  VTVDKLTAPSRIVSRKCSHD  256



>emb|CDX77067.1| BnaC04g38620D [Brassica napus]
Length=260

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 73/261 (28%), Positives = 119/261 (46%), Gaps = 21/261 (8%)
 Frame = -2

Query  843  MDGRVSPVGGDGRKGDPALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEG  664
            M  RV P     + G  +    +   P +P   P TYV+Q+P+DQ+YRVPPPENA     
Sbjct  1    MAERVHPADSPPQSGQFSGNFSSGEFPRKPAPPPATYVIQVPKDQIYRVPPPENA-----  55

Query  663  YQEMRSTNKKDTRLR-KCCF-WFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQY-  493
            ++    + KK  R R +CCF +FL  +V+L +L G     +  ++ P++PK+S+      
Sbjct  56   HRLQLLSRKKPNRSRCRCCFCYFLAAIVILVVLAGISFAVLYVVFRPEAPKYSVEGFSVS  115

Query  492  -----KKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkk  328
                   S   P F++++   N N ++ + +  G    + + +  +  G  P        
Sbjct  116  GINLTSPSPISPRFNVTVRSRNGNGKLGIYYEKGSSVDVFYGDVALCNGALPVFYQPANN  175

Query  327  STDVDLKMVA---KLSGDLRKEL-NGRRKKLMA--LKISVPMEISSWA-KGKKKDISIKC  169
             T V   +     +L+   RKE+ N   KK M   LKI  P++I   + K     + + C
Sbjct  176  VTLVKTALTGSRIQLTSGARKEMRNELSKKTMPFKLKIKAPVKIKVGSVKTWTVTVKVNC  235

Query  168  VFKVGSL-AKSTDLSEECQAD  109
               V  L A S  +S +C  D
Sbjct  236  DVTVDKLTAPSRIVSRKCSHD  256



>ref|XP_004491178.1| PREDICTED: uncharacterized protein LOC101511932 isoform X1 [Cicer 
arietinum]
 ref|XP_004491179.1| PREDICTED: uncharacterized protein LOC101511932 isoform X2 [Cicer 
arietinum]
Length=274

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 113/238 (47%), Gaps = 25/238 (11%)
 Frame = -2

Query  798  DPALTSLTFSLPVQPGEAPE----TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKD  631
            D A+      LP  P + P     TY ++IPRDQ+YRVPPP NA++ E Y     T +K+
Sbjct  25   DAAVDVAPHPLPTPPSDKPVPPLGTYTIKIPRDQIYRVPPPGNARLYEEY-----TRRKN  79

Query  630  TRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYK---------KSAR  478
             R R CC WF+  + VL +L+G   G +  ++ P++PK+SI  I  +          +A 
Sbjct  80   HRNRCCCCWFIGLIFVLLVLLGITAGVLYLVFRPEAPKYSIQQINIRGINLTSPSSTAAS  139

Query  477  HPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA  298
             P F +++   N N ++ +S+     + + + N ++  G  P+        T     +  
Sbjct  140  SPVFDVTVKADNPNNKIGISYEKESSAEIFYNNVILCNGVMPTFYQPSNNVTVFKTVLEG  199

Query  297  ---KLSGDLRKEL---NGRRKKLMALKISVPMEISSWA-KGKKKDISIKCVFKVGSLA  145
               KL+ + R+ L     +RK  + +K+  P++I   + K  K  + I C   V  L 
Sbjct  200  SGIKLNNENRRALLKAQTKRKVPLIVKLRAPVKIKVGSVKTWKITVKIDCDLTVDQLT  257



>gb|KEH34902.1| late embryogenesis abundant protein [Medicago truncatula]
Length=256

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 107/218 (49%), Gaps = 13/218 (6%)
 Frame = -2

Query  771  SLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvp  592
            S P  P     T+VVQ+P+DQ+YRVPPPENA++ E  Q   S  K+  R+   CF  +  
Sbjct  18   SKPQLPNINRNTFVVQVPKDQIYRVPPPENARLAE--QRRSSPPKEKNRMCCWCFVLIFF  75

Query  591  lvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSFG  412
            + V+ ++   +    + + TPK PKFSI       +  H  + I+L   N N  + + + 
Sbjct  76   IAVVILIGVVLGSLFSMVRTPKDPKFSIQRF-LLHTKPHTQYKITLQAQNPNSNVDILY-  133

Query  411  DGGKSSLVFKNRVIGKGKYpsvsvkpkkST--DVDLK-MVAKLSGDLRKELNGRRKKL--  247
             GG  SL  K + I  G YP+ S+  + ST  DV LK    KL  ++ + +   ++K+  
Sbjct  134  KGGDISLSLKRQKIASGAYPTFSLSNQNSTMFDVTLKGSTTKLPKEVEESVKNEQRKVQI  193

Query  246  ---MALKISVPMEISSWAKGKKKDISIKCVFKVGSLAK  142
               + + +   M++     G  K   + C   V +LA+
Sbjct  194  TFALLIHLQAQMKMGLLHSGSMK-YEVSCQVTVDTLAR  230



>gb|KDP42899.1| hypothetical protein JCGZ_23841 [Jatropha curcas]
Length=271

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 83/170 (49%), Gaps = 12/170 (7%)
 Frame = -2

Query  849  SSMDGRVSPVGGDGRKGDPALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIV  670
            SS + + +P     R   PA   L    PV P  A  TYV+QIP+DQVYRVPPPENAK  
Sbjct  13   SSTELKKTPSASPDRPLKPAAPLL--EKPVSPPPA-GTYVIQIPKDQVYRVPPPENAK--  67

Query  669  EGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYK  490
              YQ++     + +    C  WF   L    +L     G +  ++ P++PK+SI ++  K
Sbjct  68   -RYQQLSRRKHRRSTCCCCLCWFFGLLFTFILLAAIAAGVLYLVFRPEAPKYSIESVSIK  126

Query  489  ------KSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGK  358
                   +   P F +++  HN N ++ + +  G   ++ + +  +  GK
Sbjct  127  GFNLTSSAPLSPEFDVAVRAHNPNNKIGIYYRTGSSVNVYYNDVRLCNGK  176



>ref|XP_004301318.1| PREDICTED: uncharacterized protein LOC101291153 [Fragaria vesca 
subsp. vesca]
Length=277

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/222 (29%), Positives = 109/222 (49%), Gaps = 17/222 (8%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYVVQ+P+DQ+YR+PPPENA IVE +   R  +KK   +  CC +  + ++   +L   +
Sbjct  59   TYVVQVPKDQIYRIPPPENATIVERH---RDPSKKKKPV--CCNFICLGILGFFLLFIIL  113

Query  558  vgsIN--AMYTPKSPKFSIAAIQY--KKSARHPTFHISLHVHNINQRMKVSFGDGGKSSL  391
            + +    ++   K P+FS+  + Y  K  +  P + I+L   N N ++ V +  GG  + 
Sbjct  114  LITGLYVSVTMSKDPRFSVQRLVYNNKTKSHRPDYTITLKSQNPNSQVTVLYKKGGDDAF  173

Query  390  V-FKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKELNGRRKKL---MALKI  232
            +  K + I    YPS       S +  L       KL  D+ K     ++K+    +L +
Sbjct  174  LNLKTQEIATATYPSFEQDGGNSKEFALIFHGSKIKLPKDIEKSGTSSKQKVHVKFSLSM  233

Query  231  SVPMEISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQAD  109
             +P  +   A  K     ++C F V +L K T  L++EC+ +
Sbjct  234  DIPGRMRRGALKKSMIFHVECDFTVDTLVKGTRVLNQECRTN  275



>ref|XP_006294822.1| hypothetical protein CARUB_v10023872mg [Capsella rubella]
 gb|EOA27720.1| hypothetical protein CARUB_v10023872mg [Capsella rubella]
Length=261

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 74/264 (28%), Positives = 123/264 (47%), Gaps = 24/264 (9%)
 Frame = -2

Query  843  MDGRVSPVGGDGRKGDPALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEG  664
            M  RV P       G  +    +   P +P   P TYV+Q+P+DQ+YR+PPPENA  ++ 
Sbjct  1    MAERVYPADSPPESGQFSGNFSSGEFPRKPAPPPSTYVIQVPKDQIYRIPPPENAHRLQ-  59

Query  663  YQEMRSTNKKDTRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPK-----FSIAAI  499
            Y   +  N+  +R R C   F+  +  L +L G  +  +  +Y P++PK     F+++ I
Sbjct  60   YLSRKKPNR--SRCRCCICSFIALVFALIVLAGLSLAVLYLIYRPEAPKYYVEGFAVSGI  117

Query  498  QYKK-SARHPTFHISLHVHNINQRMKV-SFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkS  325
                 S   P F++++   N N ++ V  +G G    + +K+  +  G  P      K  
Sbjct  118  NLNSTSPISPRFNVTVRSRNGNGKIGVYYYGKGSSVDVYYKDVDLCNGVLPEFYQAEKNV  177

Query  324  TDVDLKMVA---KLSGDLRKELNGRRKKL------MALKISVPMEISSWA-KGKKKDISI  175
            T V L +     +L+  +RKE+   RK++        LKI  P++I   + K     + +
Sbjct  178  TVVKLGLSGSKIQLTSGMRKEM---RKEVSNKTLPFRLKIKAPVKIKVGSVKTWTMIVKV  234

Query  174  KCVFKVGSL-AKSTDLSEECQADF  106
             C   V  L A S  +S +C  DF
Sbjct  235  NCDLTVDKLTAPSRIVSRKCSHDF  258



>ref|XP_009140759.1| PREDICTED: uncharacterized protein LOC103864750 [Brassica rapa]
Length=260

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 117/261 (45%), Gaps = 21/261 (8%)
 Frame = -2

Query  843  MDGRVSPVGGDGRKGDPALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEG  664
            M  RV P     + G  +    +   P +P   P TYV+Q+P+DQ+YRVPPPENA     
Sbjct  1    MAERVHPADSPPQSGQFSGNFSSGEFPRKPAPPPATYVIQVPKDQIYRVPPPENA-----  55

Query  663  YQEMRSTNKKDTRLR-KCCF-WFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQY-  493
            ++    + KK  R R +CCF +FL  +  L +L       + A++ P++PK+S+      
Sbjct  56   HRLQLLSRKKPNRSRCRCCFCYFLAAIFTLAVLAAISFAVLYAVFRPEAPKYSVEGFSVS  115

Query  492  -----KKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkk  328
                   S   P F++++   N N ++ + +  G    + + +  +  G  P        
Sbjct  116  GINLTSPSPVSPRFNVTVRSRNGNGKLGIYYEKGSSVDVFYGDVDLCNGALPVFYQPANN  175

Query  327  STDVDLKMVA---KLSGDLRKEL-NGRRKKLMALKISV--PMEISSWA-KGKKKDISIKC  169
             T V   +     +L+   RKE+ N   KK +  K+ +  P++I   + K     + + C
Sbjct  176  VTLVKTALTGSGIQLNSGARKEMRNELSKKTVPFKVRIKAPVKIKVGSVKTWTITVKVNC  235

Query  168  VFKVGSL-AKSTDLSEECQAD  109
               V  L A S  +S +C  D
Sbjct  236  DVTVDKLTAPSRIVSRKCSHD  256



>ref|XP_002879043.1| hypothetical protein ARALYDRAFT_481588 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55302.1| hypothetical protein ARALYDRAFT_481588 [Arabidopsis lyrata subsp. 
lyrata]
Length=260

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 122/260 (47%), Gaps = 19/260 (7%)
 Frame = -2

Query  843  MDGRVSPVGGDGRKGDPALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEG  664
            M  RV P     + G  +    +   P +P   P TYV+Q+P+DQ+YR+PPPENA  ++ 
Sbjct  1    MAERVYPTDSPPQSGQFSGNFSSGEFPRKPTPPPATYVIQVPKDQIYRIPPPENAHRLQ-  59

Query  663  YQEMRSTNKKDTRLRKCCFW-FlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQY--  493
             Q  R  N + T   +CCF  FL  + +L +L G  +  +  +Y P++PK+SI       
Sbjct  60   -QLSRKKNNRST--CRCCFCSFLAAIFILIVLAGISLAILYLIYRPEAPKYSIEGFTVSG  116

Query  492  ----KKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkS  325
                  S   P F++++   N N ++ V +       + + +  +  G  P      K  
Sbjct  117  INLNSTSPISPNFNVTVRSRNGNGKIGVYYEKESSVDVYYNDVDLCNGVMPVFYQPAKNV  176

Query  324  TDVDLKMVA---KLSGDLRKEL-NGRRKKLMA--LKISVPMEISSWA-KGKKKDISIKCV  166
            T V L +     +L+  +RKE+ N   KK +   LKI  P++I   + K     ++++C 
Sbjct  177  TVVRLALSGSKIQLTSGMRKEMRNEVSKKTLPFKLKIKAPVKIKVGSVKTWSMIVNVECD  236

Query  165  FKVGSL-AKSTDLSEECQAD  109
              V  L A S  +S +C  D
Sbjct  237  VTVDKLTAPSRIVSRKCSHD  256



>ref|XP_002866881.1| hypothetical protein ARALYDRAFT_490757 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43140.1| hypothetical protein ARALYDRAFT_490757 [Arabidopsis lyrata subsp. 
lyrata]
Length=264

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 100/217 (46%), Gaps = 34/217 (16%)
 Frame = -2

Query  747  APETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgili  568
            A ETYVVQ+PRDQVY  PPP+NA+IVE  +         +   K C W            
Sbjct  77   AIETYVVQVPRDQVYWTPPPDNARIVERRRNSELGRNNKSFCSKRCIWL-----------  125

Query  567  gtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLV  388
                       +P+ P F++   +++KS RH  F I L   N    M V++   G  SL+
Sbjct  126  ---------FISPEPPVFNVK--KFEKS-RH--FEIMLTSKNPTSTMWVTY--KGLVSLM  169

Query  387  FKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALKISVPMEISS  208
            +KN+ +G+G +P +S+    S  V+L    KL G     L       + L + +     +
Sbjct  170  YKNKNLGQGNFPELSLAVSGSHTVNL----KLEGSKNAALLPPEVVSLVLTMGLNAGFGT  225

Query  207  WAKGKKKDISIKCVFKVGSL---AKSTDLSEECQADF  106
                + K++++ C  KV  L    K   +SE C+++F
Sbjct  226  GLVKRDKEVAVTCDIKVKGLLDAQKVEIVSESCESEF  262



>ref|XP_010473096.1| PREDICTED: uncharacterized protein LOC104752606 [Camelina sativa]
Length=263

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 75/262 (29%), Positives = 123/262 (47%), Gaps = 18/262 (7%)
 Frame = -2

Query  843  MDGRVSPVGGDGRKGDPALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEG  664
            M  RV P       G  +    +   P +P   P TYV+Q+P+DQ+YR+PPPENA  ++ 
Sbjct  1    MAERVYPADSPPESGQFSGNFSSGEFPRKPAPPPSTYVIQVPKDQIYRIPPPENAHRLQ-  59

Query  663  YQEMRSTNKKDTRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPK-----FSIAAI  499
            Y   +  N + +  R C   FL  +  + +L G     +  +Y P++PK     FS++ I
Sbjct  60   YLSRKKPN-RSSNCRCCICSFLAVVFTIAVLAGLSFAVLYLIYRPEAPKYSVEGFSVSGI  118

Query  498  QYKKSAR-HPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRV-IGKGKYpsvsvkpkkS  325
                S+   P F++++   N N R+ V + + G S  V+   V +  G  P+     K  
Sbjct  119  NLNSSSPVSPRFNVTVRSRNGNGRIGVYYHEVGSSVGVYYKGVDLCNGVLPAFYQPAKNV  178

Query  324  TDVDLKMVA----KLSGDLRKEL-NGRRKKLMA--LKISVPMEISSWA-KGKKKDISIKC  169
            T V L++      +L+  +RKE+ N   KK +   LK+  P+ I   + K     +++ C
Sbjct  179  TVVKLRLSGSSKIQLTSGMRKEMRNEVSKKTLPFRLKVKAPVVIKVGSVKTWTMFVNVVC  238

Query  168  VFKVGSLA-KSTDLSEECQADF  106
               V  L   S  +S +C  DF
Sbjct  239  DVTVDKLTPPSRIVSRKCTHDF  260



>emb|CDY48196.1| BnaA04g15600D [Brassica napus]
Length=260

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 117/261 (45%), Gaps = 21/261 (8%)
 Frame = -2

Query  843  MDGRVSPVGGDGRKGDPALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEG  664
            M  RV P     + G  +    +   P +P   P TYV+Q+P+DQ+YRVPPPENA     
Sbjct  1    MAERVHPADSPPQSGQFSGNFSSGEFPRKPAPPPATYVIQVPKDQIYRVPPPENA-----  55

