BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19576_g3_i1 len=506 path=[581:0-505]

Length=506
                                                                      Score     E

ref|XP_006356924.1|  PREDICTED: peroxidase 3-like                       148   5e-40   
ref|XP_006356923.1|  PREDICTED: peroxidase 3-like                       147   2e-39   
gb|AFY26878.1|  basic peroxidase swpb7                                  147   3e-39   
ref|XP_009630373.1|  PREDICTED: peroxidase 3                            145   1e-38   
ref|XP_006372958.1|  hypothetical protein POPTR_0017s06560g             139   2e-38   
ref|XP_009800216.1|  PREDICTED: peroxidase 3-like                       143   9e-38   
ref|XP_009796691.1|  PREDICTED: peroxidase 3-like                       142   1e-37   
gb|AAU04879.1|  peroxidase a                                            142   2e-37   Eucommia ulmoides
ref|XP_009768247.1|  PREDICTED: peroxidase 3                            142   2e-37   
ref|XP_009589067.1|  PREDICTED: peroxidase 3-like                       142   2e-37   
ref|XP_002515747.1|  Peroxidase 47 precursor, putative                  139   2e-37   Ricinus communis
gb|AHC69832.1|  peroxidase                                              141   3e-37   
ref|XP_011079026.1|  PREDICTED: peroxidase 3-like                       141   3e-37   
ref|XP_004243459.1|  PREDICTED: peroxidase 3-like                       141   3e-37   
ref|XP_004243458.1|  PREDICTED: peroxidase 3-like                       141   4e-37   
ref|XP_002515748.1|  Peroxidase 39 precursor, putative                  141   4e-37   Ricinus communis
ref|XP_004240142.1|  PREDICTED: peroxidase 3-like                       141   4e-37   
ref|XP_009604384.1|  PREDICTED: peroxidase 3-like                       140   9e-37   
ref|XP_011003206.1|  PREDICTED: peroxidase 3-like                       139   1e-36   
ref|XP_009603962.1|  PREDICTED: peroxidase 3-like                       140   1e-36   
ref|XP_006372956.1|  hypothetical protein POPTR_0017s06550g             138   2e-36   
gb|AHL39150.1|  class III peroxidase                                    139   2e-36   
ref|XP_002309832.1|  peroxidase precursor family protein                139   2e-36   Populus trichocarpa [western balsam poplar]
emb|CDP11801.1|  unnamed protein product                                138   4e-36   
emb|CDP20342.1|  unnamed protein product                                138   4e-36   
ref|XP_006372957.1|  hypothetical protein POPTR_0017s06550g             138   5e-36   
gb|ABK93918.1|  unknown                                                 138   5e-36   Populus trichocarpa [western balsam poplar]
ref|XP_006367288.1|  PREDICTED: peroxidase 3-like                       138   5e-36   
ref|XP_004243835.1|  PREDICTED: peroxidase 3-like                       137   1e-35   
ref|XP_011037006.1|  PREDICTED: peroxidase 3-like                       137   1e-35   
ref|XP_006367289.1|  PREDICTED: peroxidase 3-like                       138   1e-35   
ref|XP_010267773.1|  PREDICTED: peroxidase 3                            136   2e-35   
gb|KDP25860.1|  hypothetical protein JCGZ_22890                         136   2e-35   
ref|XP_002280274.1|  PREDICTED: peroxidase 3                            136   3e-35   Vitis vinifera
ref|XP_010240937.1|  PREDICTED: peroxidase 3-like                       135   4e-35   
ref|XP_009615423.1|  PREDICTED: peroxidase 3-like                       135   6e-35   
ref|XP_010522326.1|  PREDICTED: peroxidase 3                            135   6e-35   
gb|AEX20394.1|  putative class III peroxidase                           133   8e-35   
ref|XP_004243525.1|  PREDICTED: peroxidase 3-like                       135   8e-35   
ref|XP_009353255.1|  PREDICTED: peroxidase 3                            134   1e-34   
ref|XP_010109530.1|  Peroxidase 3                                       136   2e-34   
ref|XP_007215666.1|  hypothetical protein PRUPE_ppa008540mg             134   2e-34   
ref|XP_011100296.1|  PREDICTED: peroxidase 3-like                       134   2e-34   
ref|XP_008230094.1|  PREDICTED: peroxidase 3                            134   2e-34   
ref|NP_001289850.1|  peroxidase 3 precursor                             133   4e-34   
ref|XP_004240140.1|  PREDICTED: peroxidase 3                            133   4e-34   
ref|XP_004240141.1|  PREDICTED: peroxidase 3-like                       133   4e-34   
ref|XP_009342265.1|  PREDICTED: peroxidase 3-like                       132   5e-34   
ref|XP_008379618.1|  PREDICTED: peroxidase 3                            132   6e-34   
gb|KDP25855.1|  hypothetical protein JCGZ_22885                         132   6e-34   
gb|KHN25777.1|  Peroxidase 3                                            131   7e-34   
ref|XP_009624291.1|  PREDICTED: peroxidase 3-like                       132   8e-34   
ref|XP_006594890.1|  PREDICTED: peroxidase 3                            132   9e-34   
gb|ACU24335.1|  unknown                                                 132   1e-33   Glycine max [soybeans]
ref|XP_006367274.1|  PREDICTED: peroxidase 3-like                       132   1e-33   
ref|XP_011037007.1|  PREDICTED: peroxidase 3-like                       132   1e-33   
gb|KHN25776.1|  Peroxidase 39                                           130   1e-33   
ref|XP_009620797.1|  PREDICTED: peroxidase 3-like                       132   1e-33   
ref|XP_006305430.1|  hypothetical protein CARUB_v10009829mg             131   1e-33   
gb|AAD11482.1|  peroxidase precursor                                    132   1e-33   Glycine max [soybeans]
ref|XP_009597503.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 3...    128   1e-33   
ref|XP_003540316.1|  PREDICTED: peroxidase 3                            131   2e-33   
ref|XP_009802836.1|  PREDICTED: peroxidase 3-like                       131   2e-33   
ref|XP_008353582.1|  PREDICTED: peroxidase 3-like                       127   2e-33   
ref|XP_009787132.1|  PREDICTED: peroxidase 3-like                       131   2e-33   
ref|XP_003540317.1|  PREDICTED: peroxidase 39-like                      131   2e-33   
ref|XP_009118603.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 3...    130   3e-33   
ref|XP_009624293.1|  PREDICTED: peroxidase 3-like                       130   3e-33   
emb|CDY10037.1|  BnaC08g44140D                                          130   3e-33   
ref|XP_006594891.1|  PREDICTED: peroxidase 39-like                      130   3e-33   
ref|XP_006356922.1|  PREDICTED: peroxidase 3-like                       130   3e-33   
gb|KHN36550.1|  Peroxidase 39                                           130   3e-33   
ref|XP_010484852.1|  PREDICTED: peroxidase 3-like                       130   4e-33   
ref|XP_006357954.1|  PREDICTED: peroxidase 3-like                       130   7e-33   
gb|AAT72298.1|  CBRCI35                                                 130   7e-33   Capsella bursa-pastoris
ref|XP_010475209.1|  PREDICTED: peroxidase 3                            129   7e-33   
gb|AAD11481.1|  peroxidase precursor                                    130   7e-33   Glycine max [soybeans]
ref|XP_002889542.1|  CBRCI35                                            129   7e-33   
ref|XP_010457608.1|  PREDICTED: peroxidase 3-like                       129   8e-33   
emb|CDY46845.1|  BnaA10g03290D                                          129   8e-33   
ref|XP_007149959.1|  hypothetical protein PHAVU_005G113800g             129   8e-33   
gb|EYU24801.1|  hypothetical protein MIMGU_mgv1a009942mg                129   1e-32   
ref|XP_006357953.1|  PREDICTED: peroxidase 3-like                       129   1e-32   
ref|XP_009119172.1|  PREDICTED: peroxidase 3-like                       129   2e-32   
ref|XP_004287925.1|  PREDICTED: peroxidase 3-like                       128   2e-32   
ref|XP_006372959.1|  hypothetical protein POPTR_0017s06570g             128   2e-32   
ref|XP_009786925.1|  PREDICTED: peroxidase 3-like                       128   2e-32   
gb|AAM61240.1|  putative peroxidase                                     128   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172018.1|  peroxidase 3                                          128   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008341978.1|  PREDICTED: peroxidase 3-like                       128   3e-32   
ref|XP_008804375.1|  PREDICTED: peroxidase 3-like                       128   3e-32   
gb|KFK42864.1|  hypothetical protein AALP_AA1G049000                    128   3e-32   
gb|ACU19509.1|  unknown                                                 128   3e-32   Glycine max [soybeans]
ref|XP_006372960.1|  hypothetical protein POPTR_0017s06570g             128   3e-32   
ref|XP_009342252.1|  PREDICTED: peroxidase 3                            128   3e-32   
ref|XP_006855828.1|  hypothetical protein AMTR_s00037p00030970          127   4e-32   
ref|XP_008455840.1|  PREDICTED: peroxidase 39-like                      127   4e-32   
ref|XP_002309833.1|  hypothetical protein POPTR_0007s02590g             125   6e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006357991.1|  PREDICTED: peroxidase 3-like                       126   1e-31   
gb|AES67274.2|  peroxidase family protein                               126   1e-31   
ref|XP_004151878.1|  PREDICTED: peroxidase 39-like                      126   1e-31   
ref|XP_003597023.1|  Peroxidase                                         127   1e-31   
gb|KGN63270.1|  hypothetical protein Csa_2G421020                       126   1e-31   
emb|CDY49518.1|  BnaC05g03300D                                          126   1e-31   
ref|XP_006418047.1|  hypothetical protein EUTSA_v10008189mg             126   1e-31   
gb|AHL39151.1|  class III peroxidase                                    126   2e-31   
ref|XP_002515749.1|  Peroxidase 3 precursor, putative                   125   2e-31   Ricinus communis
ref|XP_006447516.1|  hypothetical protein CICLE_v10015924mg             125   2e-31   
gb|KDO59839.1|  hypothetical protein CISIN_1g048664mg                   125   3e-31   
ref|NP_192868.1|  peroxidase 39                                         125   3e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CDY13252.1|  BnaC09g24040D                                          125   3e-31   
emb|CAA67337.1|  peroxidase                                             125   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004487389.1|  PREDICTED: peroxidase 3-like                       125   4e-31   
ref|XP_009108181.1|  PREDICTED: peroxidase 39                           125   4e-31   
ref|XP_008341973.1|  PREDICTED: peroxidase 3-like                       125   4e-31   
gb|KFK31897.1|  hypothetical protein AALP_AA6G173300                    124   5e-31   
ref|XP_010931184.1|  PREDICTED: peroxidase 3-like isoform X2            122   1e-30   
ref|XP_002872571.1|  peroxidase ATP19a                                  123   1e-30   
ref|XP_006396925.1|  hypothetical protein EUTSA_v10028797mg             123   2e-30   
ref|XP_010931180.1|  PREDICTED: peroxidase 3-like isoform X1            122   3e-30   
ref|XP_007045599.1|  Peroxidase superfamily protein isoform 1           122   4e-30   
ref|XP_008784560.1|  PREDICTED: peroxidase 3-like                       122   5e-30   
ref|XP_008777796.1|  PREDICTED: peroxidase 3-like                       122   7e-30   
ref|XP_010435105.1|  PREDICTED: peroxidase 39                           121   8e-30   
ref|XP_006288205.1|  hypothetical protein CARUB_v10001445mg             121   1e-29   
ref|XP_010540729.1|  PREDICTED: peroxidase 39                           122   1e-29   
emb|CAA76374.2|  peroxidase                                             121   1e-29   Spinacia oleracea
ref|XP_010931832.1|  PREDICTED: peroxidase 3-like                       120   2e-29   
ref|XP_010455535.1|  PREDICTED: peroxidase 39-like                      120   2e-29   
ref|XP_010422076.1|  PREDICTED: peroxidase 39-like                      120   2e-29   
gb|KHG05441.1|  Peroxidase 3 -like protein                              119   9e-29   
ref|NP_001234644.1|  peroxidase precursor                               118   1e-28   
gb|ACJ11761.1|  class III peroxidase                                    118   1e-28   Gossypium hirsutum [American cotton]
ref|XP_010908222.1|  PREDICTED: peroxidase 3-like                       117   4e-28   
gb|KHN41201.1|  Peroxidase 3                                            115   5e-28   
ref|XP_010696607.1|  PREDICTED: peroxidase 3                            116   9e-28   
gb|AHZ89831.1|  peroxidase                                              115   1e-27   
ref|XP_006582342.1|  PREDICTED: peroxidase 3-like                       115   1e-27   
ref|XP_006581060.1|  PREDICTED: peroxidase isoform X1                   115   1e-27   
gb|EMS60387.1|  Peroxidase 1                                            110   2e-27   
gb|AAK84424.1|AF396465_1  peroxidase-like protein                       109   2e-27   Pisum sativum [garden pea]
ref|XP_010510594.1|  PREDICTED: peroxidase 30                           115   2e-27   
gb|KHN41200.1|  Peroxidase 3                                            114   3e-27   
ref|XP_006298132.1|  hypothetical protein CARUB_v10014176mg             114   3e-27   
ref|XP_002883319.1|  peroxidase 30                                      114   4e-27   
ref|XP_010488198.1|  PREDICTED: peroxidase 30-like                      114   4e-27   
gb|ACI00841.1|  class III peroxidase                                    114   5e-27   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010524488.1|  PREDICTED: peroxidase 30                           113   8e-27   
ref|XP_002440020.1|  hypothetical protein SORBIDRAFT_09g024580          113   8e-27   Sorghum bicolor [broomcorn]
gb|KHN22848.1|  Peroxidase 3                                            113   1e-26   
ref|XP_006406236.1|  hypothetical protein EUTSA_v10021123mg             113   1e-26   
ref|NP_001241977.1|  uncharacterized protein LOC100784922 precursor     113   1e-26   
gb|EMT01705.1|  Peroxidase 1                                            111   1e-26   
dbj|BAK06872.1|  predicted protein                                      112   2e-26   
ref|XP_009145451.1|  PREDICTED: peroxidase 30                           112   2e-26   
ref|XP_004961613.1|  PREDICTED: peroxidase 1-like                       112   2e-26   
gb|ACT35472.1|  peroxidase 30                                           112   3e-26   Brassica rapa
gb|EMS60386.1|  Peroxidase 1                                            110   3e-26   
ref|XP_007132569.1|  hypothetical protein PHAVU_011G105900g             111   3e-26   
gb|ACI00835.1|  class III peroxidase                                    111   4e-26   Triticum aestivum [Canadian hard winter wheat]
emb|CDY33143.1|  BnaCnng07140D                                          112   4e-26   
gb|EMS60389.1|  Peroxidase 1                                            111   4e-26   
gb|ACI00842.1|  class III preoxidase                                    108   4e-26   Triticum aestivum [Canadian hard winter wheat]
gb|ACF83673.1|  unknown                                                 110   5e-26   Zea mays [maize]
emb|CAA67360.1|  peroxidase ATP7a                                       110   8e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188814.1|  peroxidase 30                                         110   8e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CAA66965.1|  peroxidase                                             110   8e-26   Arabidopsis thaliana [mouse-ear cress]
gb|ACI00844.1|  class III peroxidase                                    107   9e-26   Triticum aestivum [Canadian hard winter wheat]
gb|ACI00836.1|  class III peroxidase                                    110   9e-26   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001149755.1|  peroxidase 39 precursor                            110   1e-25   Zea mays [maize]
ref|XP_006654599.1|  PREDICTED: peroxidase 1-like                       110   1e-25   
ref|XP_008643745.1|  PREDICTED: peroxidase 39 isoform X1                110   1e-25   
emb|CDY19299.1|  BnaC01g31810D                                          110   1e-25   
emb|CDY55649.1|  BnaA01g36520D                                          110   1e-25   
emb|CCJ34832.1|  horseradish peroxidase isoenzyme HRP_2021              110   1e-25   
ref|XP_004515086.1|  PREDICTED: peroxidase 3-like                       110   1e-25   
gb|AAM61382.1|  putative peroxidase                                     110   1e-25   Arabidopsis thaliana [mouse-ear cress]
gb|EMT14966.1|  hypothetical protein F775_43715                         104   2e-25   
gb|AFK38463.1|  unknown                                                 104   2e-25   
gb|ACI00843.1|  class III peroxidase                                    105   2e-25   Triticum aestivum [Canadian hard winter wheat]
gb|EMT33122.1|  hypothetical protein F775_52516                         109   2e-25   
gb|EMT04929.1|  Peroxidase 39                                           105   2e-25   
ref|XP_002437459.1|  hypothetical protein SORBIDRAFT_10g027490          109   2e-25   Sorghum bicolor [broomcorn]
gb|AIY26417.1|  peroxidase 1a                                           109   2e-25   
gb|AIV42032.1|  peroxidase                                              109   2e-25   
gb|AIY26418.1|  peroxidase 1b                                           109   2e-25   
gb|AIY26419.1|  peroxidase 1a                                           109   2e-25   
gb|AIV42033.1|  peroxidase                                              109   2e-25   
gb|AIY26420.1|  peroxidase 1b                                           109   3e-25   
ref|XP_009109348.1|  PREDICTED: peroxidase 30                           109   3e-25   
ref|XP_006469710.1|  PREDICTED: peroxidase 30-like isoform X2           108   3e-25   
dbj|BAA03644.1|  peroxidase                                             108   4e-25   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055955.1|  Os05g0499300                                       108   4e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EMS63657.1|  Peroxidase 1                                            108   4e-25   
gb|EMS54743.1|  Peroxidase 3                                            107   5e-25   
gb|EMT00309.1|  Peroxidase 1                                            108   5e-25   
gb|AIY26422.1|  peroxidase 1b                                           108   5e-25   
gb|AIY26421.1|  peroxidase 1a                                           108   6e-25   
gb|EMT05880.1|  Peroxidase 3                                            108   6e-25   
ref|XP_002488879.1|  hypothetical protein SORBIDRAFT_2674s002010        108   6e-25   Sorghum bicolor [broomcorn]
ref|XP_004966236.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 3...    108   6e-25   
gb|KFK39497.1|  hypothetical protein AALP_AA3G251500                    108   7e-25   
ref|XP_004240143.1|  PREDICTED: peroxidase 27-like                      107   8e-25   
ref|XP_008776102.1|  PREDICTED: peroxidase 56-like                      104   9e-25   
gb|EMS46833.1|  Peroxidase 1                                            107   1e-24   
ref|XP_008776103.1|  PREDICTED: peroxidase 56-like                      104   1e-24   
ref|XP_008652821.1|  PREDICTED: peroxidase 1-like                       107   1e-24   
ref|XP_010227199.1|  PREDICTED: peroxidase 3-like                       107   1e-24   
dbj|BAJ97158.1|  predicted protein                                      107   1e-24   
ref|XP_003568173.1|  PREDICTED: peroxidase 1-like                       107   1e-24   
ref|XP_006656020.1|  PREDICTED: peroxidase 1-like                       107   1e-24   
ref|XP_010231205.1|  PREDICTED: peroxidase 1-like                       107   2e-24   
dbj|BAD62399.1|  putative peroxidase 1 precursor                        107   2e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ00663.1|  hypothetical protein OsI_22684                          107   2e-24   Oryza sativa Indica Group [Indian rice]
gb|ACR61552.1|  peroxidase 2                                            107   2e-24   
ref|NP_001057469.2|  Os06g0306300                                       107   2e-24   Oryza sativa Japonica Group [Japonica rice]
tpe|CAH69322.1|  TPA: class III peroxidase 80 precursor                 106   2e-24   
ref|NP_001057675.2|  Os06g0490400                                       106   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006656386.1|  PREDICTED: peroxidase 3-like                       107   2e-24   
gb|EAZ01004.1|  hypothetical protein OsI_23038                          106   2e-24   Oryza sativa Indica Group [Indian rice]
gb|AIV42034.1|  peroxidase                                              106   3e-24   
gb|AFW81710.1|  hypothetical protein ZEAMMB73_539966                    105   4e-24   
gb|KEH29649.1|  peroxidase family protein                               106   4e-24   
ref|XP_008780520.1|  PREDICTED: peroxidase 56-like                      103   4e-24   
ref|XP_010923934.1|  PREDICTED: peroxidase 1-like                       105   4e-24   
ref|XP_002438300.1|  hypothetical protein SORBIDRAFT_10g011290          105   5e-24   Sorghum bicolor [broomcorn]
ref|XP_009382683.1|  PREDICTED: peroxidase 3-like                       105   5e-24   
ref|XP_002436932.1|  hypothetical protein SORBIDRAFT_10g011510          105   5e-24   Sorghum bicolor [broomcorn]
ref|XP_008657600.1|  PREDICTED: peroxidase 1-like                       105   5e-24   
ref|XP_008657599.1|  PREDICTED: peroxidase 1-like                       105   6e-24   
gb|EMS60388.1|  Peroxidase 1                                            105   6e-24   
dbj|BAC84009.1|  peroxidase 1 precursor-like protein                    102   6e-24   Oryza sativa Japonica Group [Japonica rice]
gb|ACL52390.1|  unknown                                                 105   8e-24   Zea mays [maize]
ref|NP_001146942.1|  peroxidase 1 precursor                             105   8e-24   Zea mays [maize]
ref|XP_008455410.1|  PREDICTED: peroxidase 27-like                      105   8e-24   
ref|XP_003568172.1|  PREDICTED: peroxidase 1                            105   1e-23   
ref|NP_001058691.1|  Os07g0104100                                       102   1e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EYU24798.1|  hypothetical protein MIMGU_mgv1a009213mg                104   1e-23   
gb|KHG20863.1|  Peroxidase 27 -like protein                             104   1e-23   
ref|XP_010908221.1|  PREDICTED: peroxidase 1-like                       104   1e-23   
ref|XP_006356926.1|  PREDICTED: peroxidase 56-like                      104   2e-23   
