BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19569_g1_i3 len=828 path=[856:0-245 1100:246-827]

Length=828
                                                                      Score     E

dbj|BAL43558.1|  type-A response regulator                              191   6e-57   
ref|XP_010322123.1|  PREDICTED: LOW QUALITY PROTEIN: two-componen...    191   1e-56   
gb|KHG06264.1|  Two-component response regulator ARR17 -like protein    189   3e-56   
ref|XP_006358744.1|  PREDICTED: two-component response regulator ...    188   7e-56   
ref|XP_006357298.1|  PREDICTED: two-component response regulator ...    188   1e-55   
ref|XP_004240845.1|  PREDICTED: two-component response regulator ...    187   2e-55   
ref|XP_009768329.1|  PREDICTED: two-component response regulator ...    186   3e-55   
ref|XP_011001387.1|  PREDICTED: two-component response regulator ...    186   4e-55   
ref|XP_002325489.1|  hypothetical protein POPTR_0019s08690g             186   4e-55   Populus trichocarpa [western balsam poplar]
gb|KEH35531.1|  two-component response regulator ARR3-like protein      186   5e-55   
emb|CBI25350.3|  unnamed protein product                                185   9e-55   
emb|CBX43990.1|  putative A-type response regulator 8                   185   9e-55   
ref|XP_002280746.1|  PREDICTED: two-component response regulator ...    185   1e-54   Vitis vinifera
ref|XP_007136418.1|  hypothetical protein PHAVU_009G043400g             185   1e-54   
ref|XP_009623473.1|  PREDICTED: two-component response regulator ...    184   2e-54   
gb|KDP21642.1|  hypothetical protein JCGZ_03313                         184   4e-54   
ref|XP_010103657.1|  Two-component response regulator                   183   6e-54   
dbj|BAM74646.1|  type-A response regulator                              182   7e-54   
ref|XP_009590654.1|  PREDICTED: two-component response regulator ...    182   1e-53   
gb|EYU35194.1|  hypothetical protein MIMGU_mgv1a015731mg                182   2e-53   
ref|XP_002520876.1|  two-component system sensor histidine kinase...    181   4e-53   Ricinus communis
ref|XP_010658172.1|  PREDICTED: two-component response regulator ...    181   5e-53   
ref|NP_001236551.1|  uncharacterized protein LOC100499827               181   6e-53   
ref|XP_011084814.1|  PREDICTED: LOW QUALITY PROTEIN: two-componen...    179   1e-52   
ref|XP_007011279.1|  Two-component response regulator ARR17             182   1e-52   
ref|NP_001241393.1|  uncharacterized protein LOC100778707               179   1e-52   
ref|XP_008233888.1|  PREDICTED: two-component response regulator ...    180   2e-52   
ref|XP_009774749.1|  PREDICTED: two-component response regulator ...    179   2e-52   
ref|XP_009362787.1|  PREDICTED: two-component response regulator ...    179   3e-52   
ref|XP_009349081.1|  PREDICTED: two-component response regulator ...    179   3e-52   
emb|CAN60564.1|  hypothetical protein VITISV_013996                     179   3e-52   Vitis vinifera
ref|XP_007219229.1|  hypothetical protein PRUPE_ppa017797mg             179   5e-52   
ref|XP_008388361.1|  PREDICTED: two-component response regulator ...    178   5e-52   
ref|XP_010427458.1|  PREDICTED: two-component response regulator ...    178   6e-52   
ref|NP_567037.1|  two-component response regulator ARR17                178   8e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010507480.1|  PREDICTED: two-component response regulator ...    177   8e-52   
ref|XP_010525415.1|  PREDICTED: two-component response regulator ...    177   1e-51   
ref|XP_009363791.1|  PREDICTED: two-component response regulator ...    177   1e-51   
ref|XP_006292820.1|  hypothetical protein CARUB_v10019069mg             175   7e-51   
ref|XP_002879884.1|  hypothetical protein ARALYDRAFT_483126             176   7e-51   
ref|NP_181599.1|  two-component response regulator ARR16                174   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004308985.1|  PREDICTED: two-component response regulator ...    174   2e-50   
ref|XP_002876364.1|  predicted protein                                  174   3e-50   
ref|XP_010427456.1|  PREDICTED: two-component response regulator ...    174   3e-50   
ref|XP_008369375.1|  PREDICTED: two-component response regulator ...    174   4e-50   
ref|XP_010525414.1|  PREDICTED: two-component response regulator ...    173   8e-50   
ref|XP_006402992.1|  hypothetical protein EUTSA_v10006466mg             172   8e-50   
ref|XP_010670065.1|  PREDICTED: two-component response regulator ...    172   2e-49   
gb|AAQ10676.1|  type-A response regulator                               171   2e-49   Catharanthus roseus [chatas]
ref|XP_009116343.1|  PREDICTED: two-component response regulator ...    171   3e-49   
ref|XP_006411334.1|  hypothetical protein EUTSA_v10017348mg             171   4e-49   
ref|XP_004502823.1|  PREDICTED: LOW QUALITY PROTEIN: two-componen...    171   4e-49   
ref|XP_006295142.1|  hypothetical protein CARUB_v10024214mg             171   4e-49   
ref|NP_001189722.1|  two-component response regulator ARR16             170   1e-48   
ref|XP_010067618.1|  PREDICTED: two-component response regulator ...    169   2e-48   
ref|XP_010508821.1|  PREDICTED: two-component response regulator ...    169   2e-48   
ref|XP_008245269.1|  PREDICTED: two-component response regulator ...    169   3e-48   
ref|XP_010505820.1|  PREDICTED: two-component response regulator ...    169   3e-48   
ref|XP_009139105.1|  PREDICTED: two-component response regulator ...    168   4e-48   
ref|XP_010517508.1|  PREDICTED: two-component response regulator ...    169   4e-48   
ref|XP_007208607.1|  hypothetical protein PRUPE_ppa021876mg             168   6e-48   
ref|XP_011009512.1|  PREDICTED: two-component response regulator ...    167   1e-47   
ref|XP_009133449.1|  PREDICTED: two-component response regulator ...    167   1e-47   
ref|XP_009116342.1|  PREDICTED: two-component response regulator ...    166   2e-47   
ref|XP_006295143.1|  hypothetical protein CARUB_v10024214mg             166   3e-47   
ref|XP_002326060.1|  hypothetical protein POPTR_0019s15410g             166   5e-47   Populus trichocarpa [western balsam poplar]
emb|CDP04042.1|  unnamed protein product                                164   1e-46   
emb|CDY22469.1|  BnaC03g22790D                                          164   1e-46   
ref|XP_010508820.1|  PREDICTED: two-component response regulator ...    165   1e-46   
ref|XP_010505819.1|  PREDICTED: two-component response regulator ...    164   2e-46   
ref|XP_009139104.1|  PREDICTED: two-component response regulator ...    163   2e-46   
ref|XP_010517507.1|  PREDICTED: two-component response regulator ...    164   3e-46   
gb|KDO67530.1|  hypothetical protein CISIN_1g042079mg                   163   3e-46   
gb|KFK36940.1|  hypothetical protein AALP_AA4G192000                    163   3e-46   
ref|XP_006435932.1|  hypothetical protein CICLE_v10032983mg             163   3e-46   
ref|XP_009133448.1|  PREDICTED: two-component response regulator ...    163   7e-46   
ref|XP_007208910.1|  hypothetical protein PRUPE_ppa027113mg             163   7e-46   
ref|XP_006470938.1|  PREDICTED: two-component response regulator ...    164   7e-46   
ref|XP_011088585.1|  PREDICTED: two-component response regulator ...    163   8e-46   
gb|KDO49056.1|  hypothetical protein CISIN_1g046192mg                   163   1e-45   
ref|XP_006420721.1|  hypothetical protein CICLE_v10005987mg             163   1e-45   
ref|XP_009594904.1|  PREDICTED: two-component response regulator ...    164   2e-45   
ref|XP_008239693.1|  PREDICTED: two-component response regulator ...    163   4e-45   
ref|XP_009139049.1|  PREDICTED: two-component response regulator ...    162   1e-44   
emb|CDX76036.1|  BnaA04g03000D                                          161   1e-44   
ref|XP_002511471.1|  two-component sensor protein histidine prote...    161   2e-44   Ricinus communis
gb|KFK36939.1|  hypothetical protein AALP_AA4G192000                    159   2e-44   
ref|XP_009803217.1|  PREDICTED: two-component response regulator ...    161   2e-44   
ref|XP_002888998.1|  hypothetical protein ARALYDRAFT_316423             160   2e-44   
ref|XP_010111960.1|  Two-component response regulator                   161   2e-44   
gb|ABG35779.1|  SRR200                                                  159   2e-44   Striga asiatica [witchweed]
ref|XP_002876392.1|  hypothetical protein ARALYDRAFT_486148             160   3e-44   
gb|EYU38278.1|  hypothetical protein MIMGU_mgv1a019913mg                158   3e-44   
ref|XP_008360657.1|  PREDICTED: two-component response regulator ...    159   4e-44   
gb|KDP31161.1|  hypothetical protein JCGZ_11537                         160   4e-44   
ref|XP_009364893.1|  PREDICTED: two-component response regulator ...    158   4e-44   
ref|XP_009788178.1|  PREDICTED: two-component response regulator ...    159   5e-44   
gb|ABQ95670.1|  type A response regulator                               159   5e-44   
emb|CDX72077.1|  BnaC08g27970D                                          160   6e-44   
ref|XP_002267932.1|  PREDICTED: two-component response regulator ...    157   7e-44   Vitis vinifera
emb|CDY06142.1|  BnaA09g36380D                                          159   9e-44   
ref|XP_009626719.1|  PREDICTED: two-component response regulator ...    159   1e-43   
ref|XP_006402918.1|  hypothetical protein EUTSA_v10006209mg             159   1e-43   
emb|CBX43986.1|  putative A-type response regulator 4                   158   1e-43   
ref|XP_011091843.1|  PREDICTED: two-component response regulator ...    157   1e-43   
gb|EYU34521.1|  hypothetical protein MIMGU_mgv1a018237mg                157   1e-43   
ref|XP_010516309.1|  PREDICTED: two-component response regulator ...    159   1e-43   
ref|XP_002304795.2|  hypothetical protein POPTR_0003s19710g             157   2e-43   Populus trichocarpa [western balsam poplar]
emb|CDY21807.1|  BnaA06g20760D                                          157   2e-43   
ref|NP_191263.1|  two-component response regulator ARR9                 159   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302845.1|  hypothetical protein CARUB_v10020975mg             158   2e-43   
ref|XP_010444157.1|  PREDICTED: two-component response regulator ...    157   2e-43   
ref|XP_009604813.1|  PREDICTED: two-component response regulator ...    158   2e-43   
emb|CDY45402.1|  BnaA07g31820D                                          157   2e-43   
emb|CDX73122.1|  BnaC06g35700D                                          157   2e-43   
ref|XP_008374475.1|  PREDICTED: two-component response regulator ...    158   2e-43   
ref|XP_009626718.1|  PREDICTED: two-component response regulator ...    158   2e-43   
ref|XP_002322144.1|  hypothetical protein POPTR_0015s08130g             158   2e-43   Populus trichocarpa [western balsam poplar]
ref|XP_009622543.1|  PREDICTED: two-component response regulator ...    157   3e-43   
emb|CDY59856.1|  BnaCnng35610D                                          157   3e-43   
ref|XP_010504623.1|  PREDICTED: two-component response regulator ...    158   3e-43   
ref|XP_006390374.1|  hypothetical protein EUTSA_v10019119mg             157   3e-43   
ref|XP_010459459.1|  PREDICTED: two-component response regulator ...    157   4e-43   
dbj|BAL43557.1|  type-A response regulator                              157   4e-43   
ref|XP_007155382.1|  hypothetical protein PHAVU_003G196500g             157   5e-43   
gb|AFK34510.1|  unknown                                                 155   5e-43   
emb|CDY30966.1|  BnaC04g24580D                                          157   5e-43   
ref|XP_004249241.1|  PREDICTED: two-component response regulator ...    157   6e-43   
gb|AAQ10677.1|  type-A response regulator                               156   6e-43   Catharanthus roseus [chatas]
ref|XP_004299595.1|  PREDICTED: two-component response regulator ...    157   6e-43   
ref|XP_010426279.1|  PREDICTED: two-component response regulator ...    156   6e-43   
ref|XP_007036075.1|  Two-component response regulator ARR5              157   6e-43   
gb|KFK28019.1|  hypothetical protein AALP_AA8G460900                    156   6e-43   
ref|XP_009768331.1|  PREDICTED: two-component response regulator ...    154   6e-43   
ref|XP_009142738.1|  PREDICTED: two-component response regulator ...    157   6e-43   
gb|KEH35092.1|  two-component response regulator ARR3-like protein      156   7e-43   
ref|XP_010484006.1|  PREDICTED: two-component response regulator ...    156   7e-43   
ref|XP_007155380.1|  hypothetical protein PHAVU_003G196300g             156   8e-43   
ref|XP_011020390.1|  PREDICTED: two-component response regulator ...    155   9e-43   
ref|XP_006291901.1|  hypothetical protein CARUB_v10018078mg             155   9e-43   
ref|XP_009106145.1|  PREDICTED: LOW QUALITY PROTEIN: two-componen...    156   1e-42   
ref|XP_006351276.1|  PREDICTED: two-component response regulator ...    157   1e-42   
emb|CDY70164.1|  BnaCnng67000D                                          155   1e-42   
ref|XP_006394337.1|  hypothetical protein EUTSA_v10004962mg             155   1e-42   
ref|XP_010508734.1|  PREDICTED: two-component response regulator ...    157   1e-42   
ref|XP_011028652.1|  PREDICTED: two-component response regulator ...    157   1e-42   
ref|XP_009149845.1|  PREDICTED: two-component response regulator ...    155   1e-42   
ref|XP_010503433.1|  PREDICTED: two-component response regulator ...    156   1e-42   
ref|XP_002268352.1|  PREDICTED: two-component response regulator ...    155   1e-42   Vitis vinifera
ref|XP_002877596.1|  hypothetical protein ARALYDRAFT_906046             155   1e-42   
ref|NP_201097.1|  two-component response regulator ARR6                 155   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427564.1|  PREDICTED: two-component response regulator ...    157   1e-42   
ref|XP_003549646.1|  PREDICTED: two-component response regulator ...    155   1e-42   
emb|CDX79942.1|  BnaA05g02140D                                          156   1e-42   
ref|XP_004511028.1|  PREDICTED: two-component response regulator ...    155   1e-42   
ref|XP_010505899.1|  PREDICTED: two-component response regulator ...    156   1e-42   
ref|XP_009374451.1|  PREDICTED: two-component response regulator ...    154   1e-42   
ref|XP_010517619.1|  PREDICTED: two-component response regulator ...    156   1e-42   
ref|XP_008384995.1|  PREDICTED: two-component response regulator ...    154   1e-42   
gb|KFK44048.1|  hypothetical protein AALP_AA1G208700                    155   2e-42   
ref|NP_173339.1|  two-component response regulator ARR7                 155   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404297.1|  hypothetical protein EUTSA_v10010754mg             155   2e-42   
ref|XP_010550669.1|  PREDICTED: two-component response regulator ...    155   2e-42   
ref|XP_004501966.1|  PREDICTED: two-component response regulator ...    155   2e-42   
emb|CDY22518.1|  BnaC03g23280D                                          155   2e-42   
ref|XP_010515122.1|  PREDICTED: two-component response regulator ...    155   2e-42   
emb|CDX83788.1|  BnaC08g18570D                                          155   2e-42   
ref|XP_010645611.1|  PREDICTED: two-component response regulator ...    153   2e-42   
ref|XP_006304102.1|  hypothetical protein CARUB_v10010030mg             157   2e-42   
ref|NP_177627.1|  two-component response regulator ARR15                155   3e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294950.1|  hypothetical protein CARUB_v10024006mg             155   3e-42   
emb|CBI40157.3|  unnamed protein product                                154   3e-42   
ref|XP_010477106.1|  PREDICTED: two-component response regulator ...    155   3e-42   
emb|CDY54257.1|  BnaC01g42890D                                          154   3e-42   
ref|XP_010416347.1|  PREDICTED: two-component response regulator ...    154   3e-42   
ref|XP_010459562.1|  PREDICTED: two-component response regulator ...    155   3e-42   
ref|XP_010498312.1|  PREDICTED: two-component response regulator ...    155   3e-42   
emb|CDX96681.1|  BnaA08g22240D                                          154   3e-42   
ref|XP_010269354.1|  PREDICTED: two-component response regulator ...    155   3e-42   
ref|XP_006577761.1|  PREDICTED: uncharacterized protein LOC100306...    154   4e-42   
ref|XP_007138131.1|  hypothetical protein PHAVU_009G182800g             154   4e-42   
gb|KFK34102.1|  hypothetical protein AALP_AA5G102300                    154   4e-42   
emb|CDY14761.1|  BnaC04g47580D                                          155   4e-42   
ref|XP_009765982.1|  PREDICTED: two-component response regulator ...    154   4e-42   
ref|XP_006411396.1|  hypothetical protein EUTSA_v10017200mg             155   4e-42   
ref|NP_181663.1|  response regulator 3                                  155   4e-42   Arabidopsis thaliana [mouse-ear cress]
gb|ABG35777.1|  SRR217                                                  155   4e-42   Striga asiatica [witchweed]
gb|KHG14174.1|  Two-component response regulator ARR6 -like protein     154   4e-42   
ref|NP_001238384.1|  uncharacterized protein LOC100306152               154   5e-42   
ref|XP_006304206.1|  hypothetical protein CARUB_v10010295mg             154   5e-42   
ref|XP_010458393.1|  PREDICTED: two-component response regulator ...    156   5e-42   
emb|CDX85860.1|  BnaC06g22740D                                          154   5e-42   
ref|XP_004249238.1|  PREDICTED: two-component response regulator ...    155   5e-42   
ref|XP_010277318.1|  PREDICTED: two-component response regulator ...    153   5e-42   
ref|NP_172517.1|  two-component response regulator ARR4                 155   5e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003545839.1|  PREDICTED: two-component response regulator ...    153   5e-42   
ref|XP_002267404.1|  PREDICTED: two-component response regulator ...    154   6e-42   Vitis vinifera
ref|XP_009606673.1|  PREDICTED: two-component response regulator ...    154   6e-42   
ref|XP_009110302.1|  PREDICTED: two-component response regulator ...    154   6e-42   
ref|XP_002283787.2|  PREDICTED: two-component response regulator ...    155   7e-42   Vitis vinifera
ref|XP_010428484.1|  PREDICTED: two-component response regulator ...    154   7e-42   
gb|KHN37666.1|  Two-component response regulator ARR8                   153   7e-42   
ref|XP_004296015.1|  PREDICTED: two-component response regulator ...    152   7e-42   
emb|CDY06934.1|  BnaA04g23810D                                          154   8e-42   
ref|NP_176202.1|  response regulator 3                                  154   8e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116409.1|  PREDICTED: two-component response regulator ...    154   8e-42   
ref|XP_010471585.1|  PREDICTED: two-component response regulator ...    154   8e-42   
ref|XP_002866522.1|  hypothetical protein ARALYDRAFT_496477             153   8e-42   
emb|CDY23856.1|  BnaC04g01810D                                          154   8e-42   
ref|XP_006301719.1|  hypothetical protein CARUB_v10022177mg             154   9e-42   
ref|XP_010475910.1|  PREDICTED: two-component response regulator ...    155   9e-42   
ref|XP_010414625.1|  PREDICTED: two-component response regulator ...    154   9e-42   
ref|XP_006579380.1|  PREDICTED: uncharacterized protein LOC100527...    154   1e-41   
ref|XP_006291782.1|  hypothetical protein CARUB_v10017962mg             154   1e-41   
ref|XP_010475909.1|  PREDICTED: two-component response regulator ...    155   1e-41   
gb|KFK34943.1|  hypothetical protein AALP_AA5G214000                    154   1e-41   
emb|CDP09526.1|  unnamed protein product                                154   1e-41   
ref|XP_002893028.1|  hypothetical protein ARALYDRAFT_889335             153   1e-41   
gb|KFK43337.1|  hypothetical protein AALP_AA1G111900                    154   1e-41   
ref|XP_002322145.2|  hypothetical protein POPTR_0015s08130g             154   1e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006281027.1|  hypothetical protein CARUB_v10027044mg             154   1e-41   
ref|XP_010554778.1|  PREDICTED: two-component response regulator ...    154   1e-41   
ref|XP_004238726.2|  PREDICTED: two-component response regulator ...    154   1e-41   
ref|XP_003541594.1|  PREDICTED: two-component response regulator ...    152   2e-41   
gb|AFK41993.1|  unknown                                                 153   2e-41   
ref|XP_006439725.1|  hypothetical protein CICLE_v10022334mg             152   2e-41   
ref|XP_006854776.1|  hypothetical protein AMTR_s00063p00116400          152   2e-41   
ref|XP_006417463.1|  hypothetical protein EUTSA_v10008575mg             154   2e-41   
emb|CBI15098.3|  unnamed protein product                                155   2e-41   
ref|XP_009151412.1|  PREDICTED: two-component response regulator ...    152   2e-41   
ref|XP_003527040.1|  PREDICTED: two-component response regulator ...    152   2e-41   
ref|XP_006407515.1|  hypothetical protein EUTSA_v10021491mg             153   2e-41   
ref|XP_010276614.1|  PREDICTED: two-component response regulator ...    152   2e-41   
gb|EMS50922.1|  Two-component response regulator ARR8                   153   2e-41   
ref|XP_009118251.1|  PREDICTED: two-component response regulator ...    154   2e-41   
gb|KFK36982.1|  hypothetical protein AALP_AA4G197100                    153   2e-41   
ref|XP_010491281.1|  PREDICTED: two-component response regulator ...    154   2e-41   
emb|CDY45155.1|  BnaA09g14370D                                          153   2e-41   
ref|XP_010670481.1|  PREDICTED: two-component response regulator ...    151   2e-41   
ref|XP_006351272.1|  PREDICTED: two-component response regulator ...    153   2e-41   
ref|XP_009150827.1|  PREDICTED: two-component response regulator ...    153   2e-41   
emb|CDY30913.1|  BnaC09g14930D                                          153   3e-41   
emb|CBI40158.3|  unnamed protein product                                150   3e-41   
ref|XP_010272107.1|  PREDICTED: two-component response regulator ...    153   3e-41   
ref|XP_006476689.1|  PREDICTED: two-component response regulator ...    152   3e-41   
emb|CDY07801.1|  BnaC03g48210D                                          154   3e-41   
dbj|BAJ88185.1|  predicted protein                                      154   3e-41   
gb|AAK14395.1|AF339732_1  response regulator protein                    154   3e-41   Dianthus caryophyllus [carnation]
ref|XP_009776026.1|  PREDICTED: two-component response regulator ...    153   3e-41   
emb|CDX68161.1|  BnaA07g22010D                                          152   3e-41   
dbj|BAA34727.1|  response regulator 5                                   151   3e-41   Arabidopsis thaliana [mouse-ear cress]
emb|CBI30106.3|  unnamed protein product                                150   3e-41   
ref|XP_007028513.1|  Type-a response regulator                          152   4e-41   
ref|NP_190393.1|  two-component response regulator ARR5                 151   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879919.1|  hypothetical protein ARALYDRAFT_483202             152   4e-41   
emb|CDY34890.1|  BnaA09g48160D                                          153   4e-41   
emb|CDY27219.1|  BnaA09g35830D                                          150   4e-41   
ref|XP_009149383.1|  PREDICTED: two-component response regulator ...    152   4e-41   
emb|CDY41014.1|  BnaC05g14720D                                          152   4e-41   
emb|CAN69259.1|  hypothetical protein VITISV_026384                     152   4e-41   Vitis vinifera
ref|XP_006357275.1|  PREDICTED: LOW QUALITY PROTEIN: two-componen...    153   4e-41   
gb|AAC26635.1|  two-component response regulator homolog                151   4e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KEH35093.1|  two-component response regulator ARR3-like protein      152   4e-41   
ref|NP_001240226.1|  uncharacterized protein LOC100788079               153   4e-41   
ref|XP_010652890.1|  PREDICTED: two-component response regulator ...    152   5e-41   
ref|XP_009133480.1|  PREDICTED: two-component response regulator ...    152   5e-41   
ref|XP_009113268.1|  PREDICTED: two-component response regulator ...    152   5e-41   
ref|XP_010322112.1|  PREDICTED: two-component response regulator ...    149   5e-41   
gb|KHN16287.1|  Two-component response regulator ARR6                   151   5e-41   
ref|XP_002886648.1|  predicted protein                                  152   5e-41   
ref|XP_009361964.1|  PREDICTED: two-component response regulator ...    150   5e-41   
ref|XP_004140290.1|  PREDICTED: two-component response regulator ...    150   6e-41   
ref|XP_007133766.1|  hypothetical protein PHAVU_011G207200g             152   6e-41   
gb|EMT09801.1|  Two-component response regulator ARR8                   152   6e-41   
ref|XP_003608937.1|  Two-component response regulator ARR5              152   6e-41   
ref|XP_002892573.1|  hypothetical protein ARALYDRAFT_888316             153   6e-41   
ref|XP_011028649.1|  PREDICTED: two-component response regulator ...    152   6e-41   
emb|CDY37975.1|  BnaC05g07990D                                          152   7e-41   
dbj|BAL43556.1|  type-A response regulator                              153   7e-41   
gb|EYU18643.1|  hypothetical protein MIMGU_mgv1a012918mg                152   7e-41   
ref|XP_010036352.1|  PREDICTED: two-component response regulator ...    151   7e-41   
ref|XP_010095967.1|  Two-component response regulator                   154   8e-41   
ref|XP_006600658.1|  PREDICTED: two-component response regulator ...    151   8e-41   
ref|XP_004493425.1|  PREDICTED: two-component response regulator ...    151   8e-41   
ref|XP_011078970.1|  PREDICTED: two-component response regulator ...    152   8e-41   
ref|XP_009104741.1|  PREDICTED: two-component response regulator ...    151   8e-41   
ref|XP_007011051.1|  Two-component response regulator ARR8              150   9e-41   
ref|XP_010095968.1|  Two-component response regulator                   152   9e-41   
ref|XP_010668382.1|  PREDICTED: two-component response regulator ...    151   9e-41   
ref|XP_010525480.1|  PREDICTED: two-component response regulator ...    152   1e-40   
ref|XP_011027272.1|  PREDICTED: two-component response regulator ...    151   1e-40   
gb|KEH23599.1|  two-component response regulator ARR3-like protein      152   1e-40   
ref|XP_004303597.1|  PREDICTED: two-component response regulator ...    151   1e-40   
gb|AHM24030.1|  two-component response regulator                        151   1e-40   
ref|XP_003627814.1|  Two-component response regulator ARR8              149   1e-40   
emb|CBI40161.3|  unnamed protein product                                149   1e-40   
ref|XP_004297679.1|  PREDICTED: two-component response regulator ...    151   1e-40   
ref|XP_006856915.1|  hypothetical protein AMTR_s00055p00222350          149   1e-40   
ref|XP_006492506.1|  PREDICTED: two-component response regulator ...    151   1e-40   
ref|XP_010269353.1|  PREDICTED: two-component response regulator ...    150   2e-40   
emb|CDX67674.1|  BnaA07g17140D                                          151   2e-40   
ref|XP_002273990.1|  PREDICTED: two-component response regulator ...    150   2e-40   
gb|AFK36913.1|  unknown                                                 151   2e-40   
gb|AFK34128.1|  unknown                                                 150   2e-40   
gb|KDO39649.1|  hypothetical protein CISIN_1g026239mg                   151   2e-40   
ref|XP_002307983.2|  Two-component response regulator ARR8 family...    151   2e-40   
emb|CDP00229.1|  unnamed protein product                                151   2e-40   
ref|XP_010553643.1|  PREDICTED: two-component response regulator ...    151   2e-40   
ref|XP_006442056.1|  hypothetical protein CICLE_v10021937mg             151   2e-40   
emb|CBX43988.1|  putative A-type response regulator 6                   150   2e-40   
ref|XP_008465907.1|  PREDICTED: two-component response regulator ...    148   2e-40   
ref|XP_007148939.1|  hypothetical protein PHAVU_005G027100g             149   2e-40   
ref|XP_006392216.1|  hypothetical protein EUTSA_v10023662mg             150   2e-40   
ref|XP_009148373.1|  PREDICTED: two-component response regulator ...    151   2e-40   
gb|KDP21284.1|  hypothetical protein JCGZ_21755                         151   2e-40   
emb|CDX93424.1|  BnaA06g06240D                                          151   3e-40   
ref|XP_010028399.1|  PREDICTED: two-component response regulator ...    150   3e-40   
emb|CDY65526.1|  BnaCnng47460D                                          148   3e-40   
gb|KEH41351.1|  two-component response regulator ARR3-like protein      149   3e-40   
gb|AGH13202.1|  cytokinin response regulator 5                          149   4e-40   
ref|XP_010940310.1|  PREDICTED: two-component response regulator ...    147   4e-40   
ref|XP_008228315.1|  PREDICTED: two-component response regulator ...    148   5e-40   
ref|XP_010095966.1|  Two-component response regulator                   149   5e-40   
ref|XP_011071752.1|  PREDICTED: two-component response regulator ...    149   5e-40   
ref|XP_011000562.1|  PREDICTED: two-component response regulator ...    148   5e-40   
ref|NP_001237197.1|  uncharacterized protein LOC100527518               149   5e-40   
gb|ABG35780.1|  SRR198                                                  150   6e-40   
ref|XP_004146434.1|  PREDICTED: two-component response regulator ...    147   6e-40   
gb|KHN48630.1|  Two-component response regulator ARR5                   148   6e-40   
gb|AFK35812.1|  unknown                                                 150   6e-40   
emb|CBX43987.1|  putative A-type response regulator 5                   148   7e-40   
ref|XP_010931988.1|  PREDICTED: two-component response regulator ...    148   7e-40   
emb|CDY20948.1|  BnaA08g25770D                                          150   7e-40   
emb|CDY66046.1|  BnaCnng49440D                                          150   7e-40   
emb|CAB88041.1|  response regulator-like protein                        145   8e-40   
ref|XP_010548083.1|  PREDICTED: two-component response regulator ...    150   8e-40   
ref|XP_007202538.1|  hypothetical protein PRUPE_ppa011054mg             149   8e-40   
ref|XP_009104039.1|  PREDICTED: two-component response regulator ...    149   8e-40   
gb|ABQ95669.1|  response regulator                                      148   9e-40   
gb|AAQ10675.1|  type-A response regulator                               150   9e-40   
ref|XP_008339984.1|  PREDICTED: two-component response regulator ...    149   9e-40   
ref|XP_010067733.1|  PREDICTED: two-component response regulator ...    147   9e-40   
ref|XP_009144440.1|  PREDICTED: two-component response regulator ...    149   1e-39   
ref|XP_009399982.1|  PREDICTED: two-component response regulator ...    147   1e-39   
ref|XP_009768330.1|  PREDICTED: two-component response regulator ...    145   1e-39   
ref|XP_009796867.1|  PREDICTED: two-component response regulator ...    148   1e-39   
emb|CDY20630.1|  BnaC08g14280D                                          149   1e-39   
ref|XP_009382585.1|  PREDICTED: two-component response regulator ...    148   1e-39   
gb|ACU24220.1|  unknown                                                 147   1e-39   
gb|AFK44366.1|  unknown                                                 149   1e-39   
gb|ABQ95668.1|  response regulator                                      148   1e-39   
gb|KHN14915.1|  Two-component response regulator ARR9                   149   1e-39   
ref|XP_007157523.1|  hypothetical protein PHAVU_002G076900g             148   1e-39   
ref|XP_008389572.1|  PREDICTED: two-component response regulator ...    149   2e-39   
ref|XP_008387409.1|  PREDICTED: two-component response regulator ...    148   2e-39   
ref|XP_009339985.1|  PREDICTED: two-component response regulator ...    148   2e-39   
ref|XP_002513063.1|  Two-component response regulator ARR8, putative    147   2e-39   
ref|XP_004504497.1|  PREDICTED: two-component response regulator ...    148   2e-39   
ref|XP_011075407.1|  PREDICTED: two-component response regulator ...    148   2e-39   
ref|NP_001241095.1|  uncharacterized protein LOC100814494               148   2e-39   
ref|XP_006838392.1|  hypothetical protein AMTR_s00002p00074510          148   2e-39   
ref|XP_009104038.1|  PREDICTED: two-component response regulator ...    149   2e-39   
ref|XP_002322625.1|  hypothetical protein POPTR_0016s03750g             148   2e-39   
ref|XP_009386845.1|  PREDICTED: two-component response regulator ...    147   2e-39   
ref|XP_008813274.1|  PREDICTED: two-component response regulator ...    145   2e-39   
ref|XP_003517746.1|  PREDICTED: two-component response regulator ...    148   2e-39   
ref|XP_006663809.1|  PREDICTED: two-component response regulator ...    147   3e-39   
ref|XP_010670482.1|  PREDICTED: two-component response regulator ...    145   3e-39   
ref|XP_009350930.1|  PREDICTED: two-component response regulator ...    147   3e-39   
ref|XP_009339571.1|  PREDICTED: two-component response regulator ...    147   3e-39   
gb|AES91134.2|  two-component response regulator ARR3-like protein      147   3e-39   
gb|KDP40526.1|  hypothetical protein JCGZ_24525                         146   4e-39   
ref|XP_009774750.1|  PREDICTED: two-component response regulator ...    144   4e-39   
emb|CBX43989.1|  putative A-type response regulator 7                   147   4e-39   
ref|XP_003519320.1|  PREDICTED: two-component response regulator ...    148   4e-39   
ref|XP_004138134.1|  PREDICTED: two-component response regulator ...    147   4e-39   
ref|XP_008808788.1|  PREDICTED: two-component response regulator ...    146   4e-39   
gb|AFK41171.1|  unknown                                                 145   4e-39   
ref|XP_003613423.1|  Two-component response regulator ARR3              147   4e-39   
ref|XP_010044664.1|  PREDICTED: two-component response regulator ...    148   4e-39   
emb|CBI40159.3|  unnamed protein product                                145   4e-39   
ref|XP_003578944.1|  PREDICTED: two-component response regulator ...    147   4e-39   
ref|XP_004236156.1|  PREDICTED: two-component response regulator ...    146   4e-39   
ref|XP_007044474.1|  Two-component response regulator ARR4              151   5e-39   
emb|CDX72141.1|  BnaC08g27330D                                          144   5e-39   
ref|XP_006340119.1|  PREDICTED: two-component response regulator ...    149   5e-39   
ref|XP_010668381.1|  PREDICTED: two-component response regulator ...    146   5e-39   
ref|XP_010044665.1|  PREDICTED: two-component response regulator ...    147   6e-39   
ref|XP_009631742.1|  PREDICTED: two-component response regulator ...    146   6e-39   
emb|CBX25288.1|  hypothetical_protein                                   146   6e-39   
ref|XP_006591196.1|  PREDICTED: two-component response regulator ...    145   7e-39   
emb|CBX43983.1|  putative A-type response regulator 1b                  147   7e-39   
ref|XP_006662727.1|  PREDICTED: two-component response regulator ...    146   7e-39   
ref|XP_006344995.1|  PREDICTED: two-component response regulator ...    146   7e-39   
gb|KHG13999.1|  Two-component response regulator ARR4 -like protein     147   7e-39   
ref|XP_010683320.1|  PREDICTED: two-component response regulator ...    148   8e-39   
ref|XP_010238744.1|  PREDICTED: two-component response regulator ...    146   8e-39   
ref|XP_010926969.1|  PREDICTED: two-component response regulator ...    146   8e-39   
gb|EYU20798.1|  hypothetical protein MIMGU_mgv1a013608mg                146   1e-38   
gb|ABG35781.1|  SRR197                                                  145   1e-38   
ref|XP_002532588.1|  two-component system sensor histidine kinase...    146   1e-38   
ref|XP_009391546.1|  PREDICTED: two-component response regulator ...    145   1e-38   
ref|XP_008244835.1|  PREDICTED: two-component response regulator ...    146   1e-38   
gb|EPS59237.1|  hypothetical protein M569_15571                         143   1e-38   
ref|XP_008799106.1|  PREDICTED: two-component response regulator ...    145   1e-38   
emb|CBX43982.1|  putative A-type response regulator 1a                  147   1e-38   
ref|XP_010100530.1|  Two-component response regulator                   146   1e-38   
ref|XP_007223876.1|  hypothetical protein PRUPE_ppa010863mg             146   1e-38   
ref|XP_010547354.1|  PREDICTED: two-component response regulator ...    145   2e-38   
gb|KDO82646.1|  hypothetical protein CISIN_1g023816mg                   146   2e-38   
ref|XP_004136644.1|  PREDICTED: two-component response regulator ...    145   2e-38   
ref|XP_008244969.1|  PREDICTED: two-component response regulator ...    145   2e-38   
gb|EPS57603.1|  hypothetical protein M569_17215                         143   2e-38   
ref|XP_009763111.1|  PREDICTED: two-component response regulator ...    146   2e-38   
ref|XP_006378200.1|  hypothetical protein POPTR_0010s04740g             146   2e-38   
ref|XP_008388362.1|  PREDICTED: two-component response regulator ...    142   2e-38   
ref|NP_001104857.1|  LOC541632                                          145   2e-38   
ref|XP_010938571.1|  PREDICTED: two-component response regulator ...    145   2e-38   
ref|XP_007220067.1|  hypothetical protein PRUPE_ppa025335mg             144   2e-38   
ref|XP_008782007.1|  PREDICTED: two-component response regulator ...    145   2e-38   
gb|ACG32848.1|  RR10 - Corn type-A response regulator                   144   2e-38   
ref|XP_010539939.1|  PREDICTED: two-component response regulator ...    144   2e-38   
gb|ABG33766.1|  reponse regulator 6                                     143   2e-38   
ref|XP_004977508.1|  PREDICTED: two-component response regulator ...    144   3e-38   
ref|NP_001242179.1|  uncharacterized protein LOC100818762               143   3e-38   
ref|XP_011000439.1|  PREDICTED: two-component response regulator ...    145   3e-38   
gb|ABK25022.1|  unknown                                                 144   3e-38   
ref|XP_004508816.1|  PREDICTED: two-component response regulator ...    145   3e-38   
ref|XP_008231573.1|  PREDICTED: two-component response regulator ...    144   3e-38   
ref|XP_008392405.1|  PREDICTED: two-component response regulator ...    144   3e-38   
ref|XP_008443276.1|  PREDICTED: two-component response regulator ...    145   3e-38   
ref|XP_004978644.1|  PREDICTED: two-component response regulator ...    144   3e-38   
ref|XP_002520201.1|  two-component sensor protein histidine prote...    145   3e-38   
gb|ACF81303.1|  unknown                                                 145   3e-38   
ref|XP_008245632.1|  PREDICTED: two-component response regulator ...    143   4e-38   
ref|XP_008453146.1|  PREDICTED: two-component response regulator ...    145   4e-38   
gb|ACN35670.1|  unknown                                                 145   4e-38   
ref|XP_009765983.1|  PREDICTED: two-component response regulator ...    143   4e-38   
ref|XP_008443275.1|  PREDICTED: two-component response regulator ...    145   4e-38   
ref|XP_004135221.1|  PREDICTED: two-component response regulator ...    145   4e-38   
dbj|BAM74645.1|  type-A response regulator                              144   5e-38   
ref|XP_010525479.1|  PREDICTED: two-component response regulator ...    145   5e-38   
ref|XP_008446266.1|  PREDICTED: two-component response regulator ...    144   5e-38   
ref|XP_004308594.1|  PREDICTED: two-component response regulator ...    143   5e-38   
ref|XP_006355595.1|  PREDICTED: two-component response regulator ...    142   5e-38   
ref|XP_010922156.1|  PREDICTED: two-component response regulator ...    143   5e-38   
ref|XP_010672986.1|  PREDICTED: two-component response regulator ...    145   5e-38   
gb|EYU28654.1|  hypothetical protein MIMGU_mgv1a012764mg                144   6e-38   
ref|XP_010095706.1|  Two-component response regulator                   144   6e-38   
ref|XP_002312699.2|  hypothetical protein POPTR_0008s19730g             145   6e-38   
ref|XP_004233018.1|  PREDICTED: two-component response regulator ...    142   6e-38   
ref|XP_002442679.1|  hypothetical protein SORBIDRAFT_08g001140          144   6e-38   
ref|XP_003565091.1|  PREDICTED: two-component response regulator ...    144   6e-38   
ref|NP_001066118.2|  Os12g0139400                                       143   7e-38   
emb|CBX25471.1|  hypothetical_protein                                   143   7e-38   
ref|NP_001065722.1|  Os11g0143300                                       143   8e-38   
ref|XP_011006898.1|  PREDICTED: two-component response regulator ...    144   8e-38   
ref|XP_008446956.1|  PREDICTED: two-component response regulator ...    142   9e-38   
ref|XP_006653015.1|  PREDICTED: two-component response regulator ...    141   1e-37   
ref|XP_009420845.1|  PREDICTED: two-component response regulator ...    140   1e-37   
ref|XP_006483757.1|  PREDICTED: two-component response regulator ...    144   1e-37   
ref|XP_006847932.1|  hypothetical protein AMTR_s00029p00125630          141   1e-37   
ref|XP_010670479.1|  PREDICTED: two-component response regulator ...    142   1e-37   
ref|XP_009606674.1|  PREDICTED: two-component response regulator ...    143   1e-37   
ref|XP_004144338.1|  PREDICTED: two-component response regulator ...    144   1e-37   
ref|XP_004173818.1|  PREDICTED: two-component response regulator ...    144   1e-37   
ref|XP_004504496.1|  PREDICTED: two-component response regulator ...    143   1e-37   
ref|XP_011086463.1|  PREDICTED: two-component response regulator ...    143   2e-37   
ref|XP_009420847.1|  PREDICTED: two-component response regulator ...    140   2e-37   
emb|CAH67773.1|  H0322F07.10                                            141   2e-37   
emb|CDY71200.1|  BnaCnng71830D                                          139   2e-37   
gb|KHG15156.1|  Two-component response regulator ARR9 -like protein     141   2e-37   
ref|XP_009360508.1|  PREDICTED: two-component response regulator ...    144   2e-37   
ref|XP_009626245.1|  PREDICTED: two-component response regulator ...    142   3e-37   
ref|NP_001054231.1|  Os04g0673300                                       140   3e-37   
ref|NP_001149868.1|  RR4 - Corn type-A response regulator               142   3e-37   
ref|NP_001104856.1|  response regulator 5                               142   3e-37   
gb|AFW59856.1|  cytokinin response regulator2                           140   3e-37   
ref|XP_010683319.1|  PREDICTED: two-component response regulator ...    143   4e-37   
ref|NP_001130159.1|  uncharacterized protein LOC100191253               142   4e-37   
ref|XP_006438504.1|  hypothetical protein CICLE_v10032281mg             142   4e-37   
emb|CBG76250.1|  OO_Ba0005L10-OO_Ba0081K17.1                            139   4e-37   
ref|XP_002984191.1|  type A response regulator                          143   5e-37   
ref|XP_003579464.2|  PREDICTED: two-component response regulator ...    140   5e-37   
ref|XP_009777129.1|  PREDICTED: two-component response regulator ...    140   6e-37   
ref|XP_011071285.1|  PREDICTED: two-component response regulator ...    141   6e-37   
ref|XP_009383882.1|  PREDICTED: two-component response regulator ...    140   7e-37   
ref|XP_010672987.1|  PREDICTED: two-component response regulator ...    142   7e-37   
ref|XP_006645383.1|  PREDICTED: two-component response regulator ...    141   7e-37   
emb|CDX75990.1|  BnaA04g02540D                                          138   8e-37   
ref|XP_004976281.1|  PREDICTED: two-component response regulator ...    138   1e-36   
ref|XP_002984192.1|  type A response regulator                          142   1e-36   
ref|XP_010243491.1|  PREDICTED: two-component response regulator ...    140   1e-36   
ref|NP_001104849.1|  cytokinin response regulator2                      139   1e-36   
ref|XP_004142431.1|  PREDICTED: two-component response regulator ...    139   1e-36   
ref|XP_002448203.1|  hypothetical protein SORBIDRAFT_06g022960          138   1e-36   
ref|XP_002456944.1|  hypothetical protein SORBIDRAFT_03g046040          141   1e-36   
ref|NP_001045420.1|  Os01g0952500                                       140   1e-36   
emb|CBX25376.1|  hypothetical_protein                                   140   2e-36   
ref|XP_009383883.1|  PREDICTED: two-component response regulator ...    139   2e-36   