Query  663  YQEMRSTNKKDTRLR-KCCF-WFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQY-  493
            ++    + KK  R R +CCF +FL  +  L +L       + A++ P++PK+S+      
Sbjct  56   HRLQLLSRKKPNRSRCRCCFCYFLAAIFTLAVLAAISFAVLYAVFRPEAPKYSVEGFSVS  115

Query  492  -----KKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkk  328
                   S   P F++++   N N ++ + +  G    + + +  +  G  P        
Sbjct  116  GINLTSPSPISPRFNVTVRSRNGNGKLGIYYEKGSSVDVFYGDVDLCNGALPVFYQPANN  175

Query  327  STDVDLKMVA---KLSGDLRKEL-NGRRKKLMALKISV--PMEISSWA-KGKKKDISIKC  169
             T V   +     +L+   RKE+ N   KK +  K+ +  P++I   + K     + + C
Sbjct  176  VTLVKTALTGSGIQLNSGARKEMRNELSKKTVPFKVRIKAPVKIKVGSVKTWTITVKVNC  235

Query  168  VFKVGSL-AKSTDLSEECQAD  109
               V  L A S  +S +C  D
Sbjct  236  DVTVDKLTAPSRIVSRKCSHD  256



>ref|XP_006290054.1| hypothetical protein CARUB_v10003689mg [Capsella rubella]
 gb|EOA22952.1| hypothetical protein CARUB_v10003689mg [Capsella rubella]
Length=282

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 59/230 (26%), Positives = 110/230 (48%), Gaps = 25/230 (11%)
 Frame = -2

Query  753  GEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgi  574
            G  P TYV++I +D++YRVPPPENA     Y+ +     K +  R+C  + L  L++L  
Sbjct  52   GPQPGTYVIEIRKDEIYRVPPPENA---HRYEYLSRRKTKQSHCRRCFCYSLAALLILLF  108

Query  573  ligtivgsINAMYTPKSPKFSIAAIQY------KKSARHPTFHISLHVHNINQRMKVSFG  412
            L   ++G +  +Y P  P++S++ +          S   P F + L   N+N ++ + +G
Sbjct  109  LAALVLGVLFLVYGPHKPRYSVSTLTVTGINLTSSSPISPVFGVKLRSQNVNSKLVLIYG  168

Query  411  DGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKELN---GRRKK  250
             G ++ + +    +G G++ +        T ++  +     +L+   R+EL     +RK 
Sbjct  169  LGSEAEVFYDGIKLGNGEFTAFKQPANNVTLIETVLKGSSIQLTSSSREELTKSQKKRKV  228

Query  249  LMALKISVPME-----ISSWAKGKKKDISIKCVFKVGSL-AKSTDLSEEC  118
               +KI  P++     +++W    K D    C   V  L A +T ++E C
Sbjct  229  PFGIKIKAPVKFKVGAVTTWTMTVKVD----CEITVDKLTASATVITENC  274



>ref|XP_004150661.1| PREDICTED: uncharacterized protein LOC101202802 [Cucumis sativus]
 gb|KGN62168.1| hypothetical protein Csa_2G307330 [Cucumis sativus]
Length=240

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 65/218 (30%), Positives = 111/218 (51%), Gaps = 12/218 (6%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCF-WFlvplvvlgiligt  562
            TYVVQIP+DQ+YR+PPPENA IVE ++         +R R CCF  FL   V+L ++I  
Sbjct  25   TYVVQIPKDQIYRIPPPENALIVERHRNPSVVT--SSRRRSCCFRIFLPIFVLLLLIIIL  82

Query  561  ivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFK  382
             +     +  PK P   +   +   S R+  F I+L + N N    +SF    + SL F+
Sbjct  83   ALLLPPLLTLPKPPVIELKKFKLTPSTRN--FLINLDILNPNSVGSISFKSPSRVSLSFR  140

Query  381  NRVIGKGKYpsvsvkpkkSTDVDLKMVAK--LSGDLRKELNGRRKKL---MALKISVPME  217
               +   K+P +  +      V L + AK     +L++ +   + KL   ++LK+++  +
Sbjct  141  KNQLATTKFPLIRQQHGSEKKVALSLRAKSAFPKELKRRMKNNKTKLHTSLSLKMNLAAQ  200

Query  216  -ISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQAD  109
             I   +  +     + C F V +L K++  LS++C+++
Sbjct  201  TIGRLSNRRNVKFVVTCSFTVNTLGKNSRILSQDCESE  238



>emb|CDX88825.1| BnaA03g08240D [Brassica napus]
Length=302

 Score = 72.0 bits (175),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 106/227 (47%), Gaps = 25/227 (11%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            P TY VQ+P+DQ+YRVPPPENA     Y+ +       +  R+CC +    L+VL +L  
Sbjct  75   PGTYHVQLPKDQIYRVPPPENA---HRYEYLSRQKHNRSACRRCCCYSFATLLVLLLLAA  131

Query  564  tivgsINAMYTPKSPKFSIAAIQY------KKSARHPTFHISLHVHNINQRMKVSFGDGG  403
             +VG    +  P  P+FS++ +          S   P F I +   N+N ++ + +  G 
Sbjct  132  LVVGVFFLVCRPHKPRFSVSGVSVAGVTLASPSPISPVFKIKVRCKNVNGKLGLIYEKGS  191

Query  402  KSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKEL---NGRRKKLMA  241
               +  +   +G G++ +     +  T    K+     +L    RK+L     RRK L  
Sbjct  192  AVEIFHEGIKLGDGEFAAFEQPAENVTMTVTKLRGSRIQLKSSSRKDLVESQKRRKVLFD  251

Query  240  LKISVPME-----ISSWAKGKKKDISIKCVFKVGSLAKS-TDLSEEC  118
            +++  P++     +++W  G    +++ C   V  L  S T ++E+C
Sbjct  252  VRVKAPIKFRVGVVTTWTMG----LTVDCKITVDKLTSSATVITEDC  294



>ref|XP_010526649.1| PREDICTED: uncharacterized protein LOC104804156 [Tarenaya hassleriana]
Length=284

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 107/214 (50%), Gaps = 9/214 (4%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligt  562
            ETYVVQ P+DQVY VPPPE+A I +  Q  +   KK     K   WF + LVVLGI++G 
Sbjct  74   ETYVVQAPKDQVYWVPPPEHANIAQ--QRRKPERKKKGGRCKRLAWFSIILVVLGIIMGF  131

Query  561  ivgsINAMYTPKSPKFSIAAIQYKKSARH-PTFHISLHVHNINQRMKVSFGDGGKSSLVF  385
            +   +N ++ P  P F++     K +  H  ++ I++   N    M V + +G   S+ +
Sbjct  132  VGLIVNFVFRPVQPIFNVYKFAVKSNQSHVVSYGITIRAENPTSNMGVEYTEGDIVSISY  191

Query  384  KNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMA-LKISVPMEISS  208
            + + IG GK+P ++     S  V LK+ A  +  L K     +  L A LK    +    
Sbjct  192  EGKNIGSGKFPKLTQSAYGSDPVHLKLDASKNAALPKSKQSVKLILSADLKAEYGVGPLR  251

Query  207  WAKGKKKDISIKCVFKVGSLAKSTDLSEECQADF  106
            W    K+++++ C   V  L    + S+ C+ +F
Sbjct  252  W----KEEVTVTCNVNVKDLNDHIE-SQRCETEF  280



>ref|XP_006826947.1| hypothetical protein AMTR_s00010p00185810 [Amborella trichopoda]
 gb|ERM94184.1| hypothetical protein AMTR_s00010p00185810 [Amborella trichopoda]
Length=246

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 106/222 (48%), Gaps = 18/222 (8%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQE--MRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            TYVVQIP+DQ+YRVPPPENA I   YQ    RS  K+      C  W +V ++V  IL G
Sbjct  30   TYVVQIPKDQIYRVPPPENAYIANKYQNNPRRSQKKRWCCSCCCLLWLIVFIIVTVILAG  89

Query  564  tivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVF  385
              VG +  +     P+FSI  +  + S     F ++L   N N ++ + + +GG   L  
Sbjct  90   AFVGILYLVVKSDIPRFSIEHVA-ENSKALSQFQVNLKGENGNSKLVLRYLNGGVVGLEH  148

Query  384  KNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKEL---NGRRKKLMALKISVPME-  217
                IG GK+P        S     ++V K S  + K+L   +G +   + L+  VP+  
Sbjct  149  LGSKIGTGKWPEFEQGSGNSK--VFRLVTKGSDAVIKQLKKKHGNKSLTLVLRAQVPIRF  206

Query  216  ----ISSWAKGKKKDISIKCVFKVGSLA-KSTDLSEECQADF  106
                I SW       + ++C FKV  L   S  LSEEC A  
Sbjct  207  EWKGIKSWV----MSMDVRCDFKVDKLGVNSRVLSEECDAKL  244



>ref|XP_010646788.1| PREDICTED: uncharacterized protein LOC104878321 [Vitis vinifera]
Length=242

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 118/235 (50%), Gaps = 11/235 (5%)
 Frame = -2

Query  795  PALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRK  616
            P L   T  L   PG   +T  + +P D+ +R+PPP NA   E   +   +NK+    R 
Sbjct  3    PTLDDPTPPLHPSPGFRSDTSTLPLPNDEAHRLPPPYNASASETPHQ--PSNKRGFINRP  60

Query  615  CCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKS-ARHPTFHISLHVHNI  439
                 L+ L  L +++GT +G I  + +PK PK +I+ +      A+HP F ISL   N 
Sbjct  61   RVIVTLLILFSLVLIVGTSLGVIYLLLSPKYPKLAISNVFVTHPLAKHPRFLISLKAKNP  120

Query  438  NQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LSGDLRKEL  268
            N R+ V +  GG+++L FK + +  G +P+ +   K S+ V + + A    +  ++R  +
Sbjct  121  NNRVGVGYEKGGRAALSFKKKSVATGPFPTFAQGDKSSSAVQMVLRASNKTMPHEIRNSI  180

Query  267  NGRRKKL---MALKISVPMEISSW-AKGKKKDISIKCVFKVGSLAKSTD-LSEEC  118
                 KL   + L ++VP+ +  W  K   +++   C F+V +LA S+  L + C
Sbjct  181  LNTTSKLPLSLGLTMNVPVRMKIWTTKIWIEELVFDCKFRVNTLANSSRILYQRC  235



>ref|XP_006360305.1| PREDICTED: uncharacterized protein LOC102595816 [Solanum tuberosum]
Length=269

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 67/249 (27%), Positives = 118/249 (47%), Gaps = 32/249 (13%)
 Frame = -2

Query  777  TFSLPVQPGEAPE----TYVVQIPRDQVYRVPPPENAKIVEGY-----QEMRSTNKKDTR  625
            T+   V   ++P     TYVVQ+P+DQ+YRVPPPENA I+E +     Q+  S+      
Sbjct  20   TYDHDVSNTQSPHFSSGTYVVQVPKDQIYRVPPPENAIIIENHRNKINQQGGSSRSCCCS  79

Query  624  LRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSAR-------HPTF  466
             R  C    + +V + I +   +     +     P+F++  +  KK  +       H  +
Sbjct  80   RRYICIVITLVVVGIIIGLVIGLTK--LLTKHNDPQFNVKQVIVKKLNKNHHDKRTHYQY  137

Query  465  HISLHVHNINQRMKVSF---GDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKM---  304
             +++   N NQ  ++S+   GDGG  SL FK + I +G +P +   PK   D ++ +   
Sbjct  138  DVTIEAKNTNQMSRISYNYKGDGG-ISLYFKQKNIARGDFPELEQDPKSLIDFEVILGNG  196

Query  303  -VAKLSGDLRKELNGRRKK----LMALKISVPMEISSWA-KGKKKDISIKCVFKVGSLAK  142
               KL  ++ + +N    K     ++L + VP+E   W      K+I + C   V  L K
Sbjct  197  DKDKLPEEVERSMNSTNSKNQRLYLSLSMDVPIEFKVWGISSMNKNIRVSCSLIVNILTK  256

Query  141  STD-LSEEC  118
            ++  ++++C
Sbjct  257  NSHVINQKC  265



>ref|XP_010520485.1| PREDICTED: protein YLS9 [Tarenaya hassleriana]
Length=267

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 107/231 (46%), Gaps = 24/231 (10%)
 Frame = -2

Query  753  GEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgi  574
            G    TY+VQIP++Q+YRVPPPENA   + Y   R T ++ +  R+C   FL  +++  +
Sbjct  37   GPPAGTYLVQIPKEQIYRVPPPENAHRYD-YLSRRKTRRR-SLCRRCVCSFLAAVLIFAV  94

Query  573  ligtivgsINAMYTPKSPKFSIAAIQY------KKSARHPTFHISLHVHNINQRMKVSFG  412
            L       +  +Y P+ P+FS+A +          S   P   ++  + N N ++   + 
Sbjct  95   LATIAAAVLYLVYRPEKPRFSVARVSITGFNLTSPSLTSPEIEVTFRLENPNGKLGFFYE  154

Query  411  DGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKELNGRRKK---  250
             G  + +       G G  PS     K  T +   +     +L+  +RKEL   +KK   
Sbjct  155  KGSTAKIYHDGVNFGNGVTPSFKQPAKNITTLMTALKGSGIQLTASMRKELTEAQKKGTL  214

Query  249  LMALKISVPME-----ISSWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQ  115
              +LKI  P++     +++W       +++ C   V  L  S D ++E+C+
Sbjct  215  PFSLKIDAPVKVNVGSVTTWT----MSVTVDCEIAVDKLTASADVVTEKCR  261



>ref|XP_009131838.1| PREDICTED: uncharacterized protein LOC103856481 [Brassica rapa]
Length=302

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 107/227 (47%), Gaps = 25/227 (11%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            P TY VQ+P++Q+YRVPPPENA     Y+ +       +  R+CC +    L+VL +L  
Sbjct  75   PGTYHVQLPKEQIYRVPPPENA---HRYEYLSRQKHNRSACRRCCCYSFATLLVLLLLAA  131

Query  564  tivgsINAMYTPKSPKFSIAAIQY------KKSARHPTFHISLHVHNINQRMKVSFGDGG  403
             +VG    +  P  P+FS++ +          S   P F+I +   N+N ++ + +  G 
Sbjct  132  LVVGVFFLVCRPHKPRFSVSGVSVAGINLTSPSPISPVFNIKVRCKNVNGKLGLIYEKGS  191

Query  402  KSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKEL---NGRRKKLMA  241
               +  +   +G G++ +     +  T    K+     +L    RK+L     RRK L  
Sbjct  192  AVEIFHEGIKLGDGEFAAFEQPAENVTMTVTKLRGSRIQLKSSSRKDLVESQKRRKVLFD  251

Query  240  LKISVPME-----ISSWAKGKKKDISIKCVFKVGSLAKS-TDLSEEC  118
            +++  P++     +++W  G    +++ C   V  L  S T ++E+C
Sbjct  252  VRVKAPIKFRVGVVTTWTMG----LTVDCKITVDKLTSSATVITEDC  294



>gb|KFK32426.1| hypothetical protein AALP_AA6G240400 [Arabis alpina]
Length=257

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 66/256 (26%), Positives = 116/256 (45%), Gaps = 14/256 (5%)
 Frame = -2

Query  843  MDGRVSPVGGDGRKGDPALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEG  664
            M  RV P       G  +    +   P +P   P TYV+Q+P+DQ+YR+PPPENA  ++ 
Sbjct  1    MAERVYPADSPPESGQFSGNFSSGEFPRKPAPPPSTYVIQVPKDQIYRIPPPENAHRLQ-  59

Query  663  YQEMRSTNKKDTRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPK-----FSIAAI  499
            Y   +  N+  +R R C    L  L ++ +L G  +  +  ++ P++P+     FS++ I
Sbjct  60   YLSRKKVNR--SRCRCCICSVLATLFIVLVLAGISLAVLYLVFHPEAPRYSVEGFSVSGI  117

Query  498  QYKKSAR-HPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkST  322
                S+   P F++++   N N ++ + +  G    + + +  +  G  P+    P   T
Sbjct  118  NLTSSSPISPKFNVTVRSRNGNGKIGIYYEKGSSVDVFYNDVDLCNGALPAFYQPPNNVT  177

Query  321  DVDLKMVA---KLSGDLRKELNGRRKKLMALKISVPMEIS-SWAKGKKKDISIKCVFKVG  154
             V   +     +L+   RKE+   +     LKI  P++I     K     + + C   V 
Sbjct  178  VVKTALTGSTIQLTTATRKEMRNEKTLPFKLKIRAPVKIKLGSVKTWTLTVKVNCDVTVD  237

Query  153  SL-AKSTDLSEECQAD  109
             L A S  +S +C  D
Sbjct  238  KLTAPSRIVSRKCSHD  253



>ref|XP_010557487.1| PREDICTED: uncharacterized protein LOC104826475 [Tarenaya hassleriana]
Length=291

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 63/237 (27%), Positives = 110/237 (46%), Gaps = 23/237 (10%)
 Frame = -2