ref|XP_008659484.1|  PREDICTED: peroxidase 1-like                       104   2e-23   
ref|XP_007045600.1|  Peroxidase superfamily protein isoform 2           103   2e-23   
gb|EMT32565.1|  Peroxidase 1                                            103   2e-23   
ref|XP_009117679.1|  PREDICTED: peroxidase 27-like                      103   2e-23   
emb|CDY55811.1|  BnaCnng29190D                                          103   2e-23   
ref|XP_002518541.1|  Peroxidase 27 precursor, putative                  103   2e-23   Ricinus communis
ref|XP_002268360.1|  PREDICTED: peroxidase 27                           103   2e-23   Vitis vinifera
ref|XP_004965311.1|  PREDICTED: peroxidase 1-like                       103   2e-23   
ref|NP_001058379.1|  Os06g0681600                                       103   3e-23   Oryza sativa Japonica Group [Japonica rice]
tpe|CAH69331.1|  TPA: class III peroxidase 89 precursor                 103   3e-23   
ref|XP_002436934.1|  hypothetical protein SORBIDRAFT_10g011530          103   4e-23   Sorghum bicolor [broomcorn]
ref|XP_004144487.1|  PREDICTED: peroxidase 56-like                      103   4e-23   
emb|CAA80502.1|  peroxidase                                             103   4e-23   Spirodela polyrhiza
ref|XP_004965312.1|  PREDICTED: peroxidase 1-like                       103   4e-23   
gb|EYU35785.1|  hypothetical protein MIMGU_mgv1a0266491mg               100   5e-23   
ref|XP_004159200.1|  PREDICTED: peroxidase 56-like                      103   5e-23   
gb|EYU24794.1|  hypothetical protein MIMGU_mgv1a0181921mg               101   5e-23   
dbj|BAK02643.1|  predicted protein                                      102   6e-23   
gb|EYU24797.1|  hypothetical protein MIMGU_mgv1a010025mg                102   6e-23   
gb|KFK28588.1|  hypothetical protein AALP_AA7G016800                    102   8e-23   
ref|XP_008809845.1|  PREDICTED: peroxidase 1-like                       102   8e-23   
ref|XP_009405647.1|  PREDICTED: peroxidase 1-like                       102   9e-23   
gb|EYU24795.1|  hypothetical protein MIMGU_mgv1a021569mg                102   1e-22   
gb|EYU24792.1|  hypothetical protein MIMGU_mgv1a009974mg                102   1e-22   
ref|XP_006593048.1|  PREDICTED: peroxidase 3-like                     99.8    1e-22   
tpe|CAH69339.1|  TPA: class III peroxidase 97 precursor                 102   1e-22   
gb|EYU24791.1|  hypothetical protein MIMGU_mgv1a010031mg                102   1e-22   
gb|EEC81377.1|  hypothetical protein OsI_24583                          102   1e-22   Oryza sativa Indica Group [Indian rice]
gb|EYU24796.1|  hypothetical protein MIMGU_mgv1a010112mg                101   1e-22   
gb|EMT32567.1|  Peroxidase 1                                            101   1e-22   
ref|XP_004987268.1|  PREDICTED: peroxidase 1-like                       101   2e-22   
ref|XP_006657390.1|  PREDICTED: peroxidase 1-like                       101   2e-22   
ref|XP_010227737.1|  PREDICTED: peroxidase 1-like                       101   2e-22   
ref|XP_002871652.1|  hypothetical protein ARALYDRAFT_325975             101   2e-22   
ref|XP_004951857.1|  PREDICTED: peroxidase 39-like                      101   3e-22   
ref|XP_004287926.1|  PREDICTED: peroxidase 27-like                      100   3e-22   
gb|KHN22847.1|  Peroxidase 3                                          99.4    3e-22   
gb|EMT04116.1|  Peroxidase 1                                            100   4e-22   
ref|XP_010267772.1|  PREDICTED: peroxidase 56-like                      100   4e-22   
gb|EYU33918.1|  hypothetical protein MIMGU_mgv1a010413mg                100   4e-22   
ref|XP_003570966.1|  PREDICTED: peroxidase 39-like                      100   4e-22   
gb|EMT19965.1|  Peroxidase 3                                            100   4e-22   
ref|XP_010420175.1|  PREDICTED: peroxidase 56-like                      100   4e-22   
ref|XP_010931155.1|  PREDICTED: peroxidase 1-like                       100   5e-22   
ref|XP_010267771.1|  PREDICTED: peroxidase 27-like                      100   5e-22   
ref|XP_006400035.1|  hypothetical protein EUTSA_v10014085mg             100   5e-22   
emb|CDY37537.1|  BnaA05g34020D                                          100   5e-22   
ref|XP_002459202.1|  hypothetical protein SORBIDRAFT_02g000470          100   5e-22   
ref|XP_009147405.1|  PREDICTED: peroxidase 27                           100   5e-22   
dbj|BAK00543.1|  predicted protein                                      100   5e-22   
ref|NP_197022.1|  peroxidase 56                                         100   5e-22   
ref|XP_008230092.1|  PREDICTED: peroxidase 27-like                      100   5e-22   
ref|XP_006408471.1|  hypothetical protein EUTSA_v10021152mg           99.8    6e-22   
gb|ABK26805.1|  unknown                                               99.8    7e-22   
emb|CDY43275.1|  BnaC05g48680D                                        99.8    8e-22   
ref|XP_004965313.1|  PREDICTED: peroxidase 1-like                     99.8    8e-22   
ref|XP_008801172.1|  PREDICTED: peroxidase 1-like                     99.4    8e-22   
ref|XP_010240935.1|  PREDICTED: peroxidase 27-like                    99.4    9e-22   
gb|EMS48321.1|  Peroxidase 1                                          97.8    1e-21   
emb|CDX85056.1|  BnaC05g19990D                                        99.4    1e-21   
ref|XP_009121602.1|  PREDICTED: peroxidase 56                         99.0    1e-21   
ref|XP_003564026.1|  PREDICTED: peroxidase 1-like                     99.0    1e-21   
ref|XP_010453647.1|  PREDICTED: peroxidase 56-like                    99.0    1e-21   
ref|XP_008379619.1|  PREDICTED: peroxidase 27-like                    99.0    1e-21   
ref|XP_009787653.1|  PREDICTED: peroxidase 27-like                    99.0    1e-21   
ref|XP_009126036.1|  PREDICTED: peroxidase 56-like                    99.0    1e-21   
ref|XP_010227808.1|  PREDICTED: peroxidase 1-like                     99.0    1e-21   
ref|XP_010035573.1|  PREDICTED: peroxidase 27-like                    99.0    1e-21   
ref|XP_010492345.1|  PREDICTED: peroxidase 56                         99.0    1e-21   
ref|XP_009353257.1|  PREDICTED: peroxidase 27-like                    98.6    2e-21   
emb|CDP20391.1|  unnamed protein product                              98.6    2e-21   
emb|CDX91005.1|  BnaC02g05920D                                        98.6    2e-21   
ref|XP_002527239.1|  Peroxidase 27 precursor, putative                98.6    2e-21   
ref|XP_002882194.1|  peroxidase 27                                    98.6    2e-21   
gb|EMS62296.1|  Peroxidase 1                                          99.0    2e-21   
gb|EMT32568.1|  Peroxidase 1                                          98.6    2e-21   
dbj|BAJ98322.1|  predicted protein                                    98.6    2e-21   
gb|KFK37581.1|  hypothetical protein AALP_AA3G001800                  98.2    2e-21   
ref|XP_010551859.1|  PREDICTED: peroxidase 27-like                    98.6    2e-21   
gb|KDP41159.1|  hypothetical protein JCGZ_03653                       93.2    3e-21   
dbj|BAK07568.1|  predicted protein                                    98.2    3e-21   
emb|CDX69544.1|  BnaA10g18930D                                        98.6    3e-21   
ref|XP_006288216.1|  hypothetical protein CARUB_v10001453mg           97.8    3e-21   
ref|XP_010931148.1|  PREDICTED: peroxidase 1                          97.8    3e-21   
ref|XP_009419593.1|  PREDICTED: peroxidase 39-like                    97.8    3e-21   
dbj|BAK01904.1|  predicted protein                                    97.8    4e-21   
ref|XP_010413829.1|  PREDICTED: peroxidase 27-like                    97.8    4e-21   
ref|XP_009794257.1|  PREDICTED: peroxidase 27-like                    97.4    4e-21   
ref|XP_006299954.1|  hypothetical protein CARUB_v10016167mg           97.4    5e-21   
ref|XP_009784557.1|  PREDICTED: peroxidase 27-like                    97.1    6e-21   
ref|XP_004251490.1|  PREDICTED: peroxidase 27                         97.1    6e-21   
ref|XP_011026638.1|  PREDICTED: peroxidase 56-like                    96.7    6e-21   
gb|EMS62297.1|  Peroxidase 1                                          97.8    6e-21   
ref|XP_011100419.1|  PREDICTED: peroxidase 27-like                    96.7    8e-21   
gb|EMT01883.1|  Peroxidase 1                                          96.7    8e-21   
ref|XP_006387131.1|  hypothetical protein POPTR_1748s002002g          93.6    8e-21   
ref|XP_006380314.1|  hypothetical protein POPTR_0007s02560g           96.7    8e-21   
ref|XP_006387149.1|  hypothetical protein POPTR_1693s00200g           96.7    8e-21   
gb|EMT08381.1|  Peroxidase 1                                          97.1    8e-21   
ref|XP_002309830.2|  hypothetical protein POPTR_0007s02570g           96.7    9e-21   
ref|XP_003580604.1|  PREDICTED: peroxidase 1-like                     96.7    9e-21   
ref|XP_008804373.1|  PREDICTED: peroxidase 1-like                     96.7    9e-21   
gb|EMS59621.1|  Peroxidase 1                                          95.5    9e-21   
gb|EMT32591.1|  Peroxidase 1                                          96.7    1e-20   
gb|EMS50723.1|  Peroxidase 1                                          96.7    1e-20   
ref|XP_009598812.1|  PREDICTED: peroxidase 27-like                    96.3    1e-20   
ref|XP_008804399.1|  PREDICTED: peroxidase 1-like                     96.3    1e-20   
ref|XP_007217744.1|  hypothetical protein PRUPE_ppa008516mg           96.3    1e-20   
ref|XP_011003204.1|  PREDICTED: peroxidase 27-like                    96.3    1e-20   
ref|XP_006363505.1|  PREDICTED: peroxidase 27-like                    95.9    1e-20   
gb|EMT19964.1|  Peroxidase 3                                          91.3    2e-20   
ref|XP_011003205.1|  PREDICTED: peroxidase 56-like                    95.9    2e-20   
ref|XP_006855827.1|  hypothetical protein AMTR_s00037p00025630        95.9    2e-20   
gb|ACR36398.1|  unknown                                               94.4    2e-20   
ref|XP_006286841.1|  hypothetical protein CARUB_v10003841mg           95.9    2e-20   
ref|XP_010057733.1|  PREDICTED: peroxidase 27-like                    95.9    2e-20   
ref|NP_001174102.1|  Os04g0628200                                     95.5    2e-20   
ref|XP_011026639.1|  PREDICTED: peroxidase 56-like                    95.9    2e-20   
gb|AAC15242.1|  peroxidase                                            91.7    2e-20   
ref|XP_010485528.1|  PREDICTED: peroxidase 27-like                    95.5    2e-20   
ref|XP_010240936.1|  PREDICTED: peroxidase 27-like                    95.5    2e-20   
ref|XP_004245974.1|  PREDICTED: peroxidase 27-like                    95.5    2e-20   
ref|XP_006447517.1|  hypothetical protein CICLE_v10017908mg           95.5    2e-20   
ref|XP_010463561.1|  PREDICTED: peroxidase 27                         95.5    2e-20   
ref|XP_002871653.1|  hypothetical protein ARALYDRAFT_909489           95.5    2e-20   
ref|XP_010233139.1|  PREDICTED: peroxidase 1-like                     95.5    3e-20   
emb|CAE04245.3|  OSJNBa0089N06.6                                      95.5    3e-20   
emb|CAJ86371.1|  OSIGBa0117N13.15                                     95.1    3e-20   
ref|XP_009796690.1|  PREDICTED: peroxidase 27-like                    95.1    3e-20   
gb|KCW47001.1|  hypothetical protein EUGRSUZ_K00806                   94.0    3e-20   
ref|XP_009630374.1|  PREDICTED: peroxidase 27-like                    95.1    3e-20   
ref|XP_009631264.1|  PREDICTED: peroxidase 27-like                    94.7    4e-20   
ref|XP_011007886.1|  PREDICTED: peroxidase 27-like                    94.7    4e-20   
ref|XP_010059640.1|  PREDICTED: peroxidase 27-like                    94.7    4e-20   
ref|XP_010999629.1|  PREDICTED: peroxidase 27-like                    94.7    4e-20   
gb|KDP41154.1|  hypothetical protein JCGZ_03648                       94.7    4e-20   
ref|XP_006652863.1|  PREDICTED: peroxidase 1-like                     94.7    4e-20   
gb|EMS62295.1|  Peroxidase 1                                          94.4    4e-20   
tpe|CAH69266.1|  TPA: class III peroxidase 24 precursor               94.7    4e-20   
ref|XP_010267770.1|  PREDICTED: peroxidase 27-like                    94.7    4e-20   
ref|XP_007045601.1|  Peroxidase superfamily protein                   94.7    4e-20   
ref|XP_010057739.1|  PREDICTED: peroxidase 27-like                    94.7    4e-20   
gb|AHL39168.1|  class III peroxidase                                  94.7    4e-20   
ref|XP_002316610.2|  hypothetical protein POPTR_0011s00280g           94.7    4e-20   
gb|EAZ21834.1|  hypothetical protein OsJ_05480                        94.7    5e-20   
gb|EMT32564.1|  hypothetical protein F775_52556                       94.4    5e-20   
ref|NP_001045979.1|  Os02g0161800                                     94.7    5e-20   
gb|ACG38470.1|  peroxidase 1 precursor                                94.7    5e-20   
gb|ACF84679.1|  unknown                                               94.7    5e-20   
ref|NP_186768.1|  peroxidase 27                                       94.4    5e-20   
ref|NP_001147671.1|  peroxidase 1 precursor                           94.4    5e-20   
gb|EYU24800.1|  hypothetical protein MIMGU_mgv1a010045mg              94.4    5e-20   
ref|XP_009604229.1|  PREDICTED: peroxidase 27-like                    94.4    6e-20   
ref|XP_004293253.1|  PREDICTED: peroxidase 27-like                    94.4    6e-20   
gb|AFQ36036.1|  peroxidase 27                                         94.0    7e-20   
gb|AHJ86268.1|  peroxidase                                            94.0    7e-20   
ref|XP_008224769.1|  PREDICTED: peroxidase 27                         94.0    8e-20   
ref|XP_007213025.1|  hypothetical protein PRUPE_ppa023088mg           94.0    8e-20   
gb|EMT32569.1|  Peroxidase 1                                          94.4    8e-20   
ref|XP_010679746.1|  PREDICTED: peroxidase 27-like                    93.6    9e-20   
ref|XP_009398185.1|  PREDICTED: peroxidase 27-like                    93.6    9e-20   
ref|XP_004251512.1|  PREDICTED: peroxidase 27-like                    93.6    1e-19   
gb|EAY84583.1|  hypothetical protein OsI_05954                        93.6    1e-19   
ref|XP_002280216.1|  PREDICTED: peroxidase 27                         93.6    1e-19   
gb|AFW86434.1|  peroxidase 1                                          93.2    1e-19   
ref|XP_006371331.1|  Peroxidase 27 precursor family protein           93.2    1e-19   
gb|KDP41151.1|  hypothetical protein JCGZ_03645                       92.4    1e-19   
ref|XP_006352038.1|  PREDICTED: peroxidase 27-like                    93.2    1e-19   
gb|KDP25852.1|  hypothetical protein JCGZ_22882                       92.8    1e-19   
gb|KCW74965.1|  hypothetical protein EUGRSUZ_E03708                   92.8    2e-19   
ref|XP_004292686.1|  PREDICTED: peroxidase 3-like                     92.8    2e-19   
gb|EMT19963.1|  hypothetical protein F775_43425                       88.6    2e-19   
gb|EPS63360.1|  hypothetical protein M569_11425                       92.4    3e-19   
ref|XP_009604224.1|  PREDICTED: peroxidase 27-like                    92.4    3e-19   
tpg|DAA57316.1|  TPA: hypothetical protein ZEAMMB73_576313            91.7    3e-19   
gb|KCW75373.1|  hypothetical protein EUGRSUZ_E041212                  92.0    3e-19   
gb|KCW44829.1|  hypothetical protein EUGRSUZ_L016031                  88.2    3e-19   
ref|XP_009800459.1|  PREDICTED: peroxidase 27-like                    92.0    3e-19   
ref|XP_006352037.1|  PREDICTED: peroxidase 56-like                    94.7    3e-19   
ref|XP_003561523.1|  PREDICTED: peroxidase 1-like                     92.0    4e-19   
gb|EEC68583.1|  hypothetical protein OsI_36924                        92.0    4e-19   
ref|XP_002304933.2|  hypothetical protein POPTR_0004s02230g           92.0    4e-19   
gb|EAY81751.1|  hypothetical protein OsI_36925                        91.7    4e-19   
gb|EEE52524.1|  hypothetical protein OsJ_34737                        91.7    4e-19   
emb|CDX75919.1|  BnaC03g40020D                                        91.7    4e-19   
ref|NP_001068411.1|  Os11g0661600                                     91.7    5e-19   
gb|AFK41845.1|  unknown                                               87.4    5e-19   
ref|XP_011007637.1|  PREDICTED: peroxidase 27-like                    91.3    6e-19   
ref|XP_010048945.1|  PREDICTED: peroxidase 27-like                    91.3    6e-19   
ref|XP_010057737.1|  PREDICTED: peroxidase 27-like                    91.3    6e-19   
ref|NP_001152239.1|  peroxidase 56 precursor                          91.3    6e-19   
tpg|DAA57314.1|  TPA: peroxidase 56                                   91.3    6e-19   
ref|NP_001150235.1|  LOC100283865 precursor                           91.3    7e-19   
emb|CDP20341.1|  unnamed protein product                              90.9    8e-19   
ref|XP_010320977.1|  PREDICTED: peroxidase 39-like                    90.9    8e-19   
ref|XP_010057976.1|  PREDICTED: peroxidase 27-like                    90.9    9e-19   
ref|XP_010048939.1|  PREDICTED: peroxidase 27-like                    90.5    1e-18   
gb|KCW75372.1|  hypothetical protein EUGRSUZ_E04120                   90.9    1e-18   
ref|XP_008663625.1|  PREDICTED: peroxidase 1-like                     90.9    1e-18   
gb|KCW81364.1|  hypothetical protein EUGRSUZ_C02744                   90.9    1e-18   
gb|EPS60456.1|  hypothetical protein M569_14347                       90.1    1e-18   
ref|XP_003638079.1|  Peroxidase                                       90.5    1e-18   
ref|XP_002458618.1|  hypothetical protein SORBIDRAFT_03g036760        90.5    1e-18   
ref|XP_002274157.2|  PREDICTED: peroxidase 27-like                    90.5    1e-18   
gb|KDO74974.1|  hypothetical protein CISIN_1g020619mg                 90.1    1e-18   
ref|XP_011100418.1|  PREDICTED: peroxidase 27-like                    90.1    1e-18   
ref|XP_010048942.1|  PREDICTED: peroxidase 27-like                    90.1    1e-18   
ref|XP_002317707.1|  hypothetical protein POPTR_0012s03980g           90.1    2e-18   
ref|XP_009604225.1|  PREDICTED: peroxidase 27-like                    89.7    2e-18   
gb|KFK42858.1|  hypothetical protein AALP_AA1G048400                  89.7    2e-18   
ref|XP_006357003.1|  PREDICTED: peroxidase 39-like                    89.7    2e-18   
ref|XP_010931166.1|  PREDICTED: peroxidase 56-like                    89.7    2e-18   
ref|XP_008345186.1|  PREDICTED: peroxidase 3-like                     89.7    2e-18   
ref|XP_006663651.1|  PREDICTED: peroxidase 1-like                     89.7    2e-18   
ref|XP_004494311.1|  PREDICTED: peroxidase 3-like                     89.4    3e-18   
ref|XP_002304934.1|  hypothetical protein POPTR_0004s02240g           89.4    3e-18   
gb|EMS55662.1|  Peroxidase 1                                          89.4    3e-18   
ref|NP_001151042.1|  LOC100284675 precursor                           89.4    3e-18   
gb|AHL39131.1|  class III peroxidase                                  89.4    3e-18   
gb|KCW84400.1|  hypothetical protein EUGRSUZ_B01255                   87.8    3e-18   
ref|XP_010045900.1|  PREDICTED: peroxidase 3-like                     87.8    4e-18   
ref|XP_009392735.1|  PREDICTED: peroxidase 56-like                    89.4    4e-18   
ref|XP_006479844.1|  PREDICTED: peroxidase 3-like                     89.0    5e-18   
gb|KFK42862.1|  hypothetical protein AALP_AA1G048800                  88.2    8e-18   
ref|XP_010048943.1|  PREDICTED: peroxidase 27-like                    88.2    8e-18   
ref|XP_002440021.1|  hypothetical protein SORBIDRAFT_09g024590        87.8    1e-17   
ref|XP_006419700.1|  hypothetical protein CICLE_v10007121mg           87.8    1e-17   
gb|KHN28247.1|  Peroxidase 3                                          87.8    1e-17   
ref|XP_004982558.1|  PREDICTED: peroxidase 56-like                    87.8    1e-17   
gb|KFK42860.1|  hypothetical protein AALP_AA1G048600                  87.4    1e-17   
ref|XP_007163044.1|  hypothetical protein PHAVU_001G201300g           87.4    1e-17   
ref|XP_010271617.1|  PREDICTED: peroxidase 27-like                    87.4    1e-17   
ref|XP_010679747.1|  PREDICTED: peroxidase 27-like                    87.4    1e-17   
gb|EAZ04149.1|  hypothetical protein OsI_26291                        87.4    1e-17   
emb|CBI28956.3|  unnamed protein product                              89.7    1e-17   
dbj|BAC79987.1|  putative cationic peroxidase isozyme 40K precursor   86.7    2e-17   
ref|XP_003638091.1|  Peroxidase                                       83.6    2e-17   
ref|XP_004978254.1|  PREDICTED: peroxidase 1-like                     87.4    2e-17   
ref|XP_010261101.1|  PREDICTED: peroxidase 3-like                     87.0    2e-17   
ref|XP_006489267.1|  PREDICTED: peroxidase 3-like                     87.0    2e-17   
ref|NP_001059851.1|  Os07g0531400                                     87.0    2e-17   
gb|EMT05692.1|  Peroxidase 1                                          86.7    2e-17   
ref|XP_010557013.1|  PREDICTED: peroxidase 2-like                     86.7    2e-17   
ref|XP_010543013.1|  PREDICTED: peroxidase 2-like                     86.7    3e-17   
ref|NP_001130975.1|  hypothetical protein precursor                   86.7    3e-17   
ref|XP_002447146.1|  hypothetical protein SORBIDRAFT_06g029370        86.7    3e-17   
emb|CDY49516.1|  BnaC05g03280D                                        86.3    3e-17   
emb|CDY46843.1|  BnaA10g03270D                                        86.3    4e-17   
ref|XP_009119176.1|  PREDICTED: peroxidase 2-like                     86.3    4e-17   
emb|CBI28955.3|  unnamed protein product                              86.7    5e-17   
emb|CDY10040.1|  BnaC08g44110D                                        85.9    5e-17   
ref|XP_004987267.1|  PREDICTED: peroxidase 1-like                     85.9    5e-17   
ref|XP_008812662.1|  PREDICTED: peroxidase 3-like                     85.9    5e-17   
ref|XP_004961612.1|  PREDICTED: peroxidase 1-like                     85.9    5e-17   
ref|NP_001044476.1|  Os01g0787000                                     85.9    5e-17   
ref|XP_011003762.1|  PREDICTED: peroxidase 3-like                     85.5    6e-17   
ref|XP_003521524.1|  PREDICTED: peroxidase 3-like                     85.5    6e-17   
emb|CDP11800.1|  unnamed protein product                              85.5    7e-17   
ref|XP_006650250.1|  PREDICTED: peroxidase 56-like                    85.5    8e-17   