>dbj|BAL43558.1| type-A response regulator [Petunia x hybrida]
Length=158

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 3/145 (2%)
 Frame = +3

Query  153  SMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQ  332
            S  MGE   DE  HVLAVDD+ ++  ++E+LLK SSCKVTTAENG+RALEYLGL  GD +
Sbjct  12   SRGMGETTADEP-HVLAVDDNLVDRKLVERLLKKSSCKVTTAENGLRALEYLGL-GGDQE  69

Query  333  HNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  512
            H S N N  KVN+IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSENIP+RI+QCME
Sbjct  70   H-STNGNGSKVNMIITDYCMPGMTGYELLKKIKESSILKDVPVVIMSSENIPTRIDQCME  128

Query  513  VGAKMFILKPLKQADVNELKSQLMH  587
             GA+MF+LKPLK +DV  L+ QL++
Sbjct  129  EGAQMFMLKPLKHSDVKRLRCQLIN  153



>ref|XP_010322123.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator 
ARR17 [Solanum lycopersicum]
Length=161

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 110/132 (83%), Gaps = 2/132 (2%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD+ I+  ++EKLLK SSCKVTTAENG+RALEYLGL  G  Q NS N N  KVN+
Sbjct  18   HVLAVDDNLIDRKLVEKLLKKSSCKVTTAENGLRALEYLGL--GANQENSTNNNGSKVNM  75

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSENIP+RI+QCME GA+MF+LKPLK 
Sbjct  76   IITDYCMPGMTGYELLKKIKESSILKDVPVVIMSSENIPTRIDQCMEEGAQMFMLKPLKH  135

Query  552  ADVNELKSQLMH  587
            +DV  L+ QLM 
Sbjct  136  SDVKRLRCQLMQ  147



>gb|KHG06264.1| Two-component response regulator ARR17 -like protein [Gossypium 
arboreum]
Length=157

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 112/134 (84%), Gaps = 2/134 (1%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD+ I+  ++EKLLK+SSCKVTTAENG+RALE+LGL  G  Q NS    V KVNL
Sbjct  25   HVLAVDDNLIDRTLVEKLLKNSSCKVTTAENGLRALEFLGL--GSDQRNSLEGTVSKVNL  82

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            +ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP+RINQC+E GA+MF+LKPLKQ
Sbjct  83   VITDYCMPGMTGYELLKKIKESSVLKEVPVVIMSSENIPTRINQCLEEGAQMFMLKPLKQ  142

Query  552  ADVNELKSQLMHKR  593
            +DV +LK  LM  R
Sbjct  143  SDVKQLKRHLMKYR  156



>ref|XP_006358744.1| PREDICTED: two-component response regulator ARR17-like [Solanum 
tuberosum]
Length=148

 Score =   188 bits (478),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 110/132 (83%), Gaps = 2/132 (2%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD+ I+  ++EKLLK SSCKVTTAENG+RALEYLGL  G  Q +S N N  KVN+
Sbjct  17   HVLAVDDNLIDRKLVEKLLKKSSCKVTTAENGLRALEYLGL--GADQEHSTNNNGSKVNM  74

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSENIP+RI+QCME GA+MF+LKPLK 
Sbjct  75   IITDYCMPGMTGYELLKKIKESSILKDVPVVIMSSENIPTRIDQCMEEGAQMFMLKPLKH  134

Query  552  ADVNELKSQLMH  587
            +DV  L+ QLM 
Sbjct  135  SDVKRLRCQLMQ  146



>ref|XP_006357298.1| PREDICTED: two-component response regulator ARR17-like [Solanum 
tuberosum]
Length=156

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 117/149 (79%), Gaps = 2/149 (1%)
 Frame = +3

Query  147  SSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD  326
            S S  MGE    +  HVLAVDD+ ++  ++E LLK SSCKVTTAE+G+RALEYLGL A  
Sbjct  9    SISKGMGEVVASDEPHVLAVDDNLVDRKLVEILLKKSSCKVTTAEDGLRALEYLGLAAH-  67

Query  327  VQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  506
             Q +S N+N  KVN+IITDY MPGM GYELLKK+K+S+M KDVPVV+MSSENIP+RINQC
Sbjct  68   -QDSSANSNGSKVNMIITDYCMPGMTGYELLKKIKESSMMKDVPVVIMSSENIPTRINQC  126

Query  507  MEVGAKMFILKPLKQADVNELKSQLMHKR  593
            ME GA++F+LKPLK +DV  L+ Q+M  R
Sbjct  127  MEEGAQIFMLKPLKHSDVERLRCQIMQCR  155



>ref|XP_004240845.1| PREDICTED: two-component response regulator ARR17-like isoform 
X1 [Solanum lycopersicum]
Length=156

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 117/149 (79%), Gaps = 2/149 (1%)
 Frame = +3

Query  147  SSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD  326
            S S  MGE    E  HVLAVDD+ ++  ++E LLK SSCKVTTAE+G+RALEYLGL A  
Sbjct  9    SISKGMGEVVASEEPHVLAVDDNLVDRKLVEILLKKSSCKVTTAEDGLRALEYLGLAAH-  67

Query  327  VQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  506
             Q +S N+N  KVN+IITDY MPGM GYELLKK+K+S+M KDVPVV+MSSENIP+RI+QC
Sbjct  68   -QDSSKNSNGSKVNMIITDYCMPGMTGYELLKKIKESSMMKDVPVVIMSSENIPTRIHQC  126

Query  507  MEVGAKMFILKPLKQADVNELKSQLMHKR  593
            ME GA++F+LKPLK +DV  L+ Q+M  R
Sbjct  127  MEEGAQIFMLKPLKHSDVERLRCQIMQCR  155



>ref|XP_009768329.1| PREDICTED: two-component response regulator ARR17-like isoform 
X1 [Nicotiana sylvestris]
Length=145

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 110/132 (83%), Gaps = 2/132 (2%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD+ ++  ++E+LLK SSCKVTTAENG+RALEYLGL  G  Q +S N N  KVN+
Sbjct  13   HVLAVDDNLVDRKLVERLLKKSSCKVTTAENGLRALEYLGL--GAEQEHSTNGNGSKVNM  70

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSENIP+RI+QC+E GA+MF+LKPLK 
Sbjct  71   IITDYCMPGMTGYELLKKIKESSILKDVPVVIMSSENIPTRIDQCLEEGAQMFMLKPLKH  130

Query  552  ADVNELKSQLMH  587
            +DV  L+ QLM 
Sbjct  131  SDVKRLRCQLMQ  142



>ref|XP_011001387.1| PREDICTED: two-component response regulator ARR17 [Populus euphratica]
 ref|XP_011001388.1| PREDICTED: two-component response regulator ARR17 [Populus euphratica]
Length=154

 Score =   186 bits (473),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD  ++  ++E+LLK+SSCKVTTAENG+RALEYLGL  GD +  S   NV KVNL
Sbjct  22   HVLAVDDSLVDRKLVERLLKNSSCKVTTAENGLRALEYLGL--GDEKRTSLEDNVSKVNL  79

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM GYELLKK+K+S+M K++PVV+MSSENIP+RIN+C+E GA+MF+LKPLKQ
Sbjct  80   IITDYCMPGMTGYELLKKIKESSMLKEIPVVIMSSENIPTRINKCLEEGAQMFMLKPLKQ  139

Query  552  ADVNELKSQLMHKR  593
            +DV +L+  LM+ R
Sbjct  140  SDVVKLRCNLMNCR  153



>ref|XP_002325489.1| hypothetical protein POPTR_0019s08690g [Populus trichocarpa]
 gb|EEE99870.1| hypothetical protein POPTR_0019s08690g [Populus trichocarpa]
Length=154