Query  768  LPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFW-Flvp  592
             P +P   P T+V+Q+P+DQ+YRVPPPENA  ++ Y   +  N+   R   CCF  F+  
Sbjct  56   FPRKPTPPPGTFVIQVPKDQIYRVPPPENAHRLQ-YLSRKKPNRSRCR---CCFCSFVAG  111

Query  591  lvvlgiligtivgsINAMYTPKSPKFSIAAIQY------KKSARHPTFHISLHVHNINQR  430
            +++L ++ G     +  +Y P+ P++S+  I          S   P F ++    N N +
Sbjct  112  ILILTVVAGISASVLYLVYRPEMPRYSVEGISISGFNVTSPSPISPRFDVTFRSQNGNGK  171

Query  429  MKVSFGDGGKSSLVFKNRVIGKGK----YpsvsvkpkkSTDVDLKMVAKLSGDLRKEL--  268
            + + +  G    + + +  +  GK    Y          T V  + + +L   +RKE+  
Sbjct  172  IGIYYEKGSSVDVYYNDLDLCNGKLPAFYQPAKNVTVFKTAVTGEKI-QLMRSMRKEMID  230

Query  267  -NGRRKKLMALKISVP--MEISSWAKGKKKDISIKCVFKVGSLA-KSTDLSEECQAD  109
              G++     L I VP  +E+ S   G   ++ + C   V +L  KS  +S +C  D
Sbjct  231  WQGKKTVPFKLSIRVPVGIEVGSVKLG-TVNVKVNCDLTVDNLTRKSRIVSTKCSHD  286



>ref|XP_004501974.1| PREDICTED: uncharacterized protein LOC101512221 [Cicer arietinum]
Length=263

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 110/239 (46%), Gaps = 25/239 (10%)
 Frame = -2

Query  771  SLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvp  592
            ++P  PGE   +Y++Q+P+DQVYR+PPPENA+  + Y     T KK+ R   C  W +  
Sbjct  28   AVPKPPGE---SYIIQLPKDQVYRIPPPENARRYQNY-----TRKKNRRSCCCLCWLIGI  79

Query  591  lvvlgiligtivgsINAMYTPKSPKFSIAAIQYKK-------SARHPTFHISLHVHNINQ  433
            +  L +L+         ++ P+ P+FSI  +  +        S   P   +S+   N N 
Sbjct  80   VFTLIMLVIVAACVFYLIFRPQVPQFSIDGVAVQGMNLTSSLSTISPECAVSVSDDNGNN  139

Query  432  RMKVSFGDGGKSSLVFKNRVIGKGK----YpsvsvkpkkSTDVDLKMVAKLSGDLRKELN  265
            ++ + +  G    + +++  I  G     Y   +   +  T +   +VA    D R  + 
Sbjct  140  KIGIYYEKGSIVEIFYRDIKICNGALPVFYQPTNSVTRFQTVLKGNVVALAVSDRRALVR  199

Query  264  --GRRKKLMALKISVPM--EISSWAKGKKKDISIKCVFKVGSLAKSTDLS--EECQADF  106
               +R   + LK+ VP+  ++ S   G+  +  ++C   +  L   + ++  E+C + F
Sbjct  200  AVAKRSVPLTLKLRVPLKFKVGSVKTGQFLEYKMECDLTLDQLTAQSKITVIEDCNSGF  258



>ref|XP_002871969.1| hypothetical protein ARALYDRAFT_489023 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48228.1| hypothetical protein ARALYDRAFT_489023 [Arabidopsis lyrata subsp. 
lyrata]
Length=281

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 64/230 (28%), Positives = 104/230 (45%), Gaps = 17/230 (7%)
 Frame = -2

Query  753  GEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgi  574
            G  P TY++ +P+DQ+YRVPPPENA   E Y   R TN+ +   R+C   FL  L++L  
Sbjct  52   GPPPGTYIINLPKDQIYRVPPPENAHRYE-YLSRRKTNQSN--CRRCFCHFLAALLILLF  108

Query  573  ligtivgsINAMYTPKSPKFSIAAIQY------KKSARHPTFHISLHVHNINQRMKVSFG  412
            L   +VG +  +Y P  P+FS++ +          S   P   I +   N+N ++ + + 
Sbjct  109  LAALVVGILYLVYQPHKPRFSVSGVSVTGINLTSSSPLSPVIGIKVRSQNVNGKLGLIYE  168

Query  411  DGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKELNGRRKK---  250
             G ++ + +    +G GK+ +        T +   +     +L+   RKEL    KK   
Sbjct  169  KGNEADVFYGGIKLGNGKFTAFKQPADNVTVIVTVLKGSSIQLTSSSRKELKESHKKGKV  228

Query  249  LMALKISVPMEISSWAKGKKKDISIK-CVFKVGSL-AKSTDLSEECQADF  106
               L+I  P++    A           C  KV  L A +T ++E C    
Sbjct  229  PFGLRIKAPVKFKVGAVTTWTMTVTVDCKIKVDKLTASATVVTENCDTGL  278



>ref|XP_010269329.1| PREDICTED: uncharacterized protein LOC104606021 [Nelumbo nucifera]
Length=267

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 86/183 (47%), Gaps = 29/183 (16%)
 Frame = -2

Query  843  MDGRVSPVGGDGRKGDPALTSLTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEG  664
            M+ RV+   G  ++   A T      P +    P TY++Q P++Q+YRVPPPENA IVE 
Sbjct  1    MEKRVTFTAGRVKQKHSAPTPKPTPSP-ELASGPGTYIIQFPKEQIYRVPPPENALIVEQ  59

Query  663  YQEMRSTNKKDTRLRKCCF--WFlvplvvlgiligtivgsINAMYT---PKSPKFSIAAI  499
            ++E + T       +K  F  W L  LV + + I  +   +   Y    P+SPKF +  +
Sbjct  60   HREQKPT-------KKATFPPWLLKLLVFVLVFILILGIIVALFYAIVQPRSPKFYVHRV  112

Query  498  QYKK----------------SARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIG  367
              KK                  + P + I+L   N N+RM + +  GG ++L F+   I 
Sbjct  113  SVKKPGSQHGDARSRRHHRHHHQFPQYVITLKAENPNKRMDIFYLKGGHATLSFRKSQIA  172

Query  366  KGK  358
             GK
Sbjct  173  TGK  175



>ref|XP_006836205.1| hypothetical protein AMTR_s00101p00083450 [Amborella trichopoda]
 gb|ERM99058.1| hypothetical protein AMTR_s00101p00083450 [Amborella trichopoda]
Length=283

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 72/249 (29%), Positives = 112/249 (45%), Gaps = 31/249 (12%)
 Frame = -2

Query  795  PALTSLTFSLPVQPGEAPE--------TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTN  640
            P+L S   SLP     APE        TY+VQ+P+DQ+YRVPPPEN     G    RS  
Sbjct  37   PSLESQN-SLPGNQNPAPEKKQDPLPGTYIVQVPKDQIYRVPPPEN-----GPHYQRSRK  90

Query  639  KKDTRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYK------KSAR  478
            ++    R  C +FL  +  L +L+  I G    + +PKSPK+SI  +  K          
Sbjct  91   RRSHCCRFLC-YFLGSIFALVVLLAAIAGISYLVISPKSPKYSIEKVAIKGFTLGRDLTI  149

Query  477  HPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkST-------D  319
             P F +++   N N+++ + +GD     + + +  +  GK P+     +  T        
Sbjct  150  SPEFDVTVRAENPNKKIGIYYGDKNNVDVFYSDVRLCNGKLPAFYQGHRNVTVFPALLVG  209

Query  318  VDLKMVAKLSGDLRKELNGRRKKLMALKISVPMEISSWA-KGKKKDISIKCVFKVGSLA-  145
             D+++   ++G L  +L   R  L  L I VP+ +   A K     +  +C   V  LA 
Sbjct  210  SDVRLSTAVNGTLTAQLREGRVPLR-LNIDVPVRVKVGAVKSWTVTVRARCDVTVDKLAV  268

Query  144  KSTDLSEEC  118
             +T L   C
Sbjct  269  DATVLDNRC  277



>ref|XP_004144152.1| PREDICTED: protein NDR1-like [Cucumis sativus]
 gb|KGN66410.1| hypothetical protein Csa_1G601000 [Cucumis sativus]
Length=258

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 72/134 (54%), Gaps = 8/134 (6%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            P TYV+Q+P+DQ+YR+PPPENA   + Y   R ++++  R R C F  L  L +L IL+G
Sbjct  31   PGTYVIQLPKDQIYRLPPPENAHRFKLY--TRQSHRRRNRCRSCLFCLLAILAILIILLG  88

Query  564  tivgsINAMYTPKSPKFSIAAI------QYKKSARHPTFHISLHVHNINQRMKVSFGDGG  403
              +     +  PKSP +SI AI          SA  P F++S+   N N+++ + +  G 
Sbjct  89   ITLAVFYFVVRPKSPNYSIDAISISGLNNLTSSAISPVFNLSVRADNPNKKIGIYYLTGS  148

Query  402  KSSLVFKNRVIGKG  361
               +   N  + +G
Sbjct  149  SVRIYSSNEKLSEG  162



>ref|XP_002313615.1| harpin-induced family protein [Populus trichocarpa]
 gb|EEE87570.1| harpin-induced family protein [Populus trichocarpa]
Length=281

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 65/233 (28%), Positives = 101/233 (43%), Gaps = 25/233 (11%)
 Frame = -2

Query  765  PVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCC--FWFlvp  592
            PVQP   P TYV+QIP+DQVYRVPPPENA+  E     R + +K  R   CC   WFL  
Sbjct  50   PVQP--PPGTYVIQIPKDQVYRVPPPENAQRFE-----RLSRRKPRRSHCCCCLCWFLSF  102

Query  591  lvvlgiligtivgsINAMYTPKSPKFSIAAIQY------KKSARHPTFHISLHVHNINQR  430
            L     L+G     +  ++ P+SP +SI  +              P F++++  +N N +
Sbjct  103  LAAFLFLVGLAAAILYLVFRPESPDYSIERVSISGLNLTSSGPISPEFNVTVRANNPNNK  162

Query  429  MKVSFGDGGKSSLVFKNRVIGKGK----YpsvsvkpkkSTDVDLKMVAKLSGDLRKELNG  262
            + + +  G   ++      +  G     Y   +      T +    +   SG     +NG
Sbjct  163  IGIYYEKGSSVNVYNDGVKMAAGSLPVFYQDKNNVTVFVTSLKGSAIELTSGVRTALVNG  222

Query  261  RRKKL----MALKISVPMEISSWAKGKKKDISIKCVFKVGSLAKSTDL-SEEC  118
              K      +AL+  V  ++ S  K  K  + + C   V  L  S  + S+ C
Sbjct  223  VSKGTVPFNLALRAPVKFKVGS-VKTWKITVKVDCDLTVDKLTASAKIGSKSC  274



>ref|XP_006400683.1| hypothetical protein EUTSA_v10015699mg [Eutrema salsugineum]
 gb|ESQ42136.1| hypothetical protein EUTSA_v10015699mg [Eutrema salsugineum]
Length=316

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 97/197 (49%), Gaps = 17/197 (9%)
 Frame = -2

Query  765  PVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplv  586
            P QP   P TY+VQ+ +++V+RVPPPENA+  E Y   R  N+  +  R+C + FL  L+
Sbjct  82   PKQP-PPPGTYLVQLRKEEVFRVPPPENARRYE-YLSRRKHNR--STFRRCFWSFLATLL  137

Query  585  vlgiligtivgsINAMYTPKSPKFSIAAIQYK-------KSARHPTFHISLHVHNINQRM  427
            VL IL   +VG +  +Y P  P FS++ +           S   P   + +   N+N R+
Sbjct  138  VLLILAALVVGILFLIYRPHKPLFSVSGVSIAGINLTSPSSPISPVIKVKVRAKNVNARL  197

Query  426  KVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKELNGRR  256
             + +G GG   L +    +G G++ +     +  T    K+     +L+   RKEL G  
Sbjct  198  GLIYGKGGAIELYYDGIKLGDGEFTAFEQPAENVTVTVTKLWGLRIQLASSSRKELMGLE  257

Query  255  KK---LMALKISVPMEI  214
            KK      L+I  P++ 
Sbjct  258  KKGKVPFDLRIKAPVKF  274



>ref|XP_007016676.1| Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family, putative isoform 1 [Theobroma cacao]
 ref|XP_007016677.1| Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family, putative isoform 1 [Theobroma cacao]
 gb|EOY34295.1| Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family, putative isoform 1 [Theobroma cacao]
 gb|EOY34296.1| Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family, putative isoform 1 [Theobroma cacao]
Length=260

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 69/141 (49%), Gaps = 9/141 (6%)
 Frame = -2

Query  765  PVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplv  586
            P +P   P TYV+QIP+DQ+YRVPPPENA+    Y  +          R CC   L  ++
Sbjct  27   PEKPVPQPGTYVIQIPKDQIYRVPPPENAR---RYAHLSKRKASGGTCRSCCCCLLTVIL  83

Query  585  vlgiligtivgsINAMYTPKSPKFSIAAIQYK------KSARHPTFHISLHVHNINQRMK  424
            VL +        +  ++ P+SP +S+ ++  K       S   P F +++  HN N ++ 
Sbjct  84   VLLLSAAIAAAVVYFVFKPESPNYSVESVAIKGLNLTSASPLSPEFDVTVRAHNPNDKIG  143

Query  423  VSFGDGGKSSLVFKNRVIGKG  361
            + +  G    + +++  +  G
Sbjct  144  IYYEKGSSVKVYYEDVNLCNG  164



>emb|CDY09100.1| BnaA02g05260D [Brassica napus]
Length=303

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 108/228 (47%), Gaps = 26/228 (11%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            P TY+VQIP++Q+YR+PPPENA+  E Y   R  N+  +  R+CC + L  L+VL  L  
Sbjct  75   PGTYLVQIPKEQIYRIPPPENARRYE-YLSRRKPNR--SACRRCCCYSLAALLVLATLAA  131

Query  564  tivgsINAMYTPKSPKFSIAAIQY-------KKSARHPTFHISLHVHNINQRMKVSFGDG  406
             +VG    ++ P  P FS++ +           S   P   I +   N+N+++ + +G G
Sbjct  132  ALVGIFFLVFRPHKPTFSVSEVSVAGINLTSSTSLISPLIKIKVRSENVNEKLGLIYGGG  191

Query  405  GKSSLVFKNRVIGKGKYpsvsvkpkkST-DVDLKMVAKLSGDL--RKELNGRRKK---LM  244
              + + +    +G G++ +    P+  T  V     +++   L  +K+L    KK     
Sbjct  192  SAAEIFYDGAKLGDGEFTAFDQPPENVTVTVTTLRGSRIQNPLAKKKDLKESEKKGKVPF  251

Query  243  ALKISVPME-----ISSWAKGKKKDISIKCVFKVGSLAKS-TDLSEEC  118
             L++  P +     ++ W       +++ C   V  L  S T L+E C
Sbjct  252  DLRVRAPFKFKVSAVTMWTMA----VTVDCKLTVDKLTSSATVLTENC  295



>ref|XP_009126502.1| PREDICTED: uncharacterized protein LOC103851399 [Brassica rapa]
Length=303

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 73/137 (53%), Gaps = 10/137 (7%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            P TY+VQIP++Q+YR+PPPENA+  E Y   R  N+  +  R+CC + L  L+VL  L  
Sbjct  75   PGTYLVQIPKEQIYRIPPPENARRYE-YLSRRKPNR--SACRRCCCYSLAALLVLATLAA  131

Query  564  tivgsINAMYTPKSPKFSIAAIQY-------KKSARHPTFHISLHVHNINQRMKVSFGDG  406
             +VG    ++ P  P FS++ +           S   P   I +   N+N+++ + +G G
Sbjct  132  ALVGIFFLVFRPHKPTFSVSEVSVAGINLTSSTSLISPLIKIKVRSENVNEKLGLIYGGG  191

Query  405  GKSSLVFKNRVIGKGKY  355
              + + +    +G G++
Sbjct  192  SAAEIFYDGAKLGDGEF  208



>ref|XP_009350715.1| PREDICTED: protein YLS9-like [Pyrus x bretschneideri]
Length=272

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 68/142 (48%), Gaps = 12/142 (8%)
 Frame = -2

Query  759  QPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvl  580
            +P  +P TYV+QIP+DQVYRVPPPENA   + Y      N + +  R C  WF   +  L
Sbjct  38   KPVPSPGTYVIQIPKDQVYRVPPPENATRYKNYTRQ---NPRRSSCRCCFCWFFGLVAAL  94

Query  579  giligtivgsINAMYTPKSPKFSIAAIQYK---------KSARHPTFHISLHVHNINQRM  427
             +L     G    +  PKSP +SI +I ++           A  P   +++   N N+++
Sbjct  95   ILLSAAAAGIFYLVVRPKSPNYSIDSIAFRGFNLTAPSPSYAISPEIQVTVRAQNPNKKI  154