>ref|XP_006356924.1| PREDICTED: peroxidase 3-like [Solanum tuberosum]
Length=327

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYYKL+LKRRGLF+SDAAL T+ TTKS+ID+L  GSL++FYAEFA 
Sbjct  241  IVEMDPGSFRTFDLSYYKLLLKRRGLFQSDAALTTSTTTKSYIDQLVAGSLKEFYAEFAQ  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VKTGSDGEIRK CAVVN
Sbjct  301  SMEKMGRIEVKTGSDGEIRKHCAVVN  326



>ref|XP_006356923.1| PREDICTED: peroxidase 3-like [Solanum tuberosum]
Length=327

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYYKL+LKRRGLF+SDAAL T+ TTKS+ID+L  GSL++FY EFA 
Sbjct  241  IVEMDPGSFRTFDLSYYKLLLKRRGLFQSDAALTTSTTTKSYIDQLVAGSLKEFYVEFAQ  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VKTGSDGEIRK CAVVN
Sbjct  301  SMEKMGRIEVKTGSDGEIRKHCAVVN  326



>gb|AFY26878.1| basic peroxidase swpb7 [Ipomoea batatas]
Length=328

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYYKLVLKRRGLF+SDAALLTNPT +S +++LA GSL  F A+FAT
Sbjct  242  IVEMDPGSFRTFDLSYYKLVLKRRGLFQSDAALLTNPTARSLVNQLAGGSLASFNAQFAT  301

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRIQVKTGS GEIR+ CAVVN
Sbjct  302  SMEKMGRIQVKTGSAGEIRRNCAVVN  327



>ref|XP_009630373.1| PREDICTED: peroxidase 3 [Nicotiana tomentosiformis]
Length=328

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSY+KL+LKRRGLF+SDAAL T+ TTKS+ID+L +GSL++FYAEFA 
Sbjct  243  IVEMDPGSFRTFDLSYFKLLLKRRGLFQSDAALTTSSTTKSYIDQLVKGSLKEFYAEFAQ  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+GRI+VKTGS+GEIRKQCA+VN
Sbjct  303  AMEKMGRIEVKTGSNGEIRKQCALVN  328



>ref|XP_006372958.1| hypothetical protein POPTR_0017s06560g [Populus trichocarpa]
 gb|ERP50755.1| hypothetical protein POPTR_0017s06560g [Populus trichocarpa]
Length=126

 Score =   139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS +TFDLSYY+L+LKRRGLF+SD+AL TN TT SF+++L QGSL++F+AEFA 
Sbjct  40   IVEMDPGSSRTFDLSYYRLLLKRRGLFQSDSALTTNSTTLSFVNQLLQGSLENFFAEFAD  99

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTG+ GEIRKQCAVVN
Sbjct  100  SMEKMGRINVKTGTVGEIRKQCAVVN  125



>ref|XP_009800216.1| PREDICTED: peroxidase 3-like [Nicotiana sylvestris]
Length=333

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSY+KL+LKRRGLF+SDAAL T+ TTK++I++L QGSL++FYAEFA 
Sbjct  248  IVEMDPGSFRTFDLSYFKLLLKRRGLFQSDAALTTSSTTKAYINQLVQGSLKEFYAEFAQ  307

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+GRI+ KTGS+GEIRKQCA+VN
Sbjct  308  AMEKMGRIEAKTGSNGEIRKQCALVN  333



>ref|XP_009796691.1| PREDICTED: peroxidase 3-like [Nicotiana sylvestris]
Length=328

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSY+KL+LKRRGLF+SDAAL T+ TTKS+I++L +GSL++FYAEFA 
Sbjct  243  IVEMDPGSFRTFDLSYFKLLLKRRGLFQSDAALTTSSTTKSYINQLVKGSLKEFYAEFAQ  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+GRI+VKTGS+GEIRKQCA VN
Sbjct  303  AMEKMGRIEVKTGSNGEIRKQCAFVN  328



>gb|AAU04879.1| peroxidase a [Eucommia ulmoides]
Length=330

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY+LVLKRRGLF+SDAAL+T+ TT+S+ID++  GSL++F+AEFA 
Sbjct  244  IVEMDPGSFRTFDLSYYRLVLKRRGLFQSDAALITSSTTRSYIDQILNGSLENFFAEFAR  303

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+GRI+VKTGS GEIR+ CAVVN
Sbjct  304  AMEKMGRIEVKTGSQGEIRRNCAVVN  329



>ref|XP_009768247.1| PREDICTED: peroxidase 3 [Nicotiana sylvestris]
Length=329

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSFKTFDLSYYKL+LKRRGLF+SDAAL    TTKSFI++L +GSL++FYAEFA 
Sbjct  243  IVEMDPGSFKTFDLSYYKLLLKRRGLFQSDAALTKRTTTKSFIEQLVEGSLKEFYAEFAK  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+GR++VKTGS GEIRKQCA VN
Sbjct  303  AMEKMGRVEVKTGSAGEIRKQCAFVN  328



>ref|XP_009589067.1| PREDICTED: peroxidase 3-like [Nicotiana tomentosiformis]
Length=331

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSY+KL+LKRRGLF+SDAAL T+ TTK +I++L QGSL+ FYAEFA 
Sbjct  245  IVEMDPGSFRTFDLSYFKLLLKRRGLFQSDAALTTSATTKLYINQLVQGSLKQFYAEFAQ  304

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+GRI++KTGS GEIRKQCAVVN
Sbjct  305  AMEKMGRIEIKTGSAGEIRKQCAVVN  330



>ref|XP_002515747.1| Peroxidase 47 precursor, putative [Ricinus communis]
 gb|EEF46694.1| Peroxidase 47 precursor, putative [Ricinus communis]
Length=234

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            +EMDPGS KTFDLSYY L+LKRRGLFESDAAL TN  + SFI+++ +GSLQDF+AE+A S
Sbjct  150  IEMDPGSRKTFDLSYYSLLLKRRGLFESDAALTTNSVSLSFINQILKGSLQDFFAEYANS  209

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTGSDGEIRK CAVVN
Sbjct  210  MEKMGRINVKTGSDGEIRKHCAVVN  234



>gb|AHC69832.1| peroxidase [Nicotiana tabacum]
Length=328

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGSFKTFDLSY+KL+LKRRGLF+SDAAL T+ TTKS+I++L QGSL++FYAEFA +
Sbjct  244  VEMDPGSFKTFDLSYFKLLLKRRGLFQSDAALTTSSTTKSYINQLVQGSLKEFYAEFAKA  303

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+G+I+VKTGS GEIRK CAVVN
Sbjct  304  MEKMGKIEVKTGSTGEIRKHCAVVN  328



>ref|XP_011079026.1| PREDICTED: peroxidase 3-like [Sesamum indicum]
Length=332

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGSF+TFDLSYY LVLKRRGLFESDAALLT+P T+S I +L QGS+++FY EFA+S
Sbjct  248  VEMDPGSFRTFDLSYYTLVLKRRGLFESDAALLTDPRTRSIITQLVQGSIENFYQEFASS  307

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+G+I+VKTGS GEIRK CAVVN
Sbjct  308  MEKMGKIEVKTGSFGEIRKHCAVVN  332



>ref|XP_004243459.1| PREDICTED: peroxidase 3-like [Solanum lycopersicum]
Length=329

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYYKL+LKRRGLF+SDAAL T+ TTKSFI++L +GSL++F AEFA 
Sbjct  243  IVEMDPGSFRTFDLSYYKLLLKRRGLFQSDAALTTSATTKSFINQLVKGSLEEFNAEFAK  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+GRI+VKTGS GEIRKQCA VN
Sbjct  303  AMEKMGRIEVKTGSAGEIRKQCAFVN  328



>ref|XP_004243458.1| PREDICTED: peroxidase 3-like [Solanum lycopersicum]
Length=329

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYYKL+LKRRGLF+SDAAL T+ TTKS+I+KL +GSL++F AEFA 
Sbjct  243  IVEMDPGSFRTFDLSYYKLLLKRRGLFQSDAALTTSSTTKSYINKLVKGSLEEFNAEFAK  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+GRI+VKTGS GEIRKQCA VN
Sbjct  303  AMEKMGRIEVKTGSAGEIRKQCAFVN  328



>ref|XP_002515748.1| Peroxidase 39 precursor, putative [Ricinus communis]
 gb|EEF46695.1| Peroxidase 39 precursor, putative [Ricinus communis]
Length=327

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            +EMDPGS KTFDLSYY L+LKRRGLFESDAAL TN  T SFI+++ +GSLQDF+AEFA S
Sbjct  243  IEMDPGSRKTFDLSYYSLLLKRRGLFESDAALTTNSVTLSFINQILKGSLQDFFAEFANS  302

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTGSDGEIRK CAVVN
Sbjct  303  MEKMGRINVKTGSDGEIRKHCAVVN  327



>ref|XP_004240142.1| PREDICTED: peroxidase 3-like [Solanum lycopersicum]
Length=327

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSFKTFDLSYYKL+LKRRGLF+SDAAL T+ TTK +ID+L  GSL++FY +FA 
Sbjct  241  IVEMDPGSFKTFDLSYYKLLLKRRGLFQSDAALTTSTTTKRYIDQLVAGSLKEFYVKFAQ  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VKTGS GEIRK CAVVN
Sbjct  301  SMEKMGRIEVKTGSTGEIRKHCAVVN  326



>ref|XP_009604384.1| PREDICTED: peroxidase 3-like [Nicotiana tomentosiformis]
 ref|XP_009604391.1| PREDICTED: peroxidase 3-like [Nicotiana tomentosiformis]
Length=329

 Score =   140 bits (352),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSFKTFDLSYYKL+LKRRGLF+SDAAL    TTKSFI+ L +GSL++FY+EFA 
Sbjct  243  IVEMDPGSFKTFDLSYYKLLLKRRGLFQSDAALTKRTTTKSFIEHLVEGSLKEFYSEFAK  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+GR++VKTGS GEIRKQCA VN
Sbjct  303  AMEKMGRVEVKTGSAGEIRKQCAFVN  328



>ref|XP_011003206.1| PREDICTED: peroxidase 3-like [Populus euphratica]
Length=327

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY+ +LKRRGLF+SD+AL TN TT SF+++L QG LQ+F+AEFA 
Sbjct  241  IVEMDPGSFRTFDLSYYRHLLKRRGLFQSDSALTTNSTTLSFVNQLLQGPLQNFFAEFAN  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTG+ GEIRK CAVVN
Sbjct  301  SMEKMGRINVKTGTTGEIRKHCAVVN  326



>ref|XP_009603962.1| PREDICTED: peroxidase 3-like [Nicotiana tomentosiformis]
Length=331

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSY+KL+LKRRGLF+SDAAL T+ TTK +I++L QGSL+ FYAEFA 
Sbjct  245  IVEMDPGSFRTFDLSYFKLLLKRRGLFQSDAALTTSATTKLYINQLVQGSLKQFYAEFAQ  304

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+ RI+VKTGS GEIRKQCAVVN
Sbjct  305  AMEKMSRIEVKTGSAGEIRKQCAVVN  330



>ref|XP_006372956.1| hypothetical protein POPTR_0017s06550g [Populus trichocarpa]
 gb|ERP50753.1| hypothetical protein POPTR_0017s06550g [Populus trichocarpa]
Length=294

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY  +LKRRGLF+SD+AL TN TT SF+++L QGSL++F+AEFA 
Sbjct  208  IVEMDPGSFRTFDLSYYGHLLKRRGLFQSDSALTTNSTTLSFVNQLLQGSLENFFAEFAD  267

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTG+ GEIRKQCAVVN
Sbjct  268  SMEKMGRINVKTGTVGEIRKQCAVVN  293



>gb|AHL39150.1| class III peroxidase [Populus trichocarpa]
Length=327

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY L+LKRRGLF+SD+AL TN  T SF+++L QG LQ+F+AEFA 
Sbjct  241  IVEMDPGSFRTFDLSYYSLLLKRRGLFQSDSALTTNSATLSFVNQLLQGPLQNFFAEFAN  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTG+ GEIRK CAVVN
Sbjct  301  SMEKMGRINVKTGTTGEIRKHCAVVN  326



>ref|XP_002309832.1| peroxidase precursor family protein [Populus trichocarpa]
 gb|EEE90282.1| peroxidase precursor family protein [Populus trichocarpa]
Length=327

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY L+LKRRGLF+SD+AL TN  T SF+++L QG LQ+F+AEFA 
Sbjct  241  IVEMDPGSFRTFDLSYYSLLLKRRGLFQSDSALTTNSATLSFVNQLLQGPLQNFFAEFAN  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTG+ GEIRK CAVVN
Sbjct  301  SMEKMGRINVKTGTTGEIRKHCAVVN  326



>emb|CDP11801.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY+L+LKRRGLF+SDAAL+T+ TT S+I++L QGSL +FY EFA 
Sbjct  244  IVEMDPGSFRTFDLSYYRLLLKRRGLFQSDAALITSSTTLSYINQLLQGSLLNFYQEFAL  303

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VKTGS GEIRK CA VN
Sbjct  304  SMEKMGRIEVKTGSSGEIRKHCAFVN  329



>emb|CDP20342.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY+L+LKRRGLF+SDAAL T+ TT S+I++L QGS QDFY EFA 
Sbjct  243  IVEMDPGSFRTFDLSYYRLLLKRRGLFQSDAALTTSSTTLSYINELLQGSRQDFYKEFAL  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS GEIRK CA VN
Sbjct  303  SMEKMGRIDVKTGSSGEIRKHCAFVN  328



>ref|XP_006372957.1| hypothetical protein POPTR_0017s06550g [Populus trichocarpa]
 gb|ERP50754.1| hypothetical protein POPTR_0017s06550g [Populus trichocarpa]
 gb|AHL39190.1| class III peroxidase [Populus trichocarpa]
Length=328

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY  +LKRRGLF+SD+AL TN TT SF+++L QGSL++F+AEFA 
Sbjct  242  IVEMDPGSFRTFDLSYYGHLLKRRGLFQSDSALTTNSTTLSFVNQLLQGSLENFFAEFAD  301

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTG+ GEIRKQCAVVN
Sbjct  302  SMEKMGRINVKTGTVGEIRKQCAVVN  327



>gb|ABK93918.1| unknown [Populus trichocarpa]
Length=328

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY  +LKRRGLF+SD+AL TN TT SF+++L QGSL++F+AEFA 
Sbjct  242  IVEMDPGSFRTFDLSYYGHLLKRRGLFQSDSALTTNSTTLSFVNQLLQGSLENFFAEFAD  301

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTG+ GEIRKQCAVVN
Sbjct  302  SMEKMGRINVKTGTVGEIRKQCAVVN  327



>ref|XP_006367288.1| PREDICTED: peroxidase 3-like [Solanum tuberosum]
Length=329

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYYKL+LKRRGLF+SDAAL T+ TTKSFI++L +GSL++F  EFA 
Sbjct  243  IVEMDPGSFRTFDLSYYKLLLKRRGLFQSDAALTTSATTKSFINQLVKGSLEEFNTEFAK  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+G+I+VKTGS GEIRKQCA VN
Sbjct  303  AMEKMGKIEVKTGSAGEIRKQCAFVN  328



>ref|XP_004243835.1| PREDICTED: peroxidase 3-like [Solanum lycopersicum]
Length=329

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYYKL+ KRRGLF+SDAAL T+ TTKS+I++L +GSL++F AEFA 
Sbjct  243  IVEMDPGSFRTFDLSYYKLLFKRRGLFQSDAALTTSSTTKSYINQLVKGSLEEFNAEFAK  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+GRI+VKTGS GEIRKQCA VN
Sbjct  303  AMEKMGRIEVKTGSFGEIRKQCAFVN  328



>ref|XP_011037006.1| PREDICTED: peroxidase 3-like [Populus euphratica]
Length=328

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY+ +LKRRGLF+SD+AL TN TT S +++L QGSL++F+AEFA 
Sbjct  242  IVEMDPGSFRTFDLSYYRHLLKRRGLFQSDSALTTNSTTLSLVNQLLQGSLENFFAEFAD  301

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTG+ GEIRKQCAVVN
Sbjct  302  SMEKMGRINVKTGTVGEIRKQCAVVN  327



>ref|XP_006367289.1| PREDICTED: peroxidase 3-like [Solanum tuberosum]
Length=404

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYYKL+LKRRGLF+SDAAL T+ TTKSFI++L +GSL++F  EFA 
Sbjct  318  IVEMDPGSFRTFDLSYYKLLLKRRGLFQSDAALTTSATTKSFINQLVKGSLEEFNTEFAK  377

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+GRI VKTGS GEIRKQCA VN
Sbjct  378  AMEKMGRIGVKTGSAGEIRKQCAFVN  403



>ref|XP_010267773.1| PREDICTED: peroxidase 3 [Nelumbo nucifera]
Length=325

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY+L+LKRRGLF+SD+AL TN TT SFI++L QG+L++FY EFA 
Sbjct  239  IVEMDPGSFRTFDLSYYRLLLKRRGLFQSDSALTTNSTTLSFINQLVQGTLENFYTEFAK  298

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+G++ VKTGS GEIRKQC  VN
Sbjct  299  SMEKMGQVDVKTGSSGEIRKQCWKVN  324



>gb|KDP25860.1| hypothetical protein JCGZ_22890 [Jatropha curcas]
Length=330

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS KTFDLSYY L+LKRRGLF SDAAL TN  T S I++L +GSL+DF+AEFA+S
Sbjct  245  VEMDPGSRKTFDLSYYSLLLKRRGLFNSDAALTTNSVTLSKINQLLKGSLEDFFAEFASS  304

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTGSDGEIRK+CAVVN
Sbjct  305  IEKMGRINVKTGSDGEIRKRCAVVN  329



>ref|XP_002280274.1| PREDICTED: peroxidase 3 [Vitis vinifera]
Length=326

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY L+LKRRGLFESDAAL TN  TK+FI ++ QG L  F AEFA 
Sbjct  240  IVEMDPGSFRTFDLSYYTLLLKRRGLFESDAALTTNSGTKAFITQILQGPLSSFLAEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VKTG+ GE+RKQCAV+N
Sbjct  300  SMEKMGRIEVKTGTAGEVRKQCAVIN  325



>ref|XP_010240937.1| PREDICTED: peroxidase 3-like [Nelumbo nucifera]
Length=327

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYYKL+LKRRGLF SD+AL T+ T++SFI++L QG+L++FY EFA 
Sbjct  241  IVEMDPGSFRTFDLSYYKLLLKRRGLFVSDSALTTDSTSRSFINQLLQGTLENFYTEFAK  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+G+I VKTGS GEIRK C+VVN
Sbjct  301  SMEKMGQIDVKTGSSGEIRKHCSVVN  326



>ref|XP_009615423.1| PREDICTED: peroxidase 3-like [Nicotiana tomentosiformis]
Length=356

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS +TFDLSYYKL+LKRRGLF+SDAAL T+ TTKS++++L +GSL++FY EFA +
Sbjct  271  VEMDPGSIRTFDLSYYKLLLKRRGLFQSDAALTTSTTTKSYVNQLVEGSLKEFYTEFAQA  330

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI+VKTGS GEIRK CA VN
Sbjct  331  MEKMGRIEVKTGSAGEIRKHCAAVN  355



>ref|XP_010522326.1| PREDICTED: peroxidase 3 [Tarenaya hassleriana]
Length=330

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY LVLKRRGLF+SD+AL TNPTT S I+ L QG+LQ+FY EFA 
Sbjct  244  IVEMDPGSRKTFDLSYYTLVLKRRGLFQSDSALTTNPTTLSAINGLVQGTLQNFYTEFAN  303

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS G +R+QC V N
Sbjct  304  SMEKMGRINVKTGSAGVVRRQCGVAN  329



>gb|AEX20394.1| putative class III peroxidase [Coffea arabica x Coffea canephora]
Length=266

 Score =   133 bits (335),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY+L+LKRRGLF+SDAAL+T+ TT S+I++L QGSL +FY EFA 
Sbjct  180  IVEMDPGSFRTFDLSYYRLLLKRRGLFQSDAALITSSTTLSYINQLLQGSLLNFYQEFAL  239

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VKTG  GEIRK CA VN
Sbjct  240  SMEKMGRIEVKTGFFGEIRKHCAFVN  265



>ref|XP_004243525.1| PREDICTED: peroxidase 3-like [Solanum lycopersicum]
Length=331

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS   FDLSY++LVLKRRGLF+SDAAL T+ TTKSFI++L QGSL+ FYAEF  
Sbjct  245  IVEMDPGSSSKFDLSYFQLVLKRRGLFQSDAALTTSATTKSFINQLVQGSLEQFYAEFGV  304

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+G+I+VKTGS GEIRK CAVVN
Sbjct  305  AMEKMGKIEVKTGSAGEIRKHCAVVN  330



>ref|XP_009353255.1| PREDICTED: peroxidase 3 [Pyrus x bretschneideri]
Length=326

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFD SYY L+LKRRGLFESDAAL T+ TT ++I++L +GSLQ+FY EF  
Sbjct  240  IVEMDPGSFRTFDRSYYTLLLKRRGLFESDAALTTSSTTLNYINRLLKGSLQNFYDEFGK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS GEIRKQC+VVN
Sbjct  300  SMEKMGRINVKTGSAGEIRKQCSVVN  325



>ref|XP_010109530.1| Peroxidase 3 [Morus notabilis]
 gb|EXC23134.1| Peroxidase 3 [Morus notabilis]
Length=587

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY L+LKRRGLF+SD+AL TN  TKS+I +L QGSL ++++EFA 
Sbjct  501  IVEMDPGSRKTFDLSYYTLLLKRRGLFQSDSALTTNSVTKSYIKQLLQGSLSNYFSEFAK  560

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+GR +VKTGSDGEIRKQCAVVN
Sbjct  561  AMEKMGRTKVKTGSDGEIRKQCAVVN  586


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -2

Query  442  KRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATSVEKLGRIQVKTGSDG  278
            +RRGL +SDAALL +P TK++++  A      F  +FA S+  +G+I V TG  G
Sbjct  220  RRRGLLQSDAALLDDPETKAYVELQATTHGSTFAQDFAESMVNMGKIGVLTGKAG  274



>ref|XP_007215666.1| hypothetical protein PRUPE_ppa008540mg [Prunus persica]
 gb|EMJ16865.1| hypothetical protein PRUPE_ppa008540mg [Prunus persica]
Length=327

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS +TFDLSYY L+LKRRGLF+SDAAL T+ TT ++I++L +G LQ+FY EFA 
Sbjct  241  IVEMDPGSHRTFDLSYYTLLLKRRGLFQSDAALTTSSTTLNYINQLLKGPLQNFYDEFAK  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GR+ VKTGS GEIRKQCAVVN
Sbjct  301  SMEKMGRVNVKTGSAGEIRKQCAVVN  326



>ref|XP_011100296.1| PREDICTED: peroxidase 3-like [Sesamum indicum]
Length=327

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY LVLKRRGLF+SDAALLT+  T+S I +L +G + +FY EFA 
Sbjct  242  IVEMDPGSFRTFDLSYYTLVLKRRGLFQSDAALLTDSRTRSMITQLVEGPVGNFYREFAK  301

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS GEIRK CAVVN
Sbjct  302  SMEKMGRIGVKTGSAGEIRKHCAVVN  327