 Score =   186 bits (473),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD  ++  ++E+LLK+SSCKVTTAENG+RALEYLGL  GD +  S   NV KVNL
Sbjct  22   HVLAVDDSLVDRKLVERLLKNSSCKVTTAENGLRALEYLGL--GDEKRTSLEDNVSKVNL  79

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM GYELLKK+K+S+M K++PVV+MSSENIP+RIN+C+E GA+MF+LKPLKQ
Sbjct  80   IITDYCMPGMTGYELLKKIKESSMLKEIPVVIMSSENIPTRINKCLEEGAQMFMLKPLKQ  139

Query  552  ADVNELKSQLMHKR  593
            +DV +L+  LM+ R
Sbjct  140  SDVVKLRCNLMNCR  153



>gb|KEH35531.1| two-component response regulator ARR3-like protein [Medicago 
truncatula]
Length=156

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = +3

Query  147  SSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD  326
            SSS  + ENG+  + HVLAVDD+ I+  ++EKLLK+SSCKVTTAENG++ALEYLGL +G 
Sbjct  6    SSSKWVMENGD--IPHVLAVDDNIIDRTLVEKLLKNSSCKVTTAENGLKALEYLGLASGA  63

Query  327  VQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  506
             Q N+     PKVNLIITDY MPGM GYELLKK+K S+M K+VPVV+MSS+NIP+RIN+C
Sbjct  64   EQKNTLENGGPKVNLIITDYCMPGMTGYELLKKIKQSSM-KEVPVVIMSSDNIPTRINKC  122

Query  507  MEVGAKMFILKPLKQADVNELKSQLMH  587
            ME GA+MF+ KP+KQ+DV +L  QLM+
Sbjct  123  MEEGAQMFLSKPVKQSDVKQLIGQLMN  149



>emb|CBI25350.3| unnamed protein product [Vitis vinifera]
Length=141

 Score =   185 bits (469),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD+ I+  +IEKLLK+ SC+VTTAENG+RALEYLGL  GD Q  S   +V KVNL
Sbjct  10   HVLAVDDNLIDRKLIEKLLKNFSCRVTTAENGLRALEYLGL--GDNQQTSHKASVSKVNL  67

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM GYELLK+VK S++ K+VPVV+MSSENIP+RIN+C+E GA+MF+LKPLKQ
Sbjct  68   IITDYCMPGMTGYELLKRVKQSSILKEVPVVIMSSENIPTRINKCLEEGAQMFMLKPLKQ  127

Query  552  ADVNELKSQLMHK  590
            +DV +L+  L H+
Sbjct  128  SDVKKLRCYLKHR  140



>emb|CBX43990.1| putative A-type response regulator 8 [Populus x canadensis]
Length=154

 Score =   185 bits (470),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 112/134 (84%), Gaps = 2/134 (1%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD  ++  ++E+LLK+SSCKVTTAENG+RALEYLGL  GD +  S   NV KVNL
Sbjct  22   HVLAVDDSLVDRKLVERLLKNSSCKVTTAENGLRALEYLGL--GDEKRTSLEDNVSKVNL  79

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM GYELLKK+K+S+M K +PVV+MSSENIP+RIN+C+E GA+MF+LKPLKQ
Sbjct  80   IITDYCMPGMTGYELLKKIKESSMLKKIPVVIMSSENIPTRINKCLEEGAQMFMLKPLKQ  139

Query  552  ADVNELKSQLMHKR  593
            +DV +L+  LM+ R
Sbjct  140  SDVVKLRCNLMNCR  153



>ref|XP_002280746.1| PREDICTED: two-component response regulator ARR17 isoform X1 
[Vitis vinifera]
Length=153

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD+ I+  +IEKLLK+ SC+VTTAENG+RALEYLGL  GD Q  S   +V KVNL
Sbjct  22   HVLAVDDNLIDRKLIEKLLKNFSCRVTTAENGLRALEYLGL--GDNQQTSHKASVSKVNL  79

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM GYELLK+VK S++ K+VPVV+MSSENIP+RIN+C+E GA+MF+LKPLKQ
Sbjct  80   IITDYCMPGMTGYELLKRVKQSSILKEVPVVIMSSENIPTRINKCLEEGAQMFMLKPLKQ  139

Query  552  ADVNELKSQLMHK  590
            +DV +L+  L H+
Sbjct  140  SDVKKLRCYLKHR  152



>ref|XP_007136418.1| hypothetical protein PHAVU_009G043400g [Phaseolus vulgaris]
 gb|ESW08412.1| hypothetical protein PHAVU_009G043400g [Phaseolus vulgaris]
Length=147

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 121/151 (80%), Gaps = 4/151 (3%)
 Frame = +3

Query  135  MACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGL  314
            MA PSSS  + E+  D V HVLAVDD+ I+  ++EKLL++SSCKVTTAENG RALE LGL
Sbjct  1    MAAPSSSNWVMESAHD-VPHVLAVDDNLIDRKLVEKLLRNSSCKVTTAENGPRALELLGL  59

Query  315  LAGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSR  494
             +G    NS N    KVNL+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP+R
Sbjct  60   TSGG--QNSMNGR-SKVNLVITDYCMPGMTGYELLKKIKESSVMKEVPVVIMSSENIPTR  116

Query  495  INQCMEVGAKMFILKPLKQADVNELKSQLMH  587
            IN+C+E GA+MFILKPLKQ+DV +L  QLM+
Sbjct  117  INKCLEEGAQMFILKPLKQSDVKKLTCQLMN  147



>ref|XP_009623473.1| PREDICTED: two-component response regulator ARR17 [Nicotiana 
tomentosiformis]
Length=148

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 110/132 (83%), Gaps = 2/132 (2%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD+ ++  ++E+LLK SSCKVTTAENG+RALEYLGL  G  Q +S N N  KVN+
Sbjct  16   HVLAVDDNLVDRKLVERLLKKSSCKVTTAENGLRALEYLGL--GADQEHSTNGNGSKVNM  73

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSENIP+RI++C+E GA+MF+LKPLK 
Sbjct  74   IITDYCMPGMTGYELLKKIKESSILKDVPVVIMSSENIPTRIDECLEEGAQMFMLKPLKH  133

Query  552  ADVNELKSQLMH  587
            +DV  L+ QLM 
Sbjct  134  SDVKRLRCQLMQ  145



>gb|KDP21642.1| hypothetical protein JCGZ_03313 [Jatropha curcas]
Length=158

 Score =   184 bits (467),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 119/151 (79%), Gaps = 3/151 (2%)
 Frame = +3

Query  141  CPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLA  320
            C S    +G+ G D   HVLAVDD+ I+  ++EKLLK+SSC+VTTAENG+RALEYLGL  
Sbjct  10   CSSMDKILGDYG-DHQPHVLAVDDNLIDRKLVEKLLKNSSCRVTTAENGLRALEYLGL--  66

Query  321  GDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRIN  500
            GD +  +   NV KVNLIITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP+RI 
Sbjct  67   GDDERKTLEKNVSKVNLIITDYCMPGMTGYELLKKIKESSILKEVPVVIMSSENIPTRIK  126

Query  501  QCMEVGAKMFILKPLKQADVNELKSQLMHKR  593
            +C+E GA+MF+LKPLK +DV +LK  LM+ R
Sbjct  127  KCLEEGAQMFMLKPLKLSDVKKLKFDLMNCR  157



>ref|XP_010103657.1| Two-component response regulator [Morus notabilis]
 gb|EXB96540.1| Two-component response regulator [Morus notabilis]
Length=154

 Score =   183 bits (465),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 114/134 (85%), Gaps = 2/134 (1%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD+ I+  ++EKLL++SSC+VTTAENG RALE+LGL  GD +HN+   NV KVNL
Sbjct  22   HVLAVDDNVIDRKLVEKLLQNSSCRVTTAENGPRALEFLGL--GDHRHNALEGNVSKVNL  79

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM GY+LLKK+K+S++ K+VPVV+MSSEN+P+RIN+C+E GA+MF++KPLKQ
Sbjct  80   IITDYCMPGMTGYDLLKKIKESSVMKEVPVVIMSSENVPTRINKCLEEGAQMFMIKPLKQ  139

Query  552  ADVNELKSQLMHKR  593
            +D+  L+  LM+ R
Sbjct  140  SDIKRLRCHLMNSR  153



>dbj|BAM74646.1| type-A response regulator [Torenia fournieri]
Length=141

 Score =   182 bits (463),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 116/141 (82%), Gaps = 4/141 (3%)
 Frame = +3

Query  171  NGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNT  350
            + ++E +HVLAVDD+ I+  I+EKLLK+SSCKVTT ENG RALEYLGL  GD Q+ S + 
Sbjct  2    DAKEEQVHVLAVDDNLIDRTIVEKLLKNSSCKVTTVENGRRALEYLGL--GDDQNISSDD  59

Query  351  NVP--KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAK  524
            N    KVN+IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSEN+P+RIN+C+E GA+
Sbjct  60   NAAASKVNMIITDYCMPGMTGYELLKKIKESSVMKDVPVVIMSSENVPTRINKCLEEGAE  119

Query  525  MFILKPLKQADVNELKSQLMH  587
            MF+LKPLK +D+ +LK QL+ 
Sbjct  120  MFMLKPLKHSDMKKLKCQLLQ  140



>ref|XP_009590654.1| PREDICTED: two-component response regulator ARR17-like [Nicotiana 
tomentosiformis]
Length=154

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 109/132 (83%), Gaps = 2/132 (2%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD+ ++  ++EKLLK SSCKVTTAE+G+RALEYLGL  G    +S N N  KVN+
Sbjct  24   HVLAVDDNLVDRKLVEKLLKKSSCKVTTAEDGLRALEYLGL--GAHHDSSTNCNGSKVNM  81

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSENIP+RINQCME GA++F+LKPLK 
Sbjct  82   IITDYCMPGMTGYELLKKIKESSIMKDVPVVIMSSENIPTRINQCMEEGAQIFMLKPLKH  141

Query  552  ADVNELKSQLMH  587
            +DV  L+ Q+M 
Sbjct  142  SDVERLRCQIMQ  153



>gb|EYU35194.1| hypothetical protein MIMGU_mgv1a015731mg [Erythranthe guttata]
Length=148

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 113/140 (81%), Gaps = 2/140 (1%)
 Frame = +3

Query  165  GENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP  344
            G  G  E  HVLAVDD+ I+ I++EKLLK+SSCKVTTAENG RALEYLGL+  +    S 
Sbjct  3    GAVGFVEEPHVLAVDDNLIDRILVEKLLKNSSCKVTTAENGQRALEYLGLVENN--QTSS  60

Query  345  NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAK  524
            N N  KVN+IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSEN+P+RIN+C+E GA+
Sbjct  61   NDNASKVNMIITDYCMPGMTGYELLKKIKESSVMKDVPVVIMSSENVPTRINKCLEEGAE  120

Query  525  MFILKPLKQADVNELKSQLM  584
            MF+LKPLK +DV +L+ Q +
Sbjct  121  MFMLKPLKFSDVKKLRCQFL  140



>ref|XP_002520876.1| two-component system sensor histidine kinase/response regulator, 
putative [Ricinus communis]
 gb|EEF41585.1| two-component system sensor histidine kinase/response regulator, 
putative [Ricinus communis]
Length=155

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 117/150 (78%), Gaps = 4/150 (3%)
 Frame = +3

Query  138  ACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLL  317
             C S    +G+ G+    HVLAVDD+ I+  ++EKLLK+S CKVTTAENG+RALEYLGL 
Sbjct  7    TCSSMEKVLGDYGDQP--HVLAVDDNLIDRKLVEKLLKNSCCKVTTAENGLRALEYLGL-  63

Query  318  AGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  497
             GD   N    NV KVNLIITDY MPGM GYELLKK+K+S++ K+VPVV++SSENIP+RI
Sbjct  64   -GDDDRNCLENNVSKVNLIITDYCMPGMTGYELLKKIKESSIMKEVPVVIVSSENIPTRI  122

Query  498  NQCMEVGAKMFILKPLKQADVNELKSQLMH  587
            N+C+E GA+MF+LKPLK +DV +L+  +M+
Sbjct  123  NKCLEEGAQMFMLKPLKLSDVKKLRCDIMN  152



>ref|XP_010658172.1| PREDICTED: two-component response regulator ARR17 isoform X2 
[Vitis vinifera]
Length=152

 Score =   181 bits (459),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 111/133 (83%), Gaps = 3/133 (2%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD+ I+  +IEKLLK+ SC+VTTAENG+RALEYLGL  GD Q  S   +V KVNL
Sbjct  22   HVLAVDDNLIDRKLIEKLLKNFSCRVTTAENGLRALEYLGL--GDNQQTSHKASVSKVNL  79

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM GYELLK+VK S++ K+VPVV+MSSENIP+RIN+C+E GA+MF+LKPLKQ
Sbjct  80   IITDYCMPGMTGYELLKRVK-SSILKEVPVVIMSSENIPTRINKCLEEGAQMFMLKPLKQ  138

Query  552  ADVNELKSQLMHK  590
            +DV +L+  L H+
Sbjct  139  SDVKKLRCYLKHR  151



>ref|NP_001236551.1| uncharacterized protein LOC100499827 [Glycine max]
 gb|ACU13822.1| unknown [Glycine max]
Length=146

 Score =   181 bits (458),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 121/151 (80%), Gaps = 5/151 (3%)
 Frame = +3

Query  135  MACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGL  314
            MA  SSS  + E+G+  V HVLAVDD+ I+  ++EKLL++SSCKVTTAENG RALE LGL
Sbjct  1    MAASSSSNWVMESGD--VPHVLAVDDNLIDRKLVEKLLRNSSCKVTTAENGPRALELLGL  58

Query  315  LAGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSR  494
             +G    N+ N    KVN+IITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP+R
Sbjct  59   TSGG--QNNMNGR-SKVNMIITDYCMPGMTGYELLKKIKESSVMKEVPVVIMSSENIPTR  115

Query  495  INQCMEVGAKMFILKPLKQADVNELKSQLMH  587
            IN+C+E GA+MFILKPLKQ+DV +L  QLM+
Sbjct  116  INKCLEEGAQMFILKPLKQSDVRKLTCQLMN  146



>ref|XP_011084814.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator 
ARR17 [Sesamum indicum]
Length=137

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD+ ++  I+EKLLK+SSCKVTTAEN  RALEYLGL+ G+  HNS   N  KV++
Sbjct  9    HVLAVDDNSLDRKIVEKLLKNSSCKVTTAENAQRALEYLGLVDGN--HNSTTHNASKVSM  66

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM GYELLKK+K+S++ K+VPVV+MSSEN+P+ IN+C+E GA+MF+LKPL  
Sbjct  67   IITDYCMPGMTGYELLKKIKESSIMKNVPVVIMSSENVPTXINECLEEGAEMFMLKPLTY  126

Query  552  ADVNELKSQLM  584
            +DVN+L+ QL+
Sbjct  127  SDVNKLRRQLL  137



>ref|XP_007011279.1| Two-component response regulator ARR17 [Theobroma cacao]
 gb|EOY20089.1| Two-component response regulator ARR17 [Theobroma cacao]
Length=237

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 125/177 (71%), Gaps = 17/177 (10%)
 Frame = +3

Query  108  FVEIKEKKIMACPSS---------SMAMGENGEDEVI------HVLAVDDDPINLIIIEK  242
            ++      I+ C SS          MA G   +D  +      HVLAVDD+ I+  ++EK
Sbjct  62   YIHTSLPGILPCSSSDYCLARRFQRMAGGGCSKDTAVDFGDQPHVLAVDDNLIDRKLVEK  121

Query  243  LLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLK  422
            LLK+SSCKVTTAENG+RALEYLGL  G+ Q ++    V KVNLIITDY MPGM GYELLK
Sbjct  122  LLKNSSCKVTTAENGLRALEYLGL--GNDQRSAMEGTVSKVNLIITDYCMPGMTGYELLK  179

Query  423  KVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQADVNELKSQLMHKR  593
            K+K+S++ K+VPVV+MSSEN P+RI+QC+E GA+MF+LKPLKQ+DV +LK  LM  R
Sbjct  180  KIKESSVLKEVPVVIMSSENSPTRISQCLEEGAQMFMLKPLKQSDVKQLKCHLMKCR  236



>ref|NP_001241393.1| uncharacterized protein LOC100778707 [Glycine max]
 gb|ACU18991.1| unknown [Glycine max]
 gb|KHN25805.1| Two-component response regulator ARR17 [Glycine soja]
Length=146

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 121/151 (80%), Gaps = 5/151 (3%)
 Frame = +3

Query  135  MACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGL  314
            MA  SSS  + E+G+  V HVLAVDD+ I+  ++EKLL++SSCKVTTAENG RALE LGL
Sbjct  1    MAAGSSSNWVMESGD--VPHVLAVDDNLIDRKLVEKLLRNSSCKVTTAENGPRALELLGL  58

Query  315  LAGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSR  494
             +G    N+ N    KVN++ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP+R
Sbjct  59   TSGG--QNTMNGR-SKVNMVITDYCMPGMTGYELLKKIKESSVTKEVPVVIMSSENIPTR  115

Query  495  INQCMEVGAKMFILKPLKQADVNELKSQLMH  587
            IN+C+E GA+MFILKPLKQ+DV +L  QLM+
Sbjct  116  INKCLEEGAQMFILKPLKQSDVKKLTCQLMN  146



>ref|XP_008233888.1| PREDICTED: two-component response regulator ARR17 [Prunus mume]
Length=157

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 112/134 (84%), Gaps = 2/134 (1%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            E  HVLAVDD  I+  +IEKLLK+ SCKVTTAENG+RALE+LGL  GD Q++S   N+ K
Sbjct  21   EQAHVLAVDDSIIDRKLIEKLLKNLSCKVTTAENGLRALEFLGL--GDHQNSSLEGNISK  78

Query  363  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
            VNL+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSE +P+RIN+C+E GA+MF+LKP
Sbjct  79   VNLVITDYCMPGMTGYELLKKIKESSLMKEVPVVIMSSEYVPNRINKCLEEGAQMFMLKP  138

Query  543  LKQADVNELKSQLM  584
            L+Q+D+ +L+  LM
Sbjct  139  LRQSDIKKLRCHLM  152



>ref|XP_009774749.1| PREDICTED: two-component response regulator ARR17-like isoform 
X1 [Nicotiana sylvestris]
Length=148

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 109/130 (84%), Gaps = 2/130 (2%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD+ ++  ++EKLLK SSCKVTTAE+G+RALEYLGL  G    +S N+N  KVN+
Sbjct  18   HVLAVDDNLVDRKLVEKLLKKSSCKVTTAEDGLRALEYLGL--GAHHDSSTNSNGSKVNM  75

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM GYELLKK+K+S++ KDVPVV++SSENIP+RINQCME GA++F+LKPLK 
Sbjct  76   IITDYCMPGMTGYELLKKIKESSIMKDVPVVIVSSENIPTRINQCMEEGAQIFMLKPLKH  135

Query  552  ADVNELKSQL  581
            +DV  L+ Q+
Sbjct  136  SDVERLRCQI  145



>ref|XP_009362787.1| PREDICTED: two-component response regulator ARR17-like [Pyrus 
x bretschneideri]
Length=155

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 112/134 (84%), Gaps = 4/134 (3%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP--KV  365
            HVLAVDD  I+  +IEKLL + SCKVTTAENG RALE+LGL  GD QHNS  +NV   KV
Sbjct  21   HVLAVDDSLIDRKLIEKLLTNLSCKVTTAENGARALEFLGL--GDQQHNSLESNVSNSKV  78

Query  366  NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPL  545
            NL+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSEN+P+RI++C+E GA+MF+LKPL
Sbjct  79   NLVITDYCMPGMTGYELLKKIKESSIMKEVPVVIMSSENVPNRIDKCLEEGAQMFMLKPL  138

Query  546  KQADVNELKSQLMH  587
            KQ+D+ +L+  LM+
Sbjct  139  KQSDIKKLRYHLMN  152



>ref|XP_009349081.1| PREDICTED: two-component response regulator ARR17-like [Pyrus 
x bretschneideri]
Length=156

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 112/134 (84%), Gaps = 4/134 (3%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP--KV  365
            HVLAVDD  I+  +IEKLL + SCKVTTAENG RALE+LGL  GD QHNS  +NV   KV
Sbjct  22   HVLAVDDSLIDRKLIEKLLTNLSCKVTTAENGARALEFLGL--GDQQHNSLESNVSNSKV  79

Query  366  NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPL  545
            NL+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSEN+P+RI++C+E GA+MF+LKPL
Sbjct  80   NLVITDYCMPGMTGYELLKKIKESSIMKEVPVVIMSSENVPNRIDKCLEEGAQMFMLKPL  139

Query  546  KQADVNELKSQLMH  587
            KQ+D+ +L+  LM+
Sbjct  140  KQSDIKKLRYHLMN  153



>emb|CAN60564.1| hypothetical protein VITISV_013996 [Vitis vinifera]
Length=154

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 110/134 (82%), Gaps = 3/134 (2%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD+ I+  +IEKLLK+ SC+VTTAENG+RALEYLGL  GD Q  S   +V KVNL
Sbjct  22   HVLAVDDNLIDRKLIEKLLKNFSCRVTTAENGLRALEYLGL--GDNQQTSHKASVSKVNL  79

Query  372  IITDYSMPGMNGYELLKKVKD-SAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            IITDY MPGM GYELLK+ K  S++ K+VPVV+MSSENIP+RIN+C+E GA+MF+LKPLK
Sbjct  80   IITDYCMPGMTGYELLKRXKQQSSILKEVPVVIMSSENIPTRINKCLEEGAQMFMLKPLK  139

Query  549  QADVNELKSQLMHK  590
            Q+DV +L+  L H+
Sbjct  140  QSDVKKLRCYLKHR  153



>ref|XP_007219229.1| hypothetical protein PRUPE_ppa017797mg [Prunus persica]
 gb|EMJ20428.1| hypothetical protein PRUPE_ppa017797mg [Prunus persica]
Length=159

 Score =   179 bits (453),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD  I+  +IEKLLK+ SCKVTTAENG+RALE+LGL  GD Q++S   N+ KVNL
Sbjct  26   HVLAVDDSIIDRKLIEKLLKNLSCKVTTAENGLRALEFLGL--GDHQNSSLEGNISKVNL  83

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            +ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSE +P+RIN+C+E GA+MF+LKPL+Q
Sbjct  84   VITDYCMPGMTGYELLKKIKESSLMKEVPVVIMSSEYVPNRINKCLEEGAQMFMLKPLRQ  143

Query  552  ADVNELKSQLM  584
            +D+ +L+  LM
Sbjct  144  SDIKKLRCHLM  154



>ref|XP_008388361.1| PREDICTED: two-component response regulator ARR17-like isoform 
X1 [Malus domestica]
Length=156

 Score =   178 bits (452),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 112/134 (84%), Gaps = 4/134 (3%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP--KV  365
            HVLAVDD  I+  +IEKLL + SCKVTTAENG RALE+LGL  GD QHNS  +NV   KV
Sbjct  22   HVLAVDDSLIDRKLIEKLLTNLSCKVTTAENGARALEFLGL--GDQQHNSLESNVSNSKV  79

Query  366  NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPL  545
            NL+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSEN+P+RI++C+E GA+MF+LKPL
Sbjct  80   NLVITDYCMPGMTGYELLKKIKESSIMKEVPVVIMSSENVPNRIDKCLEEGAQMFMLKPL  139

Query  546  KQADVNELKSQLMH  587
            +Q+D+ +L+  LM+
Sbjct  140  RQSDIKKLRYHLMN  153



>ref|XP_010427458.1| PREDICTED: two-component response regulator ARR17-like isoform 
X2 [Camelina sativa]
Length=151

 Score =   178 bits (452),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 116/141 (82%), Gaps = 3/141 (2%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP--NTN  353
            +E +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q + P  +TN
Sbjct  12   EEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGL-GGDPQQSDPVTSTN  70

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
            V KVNLIITDY MPGM G+ELLKKVK+S+  K+VPVV++SSENIP+RIN+C+  GA+MF+
Sbjct  71   VMKVNLIITDYCMPGMTGFELLKKVKESSKLKEVPVVILSSENIPTRINKCLASGAQMFM  130

Query  534  LKPLKQADVNELKSQLMHKRL  596
             KPLK +DV +LK  L++ R+
Sbjct  131  QKPLKLSDVEKLKCHLLNCRI  151



>ref|NP_567037.1| two-component response regulator ARR17 [Arabidopsis thaliana]
 sp|Q9FPR6.1|ARR17_ARATH RecName: Full=Two-component response regulator ARR17 [Arabidopsis 
thaliana]
 gb|AAG40613.1|AF305722_1 response regulator 17 [Arabidopsis thaliana]
 gb|AEE79515.1| two-component response regulator ARR17 [Arabidopsis thaliana]
Length=153

 Score =   178 bits (451),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 118/152 (78%), Gaps = 3/152 (2%)
 Frame = +3

Query  138  ACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLL  317
             C S S +   + E+E +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLGL 
Sbjct  4    GCGSGSDSCLSSMEEE-LHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGL-  61

Query  318  AGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  497
             GD Q     TNV KVNLIITDY MPGM G+ELLKKVK+S+  K+VPVV++SSENIP+RI
Sbjct  62   -GDPQQTDSLTNVMKVNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVILSSENIPTRI  120

Query  498  NQCMEVGAKMFILKPLKQADVNELKSQLMHKR  593
            N+C+  GA+MF+ KPLK +DV +LK  L++ R
Sbjct  121  NKCLASGAQMFMQKPLKLSDVEKLKCHLLNCR  152



>ref|XP_010507480.1| PREDICTED: two-component response regulator ARR17 [Camelina sativa]
Length=151

 Score =   177 bits (450),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 116/141 (82%), Gaps = 3/141 (2%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP--NTN  353
            +E +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q + P  +TN
Sbjct  12   EEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGL-GGDPQQSDPVTSTN  70

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
            V KVNLIITDY MPGM G+ELLKKVK+S+  K+VPVV++SSENIP+RIN+C+  GA+MF+
Sbjct  71   VMKVNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVILSSENIPTRINKCLASGAQMFM  130