Query  426  KVSFGDGGKSSLVFKNRVIGKG  361
             + +G      L + +  +  G
Sbjct  155  GIYYGKKSSVKLFYSDGKLCDG  176



>emb|CDX83252.1| BnaA03g22540D [Brassica napus]
Length=256

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 104/226 (46%), Gaps = 17/226 (8%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            P TYV+Q+P+DQ+Y VPPPENA     +Q +       +R R C   FL  + +L +L G
Sbjct  30   PATYVIQVPKDQIYHVPPPENA---HRFQHLSQKKVHRSRCRSCFCSFLAAIFILVVLAG  86

Query  564  tivgsINAMYTPKSPK-----FSIAAIQ-YKKSARHPTFHISLHVHNINQRMKVSFGDGG  403
              +  I  ++ P++PK     FS++ I     S   P F++++   N N ++ + +  G 
Sbjct  87   ISLAVIYLVFRPEAPKYSVEDFSVSGINLLSPSPNSPKFNVTVMSRNGNGQIGIYYEKGS  146

Query  402  KSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKELNG---RRKKLMA  241
               + +K+  +  G  P      K  T V   +     +L+  +RKE+     R+     
Sbjct  147  TVDVFYKDVDLCHGALPVFYQSAKNVTVVKTVLTGSKIQLTSGIRKEMRNDLSRKSFPFK  206

Query  240  LKISVPMEIS-SWAKGKKKDISIKCVFKVGSLAKSTDL-SEECQAD  109
            LK   P++I     K     +++ C   V  LA  T + S +C  D
Sbjct  207  LKTRAPVKIKIGSVKTWTITVNVNCDVTVDKLAAPTRIVSSKCSHD  252



>ref|XP_009386952.1| PREDICTED: uncharacterized protein LOC103973972 [Musa acuminata 
subsp. malaccensis]
Length=266

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 106/237 (45%), Gaps = 39/237 (16%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYVVQ+P+DQ+YRVPPPENA + E Y+  R  N++ +    C  W L  ++++ +L   I
Sbjct  41   TYVVQVPKDQIYRVPPPENAHLAEQYRN-RDKNERRSPCLGCLKWILGAVLLVLLLAIVI  99

Query  558  vgsINAMYTPKSPKFSIAAIQY--------KKSARHPTFHISLHVHNINQRMKVSFGDGG  403
             G I     P SP F++  +          K S   P    ++ V N ++ M  S+  GG
Sbjct  100  TGVILVTVRPGSPTFTVQRLSVNSSPHTTTKGSHPKPECDFTMRVRNPSKGMGFSYEAGG  159

Query  402  KSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKL-----MAL  238
            K+ ++ K   I  G            T   L    K +   R  L+G    L     M+L
Sbjct  160  KTVVLHKGAHIAAG------------TTPALVQGPKNTTTFRLVLHGSNMLLTKVIDMSL  207

Query  237  KIS---VPMEISSWAKGKKK---------DISIKCVFKVGSLAKSTD-LSEECQADF  106
            K S   +P+E+++    K +          + + C  +V  L K    LS+EC+ + 
Sbjct  208  KGSKDVIPLELAAEFTVKPRVGVVELGATSMYVTCDVRVRRLVKEARILSQECKTNL  264



>ref|XP_008665894.1| PREDICTED: uncharacterized protein LOC103644471 [Zea mays]
 tpg|DAA43834.1| TPA: hypothetical protein ZEAMMB73_381323 [Zea mays]
Length=275

 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 63/254 (25%), Positives = 111/254 (44%), Gaps = 27/254 (11%)
 Frame = -2

Query  783  SLTFSLPVQPGEAP-------ETYVVQIPRDQVYRVPPPENAKIVEGYQE---------M  652
            S TFS P++P  AP        TYVVQ+ +DQ+YRVPPPENA   E Y+           
Sbjct  23   STTFSSPLEPVSAPAAATPVHSTYVVQVQKDQIYRVPPPENAYFAERYRNERGGGGKKKK  82

Query  651  RSTNKKDTRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSARHP  472
            R +++       C    L  L+    L+G  V     +  P  P FS+  I    S R  
Sbjct  83   RGSSEWSAACSPCVLRTLGALLAAAALVGAAVLISLVVLRPGVPGFSVERIAVINSTRQQ  142

Query  471  TFHISLHVHNIN-QRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDL-----  310
                 L +  +N  +M   +   G++ L      + KG     +   + +TD  +     
Sbjct  143  RVDYDLFLTAVNPNKMTALWYRSGRARLTHHGTTLAKGDVGQPADGGEDATDFSVLLQGQ  202

Query  309  KMVAKLSGDLRKELNGRRKKL---MALKISVPMEISSWAKGKKKDISIKCVFKVGSLAKS  139
            K   +    + K  +G +  L   +A++++V + + ++  G+++ +++ C      L+K 
Sbjct  203  KHNGRTPRAVEKGFSGSKDHLALQLAVEVTVQVHVGAFGFGQRR-LAVDCGITAAGLSKD  261

Query  138  TDL-SEECQADF*N  100
              + S+ C++ F N
Sbjct  262  VHIASQNCRSSFRN  275



>ref|XP_009133912.1| PREDICTED: uncharacterized protein LOC103858334 [Brassica rapa]
Length=256

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 106/227 (47%), Gaps = 19/227 (8%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFW-Flvplvvlgili  568
            P TYV+Q+P+DQ+Y VPPPENA     +Q +       +R R CCF  FL  + +L +L 
Sbjct  30   PATYVIQVPKDQIYHVPPPENA---HRFQHLSQKKVHRSRCR-CCFCSFLAAIFILVVLA  85

Query  567  gtivgsINAMYTPKSPKFSIAAIQ------YKKSARHPTFHISLHVHNINQRMKVSFGDG  406
            G  +  I  ++ P++PK+S+             S   P F++++   N N ++ + +  G
Sbjct  86   GISLAVIYLVFRPEAPKYSVEGFSVSGINLLSPSPNSPKFNVTVMSRNGNGQIGIYYEKG  145

Query  405  GKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKELNG---RRKKLM  244
                + +++  +  G  P      K  T V   +     +L+  +RKE++    R+    
Sbjct  146  STVDVFYEDVDLCNGALPVFYQPAKNVTVVKTVLTGSKIQLTSGIRKEMHNDLSRKSFPF  205

Query  243  ALKISVPMEIS-SWAKGKKKDISIKCVFKVGSLAK-STDLSEECQAD  109
             LKI  P++I     K     +++ C   V  LA  S  +S +C  D
Sbjct  206  KLKIRAPVKIKIGSVKTWTITVNVYCDVTVDKLAAPSRIVSSKCSHD  252



>emb|CDY09101.1| BnaA02g05270D [Brassica napus]
Length=293

 Score = 66.2 bits (160),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 57/230 (25%), Positives = 106/230 (46%), Gaps = 28/230 (12%)
 Frame = -2

Query  747  APETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgili  568
            +P TY+VQIPR+Q+YRVPPPENA+    Y+++       +  R+CC + L  L+VL  L 
Sbjct  64   SPGTYLVQIPREQIYRVPPPENAR---RYEDLSRRKPNRSACRRCCCYSLTVLLVLVTLA  120

Query  567  gtivgsINAMYTPKSPKFSIAAIQY-------KKSARHPTFHISLHVHNINQRMKVSFGD  409
              +VG    ++ P  P FS++ +           S       + +   N+N+++ + +G 
Sbjct  121  AVLVGIFFLVFRPHKPMFSVSGVSVAGINLTSSTSLISSLVEVKVRSENVNEKLGLIYGG  180

Query  408  GGKSSLVFKNRVIGKGKYpsvsvkpkkSTDV-------DLKMVAKLSGDLRKELNGRRKK  250
            G  + + +    +G G++ +    P+  T          +++ +    DL KE   + K 
Sbjct  181  GSAAEIFYDGAKLGDGEFTAFDQPPENVTVTVTTLRGSRIQLTSSTLEDL-KESEKKGKV  239

Query  249  LMALKISVPME-----ISSWAKGKKKDISIKCVFKVGSLAKS-TDLSEEC  118
               L++  P +     ++ W       +++ C   V  L  S T ++E C
Sbjct  240  PFDLRVKAPFKFKVGVVTMWTMA----VTVDCKLTVNKLTSSATVITENC  285



>ref|XP_008359184.1| PREDICTED: protein NDR1-like [Malus domestica]
Length=272

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 89/190 (47%), Gaps = 16/190 (8%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            P TYV+QIP+DQVYRVPPPENA   + Y      N + +  R C  W    +  L +L  
Sbjct  43   PGTYVIQIPKDQVYRVPPPENATRYKNYXRQ---NPRRSSCRCCFCWLFGLVAALILLSA  99

Query  564  tivgsINAMYTPKSPKFSIAAIQYK---------KSARHPTFHISLHVHNINQRMKVSFG  412
               G    +  P+SP +SI +I +K          S   P   +++ V N N+++ + +G
Sbjct  100  AAAGIFYLVVRPESPNYSIESIAFKGFHLTTPSPSSTISPEIQVTVRVQNPNKKIGIYYG  159

Query  411  DGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKEL-NGRRKKLM  244
                  L + +  +  G  P+     K  T+    +     KL+  +++ L + +R+  +
Sbjct  160  KKNSVKLFYSDIKLCDGALPAFYQPSKNVTEFRTALKGSGIKLTSTVQQGLVDAQRQGKV  219

Query  243  ALKISVPMEI  214
             LK+ + M +
Sbjct  220  PLKLDLRMPV  229



>ref|XP_009126503.1| PREDICTED: uncharacterized protein LOC103851400 [Brassica rapa]
Length=293

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 72/138 (52%), Gaps = 10/138 (7%)
 Frame = -2

Query  747  APETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgili  568
            +P TY+VQIPR+Q+YRVPPPENA+    Y+++       +  R+CC + L  L+VL  L 
Sbjct  64   SPGTYLVQIPREQIYRVPPPENAR---RYEDLSRRKPNRSACRRCCCYSLTVLLVLVTLA  120

Query  567  gtivgsINAMYTPKSPKFSIAAIQY-------KKSARHPTFHISLHVHNINQRMKVSFGD  409
              +VG    ++ P  P FS++ +           S       + +   N+N+++ + +G 
Sbjct  121  AVLVGIFFLVFRPHKPMFSVSGVSVAGINLTSSTSLISSLVEVKVRSENVNEKLGLIYGG  180

Query  408  GGKSSLVFKNRVIGKGKY  355
            G  + + +    +G G++
Sbjct  181  GSAAEIFYDGAKLGDGEF  198



>ref|XP_003519484.1| PREDICTED: uncharacterized protein LOC100789647 [Glycine max]
Length=273

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 121/272 (44%), Gaps = 30/272 (11%)
 Frame = -2

Query  843  MDGRVSP-----VGGDGRKGDPALTSLTFSLPVQPGE-----APETYVVQIPRDQVYRVP  694
            M  RV P     V  D +   P  +S+    P+ P        P TYV++IP+DQVYRVP
Sbjct  1    MADRVHPSHSPSVSADSQPASPQDSSVVPKPPLPPSSEKPVPPPGTYVIKIPKDQVYRVP  60

Query  693  PPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKF  514
            PPENA+    Y +      + +R   C  W +  L +L + +    G +  ++ P+ PK+
Sbjct  61   PPENAR---RYDQYTRRKHRRSRCCCCFCWLIGILFILVVFLAIAAGVLYLVFRPEEPKY  117

Query  513  SIAAIQYK---------KSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKG  361
            SI  I  +          +A  P F++++   N N ++ + +     + + +K+  +  G
Sbjct  118  SIENIAVRGINLTSPSSTAAMSPVFNVTVKADNPNDKIGIRYLKDSSAEVFYKDARLCNG  177

Query  360  KYpsvsvkpkkSTDVDLKMVA---KLSGDLRKEL---NGRRKKLMALKISVPMEISSWA-  202
              P+        T     +     +L  ++R+ L     +R+  + ++I  P++I   + 
Sbjct  178  ALPAFYQPSNNVTVFGTALRGDGIELRSEVRRALLEAQTKRRVPLTVRIRAPVKIKVGSV  237

Query  201  KGKKKDISIKCVFKVGSL-AKSTDLSEECQAD  109
            K  K  + + C   V  L A++  +S+ C  D
Sbjct  238  KTWKITVKVNCHMTVNELTARAKIVSKRCNYD  269



>ref|XP_009341739.1| PREDICTED: protein YLS9-like [Pyrus x bretschneideri]
 ref|XP_009341740.1| PREDICTED: protein YLS9-like [Pyrus x bretschneideri]
Length=272

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 65/137 (47%), Gaps = 12/137 (9%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            P TYV+QIP+DQVYRVPPPENA   + Y      N + +  R C  W    +  L +L  
Sbjct  43   PGTYVIQIPKDQVYRVPPPENATRYKNYTRQ---NPRRSSCRCCFCWLFGLVAALILLSA  99

Query  564  tivgsINAMYTPKSPKFSIAAIQYK---------KSARHPTFHISLHVHNINQRMKVSFG  412
               G    +  P+SP +SI +I +K          S   P   +++ V N N+++ + +G
Sbjct  100  AAAGIFYLVVRPESPNYSIESIAFKGFNLTTPSPSSTISPEIQVTVRVQNPNKKIGIYYG  159

Query  411  DGGKSSLVFKNRVIGKG  361
                  L + +  +  G
Sbjct  160  KKNSVKLFYSDVKLCDG  176



>ref|XP_009413864.1| PREDICTED: uncharacterized protein LOC103995083 [Musa acuminata 
subsp. malaccensis]
Length=251

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 69/133 (52%), Gaps = 8/133 (6%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYVV++P+DQVYRVPPPENAK+ E Y+    + ++ +    C  W L    ++ +LI  +
Sbjct  87   TYVVRVPKDQVYRVPPPENAKLAERYRNQNRSRRRGSPCLSCLKWILGVAFLVLLLIVAV  146

Query  558  vgsINAMYTPKSPKFSIAAIQYKKSARH-------PTFHISLHVHNINQRMKVSFGDGGK  400
                  +  P +P F++  + + KS R        P + +++ V N ++ M  S+  GG+
Sbjct  147  TVIFFVVGRPGAPTFTVQRL-FVKSPRSTTGAHPKPEYDLTMSVRNPSRGMGFSYEAGGR  205

Query  399  SSLVFKNRVIGKG  361
            + +      I  G
Sbjct  206  AVITHGTVEIAAG  218



>ref|XP_008366385.1| PREDICTED: protein NDR1-like [Malus domestica]
Length=274

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 65/144 (45%), Gaps = 14/144 (10%)
 Frame = -2

Query  759  QPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvl  580
            +P   P TYV+QIP+DQVYRVPPPENA   + Y      N + +  R C  W    +  L
Sbjct  38   KPVPPPGTYVIQIPKDQVYRVPPPENATRYKNYTRQ---NPRRSSCRCCFCWLFGLVAAL  94

Query  579  giligtivgsINAMYTPKSPKFSIAAIQYK-----------KSARHPTFHISLHVHNINQ  433
              L     G    +  PKSP +SI +I ++             A  P   +++   N N+
Sbjct  95   IFLSAAAAGIFYLVVRPKSPNYSIDSIAFRGFNLTAPSPSPSYAISPEIQVTVRAQNPNK  154

Query  432  RMKVSFGDGGKSSLVFKNRVIGKG  361
            ++ + +G      L + +  +  G
Sbjct  155  KIGIYYGKKSSVXLFYSDVKLCDG  178



>emb|CDY38543.1| BnaC03g26540D [Brassica napus]
Length=256

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 63/227 (28%), Positives = 107/227 (47%), Gaps = 19/227 (8%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFW-Flvplvvlgili  568
            P TYV+Q+P+DQ+Y VPPPENA     +Q +       +R R CCF   L  + +L +L 
Sbjct  30   PATYVIQVPKDQIYYVPPPENA---HRFQHLSQKKVHRSRCR-CCFCSVLAAIFILIVLA  85

Query  567  gtivgsINAMYTPKSPK-----FSIAAIQ-YKKSARHPTFHISLHVHNINQRMKVSFGDG  406
            G  +  I  ++ P++PK     FS++ I     S   P F++++   N N ++ + +  G
Sbjct  86   GISLAVIYLVFCPEAPKYYVEGFSVSGINLLSPSPNSPIFNVTVMSRNGNGKIGIYYEKG  145

Query  405  GKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKELNG---RRKKLM  244
                + +++  +  G  P      K  T V   +     +L+  +RKE+     R+    
Sbjct  146  STVDVFYEDVDLCNGALPVFYQPAKNVTVVKTVLTGSKIQLTSGIRKEMRNDLSRKSFPF  205

Query  243  ALKISVPMEIS-SWAKGKKKDISIKCVFKVGSLAK-STDLSEECQAD  109
             LKI  P++I   + K     +++ C   V  LA  S  +S +C  D
Sbjct  206  KLKIRAPVKIKIGFVKTWTITVNVNCDVTVDKLAAPSRIVSGKCSHD  252