>ref|XP_008230094.1| PREDICTED: peroxidase 3 [Prunus mume]
Length=327

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS +TFDLSYY L+LKRRGLF+SDAAL T+ TT ++I++L +G LQ+FY EFA 
Sbjct  241  IVEMDPGSHRTFDLSYYTLLLKRRGLFQSDAALTTSSTTLNYINQLLKGPLQNFYDEFAK  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GR+ VKTGS GEIRKQCAVVN
Sbjct  301  SMEKMGRVNVKTGSAGEIRKQCAVVN  326



>ref|NP_001289850.1| peroxidase 3 precursor [Solanum lycopersicum]
 gb|AAA65637.1| peroxidase [Solanum lycopersicum]
Length=328

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSFKTFDLSY+KL+LKRRGLF+SDAAL T  +TKSFI++L  G L +F+ EFA 
Sbjct  242  IVEMDPGSFKTFDLSYFKLLLKRRGLFQSDAALTTRTSTKSFIEQLVDGPLNEFFDEFAK  301

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GR++VKTGS GEIRK CA VN
Sbjct  302  SMEKMGRVEVKTGSAGEIRKHCAFVN  327



>ref|XP_004240140.1| PREDICTED: peroxidase 3 [Solanum lycopersicum]
Length=327

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYYKL+LKRRGLF+SDAAL T+ TTK++I++L  GSL++FYAEFA 
Sbjct  241  IVEMDPGSFRTFDLSYYKLLLKRRGLFQSDAALTTSTTTKTYIEQLVAGSLKEFYAEFAQ  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VKT SDGEIRK CAVVN
Sbjct  301  SMEKMGRIEVKTRSDGEIRKHCAVVN  326



>ref|XP_004240141.1| PREDICTED: peroxidase 3-like [Solanum lycopersicum]
Length=327

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYYKL+LKRRGLF+SDAAL T+ TTK++I++L  GSL++FYAEFA 
Sbjct  241  IVEMDPGSFRTFDLSYYKLLLKRRGLFQSDAALTTSTTTKTYIEQLVAGSLKEFYAEFAQ  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VKT SDGEIRK CAVVN
Sbjct  301  SMEKMGRIEVKTRSDGEIRKHCAVVN  326



>ref|XP_009342265.1| PREDICTED: peroxidase 3-like [Pyrus x bretschneideri]
Length=325

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFD SYY  +LKRR LF+SDAAL T+PTT ++ID+L +GSLQ+FY EF  
Sbjct  239  IVEMDPGSFRTFDRSYYTHILKRRALFQSDAALATSPTTYNYIDQLLEGSLQNFYDEFGK  298

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GR  VKTGS GEIRKQC+VVN
Sbjct  299  SMEKMGRANVKTGSAGEIRKQCSVVN  324



>ref|XP_008379618.1| PREDICTED: peroxidase 3 [Malus domestica]
Length=326

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS +TFDLSYY L+LKRRGLFESDAAL ++ TT ++I++L +GSLQ+FY EF  
Sbjct  240  IVEMDPGSVRTFDLSYYTLLLKRRGLFESDAALTSSSTTLNYINQLLKGSLQNFYDEFGK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS GEIRKQC+VVN
Sbjct  300  SMEKMGRINVKTGSAGEIRKQCSVVN  325



>gb|KDP25855.1| hypothetical protein JCGZ_22885 [Jatropha curcas]
Length=323

 Score =   132 bits (332),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY  +LKRRGLF+SD+AL TN  T + I++L  GSLQ+FYAEFAT
Sbjct  237  IVEMDPGSRKTFDLSYYSNLLKRRGLFQSDSALTTNSATLATINQLLSGSLQNFYAEFAT  296

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS GEIRK CAVVN
Sbjct  297  SMEKMGRINVKTGSTGEIRKICAVVN  322



>gb|KHN25777.1| Peroxidase 3 [Glycine soja]
Length=265

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            +EMDPGS KTFDLSYY  V+KRRGLFESDAALLTN  TK+ I +L +GS+++F+AEFATS
Sbjct  180  IEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIELLEGSVENFFAEFATS  239

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTG++GEIRK CA VN
Sbjct  240  MEKMGRINVKTGTEGEIRKHCAFVN  264



>ref|XP_009624291.1| PREDICTED: peroxidase 3-like [Nicotiana tomentosiformis]
Length=333

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS  TFDLSY+KL+LKR+GLF+SDAAL T+ TTKS+I+KL QGSL+ F AEFA 
Sbjct  245  IVEMDPGSSSTFDLSYFKLLLKRKGLFQSDAALTTSATTKSYINKLVQGSLKQFNAEFAK  304

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+G I+VKTGS GEIRKQCA VN
Sbjct  305  AMEKMGSIEVKTGSAGEIRKQCAFVN  330



>ref|XP_006594890.1| PREDICTED: peroxidase 3 [Glycine max]
 gb|KHN36549.1| Peroxidase 3 [Glycine soja]
Length=324

 Score =   132 bits (331),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            +EMDPGS KTFDLSYY  V+KRRGLFESDAALLTN  TK+ I +L +GS+++F+AEFATS
Sbjct  239  IEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIQLLEGSVENFFAEFATS  298

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTG++GEIRK CA +N
Sbjct  299  IEKMGRINVKTGTEGEIRKHCAFIN  323



>gb|ACU24335.1| unknown [Glycine max]
Length=324

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            +EMDPGS KTFDLSYY  V+KRRGLFESDAALLTN  TK+ I +L +GS+++F+AEFATS
Sbjct  239  IEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIQLLEGSVENFFAEFATS  298

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTG++GEIRK CA +N
Sbjct  299  IEKMGRINVKTGTEGEIRKHCAFIN  323



>ref|XP_006367274.1| PREDICTED: peroxidase 3-like [Solanum tuberosum]
Length=328

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSFKTFDLSY+KL+LKRRGLF+SDAAL T  +TKSFI++L  G L++F+ EF  
Sbjct  242  IVEMDPGSFKTFDLSYFKLLLKRRGLFQSDAALTTRTSTKSFIEQLVDGPLKEFFDEFGK  301

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GR++VKTGS GEIRK CA VN
Sbjct  302  SMEKMGRVEVKTGSAGEIRKHCAFVN  327



>ref|XP_011037007.1| PREDICTED: peroxidase 3-like [Populus euphratica]
Length=325

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 1/86 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYYKL+LKRRGLF+SDAAL TNP T S I +L +GSL DF +EF+ 
Sbjct  240  IVEMDPGSRKTFDLSYYKLLLKRRGLFQSDAALTTNPNTLSMIRQLLEGSL-DFRSEFSK  298

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VKTGS+GEIR+QCA+VN
Sbjct  299  SMEKMGRIRVKTGSNGEIRRQCALVN  324



>gb|KHN25776.1| Peroxidase 39 [Glycine soja]
Length=265

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            +EMDPGS KTFDLSYY  V+KRRGLFESDAALLTN  TK+ I +L +GS++ F+AEFATS
Sbjct  180  IEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIELLEGSVEKFFAEFATS  239

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI+VKTG++GEIRK CA VN
Sbjct  240  IEKMGRIKVKTGTEGEIRKHCAFVN  264



>ref|XP_009620797.1| PREDICTED: peroxidase 3-like [Nicotiana tomentosiformis]
Length=333

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS  TFDLSY+KL+LKR+GLF+SDAAL T+ TTKS+I+KL QGSL+ F AEFA 
Sbjct  245  IVEMDPGSSSTFDLSYFKLLLKRKGLFQSDAALTTSATTKSYINKLVQGSLKQFNAEFAK  304

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+G I+VKTGS GEIRKQCA VN
Sbjct  305  AMEKMGSIEVKTGSAGEIRKQCAFVN  330



>ref|XP_006305430.1| hypothetical protein CARUB_v10009829mg [Capsella rubella]
 gb|EOA38328.1| hypothetical protein CARUB_v10009829mg [Capsella rubella]
Length=309

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY+LVLKRRGLF+SD+AL TNPTT S I+++  GS++ FY+EFA 
Sbjct  223  IVEMDPGSRKTFDLSYYQLVLKRRGLFQSDSALTTNPTTLSNINRILTGSVESFYSEFAK  282

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS G +R+QC+V N
Sbjct  283  SMEKMGRINVKTGSAGVVRRQCSVAN  308



>gb|AAD11482.1| peroxidase precursor, partial [Glycine max]
Length=351

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            +EMDPGS KTFDLSYY  V+KRRGLFESDAALLTN  TK+ I +L +GS+++F+AEFATS
Sbjct  266  IEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIQLLEGSVENFFAEFATS  325

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTG++GEIRK CA +N
Sbjct  326  IEKMGRINVKTGTEGEIRKHCAFIN  350



>ref|XP_009597503.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 3-like, partial [Nicotiana 
tomentosiformis]
Length=193

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS  TFDLSY+KL+LKR+GLF+SD AL T  TTKS+ID+L QGSL+ F AEF  
Sbjct  107  IVEMDPGSSSTFDLSYFKLLLKRKGLFQSDVALTTXATTKSYIDQLVQGSLKQFNAEFVK  166

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+G I+VKTGS GEIRKQCA VN
Sbjct  167  AMEKMGSIEVKTGSAGEIRKQCAFVN  192



>ref|XP_003540316.1| PREDICTED: peroxidase 3 [Glycine max]
Length=326

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            +EMDPGS KTFDLSYY  V+KRRGLFESDAALLTN  TK+ I +L +GS+++F+AEFATS
Sbjct  241  IEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIELLEGSVENFFAEFATS  300

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTG++GEIRK CA VN
Sbjct  301  MEKMGRINVKTGTEGEIRKHCAFVN  325



>ref|XP_009802836.1| PREDICTED: peroxidase 3-like [Nicotiana sylvestris]
Length=331

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS +TFDLSY+KL+LKR+GLF+SDAAL T+ TTKS+I++L QGSL+ F AEFA 
Sbjct  245  IVEMDPGSSRTFDLSYFKLLLKRKGLFQSDAALTTSATTKSYINQLVQGSLKQFNAEFAK  304

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+G I+VKTGS GEIRKQCA VN
Sbjct  305  AMEKMGSIEVKTGSAGEIRKQCAFVN  330



>ref|XP_008353582.1| PREDICTED: peroxidase 3-like [Malus domestica]
Length=156

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
             VEMDPGSF+TFDLSYY  +LKRRGLF+SDAAL T+PT  ++I++L +G LQ+F+ EF  
Sbjct  70   FVEMDPGSFRTFDLSYYTHLLKRRGLFQSDAALKTSPTAYNYINQLLKGPLQNFFYEFGK  129

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GR  VKTGS GEIRKQC+VVN
Sbjct  130  SMEKMGRANVKTGSAGEIRKQCSVVN  155



>ref|XP_009787132.1| PREDICTED: peroxidase 3-like [Nicotiana sylvestris]
Length=329

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS +TFDLSYYKL+LKRRGLF+SDAAL T   TKS++++L  GS ++FY EFA +
Sbjct  244  VEMDPGSSRTFDLSYYKLLLKRRGLFQSDAALTTTTITKSYVNQLVDGSFKEFYTEFAQA  303

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI+VKTGS GEIRK CAVVN
Sbjct  304  MEKMGRIEVKTGSAGEIRKHCAVVN  328



>ref|XP_003540317.1| PREDICTED: peroxidase 39-like [Glycine max]
Length=326

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            +EMDPGS KTFDLSYY  V+KRRGLFESDAALLTN  TK+ I +L +GS++ F+AEFATS
Sbjct  241  IEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIELLEGSVEKFFAEFATS  300

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI+VKTG++GEIRK CA VN
Sbjct  301  IEKMGRIKVKTGTEGEIRKHCAFVN  325



>ref|XP_009118603.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 3-like [Brassica rapa]
 emb|CDY59800.1| BnaAnng16310D [Brassica napus]
Length=326

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY+LVLKRRGLF+SD+AL TNPTT S I++L +GS++ F++EFA 
Sbjct  240  IVEMDPGSRKTFDLSYYQLVLKRRGLFQSDSALTTNPTTLSNINQLLKGSVESFFSEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS G +R+QC+V N
Sbjct  300  SMEKMGRINVKTGSAGVVRRQCSVAN  325



>ref|XP_009624293.1| PREDICTED: peroxidase 3-like [Nicotiana tomentosiformis]
Length=331

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS  TFDLSY+KL+LKR+GLF+SDAAL T+ TTKS+I++L QGSL+ F AEFA 
Sbjct  245  IVEMDPGSSSTFDLSYFKLLLKRKGLFQSDAALTTSATTKSYINQLVQGSLKQFNAEFAK  304

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+G I+VKTGS GEIRKQCA VN
Sbjct  305  AMEKMGSIEVKTGSAGEIRKQCAFVN  330



>emb|CDY10037.1| BnaC08g44140D [Brassica napus]
Length=326

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY+LVLKRRGLF+SD+AL TNPTT S I++L +GS++ F++EFA 
Sbjct  240  IVEMDPGSRKTFDLSYYQLVLKRRGLFQSDSALTTNPTTLSNINQLLKGSVESFFSEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS G +R+QC+V N
Sbjct  300  SMEKMGRINVKTGSAGVVRRQCSVAN  325



>ref|XP_006594891.1| PREDICTED: peroxidase 39-like [Glycine max]
Length=326

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            +EMDPGS KTFDLSYY  V+KRRGLFESDAALLTN  TKS I +L +G++++F AEFATS
Sbjct  241  IEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKSQIIQLLEGTVENFSAEFATS  300

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTG++GEIRK CA VN
Sbjct  301  IEKMGRINVKTGTEGEIRKHCAFVN  325



>ref|XP_006356922.1| PREDICTED: peroxidase 3-like [Solanum tuberosum]
Length=327

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSFKTFDLSYYKL+LKRRGLF+SDAAL T+ TTK++I++L  GSL++FY EFA 
Sbjct  241  IVEMDPGSFKTFDLSYYKLLLKRRGLFQSDAALTTSTTTKTYINQLVAGSLKEFYVEFAQ  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VK GS GEIRK CAVVN
Sbjct  301  SMEKMGRIEVKAGSTGEIRKNCAVVN  326



>gb|KHN36550.1| Peroxidase 39 [Glycine soja]
Length=326

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            +EMDPGS KTFDLSYY  V+KRRGLFESDAALLTN  TKS I +L +G++++F AEFATS
Sbjct  241  IEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKSQIIQLLEGTVENFSAEFATS  300

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTG++GEIRK CA VN
Sbjct  301  IEKMGRINVKTGTEGEIRKHCAFVN  325



>ref|XP_010484852.1| PREDICTED: peroxidase 3-like [Camelina sativa]
Length=326

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY+LVLKRRGLF+SD+AL TNPTT S I+++  GS++ F++EFA 
Sbjct  240  IVEMDPGSRKTFDLSYYQLVLKRRGLFQSDSALTTNPTTLSNINRILTGSVESFFSEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS G IR+QC+V N
Sbjct  300  SMEKMGRINVKTGSAGVIRRQCSVAN  325



>ref|XP_006357954.1| PREDICTED: peroxidase 3-like [Solanum tuberosum]
Length=331

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS   FDLSY++LVLKR+GLF+SDAAL T+ TTKSFI++L +GSL+ FYAEF  
Sbjct  245  IVEMDPGSSSKFDLSYFQLVLKRKGLFQSDAALTTSATTKSFINELVKGSLKQFYAEFGV  304

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+G+I+VKTGS GEIRK CA VN
Sbjct  305  AMEKMGKIEVKTGSAGEIRKHCAAVN  330



>gb|AAT72298.1| CBRCI35 [Capsella bursa-pastoris]
Length=326

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY+LVLKRRGLF+SD+AL TNPTT S I+++  GS++ F++EFA 
Sbjct  240  IVEMDPGSRKTFDLSYYQLVLKRRGLFQSDSALTTNPTTLSNINRILTGSVESFFSEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS G +R+QC+V N
Sbjct  300  SMEKMGRINVKTGSAGVVRRQCSVAN  325



>ref|XP_010475209.1| PREDICTED: peroxidase 3 [Camelina sativa]
Length=326

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY+LVLKRRGLF+SD+AL TNPTT S I+++  GS++ F++EFA 
Sbjct  240  IVEMDPGSRKTFDLSYYQLVLKRRGLFQSDSALTTNPTTLSNINRILTGSVESFFSEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS G +R+QC+V N
Sbjct  300  SMEKMGRINVKTGSAGVVRRQCSVAN  325



>gb|AAD11481.1| peroxidase precursor, partial [Glycine max]
Length=352

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            +EMDPGS KTFDLSYY  V+KRRGLFESDAALLTN  TK+ I +L +GS+++F+AEFATS
Sbjct  267  IEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIELLEGSVENFFAEFATS  326

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTG++GEIRK CA +N
Sbjct  327  MEKMGRINVKTGTEGEIRKHCAFLN  351



>ref|XP_002889542.1| CBRCI35 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65801.1| CBRCI35 [Arabidopsis lyrata subsp. lyrata]
Length=326

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY+LVLKRRGLF+SD+AL TNPTT S I+++  GS++ F++EFA 
Sbjct  240  IVEMDPGSRKTFDLSYYQLVLKRRGLFQSDSALTTNPTTLSNINRILTGSVESFFSEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS G +R+QC+V N
Sbjct  300  SMEKMGRINVKTGSAGVVRRQCSVAN  325



>ref|XP_010457608.1| PREDICTED: peroxidase 3-like [Camelina sativa]
Length=326

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY+LVLKRRGLF+SD+AL TNPTT S I+++  GS++ F++EFA 
Sbjct  240  IVEMDPGSRKTFDLSYYQLVLKRRGLFQSDSALTTNPTTLSNINRILTGSVESFFSEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS G +R+QC+V N
Sbjct  300  SMEKMGRINVKTGSAGVVRRQCSVAN  325



>emb|CDY46845.1| BnaA10g03290D [Brassica napus]
Length=326

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY+L+LKRRGLF+SD+AL TNPTT S I+++ +GS++ F++EFA 
Sbjct  240  IVEMDPGSRKTFDLSYYQLLLKRRGLFQSDSALTTNPTTLSNINQILKGSVEGFFSEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS G +RKQC+V N
Sbjct  300  SMEKMGRINVKTGSSGVVRKQCSVAN  325



>ref|XP_007149959.1| hypothetical protein PHAVU_005G113800g [Phaseolus vulgaris]
 gb|ESW21953.1| hypothetical protein PHAVU_005G113800g [Phaseolus vulgaris]
Length=324

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            +EMDPGS KTFDL YY+ V+KRRGLFESDAALL N  TKS I +L QGS+++F+AEFA S
Sbjct  239  IEMDPGSRKTFDLDYYRQVIKRRGLFESDAALLNNEVTKSQIIELLQGSIENFFAEFADS  298

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI+VKTG++GEIRK CA VN
Sbjct  299  IEKMGRIKVKTGTEGEIRKHCAFVN  323



>gb|EYU24801.1| hypothetical protein MIMGU_mgv1a009942mg [Erythranthe guttata]
Length=327

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGSF+TFDLSYYKLVLKRRGLFESDAAL TN  T S I+++  G  + F+ EFA S
Sbjct  243  VEMDPGSFRTFDLSYYKLVLKRRGLFESDAALTTNSITSSIINQIVNGDSKIFFKEFANS  302

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTGS GEIRK CA+VN
Sbjct  303  MEKMGRIGVKTGSVGEIRKHCALVN  327



>ref|XP_006357953.1| PREDICTED: peroxidase 3-like [Solanum tuberosum]
Length=331

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS   FDLSY++LVLKR+GLF+SDAAL T+ TTKSFI++L QGSL+ FY EF  
Sbjct  245  IVEMDPGSSSKFDLSYFQLVLKRKGLFQSDAALTTSATTKSFINELVQGSLKQFYVEFGL  304

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+G+I+VKTGS GEIRK CA VN
Sbjct  305  AMEKMGKIEVKTGSAGEIRKHCAAVN  330



>ref|XP_009119172.1| PREDICTED: peroxidase 3-like [Brassica rapa]
Length=326

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY+L+LKRRGLF+SD+AL TNPTT S I+++ +GS+  F++EFA 
Sbjct  240  IVEMDPGSRKTFDLSYYQLLLKRRGLFQSDSALTTNPTTLSNINQILKGSVAGFFSEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS G +RKQC+V N
Sbjct  300  SMEKMGRINVKTGSSGVVRKQCSVAN  325



>ref|XP_004287925.1| PREDICTED: peroxidase 3-like [Fragaria vesca subsp. vesca]
Length=326

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS +TFDLSYY L+LKRRGLF+SD+AL  + TT ++I +L QGS  +F+AEFA 
Sbjct  240  IVEMDPGSHRTFDLSYYALLLKRRGLFQSDSALTKSSTTYNYIKQLIQGSSPNFHAEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS GEIRK CAVVN
Sbjct  300  SMEKMGRINVKTGSSGEIRKHCAVVN  325



>ref|XP_006372959.1| hypothetical protein POPTR_0017s06570g [Populus trichocarpa]
 gb|ERP50756.1| hypothetical protein POPTR_0017s06570g [Populus trichocarpa]
Length=321

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYYKL+LKRRGLF+SDAAL TN  T S I ++ QGS+ DF +EF+ 
Sbjct  236  IVEMDPGSRKTFDLSYYKLLLKRRGLFQSDAALTTNSNTLSMIRQILQGSI-DFRSEFSK  294

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VKTGS+GEIR+QCA+VN
Sbjct  295  SMEKMGRIRVKTGSNGEIRRQCALVN  320



>ref|XP_009786925.1| PREDICTED: peroxidase 3-like [Nicotiana sylvestris]
Length=331

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS   FDLSY+KL+LKR+GLF+SDAAL T+ TTKS+I++L QGSL+ F AEFA 
Sbjct  245  IIEMDPGSSSAFDLSYFKLLLKRKGLFQSDAALTTSATTKSYINQLVQGSLKQFNAEFAK  304

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+G I+VKTGS GEIRKQCA VN
Sbjct  305  AMEKMGSIEVKTGSAGEIRKQCAFVN  330



>gb|AAM61240.1| putative peroxidase [Arabidopsis thaliana]
Length=326

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY+LVLKRRGLF+SD+AL TNPTT S I+++  GS+  F++EFA 
Sbjct  240  IVEMDPGSRKTFDLSYYQLVLKRRGLFQSDSALTTNPTTLSNINRILTGSVGSFFSEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS G +R+QC+V N
Sbjct  300  SMEKMGRINVKTGSAGVVRRQCSVAN  325



>ref|NP_172018.1| peroxidase 3 [Arabidopsis thaliana]
 sp|O23044.1|PER3_ARATH RecName: Full=Peroxidase 3; Short=Atperox P3; AltName: Full=ATPRC; 
AltName: Full=RCI3A; AltName: Full=Rare cold-inducible 
protein; Flags: Precursor [Arabidopsis thaliana]
 gb|AAB71452.1| Strong similarity to Arabidopsis peroxidase ATPEROX7A (gb|X98321) 
[Arabidopsis thaliana]
 gb|AAB94661.1| peroxidase precursor [Arabidopsis thaliana]
 gb|AAO44083.1| At1g05260 [Arabidopsis thaliana]
 dbj|BAE99836.1| putative peroxidase [Arabidopsis thaliana]
 gb|AEE27815.1| peroxidase 3 [Arabidopsis thaliana]
Length=326