Query  534  LKPLKQADVNELKSQLMHKRL  596
             KPLK +DV +LK  L++ R+
Sbjct  131  QKPLKLSDVEKLKCHLLNCRI  151



>ref|XP_010525415.1| PREDICTED: two-component response regulator ARR17-like isoform 
X2 [Tarenaya hassleriana]
Length=155

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 119/152 (78%), Gaps = 7/152 (5%)
 Frame = +3

Query  138  ACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLL  317
            +CPS  +   ENG  E +HVLAVDD+ ++  ++EKLLK SSCKVTTAENG+RALEYLGL 
Sbjct  10   SCPSMEVPY-ENGNGE-LHVLAVDDNLVDRKLVEKLLKISSCKVTTAENGLRALEYLGL-  66

Query  318  AGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  497
             GD +      N+ KVNLIITDY MPGM G+ELLK+VK+S+  ++VPVV+MSSENIP+RI
Sbjct  67   -GDQEQTK---NISKVNLIITDYCMPGMTGFELLKRVKESSGLREVPVVIMSSENIPTRI  122

Query  498  NQCMEVGAKMFILKPLKQADVNELKSQLMHKR  593
            ++C+  GA+MF+LKPLK +DV  LK +LM+ R
Sbjct  123  DKCLASGAQMFMLKPLKLSDVKTLKCRLMNCR  154



>ref|XP_009363791.1| PREDICTED: two-component response regulator ARR17 [Pyrus x bretschneideri]
Length=153

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 118/153 (77%), Gaps = 5/153 (3%)
 Frame = +3

Query  135  MACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGL  314
            M   SSS + G     E  HVLAVDD  ++  +IEKLL + SCKVTTAENG  ALE+LGL
Sbjct  1    MEAASSSSSKGFMANVEQPHVLAVDDSLVDRKLIEKLLTNLSCKVTTAENGASALEFLGL  60

Query  315  LAGDVQHNSPNTNVP--KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIP  488
              GD QHNS  +NV   KVNL+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP
Sbjct  61   --GD-QHNSLESNVSNSKVNLVITDYCMPGMTGYELLKKIKESSIMKEVPVVIMSSENIP  117

Query  489  SRINQCMEVGAKMFILKPLKQADVNELKSQLMH  587
            +RIN+C+E GA+MF+LKPLKQ+D+ +L+  LM+
Sbjct  118  NRINKCLEEGAQMFMLKPLKQSDMKKLRYHLMN  150



>ref|XP_006292820.1| hypothetical protein CARUB_v10019069mg, partial [Capsella rubella]
 gb|EOA25718.1| hypothetical protein CARUB_v10019069mg, partial [Capsella rubella]
Length=148

 Score =   175 bits (444),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 114/141 (81%), Gaps = 4/141 (3%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP--NTN  353
            +E +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q   P  +TN
Sbjct  10   EEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGL--GDPQQTDPVTSTN  67

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
            V KVNLIITDY MPGM G+ELL+KVK+S+  K VPVV++SSENIP+RIN+C+  GA+MF+
Sbjct  68   VMKVNLIITDYCMPGMTGFELLQKVKESSNLKGVPVVILSSENIPTRINKCLASGAQMFM  127

Query  534  LKPLKQADVNELKSQLMHKRL  596
             KPLK +DV +LK  L++ R+
Sbjct  128  QKPLKLSDVEKLKCHLLNCRI  148



>ref|XP_002879884.1| hypothetical protein ARALYDRAFT_483126 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56143.1| hypothetical protein ARALYDRAFT_483126 [Arabidopsis lyrata subsp. 
lyrata]
Length=163

 Score =   176 bits (445),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +3

Query  168  ENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN  347
             +G DE +HVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL   +   ++  
Sbjct  21   HHGHDEELHVLAVDDNLIDRKLVERLLKISSCKVTTAENAIRALEYLGLGDQNQHIDALT  80

Query  348  TNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKM  527
             NV KVNLIITDY MPGM G+ELLKKVK+S+  +++PVV+MSSENIP+RIN+C+  GA+M
Sbjct  81   CNVMKVNLIITDYCMPGMTGFELLKKVKESSNLRELPVVIMSSENIPTRINKCLASGAQM  140

Query  528  FILKPLKQADVNELKSQLMHKR  593
            F+ KPLK +DV +LK  LM+ R
Sbjct  141  FMQKPLKLSDVEKLKCHLMNCR  162



>ref|NP_181599.1| two-component response regulator ARR16 [Arabidopsis thaliana]
 sp|Q9SHC2.1|ARR16_ARATH RecName: Full=Two-component response regulator ARR16 [Arabidopsis 
thaliana]
 gb|AAG40612.1|AF305721_1 response regulator 16 [Arabidopsis thaliana]
 emb|CAC10396.1| putative type A response regulator [Arabidopsis thaliana]
 gb|ACF88487.1| At2g40670 [Arabidopsis thaliana]
 gb|AEC09862.1| two-component response regulator ARR16 [Arabidopsis thaliana]
Length=164

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +3

Query  168  ENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN  347
             +G DE +HVLAVDD+ I+  ++E+LLK S CKVTTAEN +RALEYLGL   +   ++  
Sbjct  22   HHGHDEELHVLAVDDNLIDRKLVERLLKISCCKVTTAENALRALEYLGLGDQNQHIDALT  81

Query  348  TNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKM  527
             NV KV+LIITDY MPGM G+ELLKKVK+S+  ++VPVV+MSSENIP+RIN+C+  GA+M
Sbjct  82   CNVMKVSLIITDYCMPGMTGFELLKKVKESSNLREVPVVIMSSENIPTRINKCLASGAQM  141

Query  528  FILKPLKQADVNELKSQLMHKR  593
            F+ KPLK ADV +LK  LM+ R
Sbjct  142  FMQKPLKLADVEKLKCHLMNCR  163



>ref|XP_004308985.1| PREDICTED: two-component response regulator ARR16-like [Fragaria 
vesca subsp. vesca]
Length=149

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 7/131 (5%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN-TNVPKVN  368
            HVLAVDD  I+  +IEKLLK+ SCKVTTAENG RALE+LGL  GD     PN  NV KVN
Sbjct  20   HVLAVDDSDIDRKLIEKLLKNFSCKVTTAENGARALEFLGL--GD----HPNHCNVSKVN  73

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            L+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP+RIN+C+E GA+MF+LKPLK
Sbjct  74   LVITDYCMPGMTGYELLKKIKESSVMKEVPVVIMSSENIPNRINKCLEEGAQMFMLKPLK  133

Query  549  QADVNELKSQL  581
            Q+D+ +L+  L
Sbjct  134  QSDIKQLRCHL  144



>ref|XP_002876364.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52623.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=149

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 117/152 (77%), Gaps = 7/152 (5%)
 Frame = +3

Query  138  ACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLL  317
             C S S +   + E+E +HVLAVDD+ I+   +E++LK SSCKVTTAENG+RALEYLGL 
Sbjct  4    GCGSGSESCLSSMEEE-LHVLAVDDNLIDRKFLERILKISSCKVTTAENGLRALEYLGL-  61

Query  318  AGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  497
             GD Q     TNV KVNLIITDY MPGM G+ELLKKVK+S+  K+VPVV++SSENIP+RI
Sbjct  62   -GDPQQ----TNVMKVNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVILSSENIPTRI  116

Query  498  NQCMEVGAKMFILKPLKQADVNELKSQLMHKR  593
            N+C+  GA+MF+ KPLK +DV +LK  L++ R
Sbjct  117  NKCLASGAQMFMQKPLKLSDVEKLKCHLLNCR  148



>ref|XP_010427456.1| PREDICTED: two-component response regulator ARR17-like isoform 
X1 [Camelina sativa]
Length=152

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 116/142 (82%), Gaps = 4/142 (3%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP--NTN  353
            +E +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q + P  +TN
Sbjct  12   EEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGL-GGDPQQSDPVTSTN  70

Query  354  VPKVNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCMEVGAKMF  530
            V KVNLIITDY MPGM G+ELLKKVK +S+  K+VPVV++SSENIP+RIN+C+  GA+MF
Sbjct  71   VMKVNLIITDYCMPGMTGFELLKKVKQESSKLKEVPVVILSSENIPTRINKCLASGAQMF  130

Query  531  ILKPLKQADVNELKSQLMHKRL  596
            + KPLK +DV +LK  L++ R+
Sbjct  131  MQKPLKLSDVEKLKCHLLNCRI  152



>ref|XP_008369375.1| PREDICTED: two-component response regulator ARR17 isoform X1 
[Malus domestica]
Length=152

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 111/134 (83%), Gaps = 5/134 (4%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP--KV  365
            HVLAVDD  ++  +IEKLL + SCKVTTAENG  ALE+LGL  GD QHNS  +NV   KV
Sbjct  19   HVLAVDDSLVDRKLIEKLLTNLSCKVTTAENGASALEFLGL--GD-QHNSLESNVSNSKV  75

Query  366  NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPL  545
            NL+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSEN+P+RIN+C+E GA+MF+LKPL
Sbjct  76   NLVITDYCMPGMTGYELLKKIKESSIMKEVPVVIMSSENVPTRINKCLEEGAQMFMLKPL  135

Query  546  KQADVNELKSQLMH  587
            KQ+D+ +L+  LM+
Sbjct  136  KQSDMKKLRYHLMN  149



>ref|XP_010525414.1| PREDICTED: two-component response regulator ARR17-like isoform 
X1 [Tarenaya hassleriana]
Length=156

 Score =   173 bits (438),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 119/153 (78%), Gaps = 8/153 (5%)
 Frame = +3

Query  138  ACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLL  317
            +CPS  +   ENG  E +HVLAVDD+ ++  ++EKLLK SSCKVTTAENG+RALEYLGL 
Sbjct  10   SCPSMEVPY-ENGNGE-LHVLAVDDNLVDRKLVEKLLKISSCKVTTAENGLRALEYLGL-  66

Query  318  AGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSR  494
             GD +      N+ KVNLIITDY MPGM G+ELLK+VK +S+  ++VPVV+MSSENIP+R
Sbjct  67   -GDQEQTK---NISKVNLIITDYCMPGMTGFELLKRVKQESSGLREVPVVIMSSENIPTR  122

Query  495  INQCMEVGAKMFILKPLKQADVNELKSQLMHKR  593
            I++C+  GA+MF+LKPLK +DV  LK +LM+ R
Sbjct  123  IDKCLASGAQMFMLKPLKLSDVKTLKCRLMNCR  155



>ref|XP_006402992.1| hypothetical protein EUTSA_v10006466mg [Eutrema salsugineum]
 gb|ESQ44445.1| hypothetical protein EUTSA_v10006466mg [Eutrema salsugineum]
Length=140

 Score =   172 bits (436),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 112/140 (80%), Gaps = 4/140 (3%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQH--NSPNTN  353
            +E +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q   +   TN
Sbjct  2    EEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGL--GDPQQIDSLTTTN  59

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
            V KVNLIITDY MPGM G+ELLK VK+S+  K+VPVV++SSENIP+RIN+C+  GA+MF+
Sbjct  60   VMKVNLIITDYCMPGMTGFELLKIVKESSNLKEVPVVILSSENIPTRINKCLASGAQMFM  119

Query  534  LKPLKQADVNELKSQLMHKR  593
             KPLKQ+DV +LK  L+  R
Sbjct  120  QKPLKQSDVEKLKYHLLKCR  139



>ref|XP_010670065.1| PREDICTED: two-component response regulator ARR17 [Beta vulgaris 
subsp. vulgaris]
Length=159

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 114/140 (81%), Gaps = 4/140 (3%)
 Frame = +3

Query  174  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  353
            G ++  HVLAVDD+ I+  +IE+LLKSSSCKVTTAEN + ALEYLG+  G+ Q N+  + 
Sbjct  23   GYEDQPHVLAVDDNVIDRKLIERLLKSSSCKVTTAENAMSALEYLGI--GEDQQNT--SK  78

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
              KVNLI+TDY MPGM GY+LLKK+K+S+  ++VPVV+MSSEN+P+RI++C+E GA+MF+
Sbjct  79   AAKVNLILTDYCMPGMTGYDLLKKIKESSKLREVPVVIMSSENVPTRISKCLEEGAQMFM  138

Query  534  LKPLKQADVNELKSQLMHKR  593
            LKPLK +DV +L+ Q+M +R
Sbjct  139  LKPLKLSDVKKLRCQIMKRR  158



>gb|AAQ10676.1| type-A response regulator [Catharanthus roseus]
Length=154

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 110/145 (76%), Gaps = 10/145 (7%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP----NTNV  356
            +HVLAVDD+ I+  I+EKLL SSSCKVTTAENG+RALEYLG L    +  +P    +  +
Sbjct  9    LHVLAVDDNIIDRKIVEKLLISSSCKVTTAENGIRALEYLGNLGVHSESQTPALHQDDAI  68

Query  357  P------KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVG  518
            P      KVNLIITDY  P M GYELLKK+K+S++ KD+PV+VMSSENIP+RI++C+E G
Sbjct  69   PTAAGDLKVNLIITDYCKPEMTGYELLKKIKESSILKDIPVIVMSSENIPTRIHKCLEEG  128

Query  519  AKMFILKPLKQADVNELKSQLMHKR  593
            A+MF+LKPLK +DV  L+ QLM  R
Sbjct  129  AQMFMLKPLKHSDVTRLRCQLMQCR  153



>ref|XP_009116343.1| PREDICTED: two-component response regulator ARR17 isoform X2 
[Brassica rapa]
Length=140

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 112/140 (80%), Gaps = 4/140 (3%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQH--NSPNTN  353
            +E +HVLAVDD+ ++  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q   +S   N
Sbjct  2    EEELHVLAVDDNLMDRKLVERILKISSCKVTTAENGIRALEYLGL--GDSQQADSSSTNN  59

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
            V KVNLIITDY MPGM G+ELLK VK+S+  K+VPVV++SSENIP+RIN+C+  GA+MF+
Sbjct  60   VMKVNLIITDYCMPGMTGFELLKIVKESSNLKEVPVVILSSENIPTRINKCLASGAQMFM  119

Query  534  LKPLKQADVNELKSQLMHKR  593
             KPLK +DV +LK  L++ R
Sbjct  120  QKPLKLSDVEKLKCHLLNCR  139



>ref|XP_006411334.1| hypothetical protein EUTSA_v10017348mg [Eutrema salsugineum]
 gb|ESQ52787.1| hypothetical protein EUTSA_v10017348mg [Eutrema salsugineum]
Length=160

 Score =   171 bits (433),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 113/142 (80%), Gaps = 1/142 (1%)
 Frame = +3

Query  168  ENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN  347
            ++G +E +HVLAVDD+ I+  ++EKLLK SSCKVTTAEN +RALEYLGL   +   ++  
Sbjct  19   DHGHEE-LHVLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGLGDQNQHIDALT  77

Query  348  TNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKM  527
             NV KVNLIITDY MPGM G+ELLKKVK+S+  K+VPVV+MSSE+IP+RIN+C+  GA+M
Sbjct  78   NNVMKVNLIITDYCMPGMTGFELLKKVKESSDLKEVPVVIMSSESIPTRINKCLASGAQM  137

Query  528  FILKPLKQADVNELKSQLMHKR  593
            F+ KPLK +DV +LK  LM+ R
Sbjct  138  FMQKPLKLSDVEKLKCHLMNCR  159



>ref|XP_004502823.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator 
ARR17-like [Cicer arietinum]
Length=174

 Score =   171 bits (434),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 110/135 (81%), Gaps = 3/135 (2%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            ++ HVLAVDD+ I+  ++EKLL++SSCKVTTAENG  ALE LGL +G+    S      K
Sbjct  19   DIPHVLAVDDNLIDRKLVEKLLRNSSCKVTTAENGPMALELLGLTSGE---QSTLNGESK  75

Query  363  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
            VNL+ITDY MPGM+GYELLKK+K S++ K+VPVV+MSSENIP+RIN+C+E GA+MF+LKP
Sbjct  76   VNLVITDYCMPGMSGYELLKKIKQSSIMKEVPVVIMSSENIPTRINKCLEEGAQMFMLKP  135

Query  543  LKQADVNELKSQLMH  587
            LKQ+DV +L  QLM+
Sbjct  136  LKQSDVKQLTCQLMN  150



>ref|XP_006295142.1| hypothetical protein CARUB_v10024214mg [Capsella rubella]
 gb|EOA28040.1| hypothetical protein CARUB_v10024214mg [Capsella rubella]
Length=161

 Score =   171 bits (433),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 113/145 (78%), Gaps = 5/145 (3%)
 Frame = +3

Query  168  ENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV-QHNSP  344
            ++   E IHVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL  GD  QH   
Sbjct  18   DDDHHEEIHVLAVDDNLIDRKLVERLLKISSCKVTTAENALRALEYLGL--GDQNQHIDA  75

Query  345  NT--NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVG  518
             T  N  KVNLIITDY MPGM G+ELLKKVK+S+  K+VPVV+MSSENIP+RIN+C+  G
Sbjct  76   LTTNNDLKVNLIITDYCMPGMTGFELLKKVKESSYLKEVPVVIMSSENIPTRINKCLASG  135

Query  519  AKMFILKPLKQADVNELKSQLMHKR  593
            A+MF+ KPLK +DV +LK QLM+ R
Sbjct  136  AQMFMQKPLKLSDVEKLKCQLMNCR  160



>ref|NP_001189722.1| two-component response regulator ARR16 [Arabidopsis thaliana]
 gb|AEC09863.1| two-component response regulator ARR16 [Arabidopsis thaliana]
Length=165

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 111/143 (78%), Gaps = 1/143 (1%)
 Frame = +3

Query  168  ENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN  347
             +G DE +HVLAVDD+ I+  ++E+LLK S CKVTTAEN +RALEYLGL   +   ++  
Sbjct  22   HHGHDEELHVLAVDDNLIDRKLVERLLKISCCKVTTAENALRALEYLGLGDQNQHIDALT  81

Query  348  TNVPKVNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCMEVGAK  524
             NV KV+LIITDY MPGM G+ELLKKVK +S+  ++VPVV+MSSENIP+RIN+C+  GA+
Sbjct  82   CNVMKVSLIITDYCMPGMTGFELLKKVKQESSNLREVPVVIMSSENIPTRINKCLASGAQ  141

Query  525  MFILKPLKQADVNELKSQLMHKR  593
            MF+ KPLK ADV +LK  LM+ R
Sbjct  142  MFMQKPLKLADVEKLKCHLMNCR  164



>ref|XP_010067618.1| PREDICTED: two-component response regulator ARR17-like [Eucalyptus 
grandis]
 gb|KCW65786.1| hypothetical protein EUGRSUZ_G03141 [Eucalyptus grandis]
Length=143

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD+ ++  +IE LLK+SSC+VTTAENG+RALEYLG+       +S +    KVNL
Sbjct  9    HVLAVDDNLVDRKMIEALLKNSSCRVTTAENGMRALEYLGIRDDQPGESSVSATTSKVNL  68

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM G+ELLKKVK S++ K+VPVV++SSEN+P+RIN+C+  GA+MF+LKPLK 
Sbjct  69   IITDYCMPGMTGFELLKKVKGSSILKEVPVVIVSSENVPTRINKCLAEGAQMFMLKPLKA  128

Query  552  ADVNELKSQLMHKR  593
            +DV +L+  LM+ R
Sbjct  129  SDVKKLRCHLMNCR  142



>ref|XP_010508821.1| PREDICTED: two-component response regulator ARR16 isoform X2 
[Camelina sativa]
Length=164

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            E +HVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL   +   ++   N  K
Sbjct  27   EELHVLAVDDNLIDRKLVERLLKISSCKVTTAENALRALEYLGLGDQNQHIDALTNNDLK  86

Query  363  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
            VNLIITDY MPGM G+ELLKKVK+S+  K+VPVV+MSSENIP+RIN+C+  GA+MF+ KP
Sbjct  87   VNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVIMSSENIPTRINKCLASGAQMFMQKP  146

Query  543  LKQADVNELKSQLMHKR  593
            LK +DV +LK  LM+ R
Sbjct  147  LKLSDVEKLKCHLMNCR  163



>ref|XP_008245269.1| PREDICTED: two-component response regulator ARR17-like [Prunus 
mume]
Length=172

 Score =   169 bits (429),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 111/141 (79%), Gaps = 4/141 (3%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG +G DE  HVLAVDD  ++  +IEKLL +S+CKVTTAEN   ALE LGL   D Q N 
Sbjct  21   MGWDG-DEKPHVLAVDDSFVDRRVIEKLLTNSACKVTTAENAQGALELLGL--ADGQQNF  77

Query  342  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGA  521
             NT V KVNLIITDYSMPGM GYELLKK+K+S   K++PVV++SSE+IP+RI +C+E GA
Sbjct  78   GNT-VSKVNLIITDYSMPGMTGYELLKKIKESPTGKEIPVVIVSSEHIPTRIEKCLEEGA  136

Query  522  KMFILKPLKQADVNELKSQLM  584
            K F+LKPL+Q+DVN+L+S LM
Sbjct  137  KEFLLKPLRQSDVNQLRSHLM  157



>ref|XP_010505820.1| PREDICTED: two-component response regulator ARR16-like isoform 
X2 [Camelina sativa]
Length=164

 Score =   169 bits (428),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL   +   ++   N  KVN
Sbjct  29   LHVLAVDDNLIDRKLVERLLKISSCKVTTAENALRALEYLGLGDQNQHIDALTNNDLKVN  88

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM G+ELLKKVK+S+  K+VPVV+MSSENIP+RIN+C+  GA+MF+ KPLK
Sbjct  89   LIITDYCMPGMTGFELLKKVKESSNLKEVPVVIMSSENIPTRINKCLASGAQMFMQKPLK  148

Query  549  QADVNELKSQLMHKRL  596
             +DV +LK  LM+ R+
Sbjct  149  LSDVEKLKCHLMNCRI  164



>ref|XP_009139105.1| PREDICTED: two-component response regulator ARR17 isoform X2 
[Brassica rapa]
Length=140

 Score =   168 bits (425),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 112/140 (80%), Gaps = 4/140 (3%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHN-SPNTN-  353
            DE +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q   S  TN 
Sbjct  2    DEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGL--GDPQQTESLTTNS  59

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
            V KVNLIITDY MPGM G+ELLK VK+S+  K+VPVV++SSENIP+RIN+C+  GA+MF+
Sbjct  60   VMKVNLIITDYCMPGMTGFELLKIVKESSNLKEVPVVILSSENIPTRINKCLASGAQMFM  119

Query  534  LKPLKQADVNELKSQLMHKR  593
             KPLK +DV +LK  +++ R
Sbjct  120  QKPLKLSDVEKLKGHVLNCR  139



>ref|XP_010517508.1| PREDICTED: two-component response regulator ARR16-like isoform 
X2 [Camelina sativa]
Length=165

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL   +   ++   N  KVN
Sbjct  30   LHVLAVDDNLIDRKLVERLLKISSCKVTTAENALRALEYLGLGDQNQHIDALTNNDLKVN  89

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM G+ELLKKVK+S+  K+VPVV+MSSENIP+RIN+C+  GA+MF+ KPLK
Sbjct  90   LIITDYCMPGMTGFELLKKVKESSNLKEVPVVIMSSENIPTRINKCLASGAQMFMQKPLK  149

Query  549  QADVNELKSQLMHKR  593
             +DV +LK  LM+ R
Sbjct  150  LSDVEKLKCHLMNCR  164



>ref|XP_007208607.1| hypothetical protein PRUPE_ppa021876mg [Prunus persica]
 gb|EMJ09806.1| hypothetical protein PRUPE_ppa021876mg [Prunus persica]
Length=170

 Score =   168 bits (426),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 110/141 (78%), Gaps = 4/141 (3%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG +G DE  HVLAVDD  ++  IIEKLL +S+CKVTTAEN   ALE LGL   D Q N 
Sbjct  19   MGWDG-DEKPHVLAVDDSFVDRRIIEKLLTNSACKVTTAENAQGALELLGL--ADGQQNF  75

Query  342  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGA  521
             NT V KVNLIITDYSMPGM GYELLKK+K+S   K++PVVV+SSE+IP+RI +C+E GA
Sbjct  76   GNT-VSKVNLIITDYSMPGMTGYELLKKIKESPTGKEIPVVVVSSEHIPTRIEKCLEEGA  134

Query  522  KMFILKPLKQADVNELKSQLM  584
            K F+LKPL+Q+DVN+L+  LM
Sbjct  135  KEFLLKPLRQSDVNQLRCHLM  155



>ref|XP_011009512.1| PREDICTED: two-component response regulator ARR17-like [Populus 
euphratica]
Length=163

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 106/134 (79%), Gaps = 4/134 (3%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP  359
            DE  HVLAVDD  I+  +IE+LL +S+C+VTTAENG RALEYLGL   D QH  PN +  
Sbjct  16   DEKPHVLAVDDSFIDRKVIERLLINSTCRVTTAENGKRALEYLGL--ADGQH--PNHSDL  71

Query  360  KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILK  539
            KVN+IITDYSMPGM GYELLK++K+S   K++PVVV+SSENIP+RINQCME GA+ F+LK
Sbjct  72   KVNMIITDYSMPGMTGYELLKRIKESPTMKEIPVVVVSSENIPTRINQCMEGGAQEFLLK  131

Query  540  PLKQADVNELKSQL  581
            PL+ +D  +L+  L
Sbjct  132  PLQLSDATKLRCHL  145



>ref|XP_009133449.1| PREDICTED: two-component response regulator ARR16 isoform X2 
[Brassica rapa]
 emb|CDY35445.1| BnaA03g19150D [Brassica napus]
Length=161

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +3

Query  195  VLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNLI  374
            VLAVDD+ I+  ++EKLLK SSCKVTTAEN +RALEYLGL   D   ++   N  KVNLI
Sbjct  28   VLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGLGDQDQHIDALTNNDLKVNLI  87

Query  375  ITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQA  554
            ITDY MPGM G+ELLKKVK+S+  K+VPVV+MSSENIP+RIN+C+  GA+MF+ KPLK +
Sbjct  88   ITDYCMPGMTGFELLKKVKESSNLKEVPVVIMSSENIPTRINKCLASGAQMFMQKPLKLS  147