>ref|XP_011043555.1| PREDICTED: protein YLS9-like [Populus euphratica]
Length=280

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 66/127 (52%), Gaps = 14/127 (11%)
 Frame = -2

Query  759  QPGEAPE-TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCC--FWFlvpl  589
            +PG+ P  TYV+QIP+DQVYRVPPPENA+  E     R + +K  R   CC   WFL  L
Sbjct  48   KPGQPPPGTYVIQIPKDQVYRVPPPENAQRFE-----RLSRRKPRRSHCCCCLCWFLSFL  102

Query  588  vvlgiligtivgsINAMYTPKSPKFSIAAIQY------KKSARHPTFHISLHVHNINQRM  427
                 L+G     +  ++ P+SP +SI  +              P F++++  +N N ++
Sbjct  103  AAFLFLVGLAAAILYLVFRPESPDYSIERVSISGLNLTSSGPISPEFNVTVRANNRNNKI  162

Query  426  KVSFGDG  406
             + +  G
Sbjct  163  GIYYEKG  169



>ref|XP_010031644.1| PREDICTED: protein YLS9 [Eucalyptus grandis]
 gb|KCW51001.1| hypothetical protein EUGRSUZ_J00628 [Eucalyptus grandis]
Length=268

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 63/243 (26%), Positives = 108/243 (44%), Gaps = 23/243 (9%)
 Frame = -2

Query  771  SLPVQ--PGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFl  598
            +LP Q  P   P TYV+Q+P+DQVYRVPPPENAK+ + Y     T +   R   CC  FL
Sbjct  33   ALPAQDKPVPPPLTYVIQLPKDQVYRVPPPENAKLFQRY-----TRRGQRRGSPCCCIFL  87

Query  597  vplvvlgiligtivgsINAMYTPKSPKFSIAAIQYK------KSARHPTFHISLHVHNIN  436
                 + ++          +  P+ PK+++  +          SA  P   +++   N N
Sbjct  88   AVAAFVLLVGAAAGLFY-LILKPEPPKYAVDGVAISGVDLNTTSAMSPEIILAVRAENPN  146

Query  435  QRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKM----VAKLSGDLRKEL  268
             ++ + +  G   ++ +    +  G  P++    K  T  ++ +    V   S  LR   
Sbjct  147  DKIGIYYLGGSSVNMYYDAVRLAGGALPAMYQSSKSYTVFNVTLTGSDVVLTSDSLRDLT  206

Query  267  NGRRKKLMALKISV--PMEISSWA-KGKKKDISIKCVFKVGSLAKSTDLSEECQADF*NV  97
              + +  + LK++V  P++    A K  K  + + C   V  L  S  + +E   D+ +V
Sbjct  207  TEQSQGSVPLKLTVKAPVKFKVGAVKTWKITVKLSCDVTVDKLTASAKVVQE-DCDY-SV  264

Query  96   QIF  88
             IF
Sbjct  265  NIF  267



>ref|XP_008451090.1| PREDICTED: protein YLS9-like [Cucumis melo]
Length=261

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 68/228 (30%), Positives = 108/228 (47%), Gaps = 24/228 (11%)
 Frame = -2

Query  756  PGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlg  577
            P   P TYV+Q+P+DQ+YRVPPPENA   + Y   R   ++    R C F  L  L++L 
Sbjct  27   PSPPPGTYVIQLPKDQIYRVPPPENAHRFQLY--TRQNRRRRNPCRSCLFCLLAILILLI  84

Query  576  iligtivgsINAMYTPKSPKFSIAAIQY---------KKSARHPTFHISLHVHNINQRMK  424
            IL+G  V     +  PKSP +SI AI             SA  P F++++   N N+++ 
Sbjct  85   ILLGITVAVFYLVVRPKSPNYSIDAISVSGLNLLTSSSSSAISPLFNLTVRADNPNKKIG  144

Query  423  VSFGDGGKSSLVFKNRVIGKG---------KYpsvsvkpkkSTDVDLKMVAKLSGDLRKE  271
            + +  G    + F N  + +G         K  SV     + T V+L   AK +G +  E
Sbjct  145  IYYLTGSSVRIYFSNEKLSEGVLPDFFQPAKNVSVLRSVVRGTGVNLSSGAK-NGLI--E  201

Query  270  LNGRRKKLMALKISVPMEISSWA-KGKKKDISIKCVFKVGSLAKSTDL  130
               +R  ++ ++I VP+++   A K  K  + + C   V  L  +  +
Sbjct  202  SVKQRVVVLKVEIGVPIKVKVGAVKSWKMRVKVNCDVTVDELTTAAKI  249



>ref|NP_001275940.1| protein NDR1-like [Solanum tuberosum]
 gb|AFI81517.1| LEA2-like protein [Solanum tuberosum]
Length=263

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 58/226 (26%), Positives = 111/226 (49%), Gaps = 19/226 (8%)
 Frame = -2

Query  747  APETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgili  568
            +P TYVVQ+P+DQ+YR PPP N++    Y+ +R    + +   +C  +    L++L I +
Sbjct  36   SPGTYVVQVPKDQIYRYPPPGNSR---RYEALRKRKPRRSFCCRCVCYTFSLLLILIIAL  92

Query  567  gtivgsINAMYTPKSPKFSIAAIQYKK------SARHPTFHISLHVHNINQRMKVSFGDG  406
            G     +  ++ P++PK++I+ +  K       S   P F +++   N N ++ + +  G
Sbjct  93   GITAAVLYLVFRPEAPKYTISNVAIKNFNLTSSSPVSPEFDVTVRAENPNNKIGIYYRKG  152

Query  405  GKSSLVFKNRVIGKGKYpsvsvkpkkST--DVDLKMVAKLSGD-----LRKE-LNGRRKK  250
               ++ + +  +  G+ P+        T     LK    L G+     LR E L G+   
Sbjct  153  SSVTVFYSDVRLSNGELPAFYQPTNNVTVFQTPLKGSNVLLGNAVKTALRNEQLKGKVPF  212

Query  249  LMALKISVPMEISSWAKGKKKDISIKCVFKVGSL-AKSTDLSEECQ  115
             + +K  V +++ +  K  +  + +KC   V +L AKS  +SE+C+
Sbjct  213  KVNIKAPVKVKVGA-VKMWEITVKVKCDITVNTLTAKSKIISEDCK  257



>ref|XP_008360396.1| PREDICTED: uncharacterized protein LOC103424098 [Malus domestica]
Length=245

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 73/130 (56%), Gaps = 6/130 (5%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TY+VQ+P+DQ Y VPP ENA I   +Q+    ++K  R   C  + +  +  + +L+  +
Sbjct  55   TYIVQVPKDQNYHVPPLENAHIFXRHQD---PSRKRKRPLCCNLYCIGIIAFIVLLVVML  111

Query  558  vgsINAMYT-PKSPKFSIA-AIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVF  385
            V   + M+   ++P FSI   + + KS   P + ++L V N N R+ + + +GG +SL F
Sbjct  112  VRIFSIMFANSENPIFSIERVVVHSKSNGLPDYSVTLRVQNPNSRLAIVY-NGGDTSLHF  170

Query  384  KNRVIGKGKY  355
            + + I  GKY
Sbjct  171  RQKTIANGKY  180



>ref|XP_002879057.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55316.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=225

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 64/224 (29%), Positives = 108/224 (48%), Gaps = 19/224 (8%)
 Frame = -2

Query  735  YVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFW-Flvplvvlgiligti  559
            +V+Q+P+DQ+YR+PPPENA   E     + TN+ + R   CCF  FL  + +L +L G  
Sbjct  2    WVIQVPKDQIYRIPPPENAHRFEQLSR-KKTNRSNCR---CCFCSFLATIFILIVLAGIS  57

Query  558  vgsINAMYTPKSPKFSIAAIQY------KKSARHPTFHISLHVHNINQRMKVSFGDGGKS  397
            +  +  +Y P++PK+SI             S   P F++++   N N ++ V +      
Sbjct  58   LAILYLIYRPEAPKYSIEGFTVSGINLNSTSPISPNFNVTVRSRNGNGKIGVYYEKESSV  117

Query  396  SLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKEL-NGRRKKLMA--LK  235
             + + +  +  G  P      K  T V L +     +L+  +RKE+ N   KK +   LK
Sbjct  118  DVYYNDVDLCNGVMPVFYQPAKNVTVVRLALSGSKIQLTSGMRKEMRNEVSKKTLPFKLK  177

Query  234  ISVPMEISSWA-KGKKKDISIKCVFKVGSL-AKSTDLSEECQAD  109
            I  P++I   + K     ++++C   V  L A S  +S +C  D
Sbjct  178  IKAPVKIKVGSVKTWTMIVNVECDVTVDKLTAPSRIVSRKCSHD  221



>ref|XP_003617084.1| Avr9/Cf-9 rapidly elicited protein [Medicago truncatula]
 gb|AET00043.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Medicago truncatula]
Length=255

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 70/137 (51%), Gaps = 16/137 (12%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCC--FWFlvplvvlgilig  565
            TYV++IP+D V+RVPPPENA+  E Y     T KK  R R CC   WF+  + +L  L+G
Sbjct  28   TYVIKIPKDIVHRVPPPENARRYEQY-----TRKKHRRNRHCCCLCWFIGIIFILIALLG  82

Query  564  tivgsINAMYTPKSPKFSIAAIQYK---------KSARHPTFHISLHVHNINQRMKVSFG  412
               G    ++ PK+P ++I  I  +          +   P F +++   N N ++ +S+ 
Sbjct  83   IAAGIFYLVFRPKAPNYTIENITIRGINITSPSSTTGISPEFDVTVKADNPNDKIGISYE  142

Query  411  DGGKSSLVFKNRVIGKG  361
                + + +K+  +  G
Sbjct  143  KDSSAEIFYKDMRLCNG  159



>ref|XP_010689396.1| PREDICTED: uncharacterized protein LOC104903108 [Beta vulgaris 
subsp. vulgaris]
Length=292

 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 64/231 (28%), Positives = 109/231 (47%), Gaps = 24/231 (10%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTR--LRKCCFWFlvplvvlgil  571
            P TYVVQ+P+DQ+YRVPPPENA   + Y     TNKK  +   R C  +FL  +++L IL
Sbjct  63   PGTYVVQVPKDQIYRVPPPENAHKYKLY-----TNKKARQGGCRSCICYFLAAILILAIL  117

Query  570  igtivgsINAMYTPKSPKFSIAAIQYK---------KSARHPTFHISLHVHNINQRMKVS  418
            +      +  +Y PK+P +SI  +  +          +   P F++++   N N ++ + 
Sbjct  118  LAVTGAVLYLVYKPKAPTYSIENLHVRGINLTSTATSTTISPVFNVTIKAENNNGKIGIY  177

Query  417  FGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LSGDLRKELNGRRKK-  250
            +  G    +      +  GK P+    PK  T    ++      LS   R++L   +KK 
Sbjct  178  YEQGSLIKIYHDGLNLCDGKLPAFYQPPKSLTVFSTELSGAGIVLSKSARQKLLTEQKKG  237

Query  249  --LMALKISVPMEIS-SWAKGKKKDISIKCVFKVGSL-AKSTDLSEECQAD  109
               + + + VP++I     K     I + C   V +L A +  +S+ C+ +
Sbjct  238  TVPLDINVEVPVKIRIGSVKTWTISIDVSCDVTVNALTANAKVVSKNCKVN  288



>ref|XP_008343664.1| PREDICTED: uncharacterized protein LOC103406463 [Malus domestica]
Length=164

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 59/113 (52%), Gaps = 17/113 (15%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKC----CFWFlvplvvlgil  571
            TYVVQIP+DQ+YRVPPPENA IVE     R  N ++ +   C    C      +  L ++
Sbjct  41   TYVVQIPKDQIYRVPPPENALIVE-----RHRNPENKKKSPCCTIRCLIIGAIVFSLCLI  95

Query  570  igtivgsINAMYTPKSPKFSIAAIQYKKS--------ARHPTFHISLHVHNIN  436
            +   + S++    PK PKFSI+ +  K            HP + +S+ V+N N
Sbjct  96   LFITLLSLSLTVKPKEPKFSISNVHVKNPKSKSDXGKNSHPGYEVSVKVNNPN  148



>emb|CDP19130.1| unnamed protein product [Coffea canephora]
Length=289

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 107/231 (46%), Gaps = 21/231 (9%)
 Frame = -2

Query  768  LPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvpl  589
            LP  PG    TYV+Q+P+DQ++  PPPENA     +Q++ S   + +  R C  + +  L
Sbjct  59   LPAPPG----TYVIQVPKDQIFSYPPPENA---SNFQKLSSRKPRRSCCRLCVCYTVFVL  111

Query  588  vvlgiligtivgsINAMYTPKSPKFSIAAIQYK------KSARHPTFHISLHVHNINQRM  427
             ++ +      G +  +Y PK+PK+++  +  +       SA  P F +S+   N N+++
Sbjct  112  FLVIVAAAISAGVLYLVYRPKAPKYAVLDVAIRGLNSTSTSAMSPEFDVSIRAENPNKKI  171

Query  426  KVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAK---LSGDLRKELNGRR  256
             + +  G +  +   +  +  G +P      K  T     +      LS D+R  +    
Sbjct  172  GIYYLSGSEIQVSHGDVGLSNGAWPVFYQPSKNVTVFQTALKGSDVVLSDDVRLAMANEL  231

Query  255  KK---LMALKISVPMEISSWA-KGKKKDISIKCVFKVGSLAKSTDL-SEEC  118
            ++      L I  P++I   + K  K  + +KC   V +L + + + S++C
Sbjct  232  REGNVPFRLNIKAPVKIKVGSVKTWKITVKVKCDVAVDALNQQSKIVSKDC  282



>ref|XP_010424211.1| PREDICTED: uncharacterized protein LOC104709267 [Camelina sativa]
Length=284

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 108/229 (47%), Gaps = 25/229 (11%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            P TYV++I +D++YRVPPPENA   E Y   + TN   +  R+C  + L  L++L +L  
Sbjct  56   PGTYVIEIRKDEIYRVPPPENAHRYE-YLSRQKTNH--SPCRRCFCYSLAALLILLLLAA  112

Query  564  tivgsINAMYTPKSPKFSIAAIQY------KKSARHPTFHISLHVHNINQRMKVSFGDGG  403
               G +  +Y PK P++S++ +          S   P   + L   N N ++ + +  G 
Sbjct  113  LAGGVLFLVYRPKKPQYSVSRVSVTGLNLTTSSPISPVIGVKLRAQNANGKLGLIYALGN  172

Query  402  KSSLVFKNRVIGKGKYpsvsvkpkkSTDVD--LKMVA-KLSGDLRKELNGRRKK---LMA  241
            ++ + +    +G GK+ +        T +   LK ++ +L+   RK L   +KK      
Sbjct  173  EAKVFYDGMELGNGKFTAFKQPANNVTVITTVLKGLSIQLTKTSRKGLTDSQKKGKVPFG  232

Query  240  LKISVPME-----ISSWAKGKKKDISIKCVFKVGSLAKS-TDLSEECQA  112
             KI  P++     +++W       +++ C   +  L  S T ++E C A
Sbjct  233  FKIKAPVKFKVGAVTTWP----MTVTVDCKVTLDKLTGSATVITENCDA  277



>ref|XP_002468356.1| hypothetical protein SORBIDRAFT_01g044420 [Sorghum bicolor]
 gb|EER95354.1| hypothetical protein SORBIDRAFT_01g044420 [Sorghum bicolor]
Length=272

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 107/251 (43%), Gaps = 24/251 (10%)
 Frame = -2

Query  783  SLTFSLPVQP-----GEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMR--------ST  643
            S  F  P++P         +TYVVQ+ +DQ+YRVPPPENA + E Y+  R        S+
Sbjct  23   STAFGSPLEPVAATTAATHDTYVVQVQKDQIYRVPPPENAYLAERYRNERGGGGGNKKSS  82

Query  642  NKKDTRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFH  463
             +       C    L  L+    L+G  V     +  P  P FS+  I    S R     
Sbjct  83   GQASAACSPCVLRTLGALLAAAALVGAAVLISLVVLRPGVPGFSVDRITVINSTRQQRVD  142

Query  462  ISLHVHNIN-QRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVD-----LKMV  301
              + +  +N  +M   +   G   L      +GKG     +   + + D       +K  
Sbjct  143  FDVFLTAVNPNKMTALWYRSGTVRLTHHGTTLGKGDVGQPADGGEDAIDFSVLLQGVKHN  202

Query  300  AKLSGDLRKELNGRRKKL---MALKISVPMEISSWAKGKKKDISIKCVFKVGSLAKSTDL  130
             +L   + K  +G R  L   +A++++V + + +   G+++ +++ C      L+K   +
Sbjct  203  GRLPKAVEKGFSGSRDHLPLQLAVEVTVQVHVGALGFGQRR-LAVDCGITAAGLSKDVHI  261

Query  129  -SEECQADF*N  100
             S+ C++ F N
Sbjct  262  ASQHCKSSFRN  272