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY+LVLKRRGLF+SD+AL TNPTT S I+++  GS+  F++EFA 
Sbjct  240  IVEMDPGSRKTFDLSYYQLVLKRRGLFQSDSALTTNPTTLSNINRILTGSVGSFFSEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS G +R+QC+V N
Sbjct  300  SMEKMGRINVKTGSAGVVRRQCSVAN  325



>ref|XP_008341978.1| PREDICTED: peroxidase 3-like [Malus domestica]
 ref|XP_008362256.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 3-like [Malus domestica]
Length=326

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS +TFDLSYY L+LKRRGLF+SDAAL T+ TT ++I +L +GSLQ+FY EF  
Sbjct  240  IVEMDPGSVRTFDLSYYTLLLKRRGLFQSDAALTTSSTTYNYIHQLLKGSLQNFYDEFGK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GR   KTGS GEIRKQC+VVN
Sbjct  300  SMEKMGRANXKTGSAGEIRKQCSVVN  325



>ref|XP_008804375.1| PREDICTED: peroxidase 3-like [Phoenix dactylifera]
Length=325

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDL YYK +LKRRGLF+SDAAL+TN  TK++I +L    L+ F+ EFA 
Sbjct  239  IVEMDPGSFRTFDLGYYKHLLKRRGLFQSDAALITNAATKAYIIQLVNNPLEVFFKEFAL  298

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VKTGS GEIRK CAVVN
Sbjct  299  SMEKMGRIEVKTGSLGEIRKNCAVVN  324



>gb|KFK42864.1| hypothetical protein AALP_AA1G049000 [Arabis alpina]
Length=326

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS  TFDLSYY+LVLKRRGLF+SD+AL TNPTT S I+++ +GS++ F++EFA 
Sbjct  240  IVEMDPGSRTTFDLSYYQLVLKRRGLFQSDSALTTNPTTLSNINQILKGSVESFFSEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS G +R+QC+V N
Sbjct  300  SMEKMGRINVKTGSAGVVRRQCSVAN  325



>gb|ACU19509.1| unknown [Glycine max]
Length=326

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            +EMDP S KTFDLSYY  V+KRRGLFESDAALLTN  TK+ I +L +GS+++F+AEFATS
Sbjct  241  IEMDPRSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIELLEGSVENFFAEFATS  300

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTG++GEIRK CA VN
Sbjct  301  MEKMGRINVKTGTEGEIRKHCAFVN  325



>ref|XP_006372960.1| hypothetical protein POPTR_0017s06570g [Populus trichocarpa]
 gb|ABK93506.1| unknown [Populus trichocarpa]
 gb|ERP50757.1| hypothetical protein POPTR_0017s06570g [Populus trichocarpa]
 gb|AHL39191.1| class III peroxidase [Populus trichocarpa]
Length=325

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYYKL+LKRRGLF+SDAAL TN  T S I ++ QGS+ DF +EF+ 
Sbjct  240  IVEMDPGSRKTFDLSYYKLLLKRRGLFQSDAALTTNSNTLSMIRQILQGSI-DFRSEFSK  298

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VKTGS+GEIR+QCA+VN
Sbjct  299  SMEKMGRIRVKTGSNGEIRRQCALVN  324



>ref|XP_009342252.1| PREDICTED: peroxidase 3 [Pyrus x bretschneideri]
Length=326

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS +TFDLSYY L+LKRRGLF+SDAAL T+ TT + I++L +GSLQ+FY +F  
Sbjct  240  IVEMDPGSVRTFDLSYYTLLLKRRGLFQSDAALTTSSTTYNHINQLLKGSLQNFYDKFGK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GR  VKTGS GEIRKQC+VVN
Sbjct  300  SMEKMGRANVKTGSAGEIRKQCSVVN  325



>ref|XP_006855828.1| hypothetical protein AMTR_s00037p00030970 [Amborella trichopoda]
 gb|ERN17295.1| hypothetical protein AMTR_s00037p00030970 [Amborella trichopoda]
Length=326

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY+LVLKRRGLF SDAAL+T+ T+KS ++ L  G+ +DF+ EFA 
Sbjct  240  IVEMDPGSFRTFDLSYYRLVLKRRGLFTSDAALITDSTSKSLVEDLTNGTPEDFFKEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ K+G I VKTGS GEIRK CA VN
Sbjct  300  SMVKMGEIDVKTGSSGEIRKHCAFVN  325



>ref|XP_008455840.1| PREDICTED: peroxidase 39-like [Cucumis melo]
Length=329

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSYY L+LKRRGLFESDAAL T+ TT   + KL +G +++F+AEFA S
Sbjct  243  VEMDPGSRNTFDLSYYSLLLKRRGLFESDAALTTDATTLGLVQKLVEGPIEEFFAEFAAS  302

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI+VKTG++GEIR++CAVVN
Sbjct  303  MEKMGRIKVKTGTEGEIRRKCAVVN  327



>ref|XP_002309833.1| hypothetical protein POPTR_0007s02590g [Populus trichocarpa]
 gb|EEE90283.1| hypothetical protein POPTR_0007s02590g [Populus trichocarpa]
Length=246

 Score =   125 bits (315),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSYY LVLKRRGLFESDA L TN    S I++L QGSL DFY+EFA S
Sbjct  162  VEMDPGSRNTFDLSYYALVLKRRGLFESDADLTTNSDALSMINQLLQGSL-DFYSEFAKS  220

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+G I VKTGS+GEIRKQCA+VN
Sbjct  221  MEKMGMINVKTGSNGEIRKQCALVN  245



>ref|XP_006357991.1| PREDICTED: peroxidase 3-like [Solanum tuberosum]
Length=305

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS   FDLSY++LVLK +GLF+SDAAL T+ TTKSFI++L QGSL+ FY EF  
Sbjct  219  IVEMDPGSSSKFDLSYFQLVLKGKGLFQSDAALTTSATTKSFINELVQGSLKQFYVEFGL  278

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+G+I+VKTGS GEIRK CA VN
Sbjct  279  AMEKMGKIEVKTGSAGEIRKHCAAVN  304



>gb|AES67274.2| peroxidase family protein [Medicago truncatula]
Length=326

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVE+DPGS  TFDL YY  V+KRRGLFESD+ALLTN  TK+ + +  QGSL++FYAEFA 
Sbjct  240  IVELDPGSRNTFDLGYYSQVVKRRGLFESDSALLTNSVTKALVTQFLQGSLENFYAEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+G+I+VKTGS G IRK CA+VN
Sbjct  300  SIEKMGQIKVKTGSQGVIRKHCALVN  325



>ref|XP_004151878.1| PREDICTED: peroxidase 39-like [Cucumis sativus]
 ref|XP_004158555.1| PREDICTED: peroxidase 39-like [Cucumis sativus]
Length=326

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSYY L+LKRRGLFESDAAL T+ TT   + KL +G +++F+AEFA S
Sbjct  241  VEMDPGSRNTFDLSYYSLLLKRRGLFESDAALTTDATTLGLVQKLVEGPIEEFFAEFAAS  300

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI+VKTG++GEIR++C VVN
Sbjct  301  MEKMGRIKVKTGTEGEIRRRCGVVN  325



>ref|XP_003597023.1| Peroxidase [Medicago truncatula]
Length=350

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVE+DPGS  TFDL YY  V+KRRGLFESD+ALLTN  TK+ + +  QGSL++FYAEFA 
Sbjct  264  IVELDPGSRNTFDLGYYSQVVKRRGLFESDSALLTNSVTKALVTQFLQGSLENFYAEFAK  323

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+G+I+VKTGS G IRK CA+VN
Sbjct  324  SIEKMGQIKVKTGSQGVIRKHCALVN  349



>gb|KGN63270.1| hypothetical protein Csa_2G421020 [Cucumis sativus]
Length=328

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSYY L+LKRRGLFESDAAL T+ TT   + KL +G +++F+AEFA S
Sbjct  243  VEMDPGSRNTFDLSYYSLLLKRRGLFESDAALTTDATTLGLVQKLVEGPIEEFFAEFAAS  302

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI+VKTG++GEIR++C VVN
Sbjct  303  MEKMGRIKVKTGTEGEIRRRCGVVN  327



>emb|CDY49518.1| BnaC05g03300D [Brassica napus]
Length=326

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS K FDLSYY+L+LKRRGLF+SD+AL TNPTT S I+++ +GS++ F+ EFA 
Sbjct  240  IVEMDPGSHKMFDLSYYQLLLKRRGLFQSDSALTTNPTTLSNINQILKGSVEGFFFEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS G +RKQC+V N
Sbjct  300  SMEKMGRINVKTGSAGVVRKQCSVAN  325



>ref|XP_006418047.1| hypothetical protein EUTSA_v10008189mg [Eutrema salsugineum]
 gb|ESQ36400.1| hypothetical protein EUTSA_v10008189mg [Eutrema salsugineum]
Length=326

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY+LVLKRRGLF+SD+AL TNPTT   I+++ +GS++ F++EFA 
Sbjct  240  IVEMDPGSRKTFDLSYYQLVLKRRGLFQSDSALTTNPTTLQNINQILKGSVESFFSEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI +KTGS G +R+QC++ N
Sbjct  300  SMEKMGRINLKTGSAGVVRRQCSIAN  325



>gb|AHL39151.1| class III peroxidase [Populus trichocarpa]
Length=324

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSYY LVLKRRGLFESDA L TN    S I++L QGSL DFY+EFA S
Sbjct  240  VEMDPGSRNTFDLSYYALVLKRRGLFESDADLTTNSDALSMINQLLQGSL-DFYSEFAKS  298

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+G I VKTGS+GEIRKQCA+VN
Sbjct  299  MEKMGMINVKTGSNGEIRKQCALVN  323



>ref|XP_002515749.1| Peroxidase 3 precursor, putative [Ricinus communis]
 gb|EEF46696.1| Peroxidase 3 precursor, putative [Ricinus communis]
Length=324

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY  +LKRRGLF+SD+AL T+  T S I++L  GSL++F+AEFA 
Sbjct  238  IVEMDPGSRKTFDLSYYSNLLKRRGLFQSDSALTTSSATLSTINQLLSGSLENFFAEFAA  297

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+G+I VKTGS GEIRKQCA VN
Sbjct  298  SIEKMGQINVKTGSAGEIRKQCAFVN  323



>ref|XP_006447516.1| hypothetical protein CICLE_v10015924mg [Citrus clementina]
 ref|XP_006469709.1| PREDICTED: peroxidase 30-like isoform X1 [Citrus sinensis]
 gb|ESR60756.1| hypothetical protein CICLE_v10015924mg [Citrus clementina]
Length=325

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            ++EMDPGS KTFDLSYY L+LKRRGLF SDA+L TN  T S + +L QGSL++F+AEFA 
Sbjct  240  LLEMDPGSRKTFDLSYYNLLLKRRGLFVSDASLTTNSFTLSLVKQLLQGSLENFFAEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            SVEK+GR +VKTGS+GEIRK+CA VN
Sbjct  300  SVEKMGRNKVKTGSEGEIRKRCAFVN  325



>gb|KDO59839.1| hypothetical protein CISIN_1g048664mg [Citrus sinensis]
Length=325

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            ++EMDPGS KTFDLSYY L+LKRRGLF SDA+L TN  T S + +L QGSL++F+AEFA 
Sbjct  240  LLEMDPGSRKTFDLSYYNLLLKRRGLFVSDASLTTNSFTLSLVKQLLQGSLENFFAEFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            SVEK+GR +VKTGS+GEIRK+CA VN
Sbjct  300  SVEKMGRNKVKTGSEGEIRKRCAFVN  325



>ref|NP_192868.1| peroxidase 39 [Arabidopsis thaliana]
 sp|Q9SUT2.1|PER39_ARATH RecName: Full=Peroxidase 39; Short=Atperox P39; AltName: Full=ATP19a; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB51413.1| peroxidase ATP19a [Arabidopsis thaliana]
 emb|CAB81230.1| peroxidase ATP19a [Arabidopsis thaliana]
 dbj|BAD95298.1| peroxidase ATP19a [Arabidopsis thaliana]
 gb|ABH04555.1| At4g11290 [Arabidopsis thaliana]
 gb|AEE82993.1| peroxidase 39 [Arabidopsis thaliana]
Length=326

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSYY+LVLKRRGLFESDAAL  NP   + + + A GS Q+F+AEF+ S
Sbjct  242  VEMDPGSRNTFDLSYYRLVLKRRGLFESDAALTMNPAALAQVKRFAGGSEQEFFAEFSNS  301

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTGSDGEIR+ CA VN
Sbjct  302  MEKMGRIGVKTGSDGEIRRTCAFVN  326



>emb|CDY13252.1| BnaC09g24040D [Brassica napus]
Length=326

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSY+KLVLKRRGLFESDAAL  +PT    +   A GSLQDF+ EF  S
Sbjct  242  VEMDPGSRNTFDLSYFKLVLKRRGLFESDAALTKDPTALGQVRSFAGGSLQDFFVEFGKS  301

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTGSDGEIR+ C+VVN
Sbjct  302  MEKMGRIGVKTGSDGEIRRTCSVVN  326



>emb|CAA67337.1| peroxidase [Arabidopsis thaliana]
Length=326

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSYY+LVLKRRGLFESDAAL  NP   + + + A GS Q+F+AEF+ S
Sbjct  242  VEMDPGSRNTFDLSYYRLVLKRRGLFESDAALTMNPAALAQVKRFAGGSEQEFFAEFSNS  301

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTGSDGEIR+ CA VN
Sbjct  302  MEKMGRIGVKTGSDGEIRRTCAFVN  326



>ref|XP_004487389.1| PREDICTED: peroxidase 3-like [Cicer arietinum]
Length=325

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS  TFDLSYY  V+KRRGLF+SD+ALLTN  TKS + +L  GS++ FY EFA 
Sbjct  239  IVEMDPGSRNTFDLSYYNQVVKRRGLFQSDSALLTNSVTKSLVTQLLHGSIEIFYDEFAK  298

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+G+I+VK GS+GEIRK CA+VN
Sbjct  299  SMEKMGQIKVKIGSEGEIRKHCALVN  324



>ref|XP_009108181.1| PREDICTED: peroxidase 39 [Brassica rapa]
 emb|CDX86795.1| BnaA09g21850D [Brassica napus]
Length=326

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSY+KLVLKRRGLFESDAAL  +PT    +   A GSLQDF+ EF  S
Sbjct  242  VEMDPGSRNTFDLSYFKLVLKRRGLFESDAALTKDPTALGQVRGFAGGSLQDFFVEFGKS  301

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTGSDGEIR+ C+VVN
Sbjct  302  MEKMGRIGVKTGSDGEIRRTCSVVN  326



>ref|XP_008341973.1| PREDICTED: peroxidase 3-like [Malus domestica]
Length=325

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGSF+TFDLSYY  +LKRRGLF+SDAAL T+P   ++I++L +G LQ+F+ EF  S
Sbjct  240  VEMDPGSFRTFDLSYYTHLLKRRGLFQSDAALKTSPKAYNYINQLLKGPLQNFFYEFGKS  299

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GR  VKTGS GEIRKQC+VVN
Sbjct  300  MEKMGRANVKTGSAGEIRKQCSVVN  324



>gb|KFK31897.1| hypothetical protein AALP_AA6G173300 [Arabis alpina]
Length=326

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSY+KLVLKRRGLFESDAAL  N    S + + A+GS QDF+AEFA S
Sbjct  242  VEMDPGSRNTFDLSYFKLVLKRRGLFESDAALTMNSEALSQVRRFARGSEQDFFAEFAKS  301

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI V+TGSDGEIR+ C+VVN
Sbjct  302  MEKMGRIGVQTGSDGEIRRTCSVVN  326



>ref|XP_010931184.1| PREDICTED: peroxidase 3-like isoform X2 [Elaeis guineensis]
Length=261

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDL YYK +LKRRGL +SDAAL TN  TK+ I +L    L+ F+ EFA 
Sbjct  175  IVEMDPGSFRTFDLGYYKHLLKRRGLLQSDAALTTNTATKASIMELVSSPLEVFFKEFAF  234

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VKTGS GEIRK CAVVN
Sbjct  235  SMEKMGRIEVKTGSSGEIRKNCAVVN  260



>ref|XP_002872571.1| peroxidase ATP19a [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48830.1| peroxidase ATP19a [Arabidopsis lyrata subsp. lyrata]
Length=327

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSYY+LVLKRRGLFESDAAL  NP   + + + + GS Q+F+AEF+ S
Sbjct  243  VEMDPGSRNTFDLSYYRLVLKRRGLFESDAALTMNPAALAQVKRFSGGSEQEFFAEFSKS  302

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTGSDGEIR+ CA VN
Sbjct  303  MEKMGRIGVKTGSDGEIRRTCAFVN  327



>ref|XP_006396925.1| hypothetical protein EUTSA_v10028797mg [Eutrema salsugineum]
 gb|ESQ38378.1| hypothetical protein EUTSA_v10028797mg [Eutrema salsugineum]
Length=326

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSY++LVLKRRGLFESDAAL  N    + + + A GS QDF+ EF  S
Sbjct  242  VEMDPGSRNTFDLSYFRLVLKRRGLFESDAALTMNSAALALVRRFAGGSEQDFFVEFGKS  301

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTGSDGEIR+ CAVVN
Sbjct  302  MEKMGRIGVKTGSDGEIRRTCAVVN  326



>ref|XP_010931180.1| PREDICTED: peroxidase 3-like isoform X1 [Elaeis guineensis]
Length=325

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDL YYK +LKRRGL +SDAAL TN  TK+ I +L    L+ F+ EFA 
Sbjct  239  IVEMDPGSFRTFDLGYYKHLLKRRGLLQSDAALTTNTATKASIMELVSSPLEVFFKEFAF  298

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VKTGS GEIRK CAVVN
Sbjct  299  SMEKMGRIEVKTGSSGEIRKNCAVVN  324



>ref|XP_007045599.1| Peroxidase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY01431.1| Peroxidase superfamily protein isoform 1 [Theobroma cacao]
Length=326

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSYY L+ KRRGLF SDAAL TN T+ + I++L    L+ FYAEFA S
Sbjct  241  VEMDPGSRNTFDLSYYTLLTKRRGLFNSDAALTTNSTSLALINQLLSNPLKFFYAEFAKS  300

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTGS+GEIRKQCA VN
Sbjct  301  MEKMGRINVKTGSEGEIRKQCAFVN  325



>ref|XP_008784560.1| PREDICTED: peroxidase 3-like [Phoenix dactylifera]
Length=324

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGSF+TFDL YYK VLKRRGLF+SDAAL+TN  TKS I  L     + F+ EFA S
Sbjct  239  VEMDPGSFRTFDLGYYKNVLKRRGLFQSDAALITNAGTKSSIMNLVDSPPEVFFQEFALS  298

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GR++VKTGS GEIRK CAVVN
Sbjct  299  MEKMGRVEVKTGSTGEIRKNCAVVN  323



>ref|XP_008777796.1| PREDICTED: peroxidase 3-like [Phoenix dactylifera]
Length=332

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I EMDPGSF+TFDL YYK VLKRRGLF+SDAAL+TN  TKS I  L   S + F+  FA 
Sbjct  246  IAEMDPGSFRTFDLGYYKNVLKRRGLFQSDAALITNAATKSSIMSLVNSSPEVFFKVFAF  305

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VKTGS GEIRK CAVVN
Sbjct  306  SMEKMGRIEVKTGSMGEIRKNCAVVN  331



>ref|XP_010435105.1| PREDICTED: peroxidase 39 [Camelina sativa]
Length=326

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSY+KLVLKRRGLFESDAAL  NP   + + + A GS QDF++EF+ S
Sbjct  242  VEMDPGSRNTFDLSYFKLVLKRRGLFESDAALTMNPAALAQVRRFAGGSEQDFFSEFSKS  301

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTGS GEIR+ CA VN
Sbjct  302  MEKMGRIGVKTGSAGEIRRTCAFVN  326



>ref|XP_006288205.1| hypothetical protein CARUB_v10001445mg [Capsella rubella]
 gb|EOA21103.1| hypothetical protein CARUB_v10001445mg [Capsella rubella]
Length=326

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSY++LVLKRRGLFESDAAL  +P   + + + A GS Q+F+AEFA +
Sbjct  242  VEMDPGSRNTFDLSYFRLVLKRRGLFESDAALTMDPAALAQVRRFAGGSEQEFFAEFAKA  301

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTGSDGEIR+ CA VN
Sbjct  302  MEKMGRIGVKTGSDGEIRRTCAFVN  326



>ref|XP_010540729.1| PREDICTED: peroxidase 39 [Tarenaya hassleriana]
Length=371

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS K+FDLSYY L+LKRRGLFESD AL T+ T  + + +L  GS+ +F+AEFA S
Sbjct  287  VEMDPGSRKSFDLSYYNLLLKRRGLFESDNALTTDSTALALVRRLVAGSMDEFFAEFAKS  346

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTGSDGEIR+ CA VN
Sbjct  347  MEKMGRIGVKTGSDGEIRRYCAFVN  371



>emb|CAA76374.2| peroxidase [Spinacia oleracea]
Length=322

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS +TFDLSYYKL+LKRRGLFESDAAL  + TT S+I +L  G L+ F+AEF+ 
Sbjct  237  IVEMDPGSHRTFDLSYYKLLLKRRGLFESDAALTKSSTTLSYIKELVNGPLETFFAEFSK  296

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ K+G ++V TGS GEIRKQCA VN
Sbjct  297  SMVKMGDVEVLTGSAGEIRKQCAFVN  322



>ref|XP_010931832.1| PREDICTED: peroxidase 3-like [Elaeis guineensis]
Length=324

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGSF+TFDL YYK VLKRRGLF+SDAAL+TN  TKS I  L     + F+ EFA S
Sbjct  239  VEMDPGSFRTFDLGYYKNVLKRRGLFQSDAALITNAPTKSSIMNLVNSPPEVFFQEFALS  298

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI+VK G+ GEIRK CAVVN
Sbjct  299  MEKMGRIEVKAGTTGEIRKNCAVVN  323



>ref|XP_010455535.1| PREDICTED: peroxidase 39-like [Camelina sativa]
Length=326

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSY+KLVLKRRGLFESDAAL  NP   + + + A GS QDF++EF+ +
Sbjct  242  VEMDPGSRNTFDLSYFKLVLKRRGLFESDAALTMNPAALAQVRRFAGGSEQDFFSEFSKA  301

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTGS GEIR+ CA VN
Sbjct  302  MEKMGRIGVKTGSAGEIRRTCAFVN  326



>ref|XP_010422076.1| PREDICTED: peroxidase 39-like [Camelina sativa]
Length=326

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSY+KLVLKRRGLFESDAAL  NP   + + + A GS QDF++EF+ +
Sbjct  242  VEMDPGSRNTFDLSYFKLVLKRRGLFESDAALTMNPAALAQVRRFAGGSEQDFFSEFSKA  301

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI VKTGS GEIR+ CA VN
Sbjct  302  MEKMGRIGVKTGSAGEIRRTCAFVN  326