Query  555  DVNELKSQLMHKR  593
            DV +LK  LM+ R
Sbjct  148  DVEKLKCHLMNCR  160



>ref|XP_009116342.1| PREDICTED: two-component response regulator ARR17 isoform X1 
[Brassica rapa]
Length=141

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 112/141 (79%), Gaps = 5/141 (4%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQH--NSPNTN  353
            +E +HVLAVDD+ ++  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q   +S   N
Sbjct  2    EEELHVLAVDDNLMDRKLVERILKISSCKVTTAENGIRALEYLGL--GDSQQADSSSTNN  59

Query  354  VPKVNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCMEVGAKMF  530
            V KVNLIITDY MPGM G+ELLK VK +S+  K+VPVV++SSENIP+RIN+C+  GA+MF
Sbjct  60   VMKVNLIITDYCMPGMTGFELLKIVKQESSNLKEVPVVILSSENIPTRINKCLASGAQMF  119

Query  531  ILKPLKQADVNELKSQLMHKR  593
            + KPLK +DV +LK  L++ R
Sbjct  120  MQKPLKLSDVEKLKCHLLNCR  140



>ref|XP_006295143.1| hypothetical protein CARUB_v10024214mg [Capsella rubella]
 gb|EOA28041.1| hypothetical protein CARUB_v10024214mg [Capsella rubella]
Length=162

 Score =   166 bits (421),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 113/146 (77%), Gaps = 6/146 (4%)
 Frame = +3

Query  168  ENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV-QHNSP  344
            ++   E IHVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL  GD  QH   
Sbjct  18   DDDHHEEIHVLAVDDNLIDRKLVERLLKISSCKVTTAENALRALEYLGL--GDQNQHIDA  75

Query  345  NT--NVPKVNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCMEV  515
             T  N  KVNLIITDY MPGM G+ELLKKVK +S+  K+VPVV+MSSENIP+RIN+C+  
Sbjct  76   LTTNNDLKVNLIITDYCMPGMTGFELLKKVKQESSYLKEVPVVIMSSENIPTRINKCLAS  135

Query  516  GAKMFILKPLKQADVNELKSQLMHKR  593
            GA+MF+ KPLK +DV +LK QLM+ R
Sbjct  136  GAQMFMQKPLKLSDVEKLKCQLMNCR  161



>ref|XP_002326060.1| hypothetical protein POPTR_0019s15410g [Populus trichocarpa]
 gb|EEF00442.1| hypothetical protein POPTR_0019s15410g [Populus trichocarpa]
Length=151

 Score =   166 bits (419),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 107/134 (80%), Gaps = 3/134 (2%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP  359
            DE  HVLAVDD  I+  +IE+LL +S+C+VTTAENG RALEYLGL   D QH S + ++ 
Sbjct  16   DEKPHVLAVDDSLIDRKVIERLLINSTCRVTTAENGKRALEYLGL--ADGQHPSHSQDL-  72

Query  360  KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILK  539
            KVN+IITDYSMPGM GYELLK++K+S   K++PVVV+SSENIP+RINQCME GA+ F+LK
Sbjct  73   KVNMIITDYSMPGMTGYELLKRIKESPTMKEIPVVVVSSENIPTRINQCMEGGAQEFLLK  132

Query  540  PLKQADVNELKSQL  581
            PL+ +D  +L+  +
Sbjct  133  PLQLSDATKLRCHI  146



>emb|CDP04042.1| unnamed protein product [Coffea canephora]
Length=155

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 108/145 (74%), Gaps = 6/145 (4%)
 Frame = +3

Query  156  MAMGENGE--DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV  329
            MA    G   DE  HVLAVDD  ++  +IEKL  SS+CKVTTAENG RALE LGL  GD 
Sbjct  1    MASSSRGRESDERPHVLAVDDSLVDRRLIEKLFTSSACKVTTAENGQRALEVLGL--GDG  58

Query  330  QHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  509
            QH S    V ++NLIITDY MPGM GYELLKKVK+S+  +++PVV++SSEN+P+RI +C+
Sbjct  59   QHAS--NCVSEINLIITDYCMPGMTGYELLKKVKESSRLREIPVVIVSSENVPTRIKECL  116

Query  510  EVGAKMFILKPLKQADVNELKSQLM  584
            E GA+ F+LKPL Q+DV +L+  +M
Sbjct  117  EEGAQEFMLKPLNQSDVMKLRCYMM  141



>emb|CDY22469.1| BnaC03g22790D [Brassica napus]
Length=158

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +3

Query  195  VLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV-QHNSPNTNVPKVNL  371
            VLAVDD+ I+  ++EKLLK SSCKVTTAEN +RALEYLGL  GD  QH +   N  KVNL
Sbjct  26   VLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGL--GDHNQHMALTNNNLKVNL  83

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM G+ELLKKVK+S+  K+VPVV+MSSE IP+RI++C+  GA+MF+ KPLK 
Sbjct  84   IITDYCMPGMTGFELLKKVKESSNLKEVPVVIMSSEYIPTRISKCLASGAQMFMQKPLKL  143

Query  552  ADVNELKSQLMHKR  593
            +DV +LK  LM+ R
Sbjct  144  SDVEKLKCHLMNSR  157



>ref|XP_010508820.1| PREDICTED: two-component response regulator ARR16 isoform X1 
[Camelina sativa]
Length=165

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            E +HVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL   +   ++   N  K
Sbjct  27   EELHVLAVDDNLIDRKLVERLLKISSCKVTTAENALRALEYLGLGDQNQHIDALTNNDLK  86

Query  363  VNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILK  539
            VNLIITDY MPGM G+ELLKKVK +S+  K+VPVV+MSSENIP+RIN+C+  GA+MF+ K
Sbjct  87   VNLIITDYCMPGMTGFELLKKVKQESSNLKEVPVVIMSSENIPTRINKCLASGAQMFMQK  146

Query  540  PLKQADVNELKSQLMHKR  593
            PLK +DV +LK  LM+ R
Sbjct  147  PLKLSDVEKLKCHLMNCR  164



>ref|XP_010505819.1| PREDICTED: two-component response regulator ARR16-like isoform 
X1 [Camelina sativa]
Length=165

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 108/137 (79%), Gaps = 1/137 (1%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL   +   ++   N  KVN
Sbjct  29   LHVLAVDDNLIDRKLVERLLKISSCKVTTAENALRALEYLGLGDQNQHIDALTNNDLKVN  88

Query  369  LIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPL  545
            LIITDY MPGM G+ELLKKVK +S+  K+VPVV+MSSENIP+RIN+C+  GA+MF+ KPL
Sbjct  89   LIITDYCMPGMTGFELLKKVKQESSNLKEVPVVIMSSENIPTRINKCLASGAQMFMQKPL  148

Query  546  KQADVNELKSQLMHKRL  596
            K +DV +LK  LM+ R+
Sbjct  149  KLSDVEKLKCHLMNCRI  165



>ref|XP_009139104.1| PREDICTED: two-component response regulator ARR17 isoform X1 
[Brassica rapa]
Length=141

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 112/141 (79%), Gaps = 5/141 (4%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHN-SPNTN-  353
            DE +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q   S  TN 
Sbjct  2    DEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGL--GDPQQTESLTTNS  59

Query  354  VPKVNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCMEVGAKMF  530
            V KVNLIITDY MPGM G+ELLK VK +S+  K+VPVV++SSENIP+RIN+C+  GA+MF
Sbjct  60   VMKVNLIITDYCMPGMTGFELLKIVKQESSNLKEVPVVILSSENIPTRINKCLASGAQMF  119

Query  531  ILKPLKQADVNELKSQLMHKR  593
            + KPLK +DV +LK  +++ R
Sbjct  120  MQKPLKLSDVEKLKGHVLNCR  140



>ref|XP_010517507.1| PREDICTED: two-component response regulator ARR16-like isoform 
X1 [Camelina sativa]
Length=166

 Score =   164 bits (415),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 107/136 (79%), Gaps = 1/136 (1%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL   +   ++   N  KVN
Sbjct  30   LHVLAVDDNLIDRKLVERLLKISSCKVTTAENALRALEYLGLGDQNQHIDALTNNDLKVN  89

Query  369  LIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPL  545
            LIITDY MPGM G+ELLKKVK +S+  K+VPVV+MSSENIP+RIN+C+  GA+MF+ KPL
Sbjct  90   LIITDYCMPGMTGFELLKKVKQESSNLKEVPVVIMSSENIPTRINKCLASGAQMFMQKPL  149

Query  546  KQADVNELKSQLMHKR  593
            K +DV +LK  LM+ R
Sbjct  150  KLSDVEKLKCHLMNCR  165



>gb|KDO67530.1| hypothetical protein CISIN_1g042079mg [Citrus sinensis]
Length=153

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD  ++  I+E LLK+S+CKVTTAENG+RALE+LGL+    Q N+ N+N  KVNL
Sbjct  22   HVLAVDDSIVDRKIVENLLKNSACKVTTAENGMRALEFLGLVDEQEQQNNLNSNGTKVNL  81

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            +ITDY MPGM GYELLKK+K+S++ K+VPVVV+SSENIP+RIN+C+E GA+MF+LKPLK 
Sbjct  82   VITDYCMPGMTGYELLKKIKESSVMKEVPVVVVSSENIPTRINECLEEGAQMFMLKPLKP  141

Query  552  ADVNELKSQLMH  587
            +DV +L   L++
Sbjct  142  SDVKKLTGHLIN  153



>gb|KFK36940.1| hypothetical protein AALP_AA4G192000 [Arabis alpina]
Length=154

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 109/146 (75%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  ACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLL  317
            +C S      ++   E  HVLAVDD+ I+  ++EKLLK SSCKVTTAEN +RALEYLGL 
Sbjct  6    SCSSLMEVDYDHHSHEEFHVLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGL-  64

Query  318  AGDV-QHNSPNTNVP-KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPS  491
             GD  QH    TN   KVNLIITDY MPGM G+ELLKKVK+S+  K+VPVV+MSSENIP+
Sbjct  65   -GDQNQHIDALTNHDLKVNLIITDYCMPGMTGFELLKKVKESSYLKEVPVVIMSSENIPT  123

Query  492  RINQCMEVGAKMFILKPLKQADVNEL  569
            R+N+C+  GA+MF+ KPLK +DV +L
Sbjct  124  RVNKCLASGAQMFMQKPLKLSDVEKL  149



>ref|XP_006435932.1| hypothetical protein CICLE_v10032983mg [Citrus clementina]
 ref|XP_006486159.1| PREDICTED: two-component response regulator ARR17-like [Citrus 
sinensis]
 gb|ESR49172.1| hypothetical protein CICLE_v10032983mg [Citrus clementina]
Length=152

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD  ++  I+E LLK+S+CKVTTAENG+RALE+LGL+    Q N+ N+N  KVNL
Sbjct  21   HVLAVDDSIVDRKIVENLLKNSACKVTTAENGMRALEFLGLVDEQEQQNNLNSNGTKVNL  80

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            +ITDY MPGM GYELLKK+K+S++ K+VPVVV+SSENIP+RIN+C+E GA+MF+LKPLK 
Sbjct  81   VITDYCMPGMTGYELLKKIKESSVMKEVPVVVVSSENIPTRINECLEEGAQMFMLKPLKP  140

Query  552  ADVNELKSQLMH  587
            +DV +L   L++
Sbjct  141  SDVKKLTGHLVN  152



>ref|XP_009133448.1| PREDICTED: two-component response regulator ARR16 isoform X1 
[Brassica rapa]
Length=162

 Score =   163 bits (412),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = +3

Query  195  VLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNLI  374
            VLAVDD+ I+  ++EKLLK SSCKVTTAEN +RALEYLGL   D   ++   N  KVNLI
Sbjct  28   VLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGLGDQDQHIDALTNNDLKVNLI  87

Query  375  ITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            ITDY MPGM G+ELLKKVK +S+  K+VPVV+MSSENIP+RIN+C+  GA+MF+ KPLK 
Sbjct  88   ITDYCMPGMTGFELLKKVKQESSNLKEVPVVIMSSENIPTRINKCLASGAQMFMQKPLKL  147

Query  552  ADVNELKSQLMHKR  593
            +DV +LK  LM+ R
Sbjct  148  SDVEKLKCHLMNCR  161



>ref|XP_007208910.1| hypothetical protein PRUPE_ppa027113mg, partial [Prunus persica]
 gb|EMJ10109.1| hypothetical protein PRUPE_ppa027113mg, partial [Prunus persica]
Length=164

 Score =   163 bits (412),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 109/145 (75%), Gaps = 9/145 (6%)
 Frame = +3

Query  150  SSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV  329
            S M  GE      +HVLAVDD  ++  +IE+LLK SSCKVT  ++G RAL+YLGL   D 
Sbjct  22   SQMGSGE------LHVLAVDDSHVDRKVIERLLKISSCKVTAVDSGTRALQYLGL---DG  72

Query  330  QHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  509
            + +S   +  KVNLIITDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI +RI++C+
Sbjct  73   EKSSVGFDAMKVNLIITDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILTRIDRCL  132

Query  510  EVGAKMFILKPLKQADVNELKSQLM  584
            E GA+ +ILKP+K +DVN LK  +M
Sbjct  133  EEGAEEYILKPVKLSDVNRLKHFMM  157



>ref|XP_006470938.1| PREDICTED: two-component response regulator ARR9-like [Citrus 
sinensis]
Length=187

 Score =   164 bits (414),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP  359
            D   HVLAVDD  I+  +IE+LLK+SS +VT  ++G +ALE+LGLL  D Q NS    V 
Sbjct  6    DSQFHVLAVDDSIIDRKLIERLLKTSSYQVTAVDSGNKALEFLGLLNEDEQTNS---QVI  62

Query  360  KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILK  539
            +VNLIITDY MPGM GY+LL+K+K+SA  KD+PVV+MSSENIPSRIN+C+E GA+ F LK
Sbjct  63   QVNLIITDYCMPGMTGYDLLRKIKESASLKDIPVVIMSSENIPSRINRCLEEGAEEFFLK  122

Query  540  PLKQADVNELKSQLM  584
            P++ ADVN+LK  LM
Sbjct  123  PVQLADVNKLKPHLM  137



>ref|XP_011088585.1| PREDICTED: two-component response regulator ARR9-like [Sesamum 
indicum]
Length=183

 Score =   163 bits (413),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = +3

Query  156  MAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQH  335
            M  G   E    HVLAVDD  I+  +IE+LLK+SS +VT  ++G++ALE+LGLL  D   
Sbjct  1    MGGGVATETHEFHVLAVDDSIIDRKLIERLLKTSSYQVTAVDSGMKALEFLGLLDDDENT  60

Query  336  NSPNTNVPKV--NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  509
            NS N++  KV  NLIITDY MP + GY+LL+K+K+S +FKD+PVV+MSSEN+PSRIN CM
Sbjct  61   NS-NSHHHKVEVNLIITDYCMPAITGYDLLRKIKESRLFKDIPVVIMSSENVPSRINSCM  119

Query  510  EVGAKMFILKPLKQADVNELKSQLMHKRLS  599
            E GA+ F LKP++Q+DVN+L+  LM  R S
Sbjct  120  EQGAEEFFLKPVQQSDVNKLRPHLMRGRKS  149



>gb|KDO49056.1| hypothetical protein CISIN_1g046192mg [Citrus sinensis]
Length=187

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP  359
            D   HVLAVDD  I+  +IE+LLK+SS +VT  ++G +ALE+LGLL  D Q NS    V 
Sbjct  6    DSQFHVLAVDDSIIDRKLIERLLKTSSYQVTAVDSGNKALEFLGLLNEDEQTNS---QVI  62

Query  360  KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILK  539
            +VNLIITDY MPGM GY+LL+K+K+SA  KD+PVV+MSSENIPSRIN+C+E GA+ F LK
Sbjct  63   QVNLIITDYCMPGMTGYDLLRKIKESASLKDIPVVIMSSENIPSRINRCLEEGAEEFFLK  122

Query  540  PLKQADVNELKSQLM  584
            P++ ADVN+LK  LM
Sbjct  123  PVQLADVNKLKPHLM  137



>ref|XP_006420721.1| hypothetical protein CICLE_v10005987mg [Citrus clementina]
 gb|ESR33961.1| hypothetical protein CICLE_v10005987mg [Citrus clementina]
Length=187

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP  359
            D   HVLAVDD  I+  +IE+LLK+SS +VT  ++G +ALE+LGLL  D Q NS    V 
Sbjct  6    DSQFHVLAVDDSIIDRKLIERLLKTSSYQVTAVDSGNKALEFLGLLNEDEQTNS---QVI  62

Query  360  KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILK  539
            +VNLIITDY MPGM GY+LL+K+K+SA  KD+PVV+MSSENIPSRIN+C+E GA+ F LK
Sbjct  63   QVNLIITDYCMPGMTGYDLLRKIKESASLKDIPVVIMSSENIPSRINRCLEEGAEEFFLK  122

Query  540  PLKQADVNELKSQLM  584
            P++ ADVN+LK  LM
Sbjct  123  PVQLADVNKLKPHLM  137



>ref|XP_009594904.1| PREDICTED: two-component response regulator ARR9-like [Nicotiana 
tomentosiformis]
Length=225

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG    +   HVLAVDD  I+  +IE+LLK+SSC+VTT ++G +ALE+LGL   D  H++
Sbjct  1    MGMAAAESQFHVLAVDDSIIDRKLIERLLKTSSCQVTTVDSGSKALEFLGLQEDDKNHST  60

Query  342  P------NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  503
                   N    ++NLIITDY MPGM GY+LLKK+K+S+  +++PVV+MSSEN+PSRIN+
Sbjct  61   QPCVSLDNHQEAEINLIITDYCMPGMTGYDLLKKIKESSSLRNIPVVIMSSENVPSRINR  120

Query  504  CMEVGAKMFILKPLKQADVNELKSQLMHKR  593
            C+E GA+ F LKP++ +DVN+LK  +M  R
Sbjct  121  CLEEGAEEFFLKPVRLSDVNKLKPHMMKTR  150



>ref|XP_008239693.1| PREDICTED: two-component response regulator ARR5-like [Prunus 
mume]
Length=227

 Score =   163 bits (412),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 109/145 (75%), Gaps = 9/145 (6%)
 Frame = +3

Query  150  SSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV  329
            S M  GE      +HVLAVDD  ++  +IE+LLK SSCKVT  ++G RAL+YLGL   D 
Sbjct  22   SQMGSGE------LHVLAVDDSHVDRKVIERLLKISSCKVTAVDSGTRALQYLGL---DG  72

Query  330  QHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  509
            + +S   +  KVNLIITDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI +RI++C+
Sbjct  73   EKSSVGFDAMKVNLIITDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILTRIDRCL  132

Query  510  EVGAKMFILKPLKQADVNELKSQLM  584
            E GA+ +ILKP+K +DVN LK  +M
Sbjct  133  EEGAEEYILKPVKLSDVNRLKHFMM  157



>ref|XP_009139049.1| PREDICTED: two-component response regulator ARR9-like [Brassica 
rapa]
Length=234

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG    +   HVLAVDD   +  +IEKLL+ SSC+VTT ++G +ALE+LG+ + D    S
Sbjct  1    MGMAAVESQFHVLAVDDSSFDRKLIEKLLQKSSCQVTTVDSGYKALEFLGIESNDPNALS  60

Query  342  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGA  521
             +    +VNLIITDY MPGM GY+LLKKVK+S+ FK++PVV+MSSEN+P+RI++C+E GA
Sbjct  61   TSPQEVEVNLIITDYCMPGMTGYDLLKKVKESSAFKNIPVVIMSSENVPARISRCLEEGA  120

Query  522  KMFILKPLKQADVNELKSQLMHKRLS  599
            + F LKP++ AD+N+LK  +M  +L+
Sbjct  121  EEFFLKPVRMADLNKLKPHMMKTKLN  146



>emb|CDX76036.1| BnaA04g03000D [Brassica napus]
Length=225

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG    +   HVLAVDD   +  +IEKLL+ SSC+VTT ++G +ALE+LG+ + D    S
Sbjct  1    MGMAAVESQFHVLAVDDSSFDRKLIEKLLQKSSCQVTTVDSGYKALEFLGIESNDPNALS  60

Query  342  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGA  521
             +    +VNLIITDY MPGM GY+LLKKVK+S+ FK++PVV+MSSEN+P+RI++C+E GA
Sbjct  61   TSPQEVEVNLIITDYCMPGMTGYDLLKKVKESSAFKNIPVVIMSSENVPARISRCLEEGA  120

Query  522  KMFILKPLKQADVNELKSQLMHKRLS  599
            + F LKP++ AD+N+LK  +M  +L+
Sbjct  121  EEFFLKPVRMADLNKLKPHMMKTKLN  146



>ref|XP_002511471.1| two-component sensor protein histidine protein kinase, putative 
[Ricinus communis]
 gb|EEF52073.1| two-component sensor protein histidine protein kinase, putative 
[Ricinus communis]
Length=221

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 111/144 (77%), Gaps = 4/144 (3%)
 Frame = +3

Query  156  MAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQH  335
            + +  NG +E +HVLAVDD  ++  +IE+LLK SSCKVT  ++G RAL+YLGL   D + 
Sbjct  17   VGVSSNGSEE-LHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGTRALQYLGL---DGEK  72

Query  336  NSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEV  515
            +S   N  KVNLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI +RI++C+E 
Sbjct  73   SSVGFNDLKVNLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILTRIDRCLEE  132

Query  516  GAKMFILKPLKQADVNELKSQLMH  587
            GA+ FI+KP+K +DV  LK+ +M 
Sbjct  133  GAEEFIVKPVKLSDVKRLKNFVMR  156



>gb|KFK36939.1| hypothetical protein AALP_AA4G192000 [Arabis alpina]
Length=155

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 109/147 (74%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  ACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLL  317
            +C S      ++   E  HVLAVDD+ I+  ++EKLLK SSCKVTTAEN +RALEYLGL 
Sbjct  6    SCSSLMEVDYDHHSHEEFHVLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGL-  64

Query  318  AGDV-QHNSPNTNVP-KVNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIP  488
             GD  QH    TN   KVNLIITDY MPGM G+ELLKKVK +S+  K+VPVV+MSSENIP
Sbjct  65   -GDQNQHIDALTNHDLKVNLIITDYCMPGMTGFELLKKVKQESSYLKEVPVVIMSSENIP  123

Query  489  SRINQCMEVGAKMFILKPLKQADVNEL  569
            +R+N+C+  GA+MF+ KPLK +DV +L
Sbjct  124  TRVNKCLASGAQMFMQKPLKLSDVEKL  150



>ref|XP_009803217.1| PREDICTED: two-component response regulator ARR9 [Nicotiana sylvestris]
Length=227

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 108/147 (73%), Gaps = 6/147 (4%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG    ++  HVLAVDD  I+  +IE+L ++S+C+VTT ++G +ALE+LG    D  H +
Sbjct  1    MGMVAAEQQFHVLAVDDSLIDRKLIERLFRTSACQVTTVDSGSKALEFLGFQENDHNHPN  60

Query  342  PNTNVP------KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  503
            P    P      ++NLIITDY MPGM GY+LLKK+K+S+ F+++PVV+MSSEN+PSRIN+
Sbjct  61   PPCVSPHNHQEVEINLIITDYCMPGMTGYDLLKKIKESSSFRNIPVVIMSSENVPSRINR  120

Query  504  CMEVGAKMFILKPLKQADVNELKSQLM  584
            C+E GA+ F LKP++ +DVN+LK  +M
Sbjct  121  CLEEGAEEFFLKPVRLSDVNKLKPHMM  147



>ref|XP_002888998.1| hypothetical protein ARALYDRAFT_316423 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65257.1| hypothetical protein ARALYDRAFT_316423 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 100/133 (75%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK S+CKVTT E+G RAL+YLGL   D  H S      KVN
Sbjct  18   LHVLAVDDSFVDRKVIERLLKISACKVTTVESGTRALQYLGL---DGDHGSSGLKDLKVN  74

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM  GA+ F+LKP+K
Sbjct  75   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCMIEGAEDFLLKPVK  134

Query  549  QADVNELKSQLMH  587
             ADV  LK  +M 
Sbjct  135  LADVKRLKELIMR  147



>ref|XP_010111960.1| Two-component response regulator [Morus notabilis]
 gb|EXC32234.1| Two-component response regulator [Morus notabilis]
Length=226

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 106/132 (80%), Gaps = 3/132 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL++LGL   D + NS   N  KVN
Sbjct  26   LHVLAVDDSLVDRKVIERLLKISSCKVTAVESGTRALQFLGL---DGEKNSVGFNGLKVN  82

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPGM GYELLK++K+SA F++VPVV+MSSENI +RI++C+E GA+ FI+KP+K
Sbjct  83   LIMTDYSMPGMTGYELLKRIKESAAFREVPVVIMSSENILTRIDRCLEEGAEEFIVKPVK  142

Query  549  QADVNELKSQLM  584
             +DVN LK+ +M
Sbjct  143  LSDVNRLKNFVM  154



>gb|ABG35779.1| SRR200 [Striga asiatica]
Length=158

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 109/142 (77%), Gaps = 5/142 (4%)
 Frame = +3

Query  174  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  353
            G++   HVLAVDD  I+  +IE+LLK+SS +VT  ++GV+ALE+LGLL  D   NS + +
Sbjct  5    GQEMRFHVLAVDDSIIDRKLIERLLKTSSYQVTVVDSGVKALEFLGLLDND-DTNSKSVS  63

Query  354  VPK----VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGA  521
             P+    V+LIITDYSMP + GY+LL+K+K+S + KD+PVV+MSSENIPSRIN C+E GA
Sbjct  64   QPRSNHIVDLIITDYSMPALTGYDLLRKIKESEILKDIPVVIMSSENIPSRINSCLEQGA  123

Query  522  KMFILKPLKQADVNELKSQLMH  587
            + F +KP++Q+DVN+L+  LM 
Sbjct  124  QEFFVKPVQQSDVNKLRPHLMR  145



>ref|XP_002876392.1| hypothetical protein ARALYDRAFT_486148 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52651.1| hypothetical protein ARALYDRAFT_486148 [Arabidopsis lyrata subsp. 
lyrata]
Length=232