>ref|XP_010904739.1| PREDICTED: protein YLS9-like [Elaeis guineensis]
Length=279

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/258 (25%), Positives = 115/258 (45%), Gaps = 36/258 (14%)
 Frame = -2

Query  801  GDPALTSLTFSLPVQPGEA------PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTN  640
            G+PA TS + S   Q   A      P TYV+Q+P+DQ+YRVPPPENA+ ++ Y   R  +
Sbjct  21   GEPAPTSRSESSLSQESFAEKLKPPPGTYVIQVPKDQIYRVPPPENARRLQAY--TRRAH  78

Query  639  KKDTRLRKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYK----------  490
            ++      C  W    L+ L +      G +  ++ PK PK+S+  +  K          
Sbjct  79   RRRCGFCCCLAWTAALLLFLLVATAAAAGILYLVFQPKIPKYSVDGLSVKGFNLSAATAA  138

Query  489  --KSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDV  316
               +A  P F  ++   N N+++ + +  G   S+ +    +  G +P+     +  T  
Sbjct  139  ANLAALSPEFDATVRADNPNEKIGIYYRSGSSISISYDGVNLCHGVWPTFYQGKRNVTVF  198

Query  315  DLKMVA---KLSGDLRKEL---NGRRKKLMALKISVPME-----ISSWAKGKKKDISIKC  169
               +     +LS  +R  L     RRK  + + ++VP+      +++W       ++++C
Sbjct  199  QTALTGSGIRLSAAMRNALVTAQSRRKVPLEINLAVPVRVKFGAVTTWT----ITVNVRC  254

Query  168  VFKVGSLA-KSTDLSEEC  118
               V  L   S  +S+ C
Sbjct  255  DVTVDKLTVDSRIVSKSC  272



>ref|XP_007205722.1| hypothetical protein PRUPE_ppa010043mg [Prunus persica]
 gb|EMJ06921.1| hypothetical protein PRUPE_ppa010043mg [Prunus persica]
Length=266

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 71/151 (47%), Gaps = 18/151 (12%)
 Frame = -2

Query  786  TSLTFSLPVQPGE-----APETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRL  622
            T L+ S P  P        P TYV+QIP+DQVYRVPPPENA   + Y   ++   + +  
Sbjct  17   TPLSLSRPSPPDSEKPVPPPGTYVIQIPKDQVYRVPPPENASRYQSYTHRKT---RRSSC  73

Query  621  RKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYK----------KSARHP  472
              CC WFL  L  +  L     G    +  P++P +S+ +I +K           SA  P
Sbjct  74   HCCCCWFLGLLAAIVFLSAAAAGIFYLVVRPEAPNYSVESIAFKGFNLTTTSSPPSAISP  133

Query  471  TFHISLHVHNINQRMKVSFGDGGKSSLVFKN  379
              H+++   N N+++ + +       L + +
Sbjct  134  EIHVTVRAQNPNKKIGIYYERESSVKLFYSD  164



>ref|XP_008231176.1| PREDICTED: uncharacterized protein LOC103330379 [Prunus mume]
Length=266

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 69/151 (46%), Gaps = 18/151 (12%)
 Frame = -2

Query  786  TSLTFSLPVQPGE-----APETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRL  622
            T L+ S P  P        P TYV+QIP+DQVYRVPPPENA     YQ       + +  
Sbjct  17   TPLSLSRPSPPDSEKPVPPPGTYVIQIPKDQVYRVPPPENA---SRYQSYTHRKPRRSSC  73

Query  621  RKCCFWFlvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYK----------KSARHP  472
              CC WFL  L  +  L     G    +  P++P +S+ +I +K           SA  P
Sbjct  74   HCCCCWFLGLLAAIVFLSAAAAGIFYLVVRPEAPNYSVESIAFKGFNLTTTSSLPSAISP  133

Query  471  TFHISLHVHNINQRMKVSFGDGGKSSLVFKN  379
              H+++   N N+++ + +       L + +
Sbjct  134  EIHVTVRAQNPNKKIGIYYERESSVKLFYSD  164



>ref|XP_009788478.1| PREDICTED: protein YLS9-like [Nicotiana sylvestris]
 ref|XP_009788479.1| PREDICTED: protein YLS9-like [Nicotiana sylvestris]
Length=271

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 59/222 (27%), Positives = 111/222 (50%), Gaps = 18/222 (8%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYVVQ+P+DQ+Y+ PPPEN++    Y+ +     + +   +C  + L+  +V  I++G  
Sbjct  46   TYVVQVPKDQIYKYPPPENSR---RYESLTKRKPQRSCCCRCLCFTLIVFLVSVIVLGVT  102

Query  558  vgsINAMYTPKSPKFSIAAIQYKK-------SARHPTFHISLHVHNINQRMKVSFGDGGK  400
             G + A+Y P+SPK++I++I  K        S   P F I++   N N ++ + +  G  
Sbjct  103  AGVLYAVYRPESPKYTISSIAIKNFNFTSATSTISPGFDIAVRAENPNDKIGIYYMKGSS  162

Query  399  SSLVFKNRVIGKGKYpsvsvkpkkST--DVDLKMVAKLSGDLRKE--LNGRRKKLMALKI  232
             ++V+    +  G  P+        T     LK    + G   K   +N +RK+ +  ++
Sbjct  163  VTVVYSGVDLSTGVLPAFFQPANNVTVFKTALKGSKVMLGSAVKSTLMNEQRKRKVPFRV  222

Query  231  SV--PMEISSWA-KGKKKDISIKCVFKVGSL-AKSTDLSEEC  118
            ++  P++I   A K  +  + + C   V +L  KS  +S++C
Sbjct  223  NIKAPVKIKIGAVKTWEITVKVNCGVTVDALTVKSKLVSKDC  264



>ref|XP_003564453.1| PREDICTED: protein YLS9-like [Brachypodium distachyon]
Length=299

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 99/216 (46%), Gaps = 21/216 (10%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            P TYVVQ+P+D+V+RVPPPENA++ + Y   R+  ++      CC    + L+ L IL+ 
Sbjct  67   PGTYVVQVPKDKVFRVPPPENARLFQHYAR-RAKRRRSGCFSSCCLCLFLALLALAILLA  125

Query  564  tivgsINAMYTPKSPKF-----SIAAIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGK  400
             + G       P+ P +     +++ I     A  P F  ++   N N ++ V +  G  
Sbjct  126  ALAGVAYLALQPQKPSYAVRSLAVSGIGNASVALAPRFDATIRAENPNGKIGVRYDAGSG  185

Query  399  SSLVFKNRVIGKGKYpsvsvkpkkST-------DVDLKMVAKLSGDLRKELNGRRKKL-M  244
             S+ +    +  G +P+    P+ +T          +++  +  G +      R   L +
Sbjct  186  MSVSYGGVSLAAGAWPAFYQAPRSATVFVATAKGAGIRLSERAQGQMAAAERLRSVPLDV  245

Query  243  ALKISVPMEIS---SWAKGKKKDISIKCVFKVGSLA  145
             LK+ V ++I    +WA      ++++C   V  LA
Sbjct  246  ELKVPVRLQIGALKTWA----MPVTVRCAVAVDRLA  277



>emb|CDX70963.1| BnaC03g10470D [Brassica napus]
Length=302

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 105/227 (46%), Gaps = 25/227 (11%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            P TY VQ+P++Q+YRVPPPENA     Y+ +       +  R+CC + L  L+VL +L G
Sbjct  75   PGTYHVQLPKEQIYRVPPPENA---HRYEYLSRQKHNRSACRRCCCYSLATLLVLLLLAG  131

Query  564  tivgsINAMYTPKSPKFSIAAIQY------KKSARHPTFHISLHVHNINQRMKVSFGDGG  403
             +VG    +  P  P+FS++ +         +S   P F I +   N+N ++ + +  G 
Sbjct  132  LVVGVFLLVCRPHKPRFSVSGVSVAVVNLASQSPISPVFKIKVRCKNVNGKLGLVYEKGS  191

Query  402  KSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKELNGRRKK---LMA  241
               +  +   +G G++ +     +  T    K+     +L    RKEL    K       
Sbjct  192  AVEIFHEGIKLGDGEFAAFEQPAENVTVTVTKLRGSRIQLKSLSRKELKDSEKTGKVRFD  251

Query  240  LKISVPME-----ISSWAKGKKKDISIKCVFKVGSLAKS-TDLSEEC  118
            L++  P+      +++W  G    +++ C   V  L  S T ++E+C
Sbjct  252  LRVKAPIRFRVGVVTTWTMG----VTVDCKITVNKLTSSATVITEDC  294



>ref|XP_009390664.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=265

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/189 (25%), Positives = 82/189 (43%), Gaps = 21/189 (11%)
 Frame = -2

Query  759  QPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvl  580
            +P   P +YV+Q+PRD V RVPP  N    + Y           R R CCF     L  L
Sbjct  37   KPVRQPGSYVIQVPRDLVLRVPPKGNGSRAKAY----------ARRRGCCFLVFAWLGAL  86

Query  579  giligtivgsINAMYTPKSPKF-----SIAAIQYKKSARHPTFHISLHVHNINQRMKVSF  415
              L+  +   +  ++ P+ P++     SIA+     ++  P F  ++   N N+++ + +
Sbjct  87   LFLLAVVADILYLVFRPRVPQYSIDALSIASFNLSAASVSPAFDATVRAENPNKKVGIYY  146

Query  414  GDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMALK  235
             DG   ++ +    +  G + +    P   T      VA L G   +  +  R+ L+  +
Sbjct  147  RDGSDITVAYDGVTLCTGAWLAFYQSPGNVT----VFVAALKGSTIRLSSAARQALVTAE  202

Query  234  I--SVPMEI  214
                VP+EI
Sbjct  203  TQRQVPLEI  211



>ref|XP_006408666.1| hypothetical protein EUTSA_v10002079mg [Eutrema salsugineum]
 gb|ESQ50119.1| hypothetical protein EUTSA_v10002079mg [Eutrema salsugineum]
Length=260

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 60/224 (27%), Positives = 106/224 (47%), Gaps = 17/224 (8%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYV+Q+P+DQ+YR PPPENA  ++ Y   +  N+  +R R C    L  + +L +L G  
Sbjct  36   TYVIQVPKDQIYRRPPPENAHRLQ-YLSRKKVNR--SRCRCCICSILAAIFILIVLAGIS  92

Query  558  vgsINAMYTPKSPK-----FSIAAIQYKK-SARHPTFHISLHVHNINQRMKVSFGDGGKS  397
            +  +  ++ P++PK     FS++ I     S   P F++++   N N ++ + +  G   
Sbjct  93   LTVLYLVFRPEAPKYSVEGFSVSGINLTSPSPISPKFNVTVRSRNGNGKIGIYYEKGSTV  152

Query  396  SLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKEL-NGRRKKLMALKIS  229
             + + +  +  G  P         T V   +     +L+  +RKE+ N   KK M  K+ 
Sbjct  153  DIYYNDVDLCNGALPVFYQPANNVTMVKTALTGSRIQLTSAMRKEMRNELSKKTMPFKVK  212

Query  228  V--PMEISSWA-KGKKKDISIKCVFKVGSL-AKSTDLSEECQAD  109
            +  P++I   + K     + + C   V  L A S  +S +C  D
Sbjct  213  IKAPVKIKVGSVKTWTITVKVNCDVTVDKLTAPSRIVSTKCSHD  256



>ref|XP_004291724.1| PREDICTED: uncharacterized protein LOC101301071 [Fragaria vesca 
subsp. vesca]
Length=233

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 63/227 (28%), Positives = 104/227 (46%), Gaps = 30/227 (13%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            P TYVVQIP+DQVYRVPPPENA +   Y   +       R R C  W L  +  L +L+ 
Sbjct  12   PGTYVVQIPKDQVYRVPPPENATLYNKYTSQKP------RPRNCS-WLLFIVASLLLLLL  64

Query  564  tivgsINAMYTPKSPKFSIAAIQYK-----KSARHPTFHISLHVHNINQRMKVSFGDGGK  400
            +       +  P+SP +S+  I +K       A     ++++   N N+++ + +     
Sbjct  65   SAALFYLLV-RPESPNYSVQTISFKGFNLTAPASSQQVNVAVRAENPNRKIGIYYKQPHS  123

Query  399  SSLVFKNRV-IGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKEL-NGRRKKLMALK  235
            S+ VF   + +  G  P+    PK  T++D  +     +L+   R  L   +R+  +ALK
Sbjct  124  SANVFYADIKLCHGALPAFYQPPKSVTELDAALTGTGIRLTNAARDGLVEAQRQGKVALK  183

Query  234  ISV--PM-----EISSWAKGKKKDISIKCVFKVGSLAKSTDL-SEEC  118
            + V  P+      I +W       + + C   V  LA   ++ S+ C
Sbjct  184  LHVRSPVALKLGSIKTWT----ITVKLACDLTVDQLAPDANIVSKHC  226



>gb|KFK26363.1| hypothetical protein AALP_AA8G238900 [Arabis alpina]
Length=282

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 110/241 (46%), Gaps = 33/241 (14%)
 Frame = -2

Query  774  FSLPVQ-PGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFl  598
            FS+  Q P   P TY++++P++Q++R PPP+NA       E  S     T  R+C  +FL
Sbjct  34   FSIESQKPRPPPGTYIIELPKEQIFRTPPPDNAH----RYEYLSQKPNRTSCRRCFCYFL  89

Query  597  vplvvlgiligtivgsINAMYTPKSPKFSIAAIQY------KKSARHPTFHISLHVHNIN  436
              +++L IL   +VG +  +Y P  P+F++             S   P     +   N N
Sbjct  90   AAVLILCILASAVVGILFLVYQPHKPQFTVTGFSVTGINLTSSSPISPVIETKVRSSNGN  149

Query  435  QRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA------KLSGDLRK  274
             ++ + +  G  + + +    +G G++ +     K   +V + + A      +L+   RK
Sbjct  150  GKIGLIYVKGIGAEVFYNGTKLGNGEFTAFKQPVK---NVKVMVTALKGSRIQLTSSSRK  206

Query  273  ELNG---RRKKLMALKISVPME-----ISSWAKGKKKDISIKCVFKVGSL-AKSTDLSEE  121
            EL     +RK    L+I  P++     +++W       + ++C   V  L A +T ++E 
Sbjct  207  ELTASQKKRKVPFDLRIEAPVKFQVGAVTTWT----MTVKVECKITVDKLTASATVVTEN  262

Query  120  C  118
            C
Sbjct  263  C  263



>ref|NP_001275943.1| uncharacterized protein LOC102589097 [Solanum tuberosum]
 ref|XP_006364492.1| PREDICTED: protein NDR1-like [Solanum tuberosum]
 gb|AFI81519.1| LEA2-1 [Solanum tuberosum]
Length=270

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 76/146 (52%), Gaps = 10/146 (7%)
 Frame = -2

Query  777  TFSLPVQPGEAPE-TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWF  601
            +F  P +P + P  TYVVQ+P+DQ+Y+ PPPEN++  E   + +       R     F  
Sbjct  32   SFPSPAKPVQPPAGTYVVQVPKDQIYKYPPPENSRRYESLTKRKPRRSCCCRCLCFTF--  89

Query  600  lvplvvlgiligtivgsINAMYTPKSPKFSIAAI-----QYKKSAR-HPTFHISLHVHNI  439
               L++L I IG   G +  +Y P++PK++I++I      +  S+R  P F IS+   N 
Sbjct  90   -SVLLLLIISIGITAGVLYLVYRPEAPKYTISSIAIKNFNFTASSRISPEFDISVRAENP  148

Query  438  NQRMKVSFGDGGKSSLVFKNRVIGKG  361
            N ++ + +  G   ++V+    +  G
Sbjct  149  NNKLGIYYRKGSSVTVVYSGVDLSAG  174



>ref|XP_010243135.1| PREDICTED: protein YLS9-like [Nelumbo nucifera]
Length=271

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 109/239 (46%), Gaps = 20/239 (8%)
 Frame = -2

Query  780  LTFSLPVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWF  601
            L  S+P +P   P TYVVQIP+DQ+YRVPPPEN +  + Y + ++           C W 
Sbjct  30   LPLSVPEKPVPPPGTYVVQIPKDQIYRVPPPENDRKYKLYSQRKNRRN--RCCCCFC-WS  86

Query  600  lvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYK-------KSARHPTFHISLHVHN  442
            L  L +L  LI    G    +  PK P +S+  +  K            P F++++   N
Sbjct  87   LGLLALLIFLIAIAAGVFYLVVRPKIPSYSVEDVSIKGFNLTLTDPTISPVFNVTVRAEN  146

Query  441  INQRMKVSFGDGGKSSLVFKNRVIGKGK----YpsvsvkpkkSTDV---DLKMVAKLSGD  283
             N+++ + +  G   ++ + +  +  G     +         +T++   DL++ +++   
Sbjct  147  PNKKIGIYYETGSYVAVSYTDVKLCNGALPAFFQPSKNVTVFATELKGSDLRLSSQVHAT  206