>gb|KHG05441.1| Peroxidase 3 -like protein [Gossypium arboreum]
 gb|KHG30187.1| Peroxidase 3 -like protein [Gossypium arboreum]
Length=327

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY L+ KRRGLF SDAAL T+ T+   I++L       FYA+FA 
Sbjct  241  IVEMDPGSRKTFDLSYYTLLTKRRGLFNSDAALTTDSTSLGLINQLLSSPQSFFYAQFAK  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS GEIRKQCA+VN
Sbjct  301  SMEKMGRINVKTGSQGEIRKQCALVN  326



>ref|NP_001234644.1| peroxidase precursor [Solanum lycopersicum]
 gb|AAA65636.1| peroxidase [Solanum lycopersicum]
Length=329

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDP S   FDLSY++LVL+R+GLF+SDAAL T+ TTKSFI++L QGS++ FYAE   
Sbjct  244  IVEMDPESSSKFDLSYFQLVLRRKGLFQSDAALTTSATTKSFINQLVQGSVKQFYAE-PG  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++EK+G+I+VKTGS GEIRK CA VN
Sbjct  303  AMEKMGKIEVKTGSAGEIRKHCAAVN  328



>gb|ACJ11761.1| class III peroxidase [Gossypium hirsutum]
Length=327

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDLSYY L+ KRRGLF SDAAL T+ T+   I++L       FYA+FA 
Sbjct  241  IVEMDPGSRKTFDLSYYTLLTKRRGLFNSDAALTTDSTSLGLINQLLSSPQSFFYAQFAK  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI +KTGS GEIRKQCA+VN
Sbjct  301  SMEKMGRINIKTGSQGEIRKQCALVN  326



>ref|XP_010908222.1| PREDICTED: peroxidase 3-like [Elaeis guineensis]
Length=326

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I EMDPGSF+TFDL YYK VLKRRGLF+SDAAL+TN  +KS I  +     + F+  FA 
Sbjct  240  IAEMDPGSFRTFDLGYYKNVLKRRGLFQSDAALITNAASKSAILNIVNSPPEVFFQVFAA  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+V TGS GEIRK CAVVN
Sbjct  300  SMEKMGRIEVLTGSAGEIRKHCAVVN  325



>gb|KHN41201.1| Peroxidase 3 [Glycine soja]
Length=264

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            ++EMDPGS  TFDL Y+K V+KRRGLF+SDAALL + TT++ I +  Q S Q F+AEFA 
Sbjct  179  LIEMDPGSRNTFDLGYFKQVVKRRGLFQSDAALLESSTTRAIIARQLQ-STQGFFAEFAK  237

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTG++GEIRKQCA VN
Sbjct  238  SMEKMGRINVKTGTEGEIRKQCARVN  263



>ref|XP_010696607.1| PREDICTED: peroxidase 3 [Beta vulgaris subsp. vulgaris]
Length=331

 Score =   116 bits (290),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYYKL+LKRRGLF+SDAAL  + TT S+I +L  G L  F+ EF+ 
Sbjct  245  IVEMDPGSFRTFDLSYYKLLLKRRGLFQSDAALTKSSTTLSYIKQLVNGPLDTFFDEFSQ  304

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            ++ K+G+++V TGS G+IRK+CA VN
Sbjct  305  AMVKMGQVEVLTGSAGQIRKRCAFVN  330



>gb|AHZ89831.1| peroxidase [Cucumis metulifer]
Length=328

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSYY L+LKRRGLFESDAAL T+ TT   + KL +G +++F+AEFA S
Sbjct  243  VEMDPGSRNTFDLSYYSLLLKRRGLFESDAALTTDATTLGLVQKLVEGPIEEFFAEFAAS  302

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            +EK+GRI+VKT  +  IR++C VVN
Sbjct  303  MEKMGRIKVKTELEVSIRRRCGVVN  327



>ref|XP_006582342.1| PREDICTED: peroxidase 3-like [Glycine max]
Length=325

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            ++EMDPGS  TFDL Y+K V+KRRGLF+SDAALL + TT++ I +  Q S Q F+AEFA 
Sbjct  240  LIEMDPGSRNTFDLGYFKQVVKRRGLFQSDAALLESSTTRAIIARQLQ-STQGFFAEFAK  298

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTG++GEIRKQCA VN
Sbjct  299  SMEKMGRINVKTGTEGEIRKQCARVN  324



>ref|XP_006581060.1| PREDICTED: peroxidase isoform X1 [Glycine max]
Length=324

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            ++EMDPGS  TFDL YYK V+KRRGLF+SDA LLT+P T+S I    Q S Q F+AEFA 
Sbjct  239  LIEMDPGSRDTFDLGYYKQVVKRRGLFQSDAELLTSPITRSIIASQLQ-STQGFFAEFAK  297

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VK GS+GEIRK CA VN
Sbjct  298  SMEKMGRINVKLGSEGEIRKHCARVN  323



>gb|EMS60387.1| Peroxidase 1 [Triticum urartu]
Length=119

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSFKTFD  Y+KLV KRRGLF SD ALLT+P T++++ + A G+ +D F+A+FA
Sbjct  32   LVEMDPGSFKTFDTDYFKLVSKRRGLFHSDGALLTDPFTRAYVQRHATGAFKDEFFADFA  91

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G     TGS GEIRK+C VVN
Sbjct  92   ASMIKMGNANPLTGSQGEIRKKCNVVN  118



>gb|AAK84424.1|AF396465_1 peroxidase-like protein [Pisum sativum]
Length=89

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            ++EMDPGS  TFD+ Y+K V+KRRGLFESDAALL + TT+S + +  Q S + F+ EFA 
Sbjct  5    LIEMDPGSRNTFDVGYFKQVVKRRGLFESDAALLKSSTTRSIVAQHLQ-SNEKFFTEFAK  63

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VK G++GEIRK CA +N
Sbjct  64   SMEKMGRINVKIGTEGEIRKHCAFIN  89



>ref|XP_010510594.1| PREDICTED: peroxidase 30 [Camelina sativa]
Length=326

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS ++FDLSYY+LVLKRRGLF+SD+AL TN  T   I+ L  GS Q FY  FA 
Sbjct  240  ILEMDPGSRRSFDLSYYRLVLKRRGLFQSDSALTTNSATLKMINDLVNGSEQTFYKAFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAV  254
            S+EK+GR++VKTGS G IR +C+V
Sbjct  300  SMEKMGRVKVKTGSSGVIRTRCSV  323



>gb|KHN41200.1| Peroxidase 3 [Glycine soja]
Length=324

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            ++EMDPGS  TFDL YYK V+KRRGLF+SDA LLT+P T+S I    Q S Q F+AEFA 
Sbjct  239  LIEMDPGSRDTFDLGYYKQVVKRRGLFQSDAELLTSPITRSIIASQLQ-STQGFFAEFAK  297

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VK G++GEIRK CA VN
Sbjct  298  SMEKMGRINVKLGAEGEIRKHCARVN  323



>ref|XP_006298132.1| hypothetical protein CARUB_v10014176mg [Capsella rubella]
 gb|EOA31030.1| hypothetical protein CARUB_v10014176mg [Capsella rubella]
Length=326

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS ++FDLSYY+LVLKRRGLF+SDAAL TN  T   I+ L  GS + FY  FA 
Sbjct  240  ILEMDPGSRRSFDLSYYRLVLKRRGLFQSDAALTTNSATLKMINDLVNGSEEKFYKAFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAV  254
            S+EK+GR++VKTGS G IR +C+V
Sbjct  300  SMEKMGRVKVKTGSSGVIRTRCSV  323



>ref|XP_002883319.1| peroxidase 30 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59578.1| peroxidase 30 [Arabidopsis lyrata subsp. lyrata]
Length=329

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS +TFDLSYY+LVLKRRGLF+SD+AL TN  T   I+ L  G  Q FY  FA 
Sbjct  243  ILEMDPGSSRTFDLSYYRLVLKRRGLFQSDSALTTNSATLKVINNLVNGPEQKFYEAFAK  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAV  254
            S+EK+GR++VKTGS G IR +C+V
Sbjct  303  SMEKMGRVKVKTGSAGVIRTRCSV  326



>ref|XP_010488198.1| PREDICTED: peroxidase 30-like [Camelina sativa]
Length=326

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS ++FDLSYY+L+LKRRGLF+SD+AL TN  T   I+ L  GS Q FY  FA 
Sbjct  240  ILEMDPGSRRSFDLSYYRLILKRRGLFQSDSALTTNSATLKMINDLVNGSEQTFYKAFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAV  254
            S+EK+GR++VKTGS G IR +C+V
Sbjct  300  SMEKMGRVKVKTGSSGVIRTRCSV  323



>gb|ACI00841.1| class III peroxidase [Triticum aestivum]
Length=329

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSFKTFD  Y+KLV KRRGLF SD ALLT+P T++++ + A G+ +D F+A+FA
Sbjct  242  LVEMDPGSFKTFDTDYFKLVSKRRGLFHSDGALLTDPFTRAYVQRHATGAFKDEFFADFA  301

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G  QV TGS GEIRK+C+V N
Sbjct  302  VSMVKMGNNQVLTGSQGEIRKKCSVAN  328



>ref|XP_010524488.1| PREDICTED: peroxidase 30 [Tarenaya hassleriana]
Length=324

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS KTFDL YY+ +LKRRGLF+SD+AL TN  T   ++ L  GS+++FY EF  
Sbjct  238  IVEMDPGSRKTFDLGYYRNLLKRRGLFQSDSALTTNSATLKTVNDLVSGSVEEFYKEFGR  297

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VKTGS+G IR +C+V +
Sbjct  298  SMEKMGRINVKTGSNGVIRTRCSVAD  323



>ref|XP_002440020.1| hypothetical protein SORBIDRAFT_09g024580 [Sorghum bicolor]
 gb|EES18450.1| hypothetical protein SORBIDRAFT_09g024580 [Sorghum bicolor]
Length=326

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSL-QDFYAEFA  329
            +VEMDPGSFKTFDLSY+  V KRRGLF SD ALLT+PTT++++ + A G+  ++F+A+FA
Sbjct  240  LVEMDPGSFKTFDLSYFANVAKRRGLFHSDGALLTDPTTRAYVLRHATGNYKEEFFADFA  299

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G + V TGS GEIRK+C+VVN
Sbjct  300  ASMLKMGAVDVLTGSQGEIRKKCSVVN  326



>gb|KHN22848.1| Peroxidase 3 [Glycine soja]
Length=324

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS  TFDL +YK V+KRRGLF+SDA  LT+P T+S I +  Q S Q F+AEFA 
Sbjct  239  IIEMDPGSRDTFDLGFYKQVVKRRGLFQSDAEFLTSPITRSIIARQLQ-STQGFFAEFAK  297

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VK G++GEIRK CA VN
Sbjct  298  SMEKMGRINVKLGTEGEIRKHCARVN  323



>ref|XP_006406236.1| hypothetical protein EUTSA_v10021123mg [Eutrema salsugineum]
 dbj|BAJ34038.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47689.1| hypothetical protein EUTSA_v10021123mg [Eutrema salsugineum]
Length=328

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS ++FDLSYY+LVLKRRGLF+SD+AL TN  T   I+ L  GS + FY  FA 
Sbjct  242  ILEMDPGSARSFDLSYYRLVLKRRGLFQSDSALTTNSATLKMINDLVNGSEKKFYKAFAK  301

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVV  251
            S+EK+GR++VKTGS G IR +C+V 
Sbjct  302  SMEKMGRVKVKTGSTGVIRTRCSVA  326



>ref|NP_001241977.1| uncharacterized protein LOC100784922 precursor [Glycine max]
 gb|ACU20999.1| unknown [Glycine max]
Length=324

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 66/86 (77%), Gaps = 1/86 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS  TFDL +YK V+KRRGLF+SDA  LT+P  +S ID+  Q S Q F+ EFA 
Sbjct  239  IIEMDPGSRDTFDLGFYKQVVKRRGLFQSDAEFLTSPIARSIIDRQLQ-STQGFFEEFAK  297

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VK G++GEIRK CA VN
Sbjct  298  SIEKMGRINVKLGTEGEIRKHCARVN  323



>gb|EMT01705.1| Peroxidase 1 [Aegilops tauschii]
Length=235

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSFKTFD  Y+KLV KRRGLF SD ALLT+P T++++ + A G+ +D F+A+FA
Sbjct  148  LVEMDPGSFKTFDTDYFKLVSKRRGLFHSDGALLTDPFTRAYVQRHATGAFKDEFFADFA  207

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G     TGS GEIRK+C+VVN
Sbjct  208  ASMIKMGNANQLTGSQGEIRKKCSVVN  234



>dbj|BAK06872.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=327

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSL-QDFYAEFA  329
            +VEMDPGSFKTFDL Y+KLV KRRGLF SD ALLT+P T++++ + A G+  ++F+A+FA
Sbjct  240  LVEMDPGSFKTFDLDYFKLVSKRRGLFHSDGALLTDPFTRAYVLRHATGAFKEEFFADFA  299

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G  QV TGS GEIRK+C+V N
Sbjct  300  VSMIKMGNNQVLTGSQGEIRKKCSVPN  326



>ref|XP_009145451.1| PREDICTED: peroxidase 30 [Brassica rapa]
 emb|CDY38641.1| BnaA05g19460D [Brassica napus]
Length=326

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS K+FDLSYY+LVLKRRGLF+SD+AL TN  T   I+ L  GS + FY  FA 
Sbjct  240  ILEMDPGSRKSFDLSYYRLVLKRRGLFQSDSALTTNSATLKMINDLVNGSEEKFYKAFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAV  254
            S+EK+GR++VKTGS G IR  C+V
Sbjct  300  SMEKMGRVKVKTGSAGVIRTVCSV  323



>ref|XP_004961613.1| PREDICTED: peroxidase 1-like [Setaria italica]
Length=326

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSL-QDFYAEFA  329
            +VEMDPGSFKTFDLSY+  V KRRGLF SD ALLT+P T++++ + A G+  ++F+A+FA
Sbjct  240  LVEMDPGSFKTFDLSYFGHVAKRRGLFHSDGALLTDPFTRAYVLRHATGAYREEFFADFA  299

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G ++V TGS GEIRK+C+VVN
Sbjct  300  ASMVKMGSVEVLTGSQGEIRKKCSVVN  326



>gb|ACT35472.1| peroxidase 30, partial [Brassica rapa]
Length=354

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS K+FDLSYY+LVLKRRGLF+SD+AL TN  T   I+ L  GS + FY  FA 
Sbjct  268  ILEMDPGSRKSFDLSYYRLVLKRRGLFQSDSALTTNSATLKMINDLVNGSEEKFYKAFAK  327

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVV  251
            S+EK+GR++VKTGS G IR  C+V 
Sbjct  328  SMEKMGRVKVKTGSAGVIRTVCSVA  352



>gb|EMS60386.1| Peroxidase 1 [Triticum urartu]
Length=240

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSFKTFD  Y+KLV KRRGLF SD ALLT+P T++++ + A G+ +D F+A+FA
Sbjct  153  LVEMDPGSFKTFDTDYFKLVSKRRGLFHSDGALLTDPFTRAYVQRHATGAFKDEFFADFA  212

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G     TGS GEIRK+C VVN
Sbjct  213  ASMIKMGNANPLTGSQGEIRKKCNVVN  239



>ref|XP_007132569.1| hypothetical protein PHAVU_011G105900g [Phaseolus vulgaris]
 gb|ESW04563.1| hypothetical protein PHAVU_011G105900g [Phaseolus vulgaris]
Length=325

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            ++EMDPGS  TFDL YYK V+KRRGLF+SDAALLT+ TT+S I    Q S + F+AEFA 
Sbjct  240  LIEMDPGSRDTFDLGYYKQVVKRRGLFQSDAALLTSSTTRSIITTQLQ-SNEGFFAEFAK  298

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI +K G++GEIRK CA VN
Sbjct  299  SMEKMGRINLKLGTEGEIRKHCARVN  324



>gb|ACI00835.1| class III peroxidase [Triticum aestivum]
Length=326

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSFKTFD  Y+KLV KRRGLF SD ALLT+P T++++ + A G+ +D F+A+FA
Sbjct  239  LVEMDPGSFKTFDTDYFKLVSKRRGLFHSDGALLTDPFTRAYVQRHATGAFKDEFFADFA  298

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G     TGS GEIRK+C+VVN
Sbjct  299  ASMIKMGNANPLTGSQGEIRKKCSVVN  325



>emb|CDY33143.1| BnaCnng07140D [Brassica napus]
Length=365

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS K+FDLSYY+LVLKRRGLF+SD+AL TN  T   I+ L  GS + FY  FA 
Sbjct  279  ILEMDPGSRKSFDLSYYRLVLKRRGLFQSDSALTTNSATLKMINDLVNGSEEKFYKAFAK  338

Query  325  SVEKLGRIQVKTGSDGEIRKQCAV  254
            S+EK+GR++VKTGS G IR  C+V
Sbjct  339  SMEKMGRVKVKTGSAGVIRTVCSV  362



>gb|EMS60389.1| Peroxidase 1 [Triticum urartu]
Length=327

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSFKTFD  Y+KLV KRRGLF SD ALLT+P T++++ + A G+ +D F+A+FA
Sbjct  240  LVEMDPGSFKTFDTDYFKLVSKRRGLFHSDGALLTDPFTRAYVQRHATGAFKDEFFADFA  299

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G     TGS GEIRK+C+VVN
Sbjct  300  ASMIKMGNANPLTGSQGEIRKKCSVVN  326



>gb|ACI00842.1| class III preoxidase [Triticum aestivum]
Length=169

 Score =   108 bits (269),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGS  TFD SYY+ +LKRRGLF+SDAAL+T+   ++ ++ +A+G L+ F+  FA 
Sbjct  83   IVEMDPGSLLTFDTSYYRGLLKRRGLFQSDAALITDEAARADVESVAKGPLEVFFQVFAR  142

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ ++G I+VKTG +GEIR+ CAVVN
Sbjct  143  SMVRMGMIEVKTGGEGEIRRHCAVVN  168



>gb|ACF83673.1| unknown [Zea mays]
 gb|AFW69091.1| hypothetical protein ZEAMMB73_054429 [Zea mays]
Length=280

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY+ VLKRRGLF+SDAAL+T+  +K+ I  +     + F+  FA 
Sbjct  193  IVEMDPGSFRTFDLSYYRGVLKRRGLFQSDAALITDAASKADILSVINAPPEVFFQVFAG  252

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ K+G I+VKTGS+GEIRK CA+VN
Sbjct  253  SMVKMGAIEVKTGSEGEIRKHCALVN  278



>emb|CAA67360.1| peroxidase ATP7a [Arabidopsis thaliana]
Length=326

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS ++FDLSYY+LVLKRRGLF+SD+AL TN  T   I+ L  GS + F+  FA 
Sbjct  240  ILEMDPGSSRSFDLSYYRLVLKRRGLFQSDSALTTNSATLKVINDLVNGSEKKFFKAFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAV  254
            S+EK+GR++VKTGS G IR +C+V
Sbjct  300  SMEKMGRVKVKTGSAGVIRTRCSV  323



>ref|NP_188814.1| peroxidase 30 [Arabidopsis thaliana]
 sp|Q9LSY7.1|PER30_ARATH RecName: Full=Peroxidase 30; Short=Atperox P30; AltName: Full=ATP7a; 
AltName: Full=PRXR9; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB02839.1| peroxidase [Arabidopsis thaliana]
 gb|AAL61933.1| peroxidase [Arabidopsis thaliana]
 gb|AAM47886.1| peroxidase [Arabidopsis thaliana]
 gb|AEE76550.1| peroxidase 30 [Arabidopsis thaliana]
Length=329

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS ++FDLSYY+LVLKRRGLF+SD+AL TN  T   I+ L  GS + F+  FA 
Sbjct  243  ILEMDPGSSRSFDLSYYRLVLKRRGLFQSDSALTTNSATLKVINDLVNGSEKKFFKAFAK  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAV  254
            S+EK+GR++VKTGS G IR +C+V
Sbjct  303  SMEKMGRVKVKTGSAGVIRTRCSV  326



>emb|CAA66965.1| peroxidase [Arabidopsis thaliana]
Length=329

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS ++FDLSYY+LVLKRRGLF+SD+AL TN  T   I+ L  GS + F+  FA 
Sbjct  243  ILEMDPGSSRSFDLSYYRLVLKRRGLFQSDSALTTNSATLKVINDLVNGSEKKFFKAFAK  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAV  254
            S+EK+GR++VKTGS G IR +C+V
Sbjct  303  SMEKMGRVKVKTGSAGVIRTRCSV  326



>gb|ACI00844.1| class III peroxidase [Triticum aestivum]
Length=186

 Score =   107 bits (268),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFD SYY+ +LKRRGLF+SDAAL+T+   ++ ++ +A+G  + F+  FA 
Sbjct  100  IVEMDPGSFLTFDTSYYRGLLKRRGLFQSDAALITDTAARADVESVAKGPSEVFFQVFAR  159

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ ++G I+VKTG +GEIR+ CAVVN
Sbjct  160  SMVRMGMIEVKTGGEGEIRRHCAVVN  185



>gb|ACI00836.1| class III peroxidase [Triticum aestivum]
 gb|ACI00837.1| class III peroxidase [Triticum aestivum]
 gb|ACI00838.1| class III peroxidase [Triticum aestivum]
 gb|ACI00839.1| class III peroxidase [Triticum aestivum]
 gb|ACI00840.1| class III peroxidase [Triticum aestivum]
Length=327

 Score =   110 bits (275),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSFKTFD  Y+KLV KRRGLF SD ALLT+P T++++ + A G+ +D F+A+FA
Sbjct  240  LVEMDPGSFKTFDTDYFKLVSKRRGLFHSDGALLTDPFTRAYVQRHATGAFKDEFFADFA  299

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G     TGS GEIRK+C VVN
Sbjct  300  ASMIKMGNANPLTGSQGEIRKKCNVVN  326



>ref|NP_001149755.1| peroxidase 39 precursor [Zea mays]
 gb|ACG36682.1| peroxidase 39 precursor [Zea mays]
 gb|AFW69088.1| peroxidase 39 isoform 1 [Zea mays]
 gb|AFW69089.1| peroxidase 39 isoform 2 [Zea mays]
Length=328

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY+ VLKRRGLF+SDAAL+T+  +K+ I  +     + F+  FA 
Sbjct  241  IVEMDPGSFRTFDLSYYRGVLKRRGLFQSDAALITDAASKADILSVINAPPEVFFQVFAG  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ K+G I+VKTGS+GEIRK CA+VN
Sbjct  301  SMVKMGAIEVKTGSEGEIRKHCALVN  326



>ref|XP_006654599.1| PREDICTED: peroxidase 1-like [Oryza brachyantha]
Length=326

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            +VEMDPGSF+TFDL Y+K V KRRGLF SD  LLTN  T++++ + A GS  +F+A+FA 
Sbjct  241  LVEMDPGSFRTFDLGYFKHVAKRRGLFHSDGELLTNGFTRAYVLRHAAGSQDEFFADFAA  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ K+G + V TGS GEIRK+C VVN
Sbjct  301  SMVKMGNVGVLTGSQGEIRKKCNVVN  326