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 106/144 (74%), Gaps = 9/144 (6%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNT------  350
             HVLAVDD   +   IE+LL+ SSC+VTT ++G +ALE+LGL  G +  N PN       
Sbjct  7    FHVLAVDDSLFDRKYIERLLQKSSCQVTTVDSGSKALEFLGLRQG-IDSNDPNALSKSPV  65

Query  351  --NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAK  524
               V +VNLIITDY MPGM GY+LLKKVK+S+ F+D+PVV+MSSEN+P+RI++C+E GA+
Sbjct  66   THQVVEVNLIITDYCMPGMTGYDLLKKVKESSAFRDIPVVIMSSENVPARISRCLEEGAE  125

Query  525  MFILKPLKQADVNELKSQLMHKRL  596
             F LKP++ AD+N+LK  +M  +L
Sbjct  126  EFFLKPVRLADLNKLKPHMMKTKL  149



>gb|EYU38278.1| hypothetical protein MIMGU_mgv1a019913mg [Erythranthe guttata]
Length=147

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 107/136 (79%), Gaps = 3/136 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
             HVLAVDD  I+  +IE+LLK+SS +VT  E+GV+ALE+LGL+ GD + N  NT   ++N
Sbjct  13   FHVLAVDDSIIDRKLIERLLKTSSYQVTVVESGVKALEFLGLV-GDEKSN--NTLKVEIN  69

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDYSMP + GY+LL+K+K+S + KD+PVV+MSSEN+ SRIN CME GA+ F LKP++
Sbjct  70   LIITDYSMPAVTGYDLLRKIKESRLLKDIPVVIMSSENVASRINSCMEQGAEEFFLKPVQ  129

Query  549  QADVNELKSQLMHKRL  596
            Q+DVN+L+  L+ + +
Sbjct  130  QSDVNKLRPHLLRRNI  145



>ref|XP_008360657.1| PREDICTED: two-component response regulator ARR17-like [Malus 
domestica]
Length=167

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 107/145 (74%), Gaps = 4/145 (3%)
 Frame = +3

Query  162  MGENGEDE-VIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHN  338
            MG + E E V HVLAVDD  ++  IIEKLL  S+CKVTTAE+G  ALE LGL   D Q N
Sbjct  14   MGLDFEHEKVPHVLAVDDSFVDRKIIEKLLIKSACKVTTAEDGHGALELLGL--ADGQQN  71

Query  339  SPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVG  518
              NT V  VN+IITDY MPGM GYELLK+VK+S   K++PVVV+SSENIPSRI +C+E G
Sbjct  72   FANT-VSNVNMIITDYCMPGMTGYELLKRVKESPKGKEIPVVVVSSENIPSRIEKCLEEG  130

Query  519  AKMFILKPLKQADVNELKSQLMHKR  593
            A+ F+LKPL+QADV +LK  L   R
Sbjct  131  AEEFLLKPLRQADVKKLKCHLSEFR  155



>gb|KDP31161.1| hypothetical protein JCGZ_11537 [Jatropha curcas]
Length=212

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 107/140 (76%), Gaps = 3/140 (2%)
 Frame = +3

Query  165  GENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP  344
            G +   E +HVLAVDD  ++  +IE+LL+ SSCKVT  E+G RAL+YLGL   D + +S 
Sbjct  21   GSSSCSEELHVLAVDDSFVDRKVIERLLRISSCKVTAVESGTRALQYLGL---DGEKSSV  77

Query  345  NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAK  524
              N  KVNLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI +RI++C+E GA+
Sbjct  78   GFNDLKVNLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILTRIDRCLEEGAE  137

Query  525  MFILKPLKQADVNELKSQLM  584
             FI+KP+K +DV  LK  +M
Sbjct  138  EFIVKPVKLSDVKRLKDFIM  157



>ref|XP_009364893.1| PREDICTED: two-component response regulator ARR17-like [Pyrus 
x bretschneideri]
Length=167

 Score =   158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 107/145 (74%), Gaps = 4/145 (3%)
 Frame = +3

Query  162  MGENGEDE-VIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHN  338
            MG + E E V HVLAVDD  ++  IIEKLL  S+CKVTTAE+G  ALE LGL   D Q N
Sbjct  14   MGLDFEHENVPHVLAVDDSFVDRKIIEKLLIKSACKVTTAEDGHGALELLGL--ADGQQN  71

Query  339  SPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVG  518
              NT V  VN+IITDY MPGM GYELLK+VK+S   K++PVVV+SSENIPSRI +C+E G
Sbjct  72   FANT-VSNVNMIITDYCMPGMTGYELLKRVKESPKGKEIPVVVVSSENIPSRIEKCLEEG  130

Query  519  AKMFILKPLKQADVNELKSQLMHKR  593
            A+ F+LKPL+QADV +LK  L   R
Sbjct  131  AEEFLLKPLRQADVKKLKCHLSEFR  155



>ref|XP_009788178.1| PREDICTED: two-component response regulator ARR9-like [Nicotiana 
sylvestris]
Length=210

 Score =   159 bits (403),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 107/144 (74%), Gaps = 5/144 (3%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG    +   HVLAVDD  I+  ++E+LLK+SSC+VTT ++G +ALE+LGL     Q + 
Sbjct  1    MGMAEAESQFHVLAVDDSIIDRKLVERLLKTSSCQVTTVDSGSKALEFLGL-----QEDG  55

Query  342  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGA  521
             N    ++NLIITDY MPGM GY+LLKK+K+S+  +++PVV+MSSEN+PSRIN+C+E GA
Sbjct  56   NNHQEAEINLIITDYCMPGMTGYDLLKKIKESSSLRNIPVVIMSSENVPSRINRCLEGGA  115

Query  522  KMFILKPLKQADVNELKSQLMHKR  593
            + F LKP++ +DVN+L+  +M  R
Sbjct  116  EEFFLKPVRLSDVNKLRPHMMKTR  139



>gb|ABQ95670.1| type A response regulator, partial [Malus domestica]
Length=194

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HV AVDD  ++  +IE+LLK SSCKVT  ++G RALEYLGL   D + +S   +  KVNL
Sbjct  1    HVFAVDDSHVDRKVIERLLKISSCKVTAVDSGTRALEYLGL---DGEKSSVGFDNMKVNL  57

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI +RI++C+E GA+ +I+KP+K 
Sbjct  58   IITDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILTRIDRCLEEGAEEYIVKPVKL  117

Query  552  ADVNELKSQLM  584
            +DVN LK+ +M
Sbjct  118  SDVNRLKNFMM  128



>emb|CDX72077.1| BnaC08g27970D [Brassica napus]
Length=235

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 109/149 (73%), Gaps = 4/149 (3%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAG-DVQHN  338
            MG    +   HVLAVDD  ++  +IE+LL+ SSC+VTT ++G +ALE+LGL  G +  H 
Sbjct  1    MGMAAAEWKFHVLAVDDSLVDRKLIERLLQKSSCQVTTVDSGYKALEFLGLRQGIESSHP  60

Query  339  ---SPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  509
               SP+    +VNLIITDY MPGM GY+LLKK+K+SA FK +PVV+MSSEN+P+RI++C+
Sbjct  61   TALSPSPQEVEVNLIITDYCMPGMTGYDLLKKLKESAAFKSIPVVIMSSENVPARISRCL  120

Query  510  EVGAKMFILKPLKQADVNELKSQLMHKRL  596
            E GA+ F LKP++ AD+N LK  +M  +L
Sbjct  121  EQGAEEFFLKPVRLADLNNLKPHMMKTKL  149



>ref|XP_002267932.1| PREDICTED: two-component response regulator ARR9 [Vitis vinifera]
Length=146

 Score =   157 bits (397),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 109/144 (76%), Gaps = 3/144 (2%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG   E +  HVLAVDD  I+  +IEKLLK+SS +VT  ++G +ALE+LGL   + +++ 
Sbjct  1    MGIAAETQ-FHVLAVDDSLIDRKLIEKLLKTSSFQVTAVDSGSKALEFLGLQEEEQRNHH  59

Query  342  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGA  521
            P     +VNLIITDYSMPGM GY+LL+K+K+S+  KD+PVV+MSSENIPSRIN+C+E GA
Sbjct  60   PQET--EVNLIITDYSMPGMTGYDLLRKIKESSSLKDIPVVIMSSENIPSRINRCLEEGA  117

Query  522  KMFILKPLKQADVNELKSQLMHKR  593
            + F LKP++ +DVN+L+  L+  R
Sbjct  118  EDFFLKPVQLSDVNKLRPHLLGSR  141



>emb|CDY06142.1| BnaA09g36380D [Brassica napus]
Length=236

 Score =   159 bits (403),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 109/148 (74%), Gaps = 4/148 (3%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG    +   HVLAVDD  ++  +IE+LL+ SSC+VTT ++G +ALE+LGL  G  + N 
Sbjct  1    MGMAAAECQFHVLAVDDSLVDRKLIERLLQKSSCQVTTVDSGYKALEFLGLRQG-TESND  59

Query  342  PNTNVP---KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  512
            P    P   +VNLIITDY MPGM GY+LLKK+K+S  FK++PVV+MSSEN+P+RI++C+E
Sbjct  60   PTALSPSPQEVNLIITDYCMPGMTGYDLLKKLKESPAFKNIPVVIMSSENVPARISRCLE  119

Query  513  VGAKMFILKPLKQADVNELKSQLMHKRL  596
             GA+ F LKP++ AD+N+LK  +M  +L
Sbjct  120  EGAEEFFLKPVRLADLNKLKPHMMKTKL  147



>ref|XP_009626719.1| PREDICTED: two-component response regulator ARR8-like isoform 
X2 [Nicotiana tomentosiformis]
Length=226

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 108/146 (74%), Gaps = 5/146 (3%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG    ++  HVLAVDD  I+  +IE+L ++S+C+VTT ++G +ALE+LGL   +   N 
Sbjct  1    MGMAAAEQQFHVLAVDDSLIDRKLIERLFRTSACQVTTVDSGNKALEFLGLQEHENHPNP  60

Query  342  P-----NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  506
            P     N    +VNLIITDY MPGM GY+LLKK+K+S+ F+++PVV+MSSEN+PSRIN+C
Sbjct  61   PHACPHNHQEVEVNLIITDYCMPGMTGYDLLKKIKESSSFRNIPVVIMSSENVPSRINRC  120

Query  507  MEVGAKMFILKPLKQADVNELKSQLM  584
            +E GA+ F LKP++ +DVN+L+  +M
Sbjct  121  LEEGAEEFFLKPVRLSDVNKLRPHMM  146



>ref|XP_006402918.1| hypothetical protein EUTSA_v10006209mg [Eutrema salsugineum]
 gb|ESQ44371.1| hypothetical protein EUTSA_v10006209mg [Eutrema salsugineum]
Length=241

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 112/153 (73%), Gaps = 10/153 (7%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL  G  + N 
Sbjct  1    MGMAAESQ-FHVLAVDDSLFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLREGS-ESNE  58

Query  342  PN--TNVPK------VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  497
            PN  +  P+      VNLIITDY MPGM GY+LLKKVK+S+ FK++PVV+MSSEN+P+RI
Sbjct  59   PNALSTSPEIHQEVEVNLIITDYCMPGMTGYDLLKKVKESSAFKNIPVVIMSSENVPARI  118

Query  498  NQCMEVGAKMFILKPLKQADVNELKSQLMHKRL  596
            ++C+E GA+ F LKP++ AD+N+LK  +M  +L
Sbjct  119  SRCLEEGAEEFFLKPVRLADINKLKPHMMKTKL  151



>emb|CBX43986.1| putative A-type response regulator 4 [Populus x canadensis]
Length=193

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 107/143 (75%), Gaps = 8/143 (6%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS-PNTNVP--  359
             HVLAVDD  I+  +IE+LLK+SS +VT  ++G +ALE+LGL   D Q +S P++  P  
Sbjct  13   FHVLAVDDSLIDRKLIERLLKTSSYQVTAVDSGSKALEFLGLHGDDEQRDSNPSSVSPDH  72

Query  360  -----KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAK  524
                 ++N+IITDY MPGM GY+LLKK+K+S  FKD+PVV+MSSEN+PSRIN+C+E GA+
Sbjct  73   HHQHIEINMIITDYCMPGMTGYDLLKKIKESKYFKDIPVVIMSSENVPSRINRCLEEGAE  132

Query  525  MFILKPLKQADVNELKSQLMHKR  593
             F LKP++ +DVN+L+  LM  R
Sbjct  133  EFFLKPVQLSDVNKLRPHLMKGR  155



>ref|XP_011091843.1| PREDICTED: two-component response regulator ARR8-like [Sesamum 
indicum]
Length=187

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 105/143 (73%), Gaps = 9/143 (6%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAG-DVQHNSPNTNVPK-  362
             HVLAVDD  I+  +IE+LLK+SS +VT  ++GV+ALEYLGLL   D   +S   +  K 
Sbjct  10   FHVLAVDDSIIDRKLIERLLKTSSYQVTAVDSGVKALEYLGLLDDEDTSTDSTPVSTTKN  69

Query  363  -------VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGA  521
                   VNLIITDY MPG+ GY+LL+K+K+S + KD+PVV+MSSEN+PSRIN C+E GA
Sbjct  70   HHVCEVEVNLIITDYCMPGITGYDLLRKIKESTLLKDIPVVIMSSENVPSRINSCLEQGA  129

Query  522  KMFILKPLKQADVNELKSQLMHK  590
            + F LKP++Q+DVN+L+  LM K
Sbjct  130  EEFFLKPVRQSDVNKLRPHLMRK  152



>gb|EYU34521.1| hypothetical protein MIMGU_mgv1a018237mg [Erythranthe guttata]
 gb|EYU42941.1| hypothetical protein MIMGU_mgv1a020458mg [Erythranthe guttata]
Length=178

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 108/143 (76%), Gaps = 11/143 (8%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP---  359
             HVLAVDD  I+  +IE+LLK+SS +VT  ++GV+ALEYLGL+  ++ + + ++N P   
Sbjct  3    FHVLAVDDSVIDRKLIERLLKTSSYQVTVVDSGVKALEYLGLVDDEIANTNTDSN-PIST  61

Query  360  -------KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVG  518
                   +VNLIITDY MPG+NGY+LL+K+K+S   K++PVV+MSSENIPSRIN C+E G
Sbjct  62   IKNHHEVEVNLIITDYCMPGINGYDLLRKIKESTTLKNIPVVIMSSENIPSRINNCLEQG  121

Query  519  AKMFILKPLKQADVNELKSQLMH  587
            A+ F LKP+KQ+DVN+LK  LM 
Sbjct  122  AEEFFLKPVKQSDVNKLKPHLMR  144



>ref|XP_010516309.1| PREDICTED: two-component response regulator ARR9 [Camelina sativa]
Length=236

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 113/153 (74%), Gaps = 10/153 (7%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL  G ++ N 
Sbjct  1    MGMAAESQ-FHVLAVDDSLFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLRQG-IESND  58

Query  342  PN--TNVP------KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  497
            PN  +  P      +VNLIITDY MPGM G++LLKKVK+S+ FK++PVV+MSSEN+P+RI
Sbjct  59   PNALSTAPVNHQEVEVNLIITDYCMPGMTGFDLLKKVKESSAFKNIPVVIMSSENVPARI  118

Query  498  NQCMEVGAKMFILKPLKQADVNELKSQLMHKRL  596
            ++C+E GA+ F LKP++ AD+N+LK  +M  +L
Sbjct  119  SRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKL  151



>ref|XP_002304795.2| hypothetical protein POPTR_0003s19710g [Populus trichocarpa]
 gb|EEE79774.2| hypothetical protein POPTR_0003s19710g [Populus trichocarpa]
Length=193

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 107/143 (75%), Gaps = 8/143 (6%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS-PNTNVP--  359
             HVLAVDD  I+  +IE+LLK+SS +VT  ++G +ALE+LGL   D Q +S P++  P  
Sbjct  13   FHVLAVDDSLIDRKLIERLLKTSSYQVTAVDSGSKALEFLGLSGDDEQRDSNPSSVSPDH  72

Query  360  -----KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAK  524
                 ++N+IITDY MPGM GY+LLKK+K+S  FKD+PVV+MSSEN+PSRIN+C+E GA+
Sbjct  73   HHQHIEINMIITDYCMPGMTGYDLLKKIKESKYFKDIPVVIMSSENVPSRINRCLEEGAE  132

Query  525  MFILKPLKQADVNELKSQLMHKR  593
             F LKP++ +DVN+L+  LM  R
Sbjct  133  EFFLKPVQLSDVNKLRPHLMKGR  155



>emb|CDY21807.1| BnaA06g20760D [Brassica napus]
Length=184

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 114/169 (67%), Gaps = 20/169 (12%)
 Frame = +3

Query  123  EKKIMACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALE  302
            EK  M+  +SS+     G  E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+
Sbjct  8    EKLDMSNDTSSL-----GSPELLHVLAVDDSIVDRKFIERLLRVSSCKVTVVDSATRALQ  62

Query  303  YLGLLAGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSEN  482
            YLGL   D  H+S      K+NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSEN
Sbjct  63   YLGL---DGNHSSVGFEDLKINLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSEN  119

Query  483  IPSRINQCMEVGAKMFILKPLKQADVNELKSQL------------MHKR  593
            I  RI++C+E GA+ F+LKP+K ADV  L+  L            MHKR
Sbjct  120  ILPRIDRCLEEGAEDFLLKPVKLADVKRLRDSLLKAYDEIAFKNIMHKR  168



>ref|NP_191263.1| two-component response regulator ARR9 [Arabidopsis thaliana]
 sp|O80366.1|ARR9_ARATH RecName: Full=Two-component response regulator ARR9; AltName: 
Full=Response reactor 4 [Arabidopsis thaliana]
 dbj|BAA31146.1| responce reactor4 [Arabidopsis thaliana]
 emb|CAB72174.1| responce reactor 4 [Arabidopsis thaliana]
 gb|AAL90898.1| AT3g57040/F24I3_120 [Arabidopsis thaliana]
 gb|AAM91401.1| At3g57040/F24I3_120 [Arabidopsis thaliana]
 gb|AEE79602.1| two-component response regulator ARR9 [Arabidopsis thaliana]
Length=234

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 109/153 (71%), Gaps = 10/153 (7%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL       N 
Sbjct  1    MGMAAESQ-FHVLAVDDSLFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLRQS-TDSND  58

Query  342  PNT--------NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  497
            PN          V +VNLIITDY MPGM GY+LLKKVK+S+ F+D+PVV+MSSEN+P+RI
Sbjct  59   PNAFSKAPVNHQVVEVNLIITDYCMPGMTGYDLLKKVKESSAFRDIPVVIMSSENVPARI  118

Query  498  NQCMEVGAKMFILKPLKQADVNELKSQLMHKRL  596
            ++C+E GA+ F LKP++ AD+N+LK  +M  +L
Sbjct  119  SRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKL  151



>ref|XP_006302845.1| hypothetical protein CARUB_v10020975mg [Capsella rubella]
 gb|EOA35743.1| hypothetical protein CARUB_v10020975mg [Capsella rubella]
Length=198

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 108/144 (75%), Gaps = 4/144 (3%)
 Frame = +3

Query  156  MAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQH  335
            MA+G  G    +HVLAVDD  ++  +IE+LLK S+CKVTT E+G RAL+YLGL  G    
Sbjct  1    MALG--GFSSELHVLAVDDSFVDRKVIERLLKISACKVTTVESGARALQYLGL-DGPNGS  57

Query  336  NSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEV  515
            +S  T++ KVNLI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM  
Sbjct  58   SSALTDL-KVNLIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCMIE  116

Query  516  GAKMFILKPLKQADVNELKSQLMH  587
            GA+ F+LKP+K ADV  LK  +M 
Sbjct  117  GAEDFLLKPVKLADVKRLKELIMR  140



>ref|XP_010444157.1| PREDICTED: two-component response regulator ARR6-like [Camelina 
sativa]
Length=190

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 103/137 (75%), Gaps = 3/137 (2%)
 Frame = +3

Query  174  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  353
            G  +++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   DV+  S    
Sbjct  20   GSPDLLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DVEEKSVGFE  76

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
              KVNLI+TDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI  RI++C+E GA+ F+
Sbjct  77   DLKVNLIMTDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILPRIDRCLEEGAEDFL  136

Query  534  LKPLKQADVNELKSQLM  584
            LKP+K +DV  L+  LM
Sbjct  137  LKPVKLSDVKRLRDSLM  153



>ref|XP_009604813.1| PREDICTED: two-component response regulator ARR9-like [Nicotiana 
tomentosiformis]
Length=228

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 108/147 (73%), Gaps = 6/147 (4%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG    ++  H+LAVDD  I+  +IE+L ++S+C+VTT ++  +ALE+LGL   +  H +
Sbjct  1    MGMAAAEQQFHILAVDDSLIDRKLIERLFRTSACQVTTVDSENKALEFLGLQEHEHNHPN  60

Query  342  PNTNVP------KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  503
            P    P      +VNLIITDY MPGM GY+LLKK+K+S+ F+++PVV+MSSEN+PSRIN+
Sbjct  61   PPCACPHNHQEVEVNLIITDYCMPGMTGYDLLKKIKESSSFRNIPVVIMSSENVPSRINR  120

Query  504  CMEVGAKMFILKPLKQADVNELKSQLM  584
            C+E GA+ F LKP++ +DVN+LK  +M
Sbjct  121  CLEEGAEEFFLKPVRLSDVNKLKPHMM  147



>emb|CDY45402.1| BnaA07g31820D [Brassica napus]
Length=184

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 99/133 (74%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LL+ S+CKVTT E+G RAL+YLGL   D    S      KVN
Sbjct  15   LHVLAVDDSIVDRKVIERLLRISACKVTTVESGTRALQYLGL---DGDKGSSGLKDLKVN  71

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM  GA+ F+LKP+K
Sbjct  72   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCMTEGAEDFLLKPVK  131

Query  549  QADVNELKSQLMH  587
             ADV  LK  +M 
Sbjct  132  LADVKRLKELIMR  144



>emb|CDX73122.1| BnaC06g35700D [Brassica napus]
Length=177

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 107/150 (71%), Gaps = 5/150 (3%)
 Frame = +3

Query  156  MAMGE--NGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV  329
            MA+G+  +     +HVLAVDD  ++  +IE+LL+ S+CKVTT E+G RAL+YLGL   D 
Sbjct  1    MALGDLSSSSTSELHVLAVDDSIVDRKVIERLLRISACKVTTVESGTRALQYLGL---DG  57

Query  330  QHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  509
               S      KVNLI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM
Sbjct  58   DKGSSGLKDLKVNLIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCM  117

Query  510  EVGAKMFILKPLKQADVNELKSQLMHKRLS  599
              GA+ F+LK +K ADV  LK  +M ++ S
Sbjct  118  TEGAEDFLLKSVKLADVKRLKELIMREKTS  147



>ref|XP_008374475.1| PREDICTED: two-component response regulator ARR5-like [Malus 
domestica]
Length=227

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 110/145 (76%), Gaps = 9/145 (6%)
 Frame = +3

Query  150  SSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV  329
            S M  GE      +HVLAVDD  ++  +IE+LLK SSCKVT  ++G RAL+YLGL   D 
Sbjct  22   SQMRSGE------LHVLAVDDSHVDRKVIERLLKISSCKVTAVDSGTRALQYLGL---DG  72

Query  330  QHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  509
            + +S   +  KVNLIITDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI +RI++C+
Sbjct  73   EKSSVGFDNMKVNLIITDYSMPGMTGYELLKKIKESSXFREVPVVIMSSENILTRIDRCL  132

Query  510  EVGAKMFILKPLKQADVNELKSQLM  584
            E GA+ +I+KP+K +DVN LK+ +M
Sbjct  133  EEGAEDYIVKPVKLSDVNRLKNVMM  157



>ref|XP_009626718.1| PREDICTED: two-component response regulator ARR8-like isoform 
X1 [Nicotiana tomentosiformis]
Length=229

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 108/149 (72%), Gaps = 8/149 (5%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD-----  326
            MG    ++  HVLAVDD  I+  +IE+L ++S+C+VTT ++G +ALE+LGL   +     
Sbjct  1    MGMAAAEQQFHVLAVDDSLIDRKLIERLFRTSACQVTTVDSGNKALEFLGLQEHENHPNP  60

Query  327  ---VQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  497
                 HN  N    +VNLIITDY MPGM GY+LLKK+K+S+ F+++PVV+MSSEN+PSRI
Sbjct  61   PHACPHNHQNLQEVEVNLIITDYCMPGMTGYDLLKKIKESSSFRNIPVVIMSSENVPSRI  120

Query  498  NQCMEVGAKMFILKPLKQADVNELKSQLM  584
            N+C+E GA+ F LKP++ +DVN+L+  +M
Sbjct  121  NRCLEEGAEEFFLKPVRLSDVNKLRPHMM  149



>ref|XP_002322144.1| hypothetical protein POPTR_0015s08130g [Populus trichocarpa]
 gb|EEF06271.1| hypothetical protein POPTR_0015s08130g [Populus trichocarpa]
 emb|CBX43991.1| putative A-type response regulator 10 [Populus x canadensis]
Length=223

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            E +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   N  K
Sbjct  27   EELHVLAVDDSFVDRKVIERLLKISSCKVTVVESGSRALQYLGL---DGEKSSVGFNDLK  83

Query  363  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI +RI++C+E GA+ +ILKP
Sbjct  84   INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILARIDRCLEEGAEEYILKP  143

Query  543  LKQADVNELKSQLM  584
            +K +DV  +K  +M
Sbjct  144  VKLSDVKRIKDVIM  157



>ref|XP_009622543.1| PREDICTED: two-component response regulator ARR9-like [Nicotiana 
tomentosiformis]
Length=187

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 106/141 (75%), Gaps = 3/141 (2%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD---VQHNSPNT  350
            D   HVLAVDD  I+  +IE+LLK+SS +VT  ++G +ALEYLGL + +   V+ +  + 
Sbjct  8    DHQFHVLAVDDSIIDRKLIERLLKTSSYQVTVVDSGSKALEYLGLSSDENEGVEIDHSHV  67

Query  351  NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMF  530
                +NLIITDYSMPGM GY+LL+K+K S+  KD+PV++MSSEN+PSRIN+C+E GA+ F
Sbjct  68   REVGINLIITDYSMPGMTGYDLLRKIKGSSSLKDIPVIIMSSENVPSRINRCLEEGAEEF  127