Query  282  LRKELN-GRRKKLMALKISVPMEISSWAKGKKKDISIKCVFKVGSLA-KSTDLSEECQA  112
            L +E   G+    + LK+ V +++ S  K     + + C   V  L+  +  LS+ C A
Sbjct  207  LTQEQKLGKIPLGLYLKVPVRVKVGS-VKTWTITVKVHCDITVNKLSVDAAVLSKSCDA  264



>ref|XP_010454436.1| PREDICTED: uncharacterized protein LOC104736193 [Camelina sativa]
Length=283

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 107/227 (47%), Gaps = 25/227 (11%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            P TYV++I +D++YRVPPPENA   E Y   + TN   +  R+C  + L  L++L +L  
Sbjct  55   PGTYVIEIRKDEIYRVPPPENAHRYE-YLSRQKTNH--SPCRRCFCYSLAALLILLLLAA  111

Query  564  tivgsINAMYTPKSPKFSIAAIQY------KKSARHPTFHISLHVHNINQRMKVSFGDGG  403
               G +  +Y P+ P++S++ +          S   P   + L   N N ++ + +  G 
Sbjct  112  LAGGVLLLVYRPQKPQYSVSRVSVTGLNLTTSSPISPVIVVKLRAQNANGKLGLIYAIGN  171

Query  402  KSSLVFKNRVIGKGKYpsvsvkpkkSTDVD--LK-MVAKLSGDLRKELNGRRKK---LMA  241
            ++ + +    +G GK+ +    P   T +   LK +  +L+   R  L   +KK      
Sbjct  172  EAKVFYDGMELGNGKFTAFKQPPNNLTVITTVLKGLSIQLTKASRIGLTESQKKGEVPFG  231

Query  240  LKISVPME-----ISSWAKGKKKDISIKCVFKVGSL-AKSTDLSEEC  118
             KI  P++     +++W       +++ C   V  L A +T ++E C
Sbjct  232  FKIKAPVKFKVGTVTTWP----MTVTVDCKVTVDKLTASATVITENC  274



>ref|XP_009628620.1| PREDICTED: protein YLS9 [Nicotiana tomentosiformis]
Length=269

 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 106/222 (48%), Gaps = 17/222 (8%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYVVQ+P+DQ+YR PPPEN++  E   + +       R     F     L++L I +G  
Sbjct  45   TYVVQVPKDQIYRYPPPENSRRYESLTKRKPRRSCCCRCLCYTF---SLLLILIIALGIT  101

Query  558  vgsINAMYTPKSPKFSIAAIQYKK------SARHPTFHISLHVHNINQRMKVSFGDGGKS  397
             G +  ++ P++PK++I+ I  K       S+  P F +++   N N ++ + +  G   
Sbjct  102  AGVLYLVFRPEAPKYTISGIAIKNFNLTPSSSVSPAFDVTVRAENPNNKIGIYYRKGSSV  161

Query  396  SLVFKNRVIGKGKYpsvsvkpkkST--DVDLKMVAKLSGD-LRKELNGRRKK---LMALK  235
            ++++ +  +  G++P+        T     LK    L G  +R  L   +K+      + 
Sbjct  162  TVLYSDVNLSNGEFPAFYQPTNNVTVFKTPLKGSNVLLGSAVRTALRNEQKQGKVPFRVN  221

Query  234  ISVPMEISSWA-KGKKKDISIKCVFKVGSLA-KSTDLSEECQ  115
            I  P++I   A K  +  + +KC   V +L  KS  +S +C+
Sbjct  222  IKAPVKIKVGAVKTWEITVKVKCDITVDALTEKSKIVSNDCK  263



>ref|XP_004228470.1| PREDICTED: protein YLS9 [Solanum lycopersicum]
Length=271

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 71/138 (51%), Gaps = 10/138 (7%)
 Frame = -2

Query  777  TFSLPVQPGEAPE-TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWF  601
            +F  P +P + P  TYVVQ+P+DQ+Y+ PPPEN++  E   + +       R     F  
Sbjct  33   SFPSPAKPIQPPAGTYVVQVPKDQIYKYPPPENSRRYESLTKRKPRRSCCCRCLCFTF--  90

Query  600  lvplvvlgiligtivgsINAMYTPKSPKFSIAAIQYKK------SARHPTFHISLHVHNI  439
               L+ L I IG   G +  +Y P++PK++I++I  K       S   P F IS+   N 
Sbjct  91   -SVLLFLIISIGITAGVLFLVYRPEAPKYTISSIAIKNFNVTSSSKISPEFDISVRSENP  149

Query  438  NQRMKVSFGDGGKSSLVF  385
            N ++ + +  G   ++V+
Sbjct  150  NNKLGIYYRKGSSVTVVY  167



>ref|XP_004246717.1| PREDICTED: protein YLS9-like [Solanum lycopersicum]
Length=264

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 112/226 (50%), Gaps = 19/226 (8%)
 Frame = -2

Query  747  APETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgili  568
            +P TYVVQ+P+DQ+YR PPP N++    Y+ +R    + +   +C  + L  L++L I +
Sbjct  37   SPGTYVVQVPKDQIYRYPPPGNSR---RYEALRKRKPRRSCCCRCVCYTLSLLLILIIAL  93

Query  567  gtivgsINAMYTPKSPKFSIAAIQYKK------SARHPTFHISLHVHNINQRMKVSFGDG  406
            G     +  ++ P++PK++I+ +  K       S   P F +++   N N ++ + +  G
Sbjct  94   GITAAVVYLVFRPEAPKYTISDVAIKNFNLTSSSPVSPEFDVTIRAENPNNKIGIYYRKG  153

Query  405  GKSSLVFKNRVIGKGKYpsvsvkpkkST--DVDLKMVAKLSGD-----LRKE-LNGRRKK  250
               ++ + +  +  G+ P         T     LK    L G+     LR E + G+   
Sbjct  154  SSVTVFYSDVRLSNGELPEFYQPSTNITVFQTPLKGSNVLLGNAVKTALRNEQMKGKVPF  213

Query  249  LMALKISVPMEISSWAKGKKKDISIKCVFKVGSL-AKSTDLSEECQ  115
             + +K+ V +++ +  K  +  + +KC   V +L AKS  +S++C+
Sbjct  214  KVNIKVPVKVKVGA-VKTWEITVKVKCDVTVNTLTAKSKIISKDCK  258



>ref|XP_003545485.1| PREDICTED: uncharacterized protein LOC100800674 isoform 1 [Glycine 
max]
Length=273

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 106/227 (47%), Gaps = 20/227 (9%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYV++IP+DQVYRVPPPENA+    Y +      + +R   C  W +  L +L +L+   
Sbjct  46   TYVIKIPKDQVYRVPPPENAR---RYDQYARRKHRRSRCCCCFCWLIGILFILVVLLAIA  102

Query  558  vgsINAMYTPKSPKFSIAAIQYKK---------SARHPTFHISLHVHNINQRMKVSFGDG  406
             G +  ++ P++PK+SI  I  +          +A  P F++++   N N ++ + +   
Sbjct  103  AGVLYLVFRPEAPKYSIENITVRGINLTSPSSVAAISPEFNVTVKADNPNDKIGIRYLKD  162

Query  405  GKSSLVFKNRVIGKGK----YpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKLMAL  238
              + + +K+  +  G     Y   +      T +    +   S D R  L  + K+ + L
Sbjct  163  SSAEVFYKDARLCNGALPAFYQPSNNVTVFGTALRGDGIELRSEDRRALLEAQTKRRVPL  222

Query  237  --KISVPMEISSWA-KGKKKDISIKCVFKVGSL-AKSTDLSEECQAD  109
              +I  P++I   + +  K  + + C   V  L A++  +S+ C  D
Sbjct  223  TVRIRAPVKIKVGSIRTWKITVKVNCDVTVNELTAQAKIVSKRCSYD  269



>ref|XP_009779546.1| PREDICTED: protein YLS9 [Nicotiana sylvestris]
Length=269

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 106/222 (48%), Gaps = 17/222 (8%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYVVQ+P+DQ+YR PPPEN++  E   + +       R     F     L++L I +G  
Sbjct  45   TYVVQVPKDQIYRYPPPENSRRYESLTKRKPRRSCCCRCLCYTF---SLLLILIIALGIT  101

Query  558  vgsINAMYTPKSPKFSIAAIQYKK------SARHPTFHISLHVHNINQRMKVSFGDGGKS  397
             G +  ++ P++PK++I+ +  K       S+  P F +++   N N ++ + +  G   
Sbjct  102  AGVLYLVFRPEAPKYTISDVAIKNFNLTSSSSVSPAFDVTVRAENPNNKIGIYYRKGSSV  161

Query  396  SLVFKNRVIGKGKYpsvsvkpkkST--DVDLKMVAKLSGD-LRKELNGRRKK---LMALK  235
            +++F +  +  G++P+        T     LK    L G  +R  L   +K+      + 
Sbjct  162  TVLFSDVNLSNGEFPAFYQPTNNVTVFKTPLKGSNVLLGSAVRTALRNEQKQGKVPFRVD  221

Query  234  ISVPMEISSWA-KGKKKDISIKCVFKVGSLA-KSTDLSEECQ  115
            I  P++I   A K  +  + +KC   V +L  KS  +S+ C+
Sbjct  222  IKAPVKIKVGAVKTWEITVKVKCDITVDTLTEKSKIVSKHCK  263



>ref|XP_010093832.1| hypothetical protein L484_022546 [Morus notabilis]
 gb|EXB54683.1| hypothetical protein L484_022546 [Morus notabilis]
Length=268

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 62/136 (46%), Gaps = 16/136 (12%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYV+QIP+DQVYR+PPPENA+  + Y      +++ +R  KC       L  + +L    
Sbjct  42   TYVIQIPKDQVYRIPPPENARRFQNY------SRRKSRRSKCGLCLCSLLGSIVVLAILA  95

Query  558  vgsINAMYT---PKSPKFSIAAIQYK-------KSARHPTFHISLHVHNINQRMKVSFGD  409
              S   +Y    P+SP +SI  I  K        +   P   + L   N N  + + +G 
Sbjct  96   GISAAVLYLVFRPESPNYSIDDIAIKGINTTASSAEISPAIDVVLRAKNPNDNIGIFYGK  155

Query  408  GGKSSLVFKNRVIGKG  361
                ++ + +  +  G
Sbjct  156  DSSVTVYYSDVELCNG  171



>ref|XP_008660458.1| PREDICTED: uncharacterized protein LOC103639486 [Zea mays]
 gb|AFW89402.1| hypothetical protein ZEAMMB73_463182 [Zea mays]
Length=274

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 101/232 (44%), Gaps = 19/232 (8%)
 Frame = -2

Query  741  ETYVVQIPRDQVYRVPPPENAKIVEGYQE--------MRSTNKKDTRLRKCCFWFlvplv  586
            +TYVVQ+ +DQ+YRVPPPENA + E Y+          R  ++       C    L  L+
Sbjct  44   DTYVVQVQKDQIYRVPPPENAYLAERYRNGRRGGGKKRRGRSEGSGACSPCVLRTLGALL  103

Query  585  vlgiligtivgsINAMYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNIN-QRMKVSFGD  409
                L+G  V     +  P  P FS+  I    S R       + +  +N  +M   +  
Sbjct  104  AAAALVGAAVLISLVVLRPGVPGFSVDRITVINSTRQQRVDYDVFLTAVNPNKMTALWYR  163

Query  408  GGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVD-----LKMVAKLSGDLRKELNGRRKKL-  247
             G + L      + KG     +   + +TD       +K   +    + K  +G ++ L 
Sbjct  164  RGAARLAHHGTTLAKGDVGQPADGGEDATDFSVLLQGVKHNGRTPRAVEKGFSGSKEHLA  223

Query  246  --MALKISVPMEISSWAKGKKKDISIKCVFKVGSLAKSTDL-SEECQADF*N  100
              +A++++V + + +   G+++ +++ C      L+K   + S+ C++ F N
Sbjct  224  LQLAVEVTVQVHVGALGFGQRR-LAVDCGITAAGLSKDVHIASQSCRSSFRN  274



>ref|XP_008786759.1| PREDICTED: uncharacterized protein LOC103704991 [Phoenix dactylifera]
 ref|XP_008786761.1| PREDICTED: uncharacterized protein LOC103704991 [Phoenix dactylifera]
 ref|XP_008786762.1| PREDICTED: uncharacterized protein LOC103704991 [Phoenix dactylifera]
 ref|XP_008786763.1| PREDICTED: uncharacterized protein LOC103704991 [Phoenix dactylifera]
Length=277

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 63/130 (48%), Gaps = 11/130 (8%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgilig  565
            P TYV+QIP+DQ+YRVPPPENA+  + Y  +R+  ++      C  W    L+   + + 
Sbjct  45   PGTYVIQIPKDQIYRVPPPENARRFQTYT-LRTHRRRHGCCCCCFAWTAALLLFFLVALA  103

Query  564  tivgsINAMYTPKSPKFSIAAIQYKK----------SARHPTFHISLHVHNINQRMKVSF  415
                 +  ++ PK P +S+  +  K           +A  P F  ++   N N+++ + +
Sbjct  104  AAAVILYFVFQPKIPNYSVDGLSVKGFNLSSTAANLAALSPEFDATVRADNANKKIGIYY  163

Query  414  GDGGKSSLVF  385
              G   ++ +
Sbjct  164  RSGSSIAVSY  173



>dbj|BAK05887.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=278

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 73/140 (52%), Gaps = 9/140 (6%)
 Frame = -2

Query  756  PGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlg  577
            P   P TY+VQIP+DQV RVPPP+ A+    Y+ +     +  RLR+ CF     ++ L 
Sbjct  42   PAPPPGTYIVQIPKDQVLRVPPPDRAR---RYKSLAERPVRRRRLRRACFGACGAVLFLA  98

Query  576  iligtivgsINAMYTPKSPKFSIAAIQYK-----KSARHPTFHISLHVHN-INQRMKVSF  415
            I     VG++  ++ P++P FS+A++  +       +  P   ++L   N  N+++ V +
Sbjct  99   ISAAVFVGAVYLVFRPRAPAFSVASLSIRGLDAVAPSLSPELDVTLRADNGANKKVGVDY  158

Query  414  GDGGKSSLVFKNRVIGKGKY  355
               G+ ++ +    +  G++
Sbjct  159  RGAGEVAVSYSGVRLAAGQW  178



>ref|XP_007141573.1| hypothetical protein PHAVU_008G207300g [Phaseolus vulgaris]
 gb|ESW13567.1| hypothetical protein PHAVU_008G207300g [Phaseolus vulgaris]
Length=273

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 106/224 (47%), Gaps = 20/224 (9%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYV++IP+DQVYRVPP ENA+  + Y   + +    +R   CC W +  L +  +L+G  
Sbjct  46   TYVIKIPKDQVYRVPPAENARRYDQYTRRKHSR---SRFCCCCCWLIGLLFIFVVLLGIA  102

Query  558  vgsINAMYTPKSPKFSIAAIQYK---------KSARHPTFHISLHVHNINQRMKVSFGDG  406
             G    ++ P++PK+SI  I  +          +A  P F++++   N N ++ + +   
Sbjct  103  AGIFYLVFRPEAPKYSIENIAVRGINVTSPSFDAAISPEFNVTVKADNPNDKIGIYYLKD  162

Query  405  GKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKELNG---RRKKLM  244
              + + + +  +  G  P+        T   + +     +LS + ++ L G   +RK  +
Sbjct  163  SSAEVFYNDARLCNGALPAFHQPSNNVTVFGMVLKGNGIELSSEDQRSLVGSQTKRKVPL  222

Query  243  ALKISVPMEISSWA-KGKKKDISIKCVFKVGSL-AKSTDLSEEC  118
             + I  P+ I   + K  K  + + C   V  L A++  +S+ C
Sbjct  223  TVSIRAPVRIKVGSVKTWKITVKVDCDVTVNELTAQAKIVSKRC  266



>ref|XP_010493233.1| PREDICTED: uncharacterized protein LOC104770498 [Camelina sativa]
Length=284

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/134 (27%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYV++I +D++YRVPPPENA     Y+ +       +  R+C  + L  L++L +L    
Sbjct  58   TYVIEIRKDEIYRVPPPENA---HRYEYLSRQKPNHSPCRRCFCYSLAALLILLLLAAIA  114

Query  558  vgsINAMYTPKSPKFSIAAIQY------KKSARHPTFHISLHVHNINQRMKVSFGDGGKS  397
             G +  +Y P+ P++S++ +          S   P   + L  HN N ++ + +  G ++
Sbjct  115  GGVLYLVYRPQKPQYSVSGVSVTGLNLTTSSPISPVIGVKLRAHNENGKLGLIYVLGNEA  174