>ref|XP_008643745.1| PREDICTED: peroxidase 39 isoform X1 [Zea mays]
 gb|ACN35787.1| unknown [Zea mays]
 gb|AFW69090.1| hypothetical protein ZEAMMB73_054429 [Zea mays]
Length=361

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY+ VLKRRGLF+SDAAL+T+  +K+ I  +     + F+  FA 
Sbjct  274  IVEMDPGSFRTFDLSYYRGVLKRRGLFQSDAALITDAASKADILSVINAPPEVFFQVFAG  333

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ K+G I+VKTGS+GEIRK CA+VN
Sbjct  334  SMVKMGAIEVKTGSEGEIRKHCALVN  359



>emb|CDY19299.1| BnaC01g31810D [Brassica napus]
Length=329

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS ++FDLSYY+LVLKRRGLF+SD+AL  N  T   I+ L  GS + FY  FA 
Sbjct  243  ILEMDPGSSRSFDLSYYRLVLKRRGLFQSDSALTKNSATLKMINDLVNGSEKKFYKAFAK  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAV  254
            S+EK+GR++VKTGS G IR +C+V
Sbjct  303  SMEKMGRVKVKTGSAGVIRTRCSV  326



>emb|CDY55649.1| BnaA01g36520D [Brassica napus]
Length=329

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS ++FDLSYY+LVLKRRGLF+SD+AL  N  T   I+ L  GS + FY  FA 
Sbjct  243  ILEMDPGSSRSFDLSYYRLVLKRRGLFQSDSALTKNSATLKMINDLVNGSEKKFYKAFAK  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAV  254
            S+EK+GR++VKTGS G IR +C+V
Sbjct  303  SMEKMGRVKVKTGSAGVIRTRCSV  326



>emb|CCJ34832.1| horseradish peroxidase isoenzyme HRP_2021 [Armoracia rusticana]
Length=331

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS KTFDLSYY+LVLKRRGLF+SD+AL TN  T   I+ L  G  + F   FA 
Sbjct  245  ILEMDPGSSKTFDLSYYRLVLKRRGLFQSDSALTTNSATLKMINDLVNGPEKKFLKAFAK  304

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVV  251
            S+EK+GR++VKTGS G IR +C+V 
Sbjct  305  SMEKMGRVKVKTGSAGVIRTRCSVA  329



>ref|XP_004515086.1| PREDICTED: peroxidase 3-like [Cicer arietinum]
Length=326

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            ++EMDPGS  TFDL YYK V+K RGLF+SDA LL + TTKS ID+  + S + F+ EFA 
Sbjct  242  LIEMDPGSRNTFDLGYYKQVVKNRGLFQSDATLLKSSTTKSIIDQQLK-SNKKFFIEFAK  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VK G+DGEIRK C++VN
Sbjct  301  SMEKMGRINVKVGTDGEIRKHCSLVN  326



>gb|AAM61382.1| putative peroxidase [Arabidopsis thaliana]
Length=326

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS ++FDLSYY+LVLKRRGLF+SD+AL TN  T   I+ L  GS + F+  FA 
Sbjct  240  ILEMDPGSSRSFDLSYYRLVLKRRGLFQSDSALTTNSATLKVINDLVNGSEKKFFKAFAK  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAV  254
            S+EK+GR+ VKTGS G IR +C+V
Sbjct  300  SMEKMGRVXVKTGSAGVIRTRCSV  323



>gb|EMT14966.1| hypothetical protein F775_43715 [Aegilops tauschii]
Length=85

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = -2

Query  496  MDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFATSV  320
            MDPGSFKTFD  Y+KLV KRRGLF SD ALLT+P T++++   A G+ +D F+A+FA S+
Sbjct  1    MDPGSFKTFDTDYFKLVSKRRGLFHSDGALLTDPFTRAYVQLHATGTFKDEFFADFAASM  60

Query  319  EKLGRIQVKTGSDGEIRKQCAVVN  248
             K+G     TGS GEIRK+C VVN
Sbjct  61   IKMGNANPLTGSQGEIRKKCTVVN  84



>gb|AFK38463.1| unknown [Lotus japonicus]
Length=83

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = -2

Query  496  MDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATSVE  317
            MDPGS  TFDL YYK VLKRRGLFESDAALL +  T+S I +  + S Q F+  FA S E
Sbjct  1    MDPGSRNTFDLGYYKQVLKRRGLFESDAALLNSSVTRSIITQQLR-STQKFFFGFAKSTE  59

Query  316  KLGRIQVKTGSDGEIRKQCAVVN  248
            K+GRI V TG+ GEIRK CA+VN
Sbjct  60   KMGRINVLTGTKGEIRKHCALVN  82



>gb|ACI00843.1| class III peroxidase [Triticum aestivum]
Length=126

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFD SYY+ +LKR+GLF+SDAAL+T+   ++ ++ +A+G  + F+  FA 
Sbjct  40   IVEMDPGSFLTFDTSYYRGLLKRQGLFQSDAALITDAAARADVESVAKGPSEVFFQVFAR  99

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ ++G I+VKTG +GEIR+ CA+VN
Sbjct  100  SMVRMGMIEVKTGGEGEIRRHCAIVN  125



>gb|EMT33122.1| hypothetical protein F775_52516 [Aegilops tauschii]
Length=323

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSFKTFD  Y+KLV KRRGLF SD ALLT+P T++++ + A G+ +D F+A+FA
Sbjct  236  LVEMDPGSFKTFDTDYFKLVSKRRGLFHSDGALLTDPFTRAYVQRHATGTFKDEFFADFA  295

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G     TG  GEIRK+C+VVN
Sbjct  296  ASMIKMGNANPLTGGQGEIRKKCSVVN  322



>gb|EMT04929.1| Peroxidase 39 [Aegilops tauschii]
Length=147

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            +VEMDPGSF TFDLSYY  +LK +GLF+SDAAL+T+   ++ ++ +A+G  + F+  FA 
Sbjct  61   VVEMDPGSFLTFDLSYYHGLLKYQGLFQSDAALITDEAARADVESVAKGPPEVFFQVFAR  120

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ ++G I+VKTG DGEIR+ CAVVN
Sbjct  121  SMMRMGMIEVKTGGDGEIRRHCAVVN  146



>ref|XP_002437459.1| hypothetical protein SORBIDRAFT_10g027490 [Sorghum bicolor]
 gb|EER88826.1| hypothetical protein SORBIDRAFT_10g027490 [Sorghum bicolor]
Length=331

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY+ VLKRRGLF+SDAAL+T+  +K+ I  +     + F+  FA 
Sbjct  244  IVEMDPGSFRTFDLSYYRGVLKRRGLFQSDAALITDAASKADILSVVNAPPEVFFQVFAR  303

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ K+G I VKTGS+GEIRK CA VN
Sbjct  304  SMVKMGAIDVKTGSEGEIRKHCAFVN  329



>gb|AIY26417.1| peroxidase 1a [Saccharum arundinaceum]
Length=331

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFDLSYY+ VLKRRGLF+SDAAL+T+ T+K+ I  +     + F+  FA 
Sbjct  244  IVEMDPGSFLTFDLSYYRGVLKRRGLFQSDAALITDATSKADILSVVNAPPEVFFQVFAR  303

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ ++G I VKTGS+GEIRK CA+VN
Sbjct  304  SMVRMGAIDVKTGSEGEIRKHCALVN  329



>gb|AIV42032.1| peroxidase [Saccharum hybrid cultivar ROC22]
Length=331

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFDLSYY+ VLKRRGLF+SDAAL+T+ T+K+ I  +     + F+  FA 
Sbjct  244  IVEMDPGSFLTFDLSYYRGVLKRRGLFQSDAALITDATSKADILSVVNAPPEVFFQVFAR  303

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ ++G I VKTGS+GEIRK CA+VN
Sbjct  304  SMVRMGAIDVKTGSEGEIRKHCALVN  329



>gb|AIY26418.1| peroxidase 1b [Saccharum arundinaceum]
Length=331

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFDLSYY+ VLKRRGLF+SDAAL+T+ T+K+ I  +     + F+  FA 
Sbjct  244  IVEMDPGSFLTFDLSYYRGVLKRRGLFQSDAALITDATSKADILSVVNAPPEVFFQVFAR  303

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ ++G I VKTGS+GEIRK CA+VN
Sbjct  304  SMVRMGAIDVKTGSEGEIRKHCALVN  329



>gb|AIY26419.1| peroxidase 1a [Saccharum spontaneum]
Length=331

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFDLSYY+ VLKRRGLF+SDAAL+T+ T+K+ I  +     + F+  FA 
Sbjct  244  IVEMDPGSFLTFDLSYYRGVLKRRGLFQSDAALITDATSKADILSVVNAPPEVFFQVFAR  303

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ ++G I VKTGS+GEIRK CA+VN
Sbjct  304  SMVRMGAIDVKTGSEGEIRKHCALVN  329



>gb|AIV42033.1| peroxidase [Saccharum spontaneum]
Length=331

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFDLSYY+ VLKRRGLF+SDAAL+T+ T+K+ I  +     + F+  FA 
Sbjct  244  IVEMDPGSFLTFDLSYYRGVLKRRGLFQSDAALITDATSKADILSVVNAPPEVFFQVFAR  303

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ ++G I VKTGS+GEIRK CA+VN
Sbjct  304  SMVRMGAIDVKTGSEGEIRKHCALVN  329



>gb|AIY26420.1| peroxidase 1b [Saccharum spontaneum]
Length=331

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFDLSYY+ VLKRRGLF+SDAAL+T+ T+K+ I  +     + F+  FA 
Sbjct  244  IVEMDPGSFLTFDLSYYRGVLKRRGLFQSDAALITDATSKADILSVVNAPPEVFFQVFAR  303

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ ++G I VKTGS+GEIRK CA+VN
Sbjct  304  SMVRMGAIDVKTGSEGEIRKHCALVN  329



>ref|XP_009109348.1| PREDICTED: peroxidase 30 [Brassica rapa]
Length=329

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS ++FDLSYY+LVLKRRGLF+SD+AL  N  T   I+ L  GS + FY  FA 
Sbjct  243  ILEMDPGSSRSFDLSYYRLVLKRRGLFQSDSALTKNLATLKMINDLVNGSEKKFYKAFAK  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAV  254
            S+EK+GR++VKTGS G IR +C+V
Sbjct  303  SMEKMGRVKVKTGSAGVIRTRCSV  326



>ref|XP_006469710.1| PREDICTED: peroxidase 30-like isoform X2 [Citrus sinensis]
Length=316

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            ++EMDPGS KTFDLSYY L+LKRRGLF SDA+L TN  T S + +L QGSL++F+AEFA 
Sbjct  240  LLEMDPGSRKTFDLSYYNLLLKRRGLFVSDASLTTNSFTLSLVKQLLQGSLENFFAEFAK  299

Query  325  SVEKLGRIQVKTGSDGE  275
            SVEK+GR +VKTGS+G+
Sbjct  300  SVEKMGRNKVKTGSEGQ  316



>dbj|BAA03644.1| peroxidase [Oryza sativa Japonica Group]
Length=326

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSFKTFDL Y+K V KRRGLF SD  LLTN  T++++ + A G  +D F+A+FA
Sbjct  240  LVEMDPGSFKTFDLGYFKNVAKRRGLFHSDGELLTNGFTRAYVQRHAGGGYKDEFFADFA  299

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G ++V TGS GEIRK+C VVN
Sbjct  300  ASMVKMGGVEVLTGSQGEIRKKCNVVN  326



>ref|NP_001055955.1| Os05g0499300 [Oryza sativa Japonica Group]
 sp|P37834.2|PER1_ORYSJ RecName: Full=Peroxidase 1; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAT93858.1| peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69316.1| TPA: class III peroxidase 74 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF17869.1| Os05g0499300 [Oryza sativa Japonica Group]
 gb|EAY98577.1| hypothetical protein OsI_20490 [Oryza sativa Indica Group]
 dbj|BAG90155.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97037.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64248.1| hypothetical protein OsJ_19081 [Oryza sativa Japonica Group]
Length=326

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSFKTFDL Y+K V KRRGLF SD  LLTN  T++++ + A G  +D F+A+FA
Sbjct  240  LVEMDPGSFKTFDLGYFKNVAKRRGLFHSDGELLTNGFTRAYVQRHAGGGYKDEFFADFA  299

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G ++V TGS GEIRK+C VVN
Sbjct  300  ASMVKMGGVEVLTGSQGEIRKKCNVVN  326



>gb|EMS63657.1| Peroxidase 1 [Triticum urartu]
Length=293

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSF+TFDL+Y+K V+KRRGLF SD ALLTN  T++++++ A G  +D F+A+FA
Sbjct  206  LVEMDPGSFRTFDLAYFKNVVKRRGLFHSDGALLTNAFTRAYVERHAGGGYKDEFFADFA  265

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G   V TGS GEIRK+C V N
Sbjct  266  ASMIKMGNADVLTGSQGEIRKKCNVPN  292



>gb|EMS54743.1| Peroxidase 3 [Triticum urartu]
Length=261

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFD SYY+ +LKRRGLF+SDAAL+T+   ++ ++ +A+G  + F+  FA 
Sbjct  175  IVEMDPGSFLTFDTSYYRGLLKRRGLFQSDAALITDAAARADVESVAKGPSEVFFQVFAR  234

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ ++G I+VKTG +GEIR+ CA+VN
Sbjct  235  SMVRMGMIEVKTGGEGEIRRHCAIVN  260



>gb|EMT00309.1| Peroxidase 1 [Aegilops tauschii]
Length=326

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSL-QDFYAEFA  329
            +VEMDPGSF+TFDL+Y+K V+KRRGLF SD ALLTN  T++++++ A GS  ++F+A+FA
Sbjct  239  LVEMDPGSFRTFDLAYFKNVVKRRGLFHSDGALLTNAFTRAYVERHAGGSYKEEFFADFA  298

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G   V TGS GEIRK+C V N
Sbjct  299  ASMIKMGNADVLTGSQGEIRKKCNVPN  325



>gb|AIY26422.1| peroxidase 1b [Saccharum hybrid cultivar ROC22]
Length=331

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFDLSYY+ VLKRRGLF+SDAAL+T+ T+K+ I  +     + F+  FA 
Sbjct  244  IVEMDPGSFLTFDLSYYRGVLKRRGLFQSDAALITDATSKADILSVVNAPPEVFFQVFAR  303

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ ++G I VKTGS+GEIRK CA VN
Sbjct  304  SMVRMGAIDVKTGSEGEIRKHCAFVN  329



>gb|AIY26421.1| peroxidase 1a [Saccharum hybrid cultivar ROC22]
Length=331

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFDLSYY+ VLKRRGLF+SDAAL+T+ T+K+ I  +     + F+  FA 
Sbjct  244  IVEMDPGSFLTFDLSYYRGVLKRRGLFQSDAALITDATSKADILSVVNAPPEVFFQVFAR  303

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ ++G I VKTGS+GEIRK CA VN
Sbjct  304  SMVRMGAIDVKTGSEGEIRKHCAFVN  329



>gb|EMT05880.1| Peroxidase 3 [Aegilops tauschii]
Length=332

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFD SYY+ +LKRRGLF+SDAAL+T+   ++ ++ +A+G  + F+  FA 
Sbjct  246  IVEMDPGSFLTFDTSYYRGLLKRRGLFQSDAALITDAAARADVESVAKGPSEVFFQVFAR  305

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ ++G I+VKTG +GEIR+ CAVVN
Sbjct  306  SMVRMGMIEVKTGGEGEIRRHCAVVN  331



>ref|XP_002488879.1| hypothetical protein SORBIDRAFT_2674s002010 [Sorghum bicolor]
 gb|EES20442.1| hypothetical protein SORBIDRAFT_2674s002010 [Sorghum bicolor]
Length=329

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            + EMDPGS+KTFD SYY+ V KRRGLF+SDAALLT+ TT+ ++ ++A G   D F+ +F+
Sbjct  243  LSEMDPGSYKTFDTSYYRHVAKRRGLFQSDAALLTDATTREYVQRIATGKFDDVFFKDFS  302

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G + V TG+DGEIRK+C +VN
Sbjct  303  ESMIKMGNVGVITGADGEIRKKCYIVN  329



>ref|XP_004966236.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 3-like [Setaria italica]
Length=330

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDLSYY+ VLKRRGLF+SDAAL+T+   K+ I        + F   FA 
Sbjct  243  IVEMDPGSFRTFDLSYYRGVLKRRGLFQSDAALITDAAAKADILTAVNSPPEFFSQVFAR  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ K+G I+VKTGS+GEIRK CA+VN
Sbjct  303  SMVKMGAIEVKTGSEGEIRKHCAIVN  328



>gb|KFK39497.1| hypothetical protein AALP_AA3G251500 [Arabis alpina]
Length=327

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            I+EMDPGS  +FDLSYY+LVLKRRGLF+SD+AL TN  T   I+ L  G    F+  FA 
Sbjct  241  ILEMDPGSRSSFDLSYYRLVLKRRGLFQSDSALTTNSATLKMINDLVNGPEDKFFKAFAK  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAV  254
            S+EK+GR++VKTGS G IR +C+V
Sbjct  301  SMEKMGRVKVKTGSSGVIRTKCSV  324



>ref|XP_004240143.1| PREDICTED: peroxidase 27-like [Solanum lycopersicum]
Length=322

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSFKTFD SYY LV KRRGLF+SDAALL +  TK+++   A      F+ +FA 
Sbjct  237  IVEMDPGSFKTFDGSYYSLVAKRRGLFQSDAALLDDNETKAYVKLQAMSHGSTFFKDFAE  296

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI V TG  GEIRK C+ +N
Sbjct  297  SMEKMGRISVLTGKAGEIRKHCSFIN  322



>ref|XP_008776102.1| PREDICTED: peroxidase 56-like [Phoenix dactylifera]
Length=153

 Score =   104 bits (259),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 66/88 (75%), Gaps = 2/88 (2%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQ--GSLQDFYAEF  332
            IVEMDPGSFKTFD SYYKLV KRR LF SDA L+ +  TK+++++ AQ  G   +F+ +F
Sbjct  66   IVEMDPGSFKTFDTSYYKLVAKRRALFTSDATLILDSQTKAYVERQAQANGFPSEFFRDF  125

Query  331  ATSVEKLGRIQVKTGSDGEIRKQCAVVN  248
              S+ K+G I+V TG+ GEIRK+CA VN
Sbjct  126  GESMVKMGNIEVLTGNQGEIRKKCAFVN  153



>gb|EMS46833.1| Peroxidase 1 [Triticum urartu]
Length=326

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSFKTFD  Y+KLV KRRGLF SD ALLT+P T++ + + A G+ +D F+A+FA
Sbjct  239  LVEMDPGSFKTFDTDYFKLVSKRRGLFHSDGALLTDPFTRASVPRHATGAFKDEFFADFA  298

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G     TG  GEIRK+C+VVN
Sbjct  299  ASMIKMGNANPLTGGQGEIRKKCSVVN  325



>ref|XP_008776103.1| PREDICTED: peroxidase 56-like [Phoenix dactylifera]
Length=172

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 66/88 (75%), Gaps = 2/88 (2%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQ--GSLQDFYAEF  332
            IVEMDPGSFKTFD SYYKLV KRR LF SDA L+ +  TK+++++ AQ  G   +F+ +F
Sbjct  85   IVEMDPGSFKTFDTSYYKLVAKRRALFTSDATLILDSQTKAYVERQAQANGFPSEFFRDF  144

Query  331  ATSVEKLGRIQVKTGSDGEIRKQCAVVN  248
              S+ K+G I+V TG+ GEIRK+CA VN
Sbjct  145  GESMVKMGNIEVLTGNQGEIRKKCAFVN  172



>ref|XP_008652821.1| PREDICTED: peroxidase 1-like [Zea mays]
 tpg|DAA61879.1| TPA: hypothetical protein ZEAMMB73_609860 [Zea mays]
Length=284

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSF+TFDL YY  V KRRGLF SDA LL +P+T++++ + A G+ +D F+A+FA
Sbjct  198  LVEMDPGSFRTFDLGYYANVAKRRGLFHSDAQLLADPSTRAYVLRHATGAHRDEFFADFA  257

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G + V TG  GE+RK+C VVN
Sbjct  258  ASMIKMGAVSVLTGGQGEVRKKCNVVN  284



>ref|XP_010227199.1| PREDICTED: peroxidase 3-like [Brachypodium distachyon]
Length=338

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFDL YY+ +LKRRGLF+SDAAL+T+   ++ ++ +A+G  + F+  FA 
Sbjct  252  IVEMDPGSFLTFDLGYYRGLLKRRGLFQSDAALITDAAARADVESVAKGPPEVFFQVFAR  311

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ +LG + VKTG+ GEIR+ CAVVN
Sbjct  312  SMVRLGMVGVKTGAQGEIRRHCAVVN  337



>dbj|BAJ97158.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFDLSYY+ +LK RGLF+SDAAL+T+   ++ ++ +A+G  + F+  FA 
Sbjct  250  IVEMDPGSFLTFDLSYYRGLLKHRGLFQSDAALITDAAARADVESVAKGPPEVFFQVFAR  309

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ ++G I VKTG +GEIR+ CAVVN
Sbjct  310  SMVRMGMIGVKTGGEGEIRRHCAVVN  335



>ref|XP_003568173.1| PREDICTED: peroxidase 1-like [Brachypodium distachyon]
Length=327

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSL-QDFYAEFA  329
            +VEMDPGSFKTFDL Y+ +V KRRGLF SD ALLTN  T++++ + A G+  ++F+A+FA
Sbjct  240  VVEMDPGSFKTFDLDYFTVVAKRRGLFHSDGALLTNDFTRAYVQRHAGGAFKEEFFADFA  299

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G   V TGS GEIRK+C+V N
Sbjct  300  ASMVKMGNADVLTGSQGEIRKKCSVPN  326



>ref|XP_006656020.1| PREDICTED: peroxidase 1-like [Oryza brachyantha]
Length=326

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQ-DFYAEFA  329
            I EMDPGS+KTFD SYY+ V KRRGLF SDAALL++ TT+ ++ ++A G    +F+A+FA
Sbjct  240  ISEMDPGSYKTFDTSYYRHVAKRRGLFYSDAALLSDATTREYVQRIATGKFDGEFFADFA  299

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G + V TG +GEIRK+C V+N
Sbjct  300  VSMAKMGNVGVLTGDEGEIRKKCYVIN  326



>ref|XP_010231205.1| PREDICTED: peroxidase 1-like [Brachypodium distachyon]
Length=326

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSL-QDFYAEFA  329
            +VEMDPGSFKTFDL Y+ +V KRRGLF SD ALLTN  T++++ + A G+  ++F+A+FA
Sbjct  239  LVEMDPGSFKTFDLDYFTIVAKRRGLFHSDGALLTNAFTRAYVQRHAGGAFKEEFFADFA  298

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G   V TGS GEIRK+C+V N
Sbjct  299  ASMIKMGNADVLTGSQGEIRKKCSVPN  325



>dbj|BAD62399.1| putative peroxidase 1 precursor [Oryza sativa Japonica Group]
 tpe|CAH69320.1| TPA: class III peroxidase 78 precursor [Oryza sativa Japonica 
Group]
Length=331