Query  531  ILKPLKQADVNELKSQLMHKR  593
             LKPL+Q+DVN +K  LM ++
Sbjct  128  FLKPLQQSDVNRIKPHLMREK  148



>emb|CDY59856.1| BnaCnng35610D [Brassica napus]
Length=183

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 114/168 (68%), Gaps = 19/168 (11%)
 Frame = +3

Query  123  EKKIMACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALE  302
            EK  M+  +SS+     G  E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+
Sbjct  8    EKLDMSNDTSSL-----GSPELLHVLAVDDSIVDRKFIERLLRVSSCKVTVVDSATRALQ  62

Query  303  YLGLLAGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSEN  482
            YLGL   D  H+S      K+NLI+TDYSMPGM GYEL+KK+K+S+ F+++PVV+MSSEN
Sbjct  63   YLGL---DGNHSSVGFEDLKINLIMTDYSMPGMTGYELMKKIKESSAFREIPVVIMSSEN  119

Query  483  IPSRINQCMEVGAKMFILKPLKQADVNELKSQL-----------MHKR  593
            I  RI++C+E GA+ F+LKP+K ADV  L+  L           MHKR
Sbjct  120  ILPRIDRCLEEGAEDFLLKPVKLADVKRLRDSLLKADEMAFKNIMHKR  167



>ref|XP_010504623.1| PREDICTED: two-component response regulator ARR9-like isoform 
X1 [Camelina sativa]
Length=235

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 113/153 (74%), Gaps = 10/153 (7%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VT+ ++G +ALE+LGL  G ++ N 
Sbjct  1    MGMAAESQ-FHVLAVDDSLFDRKLIERLLQKSSCQVTSVDSGSKALEFLGLRQG-IESND  58

Query  342  PN--TNVP------KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  497
            PN  +  P      +VNLIITDY MPGM G++LLKKVK+S+ FK++PVV+MSSEN+P+RI
Sbjct  59   PNALSTAPVNHQQVEVNLIITDYCMPGMTGFDLLKKVKESSAFKNIPVVIMSSENVPARI  118

Query  498  NQCMEVGAKMFILKPLKQADVNELKSQLMHKRL  596
            ++C+E GA+ F LKP++ AD+N+LK  +M  +L
Sbjct  119  SRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKL  151



>ref|XP_006390374.1| hypothetical protein EUTSA_v10019119mg [Eutrema salsugineum]
 gb|ESQ27660.1| hypothetical protein EUTSA_v10019119mg [Eutrema salsugineum]
Length=219

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 99/133 (74%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL   D    S      KVN
Sbjct  15   LHVLAVDDSFVDRKVIERLLRISSCKVTTVESGTRALQYLGL---DGDKGSSGLKDLKVN  71

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM  GA+ F+LKP+K
Sbjct  72   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIQQCMTEGAEDFLLKPVK  131

Query  549  QADVNELKSQLMH  587
             ADV  LK  +M 
Sbjct  132  LADVKRLKELIMR  144



>ref|XP_010459459.1| PREDICTED: two-component response regulator ARR6 [Camelina sativa]
Length=190

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 103/137 (75%), Gaps = 3/137 (2%)
 Frame = +3

Query  174  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  353
            G  +++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   DV+  S    
Sbjct  20   GSPDLLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DVEDKSVGFE  76

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
              KVNLI+TDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI  RI++C+E GA+ F+
Sbjct  77   DLKVNLIMTDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILPRIDRCLEEGAEDFL  136

Query  534  LKPLKQADVNELKSQLM  584
            LKP+K +DV  L+  LM
Sbjct  137  LKPVKLSDVKRLRDSLM  153



>dbj|BAL43557.1| type-A response regulator [Petunia x hybrida]
Length=227

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 108/147 (73%), Gaps = 6/147 (4%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV-QHN  338
            MG    +   HVLAVDD  I+  +IE+LLK+SSC+VTT ++G +ALE+LGL   +  + N
Sbjct  1    MGMAAAESQFHVLAVDDSLIDRKLIERLLKTSSCQVTTVDSGSKALEFLGLQEHEQNKSN  60

Query  339  SP-----NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  503
             P     N    ++NLIITDY MPGM GY+LLKK+K+S+  +++PVV+MSSEN+PSRIN+
Sbjct  61   QPCVSLDNHQEAEINLIITDYCMPGMTGYDLLKKIKESSSLRNIPVVIMSSENVPSRINR  120

Query  504  CMEVGAKMFILKPLKQADVNELKSQLM  584
            C+E GA+ F LKP++ +DVN+L+  +M
Sbjct  121  CLEEGAEEFFLKPVRLSDVNKLRPHMM  147



>ref|XP_007155382.1| hypothetical protein PHAVU_003G196500g [Phaseolus vulgaris]
 gb|ESW27376.1| hypothetical protein PHAVU_003G196500g [Phaseolus vulgaris]
Length=206

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 104/132 (79%), Gaps = 3/132 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   +  KVN
Sbjct  26   LHVLAVDDSLVDRKVIERLLKISSCKVTVVESGTRALQYLGL---DGETSSLGFDSVKVN  82

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPGM GYELLKK+K+S++F+++PVV+MSSEN+ +RI+ C+E GA+ F+LKP+K
Sbjct  83   LIMTDYSMPGMTGYELLKKIKESSVFREIPVVIMSSENVLTRIDSCLEEGAEEFLLKPVK  142

Query  549  QADVNELKSQLM  584
             +DV  LK  +M
Sbjct  143  LSDVRRLKDFIM  154



>gb|AFK34510.1| unknown [Medicago truncatula]
Length=167

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 108/142 (76%), Gaps = 6/142 (4%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNT------  350
             HVLAVDD  I+ ++IE+LLK+SS  VT  ++G +AL++LGL+  +V++  P++      
Sbjct  4    FHVLAVDDSVIDRMLIERLLKTSSFHVTVVDSGTKALKFLGLVEDEVRNEKPHSIAAETD  63

Query  351  NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMF  530
             V +VNLIITDY MPGM GY+LL+K+K+S   KD+PVV+ SSEN+PSRIN+C+E GA+ F
Sbjct  64   QVVEVNLIITDYCMPGMTGYDLLRKIKESNSLKDIPVVITSSENVPSRINRCLEEGAEEF  123

Query  531  ILKPLKQADVNELKSQLMHKRL  596
             LKP++Q+DVN+LK  L+  ++
Sbjct  124  FLKPVQQSDVNKLKPHLLKTKV  145



>emb|CDY30966.1| BnaC04g24580D [Brassica napus]
Length=232

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG    +   HVLAVDD  ++  +IE+LL+ SSC+VTT ++G +ALE+LG+ + D    S
Sbjct  1    MGMAAVESQFHVLAVDDSSLDRKLIERLLQKSSCQVTTVDSGYKALEFLGIESNDPNALS  60

Query  342  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGA  521
             +    +VNLIITDY MPGM GY+LLKKVK+S  FK++PVV+MSSEN+P+RI++C+E GA
Sbjct  61   TSPQEVEVNLIITDYCMPGMTGYDLLKKVKESPAFKNIPVVIMSSENVPARISRCLEEGA  120

Query  522  KMFILKPLKQADVNELKSQLMHKRLS  599
            + F LKP++  D+N+LK  +M  +L+
Sbjct  121  EEFFLKPVRMDDLNKLKPHMMKTKLN  146



>ref|XP_004249241.1| PREDICTED: two-component response regulator ARR8 [Solanum lycopersicum]
Length=239

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 106/149 (71%), Gaps = 5/149 (3%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG    D   HVLAVDD  I+  +IE+L K SSC+VTT ++G +ALE+LGL     + N 
Sbjct  1    MGMAAADLQFHVLAVDDSLIDRKLIERLFKISSCQVTTVDSGSKALEFLGLQEEHDEQNH  60

Query  342  P-----NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  506
            P     N    ++NLIITDY MPGM GY+LLKK+K+SA  +++PVV+MSSEN+PSRI++C
Sbjct  61   PCVSPSNQQEVEINLIITDYCMPGMTGYDLLKKIKESASLRNIPVVIMSSENVPSRISRC  120

Query  507  MEVGAKMFILKPLKQADVNELKSQLMHKR  593
            +E GA+ F LKP++ +DVN+LK  +M  +
Sbjct  121  LEEGAEEFFLKPVRLSDVNKLKPHMMKTK  149



>gb|AAQ10677.1| type-A response regulator [Catharanthus roseus]
Length=188

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 103/128 (80%), Gaps = 1/128 (1%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQ-HNSPNTNVPKV  365
             HVLAVDD  ++  +IE+LLK+S+ +VT  ++G++ALE+LGLL  + +   S +  V +V
Sbjct  10   FHVLAVDDSLVDRKLIERLLKTSAYQVTVVDSGIKALEFLGLLDEEKEISGSNHQQVVEV  69

Query  366  NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPL  545
            NLIITDYSMPGM GY+LL+KVK+S+  KD+PVV+MSSENIPSRIN+C+E GA  F LKP+
Sbjct  70   NLIITDYSMPGMTGYDLLRKVKESSYLKDIPVVIMSSENIPSRINRCLEEGADDFFLKPV  129

Query  546  KQADVNEL  569
            KQ+DVN+L
Sbjct  130  KQSDVNKL  137



>ref|XP_004299595.1| PREDICTED: two-component response regulator ARR5-like [Fragaria 
vesca subsp. vesca]
Length=228

 Score =   157 bits (397),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 106/132 (80%), Gaps = 2/132 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  I+  +IEKLLK S CKVT  ++G RAL+YLGL  G+ + +S   +  KVN
Sbjct  23   LHVLAVDDSIIDRKVIEKLLKISCCKVTAVDSGTRALQYLGL-DGE-KKSSVGFDAMKVN  80

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI +RI++C+E GA+ FI+KP+K
Sbjct  81   LIITDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENIVTRIDRCLEEGAEEFIVKPVK  140

Query  549  QADVNELKSQLM  584
             +DVN LK+ +M
Sbjct  141  LSDVNRLKNFMM  152



>ref|XP_010426279.1| PREDICTED: two-component response regulator ARR5 [Camelina sativa]
Length=184

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 109/146 (75%), Gaps = 7/146 (5%)
 Frame = +3

Query  147  SSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD  326
            +SS+A  +    E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D
Sbjct  16   TSSLASSQ----ELLHVLAVDDSMVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---D  68

Query  327  VQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  506
             ++ S      K+NLI+TDYSMPGM GYELLKK+K+S++F+++PVV+MSSENI  RI++C
Sbjct  69   GENGSVGFEDLKINLIMTDYSMPGMTGYELLKKIKESSIFREIPVVIMSSENILPRIDRC  128

Query  507  MEVGAKMFILKPLKQADVNELKSQLM  584
            +E GA+ F+LKP+K ADV  L+  LM
Sbjct  129  LEEGAEDFLLKPVKLADVKRLRDSLM  154



>ref|XP_007036075.1| Two-component response regulator ARR5 [Theobroma cacao]
 gb|EOY20576.1| Two-component response regulator ARR5 [Theobroma cacao]
Length=228

 Score =   157 bits (397),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IEKLLK SSCKVT  E+G RAL+YLGL  G     S   N  KVN
Sbjct  15   LHVLAVDDSHVDRKVIEKLLKISSCKVTAVESGTRALQYLGLDGG---KGSLGFNDLKVN  71

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPGM GYELLKK+K S+ F+++PVV+MSSENI +RI++C+E GA+ F++KP+K
Sbjct  72   LIMTDYSMPGMTGYELLKKIKQSSAFREIPVVIMSSENILTRIDRCLEEGAEEFLVKPVK  131

Query  549  QADVNELKSQLMH  587
             +DV  LK  +M 
Sbjct  132  LSDVKRLKDFIMR  144



>gb|KFK28019.1| hypothetical protein AALP_AA8G460900 [Arabis alpina]
Length=191

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = +3

Query  174  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  353
            G  +++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   DV+  S    
Sbjct  20   GSSDLLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DVEDKSIGFE  76

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
              KVNLI+TDYSMPGM GYELLKK+K+S+ F+ VPVV+MSSENI  RI++C+E GA+ F+
Sbjct  77   DLKVNLIMTDYSMPGMTGYELLKKIKESSAFRQVPVVIMSSENILPRIDRCLEEGAEDFL  136

Query  534  LKPLKQADVNELKSQLM  584
            LKP+K +DV  ++  LM
Sbjct  137  LKPVKLSDVTRIRDSLM  153



>ref|XP_009768331.1| PREDICTED: two-component response regulator ARR17-like isoform 
X3 [Nicotiana sylvestris]
Length=120

 Score =   154 bits (388),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 2/107 (2%)
 Frame = +3

Query  267  VTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMF  446
            +TTAENG+RALEYLGL  G  Q +S N N  KVN+IITDY MPGM GYELLKK+K+S++ 
Sbjct  13   MTTAENGLRALEYLGL--GAEQEHSTNGNGSKVNMIITDYCMPGMTGYELLKKIKESSIL  70

Query  447  KDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQADVNELKSQLMH  587
            KDVPVV+MSSENIP+RI+QC+E GA+MF+LKPLK +DV  L+ QLM 
Sbjct  71   KDVPVVIMSSENIPTRIDQCLEEGAQMFMLKPLKHSDVKRLRCQLMQ  117



>ref|XP_009142738.1| PREDICTED: two-component response regulator ARR8-like [Brassica 
rapa]
Length=214

 Score =   157 bits (396),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 105/140 (75%), Gaps = 8/140 (6%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNT----NV  356
             HVLAVDD  ++  +IE+LL+ SSC+VTT ++G +ALE+LGL     + N PN+      
Sbjct  9    FHVLAVDDSQLDREMIERLLQKSSCQVTTVDSGSKALEFLGLR----ESNDPNSLETHQE  64

Query  357  PKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFIL  536
             ++NLIITDY MPGM GY+LLKKVK+SA F+ +PVV+MSSEN+P+RI++C+E GA+ F L
Sbjct  65   VEINLIITDYCMPGMTGYDLLKKVKESAAFRSIPVVIMSSENVPARISRCLEEGAEEFFL  124

Query  537  KPLKQADVNELKSQLMHKRL  596
            KP+K ADV +LK  +M  +L
Sbjct  125  KPVKLADVTKLKPHMMKTKL  144



>gb|KEH35092.1| two-component response regulator ARR3-like protein [Medicago 
truncatula]
Length=200

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK +SCKVT  E+G RAL+YLGL   D   +S   +  KVN
Sbjct  23   LHVLAVDDSFVDRKVIERLLKFTSCKVTVVESGTRALQYLGL---DGDTSSIGFDGVKVN  79

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            +I+TDYSMPGM GYELLKK+K+S++F+++PVVVMSSENI +RI+ C+E GA+ F+LKP+K
Sbjct  80   MIMTDYSMPGMTGYELLKKIKESSVFREIPVVVMSSENILTRIDSCLEEGAEEFLLKPVK  139

Query  549  QADVNELKSQLMH  587
             ADV  L   +M 
Sbjct  140  LADVKRLTDFIMR  152



>ref|XP_010484006.1| PREDICTED: two-component response regulator ARR6-like [Camelina 
sativa]
Length=190

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 103/137 (75%), Gaps = 3/137 (2%)
 Frame = +3

Query  174  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  353
            G  +++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   DV+  S    
Sbjct  20   GSPDLLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DVEVKSVGFE  76

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
              KVNLI+TDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI  RI++C+E GA+ F+
Sbjct  77   DLKVNLIMTDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILPRIDRCLEEGAEDFL  136

Query  534  LKPLKQADVNELKSQLM  584
            LKP+K +DV  L+  LM
Sbjct  137  LKPVKLSDVKRLRDSLM  153



>ref|XP_007155380.1| hypothetical protein PHAVU_003G196300g [Phaseolus vulgaris]
 gb|ESW27374.1| hypothetical protein PHAVU_003G196300g [Phaseolus vulgaris]
Length=206

 Score =   156 bits (395),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 104/132 (79%), Gaps = 3/132 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   +  KVN
Sbjct  26   LHVLAVDDSLVDRKVIERLLKISSCKVTVVESGTRALQYLGL---DGETSSLGFDSVKVN  82

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPGM GYELLKK+K+S++F+++PVV+MSSEN+ +RI+ C+E GA+ F+LKP+K
Sbjct  83   LIMTDYSMPGMTGYELLKKIKESSVFREIPVVIMSSENVLTRIDSCLEEGAEEFLLKPVK  142

Query  549  QADVNELKSQLM  584
             +DV  LK  +M
Sbjct  143  LSDVRRLKDFIM  154



>ref|XP_011020390.1| PREDICTED: two-component response regulator ARR8-like [Populus 
euphratica]
Length=193

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 106/143 (74%), Gaps = 8/143 (6%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS-PNTNVP--  359
             HVLAVDD  I+  +IE+LLK+SS +VT  ++G +ALE+LGL   D Q +S P+   P  
Sbjct  13   FHVLAVDDSLIDRKLIERLLKTSSYQVTAVDSGSKALEFLGLNGDDEQRDSNPSPVSPDH  72

Query  360  -----KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAK  524
                 ++N+IITDY MPGM GY+LLKK+K+S  FKD+PVV+MSSEN+PSRIN+C+E GA+
Sbjct  73   HHQHIEINMIITDYCMPGMTGYDLLKKIKESKYFKDIPVVIMSSENVPSRINRCLEEGAE  132

Query  525  MFILKPLKQADVNELKSQLMHKR  593
             F LKP++ +DVN+L+  LM  R
Sbjct  133  EFFLKPVQLSDVNKLRPHLMKGR  155



>ref|XP_006291901.1| hypothetical protein CARUB_v10018078mg [Capsella rubella]
 gb|EOA24799.1| hypothetical protein CARUB_v10018078mg [Capsella rubella]
Length=186

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 103/134 (77%), Gaps = 3/134 (2%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D +++S      K
Sbjct  26   ELLHVLAVDDSMVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DGENSSVGFEDLK  82

Query  363  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI  RI++C+E GA+ F+LKP
Sbjct  83   INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILPRIDRCLEEGAEDFLLKP  142

Query  543  LKQADVNELKSQLM  584
            +K ADV  L+  LM
Sbjct  143  VKLADVKRLRDSLM  156



>ref|XP_009106145.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator 
ARR15 [Brassica rapa]
Length=210

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 99/133 (74%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LL+ S+CKVTT E+G RAL+YLGL   D    S      KVN
Sbjct  16   LHVLAVDDSIVDRKVIERLLRISACKVTTVESGTRALQYLGL---DGDKGSSGLKDLKVN  72

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM  GA+ F+LKP+K
Sbjct  73   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCMTEGAEDFLLKPVK  132

Query  549  QADVNELKSQLMH  587
             ADV  LK  +M 
Sbjct  133  LADVKRLKELIMR  145



>ref|XP_006351276.1| PREDICTED: two-component response regulator ARR9-like [Solanum 
tuberosum]
Length=226

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 106/149 (71%), Gaps = 5/149 (3%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG    D   HVLAVDD  I+  +IE+L K SSC+VTT ++G +ALE+LGL     + N 
Sbjct  1    MGMAAADLQFHVLAVDDSLIDRKLIERLFKISSCQVTTVDSGSKALEFLGLQEEHDEQNH  60

Query  342  P-----NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  506
            P     N    ++NLIITDY MPGM GY+LLKK+K+SA  +++PVV+MSSEN+PSRI++C
Sbjct  61   PCVSPSNQQEVEINLIITDYCMPGMTGYDLLKKIKESASLRNIPVVIMSSENVPSRISRC  120

Query  507  MEVGAKMFILKPLKQADVNELKSQLMHKR  593
            +E GA+ F LKP++ +DVN+LK  +M  +
Sbjct  121  LEEGAEEFFLKPVRLSDVNKLKPHMMKTK  149



>emb|CDY70164.1| BnaCnng67000D [Brassica napus]
 emb|CDY36905.1| BnaA06g16900D [Brassica napus]
Length=183

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 14/148 (9%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D  +NS      K
Sbjct  23   ELLHVLAVDDSIVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DGDNNSVGFEDLK  79

Query  363  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI  RI++C+E GA+ F+LKP
Sbjct  80   INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILPRIDRCLEEGAEDFLLKP  139

Query  543  LKQADVNELKSQL-----------MHKR  593
            +K ADV  L+  L           MHKR
Sbjct  140  VKLADVKRLRDSLLKAEERVFKNIMHKR  167



>ref|XP_006394337.1| hypothetical protein EUTSA_v10004962mg [Eutrema salsugineum]
 dbj|BAJ34561.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31623.1| hypothetical protein EUTSA_v10004962mg [Eutrema salsugineum]
Length=190

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 3/137 (2%)
 Frame = +3

Query  174  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  353
            G   ++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   DV   +    
Sbjct  20   GSPHLLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DVDEKTVGLE  76

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
              KVNLI+TDYSMPGM GYELLKK+K+S+ FKD+PVVVMSSENI  RI++C+E GA+ F+
Sbjct  77   DLKVNLIMTDYSMPGMTGYELLKKIKESSAFKDIPVVVMSSENILPRIDRCLEEGAEDFL  136

Query  534  LKPLKQADVNELKSQLM  584
            LKP+K +DV  L+  L+
Sbjct  137  LKPVKLSDVRRLRDSLI  153



>ref|XP_010508734.1| PREDICTED: two-component response regulator ARR8 [Camelina sativa]
Length=226

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD----V  329
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL   D    V
Sbjct  1    MGMETESQ-FHVLAVDDSLFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRVDDEDPNV  59

Query  330  QHNSPNTNVP-KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  506
               SP+ +   ++NLIITDY MPGM GY+LLKKVK+SA FK +PVV+MSSEN+P+RI++C
Sbjct  60   LSTSPHIHQEVEINLIITDYCMPGMTGYDLLKKVKESAAFKSIPVVIMSSENVPARISRC  119

Query  507  MEVGAKMFILKPLKQADVNELKSQLMHKRL  596
            +E GA+ F LKP+K AD+ +LK  +M  +L
Sbjct  120  LEEGAEEFFLKPVKLADLTKLKPHMMKTKL  149



>ref|XP_011028652.1| PREDICTED: two-component response regulator ARR5-like isoform 
X2 [Populus euphratica]
Length=228

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            E +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   N  K
Sbjct  32   EELHVLAVDDSFVDRKVIERLLKISSCKVTVVESGSRALQYLGL---DGEKSSVAFNDLK  88

Query  363  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI +RI++C+E GA+ +ILKP
Sbjct  89   INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILARIDRCLEEGAEEYILKP  148

Query  543  LKQADVNELKSQLM  584
            +K +DV  +K  +M
Sbjct  149  VKLSDVKRIKDVIM  162



>ref|XP_009149845.1| PREDICTED: two-component response regulator ARR5 [Brassica rapa]
 emb|CDY68129.1| BnaAnng26230D [Brassica napus]
Length=179

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 14/148 (9%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D  +NS      K
Sbjct  19   ELLHVLAVDDSIVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DGDNNSVGFEDLK  75

Query  363  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI  RI++C+E GA+ F+LKP
Sbjct  76   INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILPRIDRCLEEGAEDFLLKP  135

Query  543  LKQADVNELKSQL-----------MHKR  593
            +K ADV  L+  L           MHKR
Sbjct  136  VKLADVKRLRDSLLKAEERVFKNIMHKR  163



>ref|XP_010503433.1| PREDICTED: two-component response regulator ARR5-like [Camelina 
sativa]
Length=205

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 109/146 (75%), Gaps = 7/146 (5%)
 Frame = +3

Query  147  SSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD  326
            +SS+A  +    E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D
Sbjct  37   TSSLASSQ----ELLHVLAVDDSMVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---D  89

Query  327  VQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  506
             ++ S      K+NLI+TDYSMPGM GYELLKK+K+S++F+++PVV+MSSENI  RI++C
Sbjct  90   GENGSVGFEDLKINLIMTDYSMPGMTGYELLKKIKESSIFREIPVVIMSSENILPRIDRC  149

Query  507  MEVGAKMFILKPLKQADVNELKSQLM  584
            +E GA+ F+LKP+K ADV  L+  LM
Sbjct  150  LEEGAEDFLLKPVKLADVKRLRDSLM  175



>ref|XP_002268352.1| PREDICTED: two-component response regulator ARR17 [Vitis vinifera]
 emb|CBI40163.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 107/135 (79%), Gaps = 2/135 (1%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
             HVLAVDD+ I+  +IEKLLK+SS +VT  ++G +ALE+LGL   + +++ P     +VN
Sbjct  9    FHVLAVDDNLIDRKLIEKLLKTSSFQVTAVDSGSKALEFLGLQEEEQRNHHPQEM--EVN  66

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDYSMPGM GY+LL+K+K+S+  KD+PVV+MSSENIPSRIN+C+E GA+ F LKP++
Sbjct  67   LIITDYSMPGMTGYDLLRKIKESSSLKDIPVVIMSSENIPSRINRCLEEGAEDFFLKPVQ  126

Query  549  QADVNELKSQLMHKR  593
             +DV++L+  L+ ++
Sbjct  127  LSDVSKLRPHLLRRK  141



>ref|XP_002877596.1| hypothetical protein ARALYDRAFT_906046 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53855.1| hypothetical protein ARALYDRAFT_906046 [Arabidopsis lyrata subsp. 
lyrata]
Length=183

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 103/134 (77%), Gaps = 3/134 (2%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D +++S      K
Sbjct  23   ELLHVLAVDDSMVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DGENSSVGFEDLK  79

Query  363  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI  RI++C+E GA+ F+LKP
Sbjct  80   INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILPRIDRCLEEGAEDFLLKP  139

Query  543  LKQADVNELKSQLM  584
            +K ADV  L+  LM
Sbjct  140  VKLADVKRLRDSLM  153



>ref|NP_201097.1| two-component response regulator ARR6 [Arabidopsis thaliana]
 sp|Q9ZWS6.2|ARR6_ARATH RecName: Full=Two-component response regulator ARR6 [Arabidopsis 
thaliana]
 dbj|BAA34728.1| response regulator 6 [Arabidopsis thaliana]
 dbj|BAB10861.1| response regulator 6 [Arabidopsis thaliana]
 gb|AAO44065.1| At5g62920 [Arabidopsis thaliana]
 dbj|BAE99822.1| response regulator 6 [Arabidopsis thaliana]
 gb|AED97674.1| two-component response regulator ARR6 [Arabidopsis thaliana]
Length=186