Query  396  SLVFKNRVIGKGKY  355
             + +    +G GK+
Sbjct  175  KVFYDGMELGNGKF  188



>gb|AFK38883.1| unknown [Medicago truncatula]
Length=265

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 96/226 (42%), Gaps = 18/226 (8%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYV+Q+P+DQ YR+PPPENA   + Y        +      C  WF+  L  L +L+   
Sbjct  28   TYVIQLPKDQTYRIPPPENA---QRYANYTRRKSRRCGCCCCLCWFIGILFTLIVLMAIA  84

Query  558  vgsINAMYTPKSPKFSIAAIQYKK------SARHPTFHISLHVHNINQRMKVSFGDGGKS  397
             G    +  P++PK++I  +  K       S   P F +S+   N N+++ + +      
Sbjct  85   AGVFYLIVRPEAPKYAIDRVSVKGMNLTSLSTISPEFDVSVKADNGNKKIGIYYESDSSV  144

Query  396  SLVFKNRVIGKGK----YpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKL--MALK  235
             + ++   + KG     Y   +      T +    +  +  D R  +N   K    + LK
Sbjct  145  EMFYRGVSLCKGVLPAFYQPSNNVTVFQTVLKGNGIELVRSDQRALVNAVTKGSVPLTLK  204

Query  234  ISVPMEI--SSWAKGKKKDISIKCVFKVGSL-AKSTDLSEECQADF  106
            +  P++I   S  K  K  + + C   V  L A++  +  +C   F
Sbjct  205  LRAPVKIRVGSVKKTWKVRVKVDCDLTVDQLTAQAKIVDRDCSYGF  250



>gb|KEH35108.1| late embryogenesis abundant hydroxyproline-rich glycoprotein, 
putative [Medicago truncatula]
Length=265

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 96/226 (42%), Gaps = 18/226 (8%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYV+Q+P+DQ YR+PPPENA   + Y        +      C  WF+  L  L +L+   
Sbjct  28   TYVIQLPKDQTYRIPPPENA---QRYANYTRRKSRRCGCCCCLCWFIGILFTLIVLMAIA  84

Query  558  vgsINAMYTPKSPKFSIAAIQYKK------SARHPTFHISLHVHNINQRMKVSFGDGGKS  397
             G    +  P++PK++I  +  K       S   P F +S+   N N+++ + +      
Sbjct  85   AGVFYLIVRPEAPKYAIDRVSVKGMNLTSLSTISPEFDVSVKADNGNKKIGIYYESDSSV  144

Query  396  SLVFKNRVIGKGK----YpsvsvkpkkSTDVDLKMVAKLSGDLRKELNGRRKKL--MALK  235
             + ++   + KG     Y   +      T +    +  +  D R  +N   K    + LK
Sbjct  145  EMFYRGVSLCKGVLPAFYQPSNNVTVFQTVLKGNGIELVRSDQRALVNAVTKGSVPLTLK  204

Query  234  ISVPMEI--SSWAKGKKKDISIKCVFKVGSL-AKSTDLSEECQADF  106
            +  P++I   S  K  K  + + C   V  L A++  +  +C   F
Sbjct  205  LRAPVKIKVGSVKKTWKVRVKVDCDLTVDQLTAQAKIVDRDCSYGF  250



>ref|XP_006470441.1| PREDICTED: protein YLS9-like [Citrus sinensis]
Length=254

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 67/135 (50%), Gaps = 10/135 (7%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYV+QIP+DQ+YRVPPPENA  ++G    R   K  +    C  +    L++L +L+   
Sbjct  28   TYVIQIPKDQIYRVPPPENADRIKGLSRRR---KSRSTTCCCFRFCCCSLLLLVLLLAIA  84

Query  558  vgsINAMYTPKSPKFSIAAIQYK-------KSARHPTFHISLHVHNINQRMKVSFGDGGK  400
             G    ++ P+SP +S+  +           S   P F +S+   N N ++ + +  G  
Sbjct  85   AGVFYLVFRPESPNYSVDGVSIAGLNLTSPSSVVSPRFDVSVTADNPNDKIGIYYERGSS  144

Query  399  SSLVFKNRVIGKGKY  355
              + +K+  +  G++
Sbjct  145  VEVSYKDVALCDGEW  159



>ref|XP_004165481.1| PREDICTED: uncharacterized protein LOC101223891 [Cucumis sativus]
Length=215

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 63/131 (48%), Gaps = 12/131 (9%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYV+QIP+DQVYR+PPPENA     Y   R  ++     R  CF  L+ L+         
Sbjct  26   TYVIQIPKDQVYRIPPPENAARFNLYT--RHHHRPSPCRRFLCFILLLLLLSAITSALVF  83

Query  558  vgsINAMYTPKSPKFSIAAIQYKK-----SARHPTFHISLHVHNINQRMKVSFGDGGKSS  394
            +     +  P  P+FSI A+   +     ++  P F++++   N N+ + + +      S
Sbjct  84   L-----ILQPDLPRFSILAVSISRIKPNTTSFSPQFNVTIRAENHNKNIGIYYEKNSTVS  138

Query  393  LVFKNRVIGKG  361
            +   + ++ +G
Sbjct  139  MNLSDVMLCEG  149



>ref|XP_004149664.1| PREDICTED: uncharacterized protein LOC101202799 [Cucumis sativus]
 gb|KGN54042.1| hypothetical protein Csa_4G269730 [Cucumis sativus]
Length=247

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 65/131 (50%), Gaps = 12/131 (9%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYV+QIP+DQVYR+PPPENA     Y   R  ++     R  CF     +++L +L    
Sbjct  26   TYVIQIPKDQVYRIPPPENAARFNLYT--RHHHRPSPCRRFLCF-----ILLLLLLSAIT  78

Query  558  vgsINAMYTPKSPKFSIAAIQYKK-----SARHPTFHISLHVHNINQRMKVSFGDGGKSS  394
               +  +  P  P+FSI A+   +     ++  P F++++   N N+ + + +      S
Sbjct  79   SALVFLILQPDLPRFSILAVSISRIKPNTTSFSPQFNVTIRAENHNKNIGIYYEKNSTVS  138

Query  393  LVFKNRVIGKG  361
            +   + ++ +G
Sbjct  139  MNLSDVMLCEG  149



>ref|XP_006644886.1| PREDICTED: uncharacterized protein LOC102721597 [Oryza brachyantha]
Length=312

 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/153 (25%), Positives = 73/153 (48%), Gaps = 19/153 (12%)
 Frame = -2

Query  759  QPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvl  580
            QP  A  TYVVQ+P+D+V+RVPPPENA++ + Y   R+  +      + C W L+ L+VL
Sbjct  63   QPPPAAGTYVVQMPKDKVFRVPPPENARLFQHYSR-RAKRRASCSCVRVCSWLLLALLVL  121

Query  579  giligtivgsINAMYTPKSPKFSIAAIQYK-----------------KSARHPTFHISLH  451
             +++  +   +  ++ P+ P +++ ++                         P F  ++ 
Sbjct  122  AVVLAVLAAVVYLVFKPRQPDYTLQSLAVSGLVGILGNASSSSSSTAPVTFSPEFDATIR  181

Query  450  VHNINQRMKVSF-GDGGKSSLVFKNRVIGKGKY  355
              N N ++ V + GDG   ++ +    +  G +
Sbjct  182  ADNPNDKIGVHYEGDGSHVAVSYGGVRLADGAW  214



>ref|XP_010922964.1| PREDICTED: protein YLS9 [Elaeis guineensis]
Length=281

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 87/198 (44%), Gaps = 18/198 (9%)
 Frame = -2

Query  759  QPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvl  580
            +P   P TYV+Q+P+DQ++RVPPPENA+  E Y    +  ++         W    L+ L
Sbjct  45   KPKPPPGTYVIQVPKDQIFRVPPPENARRFEAYTRRATRRRRGCCCCLA--WTAALLLFL  102

Query  579  giligtivgsINAMYTPKSPKFSIAAIQYKK----------SARHPTFHISLHVHNINQR  430
               +    G +  ++ PK PK+S+  +  K           +A  P F  ++   N N++
Sbjct  103  LFALAVTAGILYLVFQPKIPKYSVDGLAVKGFNLSSAATNLAAISPEFDATIRADNPNKK  162

Query  429  MKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkkSTDVDLKMVA---KLSGDLRKEL---  268
            + + +  G   ++ +    +  G +P+     +  T     +     +LS  ++  L   
Sbjct  163  IGIYYRSGSSITVSYDGVNLCHGVWPTFYQGKRNVTVFQTALTGAGIRLSAAMKDALVTA  222

Query  267  NGRRKKLMALKISVPMEI  214
              R +  + + I VP+ I
Sbjct  223  QSRGEVPLEINIKVPVRI  240



>gb|KHN09129.1| hypothetical protein glysoja_025590 [Glycine soja]
Length=157

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/154 (26%), Positives = 74/154 (48%), Gaps = 12/154 (8%)
 Frame = -2

Query  540  MYTPKSPKFSIAAIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRV-IGK  364
            + TP+ PKFSI + +  ++  HP + ++L VHN N  + + +   G  SL  + +  I  
Sbjct  2    LLTPEDPKFSITSFKVVETKPHPKYDVTLEVHNPNSDVGILYNGKGHVSLSLRRQENIAS  61

Query  363  GKYpsvsvkpkkSTDVDLKMVAKLSGDLRKEL-----NGRRKKLMALKISV----PMEIS  211
            G YP+       +T   L + +     L KE+     N ++K  +   +++     M++ 
Sbjct  62   GAYPTFRQDSHDTTTFGLTLTSSSKAVLPKEVEESVRNDKKKVSVTFSLAIHALAHMKMG  121

Query  210  SWAKGKKKDISIKCVFKVGSLAKSTD-LSEECQA  112
                G  K   + C  K+ +LAK+T  LS++C+ 
Sbjct  122  LLRSGTMK-FDVTCKVKLDTLAKTTHVLSQQCET  154



>gb|KDO66384.1| hypothetical protein CISIN_1g025262mg [Citrus sinensis]
Length=255

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 66/135 (49%), Gaps = 9/135 (7%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYV+QIP+DQ+YRVPPPENA  ++G    R  ++  T            L++L +L+   
Sbjct  28   TYVIQIPKDQIYRVPPPENADRIKGLSRRRRKSRSTTCCCFRF--CCCSLLLLVLLLAIA  85

Query  558  vgsINAMYTPKSPKFSIAAIQYK-------KSARHPTFHISLHVHNINQRMKVSFGDGGK  400
             G    ++ P+SP +S+  +           S   P F +S+   N N ++ + +  G  
Sbjct  86   AGVFYLVFRPESPNYSVDGVSIAGLNLTSPSSVVSPRFDVSVTADNPNDKIGIYYERGSS  145

Query  399  SSLVFKNRVIGKGKY  355
              + +K+  +  G++
Sbjct  146  VEVSYKDVALCDGEW  160



>gb|ACJ85044.1| unknown [Medicago truncatula]
Length=180

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 62/132 (47%), Gaps = 9/132 (7%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYV+Q+P+DQ YR+PPPENA   + Y        +      C  WF+  L  L +L+   
Sbjct  28   TYVIQLPKDQTYRIPPPENA---QRYANYTRRKSRRCGCCCCLCWFIGILFTLIVLMAIA  84

Query  558  vgsINAMYTPKSPKFSIAAIQYKK------SARHPTFHISLHVHNINQRMKVSFGDGGKS  397
             G    +  P++PK++I  +  K       S   P F +S+   N N+++ + +      
Sbjct  85   AGVFYLIVRPEAPKYAIDRVSVKGMNLTSLSTISPEFDVSVKADNGNKKIGIYYESDSSV  144

Query  396  SLVFKNRVIGKG  361
             + ++   + KG
Sbjct  145  EMFYRGVSLCKG  156



>ref|XP_003561956.1| PREDICTED: uncharacterized protein LOC100843022 [Brachypodium 
distachyon]
Length=297

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 60/262 (23%), Positives = 106/262 (40%), Gaps = 35/262 (13%)
 Frame = -2

Query  795  PALTSLTFSLPVQPGEAPE------------TYVVQIPRDQVYRVPPPENAKIVEGYQEM  652
            P  ++  F  P+ P  AP             TYVV + +DQVYRVPPPENA + E Y+  
Sbjct  37   PPSSAAAFGSPLDPVAAPAVRAGHLKPPPGGTYVVHVQKDQVYRVPPPENAYLAERYRAE  96

Query  651  RSTNKKDTRLRKCCFWFlvplvvlgiligtivgsINA------MYTPKSPKFSI------  508
            R++  K +            L  LG      +           +  P +P F++      
Sbjct  97   RASAGKSSCAPSSSSCSPCLLRALGAAAAVALLLAAIVALTIVVLRPDAPSFAVDRFSVR  156

Query  507  AAIQYKKSARHPTFHISLHVHNINQRMKVSFGDGGKSSLVFKNRVIGKGKYpsvsvkpkk  328
             A   ++SAR   +   L   N N    + +  GG + L  +   + +G         + 
Sbjct  157  NASSAQRSAR-VDYDFFLTAVNPNNVTALWYRRGGSARLRHRGTALAEGHVGRAEDGGED  215

Query  327  STDVDLKMVAKLSGD-----LRKELNGRRKKL-MALKISVPMEISSWAKG-KKKDISIKC  169
            +T  D K++ +  G      + K L G +  + + L + +P+++   A G   + +++ C
Sbjct  216  AT--DFKVLLRGGGQHLPKAVEKGLAGNKGAVALHLAVEIPVQVHVGALGFATRRLAVSC  273

Query  168  VFKVGSLAKSTDLSEE-CQADF  106
                  L K   +S + C++ F
Sbjct  274  EISAAGLRKDVHISSQNCKSRF  295



>ref|XP_007018809.1| Uncharacterized protein TCM_034934 [Theobroma cacao]
 gb|EOY16034.1| Uncharacterized protein TCM_034934 [Theobroma cacao]
Length=104

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 4/47 (9%)
 Frame = -2

Query  744  PETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFW  604
            P TYV+Q+P+DQ+Y VPPPENA I E +   R+ N +      CC+W
Sbjct  33   PGTYVIQVPKDQIYSVPPPENALIAERHLNNRANNNRRR----CCYW  75



>tpg|DAA57165.1| TPA: NHL25 [Zea mays]
Length=306

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/137 (25%), Positives = 63/137 (46%), Gaps = 13/137 (9%)
 Frame = -2

Query  738  TYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTRLRKCCFWFlvplvvlgiligti  559
            TYVVQ+P+D+V+RVPPPENA++ + Y       ++ +    C    L+    + +     
Sbjct  75   TYVVQVPKDKVFRVPPPENARLFDHYTRRARRRRRGS----CSCACLLVGAAVALAAALA  130

Query  558  vgsINAMYTPKSPKFSIAAIQYKK--------SARHPTFHISLHVHNINQRMKVSFGDG-  406
                  +  PK P +++ A+            +A  P F  ++   N N R+ V +  G 
Sbjct  131  GVLACLVLGPKPPAYAVQALAVSGLVNASSSPAALSPGFDATVRADNRNGRLGVRYEGGR  190

Query  405  GKSSLVFKNRVIGKGKY  355
            G+ S+ +   ++  G +
Sbjct  191  GRVSVSYGGALLADGAW  207



>ref|XP_006384760.1| harpin-induced family protein [Populus trichocarpa]
 gb|ERP62557.1| harpin-induced family protein [Populus trichocarpa]
Length=273

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 106/234 (45%), Gaps = 25/234 (11%)
 Frame = -2

Query  765  PVQPGEAPETYVVQIPRDQVYRVPPPENAKIVEGYQEMRSTNKKDTR--LRKCCFWFlvp  592
            PV P   P TYV+QIP+DQVYRVPPPENAK     +  R T +K +R     C  W L  
Sbjct  42   PVPP--PPGTYVIQIPKDQVYRVPPPENAK-----RHERLTRRKPSRSPCCCCLCWLLAL  94

Query  591  lvvlgiligtivgsINAMYTPKSPKFSIAAIQYK----KSAR--HPTFHISLHVHNINQR  430
            L  L  L+G        ++ P+SP +S+  +        S+R   P F +++  +N N +
Sbjct  95   LTALIFLVGVAAAVFYFVFRPESPDYSVERLSISGFNLTSSRWVSPEFDVTVRANNPNDK  154

Query  429  MKVSFGDGGKSSLVFKNRVIGKGK----YpsvsvkpkkSTDVDLKMVAKLSGDLRKELN-  265
            + + +  G    + + +  +  G     Y   +      T +    V   SGD    ++ 
Sbjct  155  IGIYYRRGSSVDVYYDSVKLATGSLPIFYQGTNNVTVFVTPLKGSAVELTSGDRTAMIDE  214

Query  264  ---GRRKKLMALKISVPMEISSWAKGKKKDISIKCVFKVGSLAKSTDL-SEECQ  115
               G+    +AL+  V +++ S  +  +  + + C   V  L  + ++ S++C 
Sbjct  215  VGKGQVPFKLALRAPVKIKVGS-VETWEITVKVDCDLTVDKLTATAEIGSKKCD  267



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2899735426956