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQ-DFYAEFA  329
            I EMDPGS+KTFD SYY+ V KRRGLF SDA+LLT+ TT+ ++ ++A G    +F+++F 
Sbjct  244  ISEMDPGSYKTFDTSYYRHVAKRRGLFSSDASLLTDATTRDYVRRIATGKFDAEFFSDFG  303

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G +QV TG +GEIRK+C V+N
Sbjct  304  ESMTKMGNVQVLTGEEGEIRKKCYVIN  330



>gb|EAZ00663.1| hypothetical protein OsI_22684 [Oryza sativa Indica Group]
Length=331

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQ-DFYAEFA  329
            I EMDPGS+KTFD SYY+ V KRRGLF SDA+LLT+ TT+ ++ ++A G    +F+++F 
Sbjct  244  ISEMDPGSYKTFDTSYYRHVAKRRGLFSSDASLLTDATTRDYVRRIATGKFDAEFFSDFG  303

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G +QV TG +GEIRK+C V+N
Sbjct  304  ESMTKMGNVQVLTGEEGEIRKKCYVIN  330



>gb|ACR61552.1| peroxidase 2 [Zea mays]
 gb|AFW78556.1| peroxidase R15 [Zea mays]
Length=323

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSF+TFDL YY  V KRRGLF SDA LL +P+T++++ + A G+ +D F+A+FA
Sbjct  237  LVEMDPGSFRTFDLGYYANVAKRRGLFHSDAQLLADPSTRAYVLRHATGAHRDEFFADFA  296

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G + V TG  GE+RK+C VVN
Sbjct  297  ASMVKMGSVGVLTGGQGEVRKKCNVVN  323



>ref|NP_001057469.2| Os06g0306300 [Oryza sativa Japonica Group]
 dbj|BAF19383.2| Os06g0306300, partial [Oryza sativa Japonica Group]
Length=387

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQ-DFYAEFA  329
            I EMDPGS+KTFD SYY+ V KRRGLF SDA+LLT+ TT+ ++ ++A G    +F+++F 
Sbjct  300  ISEMDPGSYKTFDTSYYRHVAKRRGLFSSDASLLTDATTRDYVRRIATGKFDAEFFSDFG  359

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G +QV TG +GEIRK+C V+N
Sbjct  360  ESMTKMGNVQVLTGEEGEIRKKCYVIN  386



>tpe|CAH69322.1| TPA: class III peroxidase 80 precursor [Oryza sativa Japonica 
Group]
Length=323

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = -2

Query  499  EMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFATS  323
            EMDPGS+KTFD SYY+ V KRRGLF SDA+LLT+ TT+ ++ ++A G   D F+ +F  S
Sbjct  239  EMDPGSYKTFDTSYYRHVAKRRGLFSSDASLLTDATTRGYVQRIATGKFDDEFFRDFGES  298

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            + K+G + V TG+DGEIRK+C V+N
Sbjct  299  MTKMGNVAVLTGADGEIRKKCYVIN  323



>ref|NP_001057675.2| Os06g0490400 [Oryza sativa Japonica Group]
 dbj|BAD45333.1| putative Peroxidase 1 precursor [Oryza sativa Japonica Group]
 gb|EAZ37066.1| hypothetical protein OsJ_21409 [Oryza sativa Japonica Group]
 dbj|BAF19589.2| Os06g0490400 [Oryza sativa Japonica Group]
Length=324

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = -2

Query  499  EMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFATS  323
            EMDPGS+KTFD SYY+ V KRRGLF SDA+LLT+ TT+ ++ ++A G   D F+ +F  S
Sbjct  240  EMDPGSYKTFDTSYYRHVAKRRGLFSSDASLLTDATTRGYVQRIATGKFDDEFFRDFGES  299

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            + K+G + V TG+DGEIRK+C V+N
Sbjct  300  MTKMGNVAVLTGADGEIRKKCYVIN  324



>ref|XP_006656386.1| PREDICTED: peroxidase 3-like [Oryza brachyantha]
Length=335

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFDLSYY+ +LKRRGLF+SDAAL+T+   K+ I  +     + F+  FA 
Sbjct  247  IVEMDPGSFLTFDLSYYRGLLKRRGLFQSDAALVTDAAAKANIASVVGSPPEVFFQVFAR  306

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ KLG + VKTGS+GEIRK CA+VN
Sbjct  307  SMVKLGMVDVKTGSEGEIRKHCALVN  332



>gb|EAZ01004.1| hypothetical protein OsI_23038 [Oryza sativa Indica Group]
Length=324

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = -2

Query  499  EMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFATS  323
            EMDPGS+KTFD SYY+ V KRRGLF SDA+LLT+ TT+ ++ ++A G   D F+ +F  S
Sbjct  240  EMDPGSYKTFDTSYYRHVAKRRGLFSSDASLLTDATTRGYVQRIATGKFDDEFFRDFGES  299

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            + K+G + V TG+DGEIRK+C V+N
Sbjct  300  MTKMGNVAVLTGADGEIRKKCYVIN  324



>gb|AIV42034.1| peroxidase [Saccharum arundinaceum]
Length=331

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFDLSYY+ VLKRRGLF+SDAAL+T+ T+K+ I  +     + F+  FA 
Sbjct  244  IVEMDPGSFLTFDLSYYRGVLKRRGLFQSDAALITDATSKADILSVVNAPPEVFFQVFAR  303

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ ++G I VKTG +GEIRK CA+VN
Sbjct  304  SMVRMGAIDVKTGFEGEIRKHCALVN  329



>gb|AFW81710.1| hypothetical protein ZEAMMB73_539966 [Zea mays]
 gb|AFW81711.1| hypothetical protein ZEAMMB73_730343 [Zea mays]
Length=284

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSF+TFDL YY  V KRRG+F SDA LL +P+T++++ + A G+ +D F+A+FA
Sbjct  198  LVEMDPGSFRTFDLGYYANVAKRRGVFHSDAQLLADPSTRAYVLRHATGAHRDEFFADFA  257

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G + V TG  GE+RK+C VVN
Sbjct  258  ASMVKMGAVGVLTGGQGEVRKKCNVVN  284



>gb|KEH29649.1| peroxidase family protein [Medicago truncatula]
Length=326

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 66/86 (77%), Gaps = 1/86 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            ++EMDPGS  TFDL Y+K V+KRRGLF+SDAALL + TT+S + +  Q S + F+ EF  
Sbjct  242  LIEMDPGSRNTFDLGYFKQVVKRRGLFQSDAALLKSSTTRSILAQHLQ-SNEKFFTEFGR  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI VK G++GEIRK CA +N
Sbjct  301  SMEKMGRINVKIGTEGEIRKHCAFIN  326



>ref|XP_008780520.1| PREDICTED: peroxidase 56-like, partial [Phoenix dactylifera]
Length=179

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 66/88 (75%), Gaps = 2/88 (2%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQ--GSLQDFYAEF  332
            IVEMDPGSF+TFD SYYKLV KRR LF SDA L+ +  TK+++++ AQ  G   +F+ +F
Sbjct  92   IVEMDPGSFRTFDTSYYKLVAKRRALFTSDATLILDSQTKAYVERQAQANGFPSEFFRDF  151

Query  331  ATSVEKLGRIQVKTGSDGEIRKQCAVVN  248
              S+ K+G I+V TG+ GEIRK+CA VN
Sbjct  152  GESMVKMGNIEVLTGNQGEIRKKCAFVN  179



>ref|XP_010923934.1| PREDICTED: peroxidase 1-like [Elaeis guineensis]
Length=326

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSL-QDFYAEFA  329
            +VEMDPGSF+TFD SYY LV KRRGLFESDAALL N  T++++ + A G+   +F+ +F 
Sbjct  240  LVEMDPGSFRTFDTSYYSLVSKRRGLFESDAALLQNSQTRAYVLRQAGGAFASEFFKDFG  299

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+  +G IQV TG+ GEIRK CA VN
Sbjct  300  DSMINMGNIQVLTGAQGEIRKTCAFVN  326



>ref|XP_002438300.1| hypothetical protein SORBIDRAFT_10g011290 [Sorghum bicolor]
 gb|EER89667.1| hypothetical protein SORBIDRAFT_10g011290 [Sorghum bicolor]
Length=332

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 66/85 (78%), Gaps = 1/85 (1%)
 Frame = -2

Query  499  EMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFATS  323
            EMDPGS+KTFD SYY+ V KRRGLF+SDAALLT+  T+ +++++A G   D F+ +F+ S
Sbjct  248  EMDPGSYKTFDTSYYRHVAKRRGLFQSDAALLTDAATRDYVERIATGKFDDVFFKDFSES  307

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            + K+G + V TG DGEIRK+C +VN
Sbjct  308  MIKMGNVGVITGVDGEIRKKCYIVN  332



>ref|XP_009382683.1| PREDICTED: peroxidase 3-like [Musa acuminata subsp. malaccensis]
Length=326

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF+TFDL YYK +L+RRGLF SDAAL T+  TKS I +L    ++ F+ EF  
Sbjct  240  IVEMDPGSFRTFDLGYYKHLLQRRGLFRSDAALATDAATKSAIIQLVNSPMEVFFKEFGL  299

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI+VKTGS GEIRK CAV+N
Sbjct  300  SMEKMGRIEVKTGSAGEIRKNCAVIN  325



>ref|XP_002436932.1| hypothetical protein SORBIDRAFT_10g011510 [Sorghum bicolor]
 gb|EER88299.1| hypothetical protein SORBIDRAFT_10g011510 [Sorghum bicolor]
Length=339

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            + EMDPGS+KTFD SYY+ V KRRGLF+SDAALLT+ TT+ ++ ++A G   D F+ +F+
Sbjct  253  LSEMDPGSYKTFDTSYYRHVAKRRGLFQSDAALLTDATTREYVQRIATGKFDDVFFKDFS  312

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G + V TG DGEIRK+C V N
Sbjct  313  ESMIKMGSVGVLTGVDGEIRKKCYVAN  339



>ref|XP_008657600.1| PREDICTED: peroxidase 1-like [Zea mays]
Length=327

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSF+TFDL YY  V KRRG+F SDA LL +P+T++++ + A G+ +D F+A+FA
Sbjct  241  LVEMDPGSFRTFDLGYYANVAKRRGVFHSDAQLLADPSTRAYVLRHATGAHRDEFFADFA  300

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G + V TG  GE+RK+C VVN
Sbjct  301  ASMVKMGAVGVLTGGQGEVRKKCNVVN  327



>ref|XP_008657599.1| PREDICTED: peroxidase 1-like [Zea mays]
Length=349

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSF+TFDL YY  V KRRG+F SDA LL +P+T++++ + A G+ +D F+A+FA
Sbjct  263  LVEMDPGSFRTFDLGYYANVAKRRGVFHSDAQLLADPSTRAYVLRHATGAHRDEFFADFA  322

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G + V TG  GE+RK+C VVN
Sbjct  323  ASMVKMGAVGVLTGGQGEVRKKCNVVN  349



>gb|EMS60388.1| Peroxidase 1 [Triticum urartu]
Length=341

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            +VEMDPGSFKTFD  Y+KLV KRRGLF SD ALLT+P T++++ + A G+  D F+A+FA
Sbjct  237  LVEMDPGSFKTFDTDYFKLVSKRRGLFHSDGALLTDPFTRAYVQRHATGAFMDEFFADFA  296

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAV  254
             S+ K+G     TGS GEIRK+C V
Sbjct  297  ASMIKMGNANPLTGSQGEIRKKCNV  321



>dbj|BAC84009.1| peroxidase 1 precursor-like protein [Oryza sativa Japonica Group]
Length=157

 Score =   102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSL-QDFYAEFA  329
            + EMDPGSF TFD SYY+LV KRRG+F SD+ALLT+P T++++++ A G    DF+ +FA
Sbjct  70   LSEMDPGSFLTFDASYYRLVAKRRGIFHSDSALLTDPVTRAYVERQATGHFADDFFRDFA  129

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+  I V TG+ GEIR +C  +N
Sbjct  130  DSMVKMSTIDVLTGAQGEIRNKCYAIN  156



>gb|ACL52390.1| unknown [Zea mays]
Length=338

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            + EMDPGS+KTFD SYY+ V KRRGLF+SDAALL + TT+ ++ ++A G   D F+ +FA
Sbjct  252  LSEMDPGSYKTFDTSYYRHVAKRRGLFQSDAALLADATTREYVHRIATGKFDDVFFKDFA  311

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+  + V TG++GEIRK+C +VN
Sbjct  312  ESMTKMANVAVLTGAEGEIRKKCYIVN  338



>ref|NP_001146942.1| peroxidase 1 precursor [Zea mays]
 gb|ACG24592.1| peroxidase 1 precursor [Zea mays]
 gb|AFW77040.1| peroxidase 1 [Zea mays]
Length=338

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            + EMDPGS+KTFD SYY+ V KRRGLF+SDAALL + TT+ ++ ++A G   D F+ +FA
Sbjct  252  LSEMDPGSYKTFDTSYYRHVAKRRGLFQSDAALLADATTREYVHRIATGKFDDVFFNDFA  311

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+  + V TG++GEIRK+C +VN
Sbjct  312  ESMTKMANVDVLTGAEGEIRKKCYIVN  338



>ref|XP_008455410.1| PREDICTED: peroxidase 27-like [Cucumis melo]
Length=328

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSFKTFD SYY LV KRRGLF+SD+ALL +P TK+++   A+     F A+FA 
Sbjct  243  IVEMDPGSFKTFDHSYYTLVSKRRGLFQSDSALLDDPDTKAYVQLQARTRGATFAADFAE  302

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+  +G I V TG+DGEIR++C  VN
Sbjct  303  SMINMGNIGVLTGTDGEIRRRCGFVN  328



>ref|XP_003568172.1| PREDICTED: peroxidase 1 [Brachypodium distachyon]
 gb|ACR61559.1| peroxidase 2 [Brachypodium distachyon]
Length=324

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSL-QDFYAEFA  329
            +VEMDPGSFKTFDL Y+ +V KRRGLF SD ALLT+  T++++ + A G+  ++F+A+FA
Sbjct  236  LVEMDPGSFKTFDLDYFTVVAKRRGLFHSDGALLTDDFTRAYVQRHAGGAFKEEFFADFA  295

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G + V TG+ GEIRK+C+V N
Sbjct  296  ASMIKMGNVDVLTGTQGEIRKKCSVPN  322



>ref|NP_001058691.1| Os07g0104100 [Oryza sativa Japonica Group]
 dbj|BAF20605.1| Os07g0104100, partial [Oryza sativa Japonica Group]
Length=169

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSL-QDFYAEFA  329
            + EMDPGSF TFD SYY+LV KRRG+F SD+ALLT+P T++++++ A G    DF+ +FA
Sbjct  82   LSEMDPGSFLTFDASYYRLVAKRRGIFHSDSALLTDPVTRAYVERQATGHFADDFFRDFA  141

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+  I V TG+ GEIR +C  +N
Sbjct  142  DSMVKMSTIDVLTGAQGEIRNKCYAIN  168



>gb|EYU24798.1| hypothetical protein MIMGU_mgv1a009213mg [Erythranthe guttata]
Length=349

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 3/88 (3%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLA--QGSLQDFYAEF  332
            +VEMDPGSFKTFD+ YY LV KRRGLF SDAALL +  T++++   A  QGS +DF  +F
Sbjct  263  LVEMDPGSFKTFDIEYYTLVAKRRGLFTSDAALLADSETRAYVTSHATPQGS-KDFLKDF  321

Query  331  ATSVEKLGRIQVKTGSDGEIRKQCAVVN  248
            A S+ K+G+I V TGS GEIRK CA +N
Sbjct  322  AKSMVKMGKIGVLTGSQGEIRKTCAFIN  349



>gb|KHG20863.1| Peroxidase 27 -like protein [Gossypium arboreum]
Length=326

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 66/86 (77%), Gaps = 1/86 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            +VEMDPGSFKTFD +YY LV KRRGLF SDAALL N  TK+++ + ++     F  +FA 
Sbjct  242  LVEMDPGSFKTFDEAYYTLVSKRRGLFGSDAALLNNAETKAYVLQASRHG-STFARDFAV  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+G+++V TG+ GEIRK CA+VN
Sbjct  301  SMEKMGKVEVLTGNQGEIRKHCAMVN  326



>ref|XP_010908221.1| PREDICTED: peroxidase 1-like [Elaeis guineensis]
Length=329

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 66/88 (75%), Gaps = 2/88 (2%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGS--LQDFYAEF  332
            +VEMDPGSFKTFD SYYKLV KRRGLF SDA L+ +  TK++I++ AQ S    +F+ +F
Sbjct  242  LVEMDPGSFKTFDTSYYKLVAKRRGLFTSDATLILDGQTKAYIERQAQASGFPSEFFKDF  301

Query  331  ATSVEKLGRIQVKTGSDGEIRKQCAVVN  248
              S+ K+G I V TG+ GEIRK+CA VN
Sbjct  302  GESMVKMGNIGVLTGNQGEIRKRCAFVN  329



>ref|XP_006356926.1| PREDICTED: peroxidase 56-like [Solanum tuberosum]
Length=337

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSFK FD SYY LV KRRGLF+SDAALL +  TK+++   A      F+ +FA 
Sbjct  252  IVEMDPGSFKIFDGSYYSLVEKRRGLFQSDAALLDDNETKAYVKLQAMSHGSTFFKDFAE  311

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+EK+GRI V TG  GEIRK+C+ +N
Sbjct  312  SMEKMGRIGVLTGKAGEIRKRCSFIN  337



>ref|XP_008659484.1| PREDICTED: peroxidase 1-like [Zea mays]
 gb|AFW86435.1| hypothetical protein ZEAMMB73_084509 [Zea mays]
Length=336

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            + EMDPGSFKTFD SYY+ V KRRGLF+SDAALL + TT+ ++ ++A G   D F+ +F+
Sbjct  250  LSEMDPGSFKTFDTSYYRHVAKRRGLFQSDAALLADATTREYVQRIATGRFDDEFFNDFS  309

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G + V TG+ GEIR++C +VN
Sbjct  310  ESMVKMGNVGVLTGAQGEIRRKCYIVN  336



>ref|XP_007045600.1| Peroxidase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY01432.1| Peroxidase superfamily protein isoform 2 [Theobroma cacao]
Length=258

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            VEMDPGS  TFDLSYY L+ KRRGLF SDAAL TN T+ + I++L    L+ FYAEFA S
Sbjct  180  VEMDPGSRNTFDLSYYTLLTKRRGLFNSDAALTTNSTSLALINQLLSNPLKFFYAEFAKS  239

Query  322  VEKLGRIQVKTGSDG  278
            +EK+GRI VKTGS+G
Sbjct  240  MEKMGRINVKTGSEG  254



>gb|EMT32565.1| Peroxidase 1 [Aegilops tauschii]
Length=329

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQ-DFYAEFA  329
            + EMDPGSFKTFD SYY+ V KRRGLF SDAALL + TTK ++ ++A G+   DF+ +F+
Sbjct  243  LSEMDPGSFKTFDTSYYRHVAKRRGLFRSDAALLFDATTKDYVQRIATGTFDGDFFRDFS  302

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G + V TG++GEIRK+C V+N
Sbjct  303  ESMIKMGDVGVLTGAEGEIRKKCHVLN  329



>ref|XP_009117679.1| PREDICTED: peroxidase 27-like [Brassica rapa]
Length=319

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            +EMDPGSFKTFD+SY+KLV KRRGLF+SDAALL N  T++++ + A+GS   F+ +F  S
Sbjct  237  LEMDPGSFKTFDVSYFKLVAKRRGLFQSDAALLDNSKTRAYVLQQARGS--TFFHDFGVS  294

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            + K+GRI V TG  GEIRK C V N
Sbjct  295  MVKMGRIGVLTGRTGEIRKMCRVPN  319



>emb|CDY55811.1| BnaCnng29190D [Brassica napus]
Length=319

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = -2

Query  502  VEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFATS  323
            +EMDPGSFKTFD+SY+KLV KRRGLF+SDAALL N  T++++ + A+GS   F+ +F  S
Sbjct  237  LEMDPGSFKTFDVSYFKLVAKRRGLFQSDAALLDNSKTRAYVLQQARGS--TFFHDFGVS  294

Query  322  VEKLGRIQVKTGSDGEIRKQCAVVN  248
            + K+GRI V TG  GEIRK C V N
Sbjct  295  MVKMGRIGVLTGRTGEIRKMCRVPN  319



>ref|XP_002518541.1| Peroxidase 27 precursor, putative [Ricinus communis]
 gb|EEF43928.1| Peroxidase 27 precursor, putative [Ricinus communis]
Length=330

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            +VEMDPGSFKTFD SY+ LV KRRGLF+SDAALL N  TK++I   A      F+ +F  
Sbjct  245  LVEMDPGSFKTFDESYFTLVSKRRGLFQSDAALLDNRVTKNYIKLQAATKSSTFFKDFGV  304

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ K+GR+ V TGS GEIRK C++VN
Sbjct  305  SMVKMGRVDVLTGSAGEIRKVCSMVN  330



>ref|XP_002268360.1| PREDICTED: peroxidase 27 [Vitis vinifera]
Length=326

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            +VEMDPGSFKTFD SYY LV KRRGLF SDAALL +  TK+++   A      F+ +F  
Sbjct  241  LVEMDPGSFKTFDESYYTLVGKRRGLFVSDAALLDDSETKAYVKLQATTHGSTFFEDFGV  300

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ K+GRI V TGS GEIRK+CA+VN
Sbjct  301  SMIKMGRIGVLTGSSGEIRKECALVN  326



>ref|XP_004965311.1| PREDICTED: peroxidase 1-like [Setaria italica]
Length=329

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQD-FYAEFA  329
            + EMDPGS+KTFD SYY+ V KRRGLF+SDAALLT+  T+ ++  +A G   D F+ +F+
Sbjct  243  LSEMDPGSYKTFDTSYYRHVAKRRGLFQSDAALLTDAATRDYVQHIATGKFDDVFFKDFS  302

Query  328  TSVEKLGRIQVKTGSDGEIRKQCAVVN  248
             S+ K+G + V TG++GEIRK+C +VN
Sbjct  303  ESMIKMGNVGVLTGAEGEIRKKCYIVN  329



>ref|NP_001058379.1| Os06g0681600 [Oryza sativa Japonica Group]
 dbj|BAD45893.1| putative peroxidase [Oryza sativa Japonica Group]
 dbj|BAF20293.1| Os06g0681600 [Oryza sativa Japonica Group]
 dbj|BAG87848.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97497.1| unnamed protein product [Oryza sativa Japonica Group]
Length=337

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  505  IVEMDPGSFKTFDLSYYKLVLKRRGLFESDAALLTNPTTKSFIDKLAQGSLQDFYAEFAT  326
            IVEMDPGSF TFDL YY+ +L+RRGLF+SDAAL+T+   ++ I  +     + F+  FA 
Sbjct  248  IVEMDPGSFLTFDLGYYRGLLRRRGLFQSDAALVTDAAAEANIASVVSSPPEVFFQVFAR  307

Query  325  SVEKLGRIQVKTGSDGEIRKQCAVVN  248
            S+ KLG + VKTGS+GEIRK CA+VN
Sbjct  308  SMAKLGMVGVKTGSEGEIRKHCALVN  333



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517811659326