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = +3

Query  174  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  353
            G  + +HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   DV+  S    
Sbjct  20   GSPDPLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DVEEKSVGFE  76

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
              KVNLI+TDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI  RI++C+E GA+ F+
Sbjct  77   DLKVNLIMTDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILPRIDRCLEEGAEDFL  136

Query  534  LKPLKQADVNELKSQLM  584
            LKP+K +DV  L+  LM
Sbjct  137  LKPVKLSDVKRLRDSLM  153



>ref|XP_010427564.1| PREDICTED: two-component response regulator ARR9-like [Camelina 
sativa]
Length=235

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 110/153 (72%), Gaps = 10/153 (7%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL  G ++ N 
Sbjct  1    MGMAAESQ-FHVLAVDDSLFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLRQG-IESND  58

Query  342  PNT--------NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  497
            PN            +VNLIITDY MPGM GY+LLKKVK+S+ FK++PVV+MSSEN+P+ I
Sbjct  59   PNALSTALVNHQEVEVNLIITDYCMPGMTGYDLLKKVKESSAFKNIPVVIMSSENVPATI  118

Query  498  NQCMEVGAKMFILKPLKQADVNELKSQLMHKRL  596
            ++C+E GA+ F LKP++ AD+N+LK  +M  +L
Sbjct  119  SRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKL  151



>ref|XP_003549646.1| PREDICTED: two-component response regulator ARR15-like isoformX1 
[Glycine max]
Length=206

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 105/132 (80%), Gaps = 3/132 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   + ++ S   +  KVN
Sbjct  26   LHVLAVDDSLVDRKVIERLLKISSCKVTVVESGTRALQYLGL---EGENGSLGFDSVKVN  82

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPGM GYELLKK+K+S++F+++PVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  83   LIMTDYSMPGMTGYELLKKIKESSVFREIPVVIMSSENVLTRIDRCLEEGAEDFLLKPVK  142

Query  549  QADVNELKSQLM  584
             +DV  LK  +M
Sbjct  143  LSDVRRLKDFIM  154



>emb|CDX79942.1| BnaA05g02140D [Brassica napus]
Length=215

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 105/141 (74%), Gaps = 9/141 (6%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNT-----N  353
             HVLAVDD  ++  +IE+LL+ SSC+VTT ++G +ALE+LGL     + N PN+      
Sbjct  9    FHVLAVDDSQLDRKMIERLLQKSSCQVTTVDSGSKALEFLGLR----ESNDPNSLETHQQ  64

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
              ++NLIITDY MPGM GY+LLKKVK+SA F+ +PVV+MSSEN+P+RI++C+E GA+ F 
Sbjct  65   EVEINLIITDYCMPGMTGYDLLKKVKESAAFRSIPVVIMSSENVPARISRCLEEGAEEFF  124

Query  534  LKPLKQADVNELKSQLMHKRL  596
            LKP+K ADV +LK  +M  +L
Sbjct  125  LKPVKLADVTKLKPHMMKTKL  145



>ref|XP_004511028.1| PREDICTED: two-component response regulator ARR9-like [Cicer 
arietinum]
Length=179

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 113/151 (75%), Gaps = 8/151 (5%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQ-HN  338
            MG   E +  HVLAVDD  I+ ++IE+LLK+SS  VT  E+  +AL++LGL+  +++  +
Sbjct  1    MGMAAETQ-FHVLAVDDSIIDRMLIERLLKTSSFHVTAVESASKALKFLGLVEDELRTFD  59

Query  339  SP-----NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  503
            +P     + +V  VNLIITDY MPGM GY+LL+K+K+S  FKD+PVV+MSSEN+PSRIN+
Sbjct  60   TPVASEIHQDV-DVNLIITDYCMPGMTGYDLLRKIKESKSFKDIPVVIMSSENVPSRINR  118

Query  504  CMEVGAKMFILKPLKQADVNELKSQLMHKRL  596
            C+E GA+ F LKP++Q+DVN+LK  L+  R+
Sbjct  119  CLEEGAEEFFLKPVQQSDVNKLKPHLLKSRV  149



>ref|XP_010505899.1| PREDICTED: two-component response regulator ARR8-like [Camelina 
sativa]
Length=224

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD----V  329
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL   D    V
Sbjct  1    MGMETESQ-FHVLAVDDSLFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRVDDEDPNV  59

Query  330  QHNSPNTNVP-KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  506
               SP+ +   ++NLIITDY MPGM GY+LLKKVK+SA FK +PVV+MSSEN+P+RI++C
Sbjct  60   LSTSPHIHQEVEINLIITDYCMPGMTGYDLLKKVKESAAFKSIPVVIMSSENVPARISRC  119

Query  507  MEVGAKMFILKPLKQADVNELKSQLMHKRL  596
            +E GA+ F LKP+K AD+ +LK  +M  +L
Sbjct  120  LEEGAEEFFLKPVKLADLTKLKPHMMKTKL  149



>ref|XP_009374451.1| PREDICTED: two-component response regulator ARR17-like [Pyrus 
x bretschneideri]
Length=156

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 105/142 (74%), Gaps = 4/142 (3%)
 Frame = +3

Query  156  MAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQH  335
            M +G   +DE  HVLAVDD  ++  IIEKLL +S+C VTTAEN   ALE LGL  G  Q 
Sbjct  1    MGLGWK-DDEKPHVLAVDDSLVDCKIIEKLLTNSACNVTTAENAHGALELLGLADG--QQ  57

Query  336  NSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEV  515
            N  NT V  VN IITDYSMPGM GYELLKK+KDS   K++PVVV+SSE+IP+RI +C+E 
Sbjct  58   NFGNT-VSNVNTIITDYSMPGMTGYELLKKIKDSPTVKEIPVVVVSSEDIPTRIEKCLEE  116

Query  516  GAKMFILKPLKQADVNELKSQL  581
            GA+ F LKP++Q+DV +L+ +L
Sbjct  117  GAEEFFLKPIRQSDVIKLQCRL  138



>ref|XP_010517619.1| PREDICTED: two-component response regulator ARR8-like [Camelina 
sativa]
Length=223

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD----V  329
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL   D    V
Sbjct  1    MGMETESQ-FHVLAVDDSLFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRVDDEDPNV  59

Query  330  QHNSPNTNVP-KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  506
               SP+ +   ++NLIITDY MPGM GY+LLKKVK+SA FK +PVV+MSSEN+P+RI++C
Sbjct  60   LSTSPHIHQEVEINLIITDYCMPGMTGYDLLKKVKESAAFKSIPVVIMSSENVPARISRC  119

Query  507  MEVGAKMFILKPLKQADVNELKSQLMHKRL  596
            +E GA+ F LKP+K AD+ +LK  +M  +L
Sbjct  120  LEEGAEEFFLKPVKLADLTKLKPHMMKTKL  149



>ref|XP_008384995.1| PREDICTED: two-component response regulator ARR17-like, partial 
[Malus domestica]
Length=159

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP  359
            DE  HVLAVDD  ++  IIEKLL +S+CKVTTAEN   ALE LGL  G  Q N  N  V 
Sbjct  11   DEKPHVLAVDDSLVDRKIIEKLLTNSACKVTTAENAHGALELLGLADG--QQNFGNI-VS  67

Query  360  KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILK  539
             VN+IITDYSMPGM GYELLKK+KDS   K++PVVV+SSE+IP+RI +C+E GA+ F LK
Sbjct  68   NVNMIITDYSMPGMTGYELLKKIKDSPTVKEIPVVVVSSEDIPTRIEKCLEEGAEEFFLK  127

Query  540  PLKQADVNELKSQL  581
            PL+Q+DV +L+ +L
Sbjct  128  PLRQSDVIKLQCRL  141



>gb|KFK44048.1| hypothetical protein AALP_AA1G208700 [Arabis alpina]
Length=201

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL   D +  + +    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL---DGEKGASDLKDLKVN  80

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GY+LLKK+K+S++F+++PVV+MSSENI  RI QC++ GA+ F+LKP+K
Sbjct  81   LIVTDYSMPGVTGYDLLKKIKESSVFREIPVVIMSSENILPRIEQCLKEGAEDFLLKPVK  140

Query  549  QADVNELKSQLMH  587
             ADV  +K  +M 
Sbjct  141  LADVKRIKQLIMR  153



>ref|NP_173339.1| two-component response regulator ARR7 [Arabidopsis thaliana]
 sp|Q9ZWS7.1|ARR7_ARATH RecName: Full=Two-component response regulator ARR7 [Arabidopsis 
thaliana]
 gb|AAF79300.1|AC068602_23 F14D16.20 [Arabidopsis thaliana]
 dbj|BAA34729.1| response regulator 7 [Arabidopsis thaliana]
 gb|ABD42983.1| At1g19050 [Arabidopsis thaliana]
 gb|AEE29795.1| two-component response regulator ARR7 [Arabidopsis thaliana]
Length=206

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL  G     + N    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGLDGG---KGASNLKDLKVN  80

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG++GY+LLKK+K+S+ F++VPVV+MSSENI  RI +C++ GA+ F+LKP+K
Sbjct  81   LIVTDYSMPGLSGYDLLKKIKESSAFREVPVVIMSSENILPRIQECLKEGAEEFLLKPVK  140

Query  549  QADVNELKSQLMH  587
             ADV  +K  +M 
Sbjct  141  LADVKRIKQLIMR  153



>ref|XP_006404297.1| hypothetical protein EUTSA_v10010754mg [Eutrema salsugineum]
 gb|ESQ45750.1| hypothetical protein EUTSA_v10010754mg [Eutrema salsugineum]
Length=183

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 103/137 (75%), Gaps = 3/137 (2%)
 Frame = +3

Query  174  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  353
            G  E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D  ++S    
Sbjct  20   GSPELLHVLAVDDSIVDRKFIERLLRVSSCKVTLVDSATRALQYLGL---DGDNSSVGFE  76

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
              K+NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI  RI++C+E GA+ F+
Sbjct  77   DLKINLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILPRIDRCLEEGAEDFL  136

Query  534  LKPLKQADVNELKSQLM  584
            LKP+K ADV  L+  LM
Sbjct  137  LKPVKLADVKRLRDSLM  153



>ref|XP_010550669.1| PREDICTED: two-component response regulator ARR5-like [Tarenaya 
hassleriana]
Length=198

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 105/138 (76%), Gaps = 3/138 (2%)
 Frame = +3

Query  171  NGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNT  350
            +G  E++HVLAVDD  ++   IE+LLK SSCKVT  ++G RAL+YLGL   D + +S   
Sbjct  19   SGSPELLHVLAVDDSHVDRKFIERLLKISSCKVTVVDSGTRALQYLGL---DGEKSSVGF  75

Query  351  NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMF  530
               KVNLI+TDYSMPGM GYEL+KK+K+S+ F+++PVV+MSSENI  RI++C+E GA+ F
Sbjct  76   ADLKVNLIMTDYSMPGMTGYELMKKIKESSAFREIPVVIMSSENILPRIDRCLEEGAEDF  135

Query  531  ILKPLKQADVNELKSQLM  584
            +LKP+K +DV  L+  LM
Sbjct  136  LLKPVKLSDVKRLRDSLM  153



>ref|XP_004501966.1| PREDICTED: two-component response regulator ARR15-like [Cicer 
arietinum]
Length=202

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 102/132 (77%), Gaps = 3/132 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK +SCKVT  E+G RAL+YLGL   D   +S   +  KVN
Sbjct  21   LHVLAVDDSHVDRKVIERLLKFTSCKVTVVESGTRALQYLGL---DGDTSSIGFDGVKVN  77

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            +I+TDYSMPGM GYELLKK+K+S++F+++PVVVMSSENI +RI+ C+E GA+ F+LKP+K
Sbjct  78   MIMTDYSMPGMTGYELLKKIKESSIFREIPVVVMSSENILTRIDSCLEEGAEEFLLKPVK  137

Query  549  QADVNELKSQLM  584
             +DV  L   +M
Sbjct  138  LSDVKRLTDFIM  149



>emb|CDY22518.1| BnaC03g23280D [Brassica napus]
Length=217

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 106/140 (76%), Gaps = 5/140 (4%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN--TNVPK  362
             HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL   + Q + PN  +  P+
Sbjct  9    FHVLAVDDSFFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRESN-QSDDPNATSTSPE  67

Query  363  V--NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFIL  536
            V  NLIITDY MPGM GY+LLK+VK+SA F+ +PVV+MSSENIP+RI++C+E GA+ F L
Sbjct  68   VEINLIITDYCMPGMTGYDLLKRVKESAAFRSIPVVIMSSENIPARISRCLEEGAEEFFL  127

Query  537  KPLKQADVNELKSQLMHKRL  596
            KP+K AD+ +LK  +M  +L
Sbjct  128  KPVKLADLTKLKLHMMKTKL  147



>ref|XP_010515122.1| PREDICTED: two-component response regulator ARR5-like [Camelina 
sativa]
Length=206

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 103/134 (77%), Gaps = 3/134 (2%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D ++ S      K
Sbjct  46   ELLHVLAVDDSMVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DGENGSVGFEDLK  102

Query  363  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
            +NLI+TDYSMPGM GYELLKK+K+S++F+++PVV+MSSENI  RI++C+E GA+ F+LKP
Sbjct  103  INLIMTDYSMPGMTGYELLKKIKESSIFREIPVVIMSSENILPRIDRCLEEGAEDFLLKP  162

Query  543  LKQADVNELKSQLM  584
            +K ADV  L+  LM
Sbjct  163  VKLADVKRLRDSLM  176



>emb|CDX83788.1| BnaC08g18570D [Brassica napus]
Length=212

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 106/143 (74%), Gaps = 9/143 (6%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL   D    + +    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL---DGNTGASDLKDLKVN  80

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GY+LLKK+K+S+ F+++PVV+MSSENI +RI QC++ GA+ F+LKP+K
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSTFREIPVVIMSSENILTRIEQCLKEGAEDFLLKPVK  140

Query  549  QADVNELKSQLM------HKRLS  599
             ADV  +K  +M      HK LS
Sbjct  141  LADVKRIKQLIMRNEAEDHKTLS  163



>ref|XP_010645611.1| PREDICTED: two-component response regulator ARR9 [Vitis vinifera]
Length=140

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 104/144 (72%), Gaps = 9/144 (6%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG  GE +  HVLAVDD  I+   IEKLLK+SS +VT  ++  +ALE+LGL   + +   
Sbjct  1    MGMAGESQ-FHVLAVDDSIIDRKWIEKLLKTSSFQVTVVDSVSKALEFLGLQEAEQER--  57

Query  342  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGA  521
                  KVNLIITDYSMPGM GY+LL+K+K+S   KD+PVV+MSSENIPSRIN+C+E GA
Sbjct  58   ------KVNLIITDYSMPGMTGYDLLRKIKESTSLKDIPVVIMSSENIPSRINRCLEEGA  111

Query  522  KMFILKPLKQADVNELKSQLMHKR  593
            + F LKP++ +DVN+L+  L+  R
Sbjct  112  EDFFLKPVQLSDVNKLRPHLLGWR  135



>ref|XP_006304102.1| hypothetical protein CARUB_v10010030mg [Capsella rubella]
 gb|EOA37000.1| hypothetical protein CARUB_v10010030mg [Capsella rubella]
Length=265

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 102/131 (78%), Gaps = 3/131 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D    SP  +  KV+
Sbjct  39   LHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DNDKASPQLDRLKVD  95

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM GYELLKK+K+S+ F+ VPVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  96   LIITDYCMPGMTGYELLKKIKESSNFRQVPVVIMSSENVVTRIDRCLEEGAQDFLLKPVK  155

Query  549  QADVNELKSQL  581
             ADV  L+S L
Sbjct  156  LADVKRLRSHL  166



>ref|NP_177627.1| two-component response regulator ARR15 [Arabidopsis thaliana]
 sp|Q7G8V2.1|ARR15_ARATH RecName: Full=Two-component response regulator ARR15 [Arabidopsis 
thaliana]
 gb|AAD55287.1|AC008263_18 Similar to gb|AB008490 response regulator 7 (ARR7) from Arabidopsis 
thaliana. EST gb|AA042183 comes from this gene [Arabidopsis 
thaliana]
 gb|AAG40611.1|AF305720_1 response regulator 15 [Arabidopsis thaliana]
 gb|AAG51914.1|AC013258_8 putative response regulator (two component phosphotransfer signaling); 
70657-71777 [Arabidopsis thaliana]
 gb|AEE35644.1| two-component response regulator ARR15 [Arabidopsis thaliana]
Length=206

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 99/133 (74%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK S+CKVTT E+G RAL+YLGL   D  + S      KVN
Sbjct  18   LHVLAVDDSFVDRKVIERLLKISACKVTTVESGTRALQYLGL---DGDNGSSGLKDLKVN  74

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GYELLKK+K+S+  +++PVV+MSSENI  RI QCM  GA+ F+LKP+K
Sbjct  75   LIVTDYSMPGLTGYELLKKIKESSALREIPVVIMSSENIQPRIEQCMIEGAEEFLLKPVK  134

Query  549  QADVNELKSQLMH  587
             ADV  LK  +M 
Sbjct  135  LADVKRLKELIMR  147



>ref|XP_006294950.1| hypothetical protein CARUB_v10024006mg [Capsella rubella]
 gb|EOA27848.1| hypothetical protein CARUB_v10024006mg [Capsella rubella]
Length=225

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHN-  338
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL   D   N 
Sbjct  1    MGMETESQ-FHVLAVDDSLFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRVDDEDPNV  59

Query  339  ---SPNTNVP-KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  506
               SP+ +   ++NLIITDY MPGM GY+LLKKVK+SA FK +PVV+MSSEN+P+RI++C
Sbjct  60   LSTSPHIHQEVEINLIITDYCMPGMTGYDLLKKVKESAAFKSIPVVIMSSENVPARISRC  119

Query  507  MEVGAKMFILKPLKQADVNELKSQLMHKRL  596
            +E GA+ F LKP+K AD+ +LK  +M  +L
Sbjct  120  LEEGAEEFFLKPVKLADLTKLKPHMMKTKL  149



>emb|CBI40157.3| unnamed protein product [Vitis vinifera]
Length=170

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 104/136 (76%), Gaps = 4/136 (3%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP---  359
             HVLAVDD  I+  +IEKLLK+SS +VT  ++G +ALE+LGL   + ++ SP +  P   
Sbjct  9    FHVLAVDDSIIDRKLIEKLLKTSSYQVTAVDSGSKALEFLGLQEAEQRNLSPPSLCPSQE  68

Query  360  -KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFIL  536
             +VNLIITDY MPGM GY+LL+K+K+S   KD+PVV+MSSENIPSRIN+C+E GA+ F L
Sbjct  69   MEVNLIITDYCMPGMTGYDLLRKIKESTSLKDIPVVIMSSENIPSRINRCLEEGAEDFFL  128

Query  537  KPLKQADVNELKSQLM  584
            KP++ +DVN+L+  L+
Sbjct  129  KPVQLSDVNKLRPHLL  144



>ref|XP_010477106.1| PREDICTED: two-component response regulator ARR7 [Camelina sativa]
Length=208

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL   D    + N    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL---DGDKGASNLKDLKVN  80

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GY+LLKK+K+S+ F++VPVV+MSSENI  RI +C++ GA+ F+LKP+K
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSAFREVPVVIMSSENILPRIEECLKEGAEEFLLKPVK  140

Query  549  QADVNELKSQLMH  587
             ADV  +K  +M 
Sbjct  141  LADVKRIKQLIMR  153



>emb|CDY54257.1| BnaC01g42890D [Brassica napus]
Length=183

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D  ++S      K
Sbjct  23   ELLHVLAVDDSIVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DGDNSSVGFQDLK  79

Query  363  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI  RI++C+E GA+ F+LKP
Sbjct  80   INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILPRIDRCLEEGAEDFLLKP  139

Query  543  LKQADVNELKSQLM  584
            +K ADV  L+  LM
Sbjct  140  VKLADVKRLRDSLM  153



>ref|XP_010416347.1| PREDICTED: two-component response regulator ARR15 [Camelina sativa]
Length=198

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 99/133 (74%), Gaps = 5/133 (4%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK S+CKVTT E+G RAL+YLGL  G     S      KVN
Sbjct  14   LHVLAVDDSFVDRKVIERLLKISACKVTTVESGTRALQYLGLDKG-----SSGLKDLKVN  68

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM  GA+ F+LKP+K
Sbjct  69   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCMVEGAEDFLLKPVK  128

Query  549  QADVNELKSQLMH  587
             ADV  +K  +M 
Sbjct  129  LADVKRIKELIMR  141



>ref|XP_010459562.1| PREDICTED: two-component response regulator ARR7-like [Camelina 
sativa]
Length=211

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL   D    + N    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL---DGDKGASNLKDLKVN  80

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GY+LLKK+K+S+ F++VPVV+MSSENI  RI +C++ GA+ F+LKP+K
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSAFREVPVVIMSSENILPRIEECLKEGAEEFLLKPVK  140

Query  549  QADVNELKSQLMH  587
             ADV  +K  +M 
Sbjct  141  LADVKRIKQLIMR  153



>ref|XP_010498312.1| PREDICTED: two-component response regulator ARR7-like [Camelina 
sativa]
Length=210

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL   D    + N    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL---DGDKGASNLKDLKVN  80

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GY+LLKK+K+S+ F++VPVV+MSSENI  RI +C++ GA+ F+LKP+K
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSAFREVPVVIMSSENILPRIEECLKEGAEEFLLKPVK  140

Query  549  QADVNELKSQLMH  587
             ADV  +K  +M 
Sbjct  141  LADVKRIKQLIMR  153



>emb|CDX96681.1| BnaA08g22240D [Brassica napus]
Length=207

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 106/143 (74%), Gaps = 9/143 (6%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL   D    + +    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL---DGNTGASDLKDLKVN  80

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GY+LLKK+K+S+ F+++PVV+MSSENI +RI QC++ GA+ F+LKP+K
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSTFREIPVVIMSSENILTRIEQCLKEGAEDFLLKPVK  140

Query  549  QADVNELKSQLM------HKRLS  599
             ADV  +K  +M      H+ LS
Sbjct  141  LADVKRIKQLIMRNEAEDHRTLS  163



>ref|XP_010269354.1| PREDICTED: two-component response regulator ARR9-like isoform 
X2 [Nelumbo nucifera]
Length=209

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 110/150 (73%), Gaps = 6/150 (4%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG   E +  HVLAVDD  I+  +IE+LLK+SS +VT  ++G +ALE+LGL   D  + S
Sbjct  1    MGMAAEAQ-FHVLAVDDSLIDRKLIERLLKNSSYQVTAVDSGSKALEFLGLREDDQTNPS  59

Query  342  P-----NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  506
            P     N +  +VNLIITDY MPGM GY+LLKK+K+S+  KD+PVV+MSSEN+PSRIN+C
Sbjct  60   PPSVPSNHHEMQVNLIITDYCMPGMTGYDLLKKIKESSSLKDIPVVIMSSENVPSRINRC  119

Query  507  MEVGAKMFILKPLKQADVNELKSQLMHKRL  596
            +E GA+ F+LKP++ +DVN L+  L+  +L
Sbjct  120  LEEGAEEFLLKPVQLSDVNRLRPHLLKGKL  149



>ref|XP_006577761.1| PREDICTED: uncharacterized protein LOC100306152 isoform X1 [Glycine 
max]
Length=204

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   +  KVN
Sbjct  21   LHVLAVDDSHVDRKVIERLLKISSCKVTVVESGSRALQYLGL---DGEKSSIGLDSVKVN  77

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPGM GYELLKK+K+S++F++VPVVVMSSENI +RI+ C+E GA+ F+LKP+K
Sbjct  78   LIMTDYSMPGMTGYELLKKIKESSVFREVPVVVMSSENILTRIDSCLEEGAEEFLLKPVK  137

Query  549  QADVNELKSQLMH  587
             +DV  +   +M 
Sbjct  138  LSDVKRVTDFIMR  150



>ref|XP_007138131.1| hypothetical protein PHAVU_009G182800g [Phaseolus vulgaris]
 gb|ESW10125.1| hypothetical protein PHAVU_009G182800g [Phaseolus vulgaris]
Length=201

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 103/132 (78%), Gaps = 3/132 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   +  KVN
Sbjct  17   LHVLAVDDSHVDRKVIERLLKISSCKVTVVESGSRALQYLGL---DGEKSSIGFDSVKVN  73

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPGM GYELLKK+K+S++F++VPVVVMSSENI +RI+ C+E GA+ F+LKP+K
Sbjct  74   LIMTDYSMPGMTGYELLKKIKESSVFREVPVVVMSSENILTRIDSCLEEGAEEFLLKPVK  133

Query  549  QADVNELKSQLM  584
             +DV  +   +M
Sbjct  134  LSDVKRVTDFIM  145



>gb|KFK34102.1| hypothetical protein AALP_AA5G102300 [Arabis alpina]
Length=185

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 103/134 (77%), Gaps = 3/134 (2%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D ++++      K
Sbjct  24   ELLHVLAVDDSIVDRKFIERLLRVSSCKVTLVDSATRALQYLGL---DGENSTVGFEDLK  80

Query  363  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI  RI++C+E GA+ F+LKP
Sbjct  81   INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILPRIDRCLEEGAEDFLLKP  140

Query  543  LKQADVNELKSQLM  584
            +K ADV  L+  LM
Sbjct  141  VKLADVKRLRDSLM  154



>emb|CDY14761.1| BnaC04g47580D [Brassica napus]
Length=222

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 108/144 (75%), Gaps = 9/144 (6%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN--TNVP-  359
             HVLAVDD  ++  +IE+LL+ SSC+VTT ++G +ALE+LGL   + + N PN  ++ P 
Sbjct  9    FHVLAVDDSLVDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRESN-ESNDPNAPSSSPV  67

Query  360  -----KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAK  524
                 ++NLIITDY MPGM GY+LLK+VK+SA F+ +PVV+MSSEN+P+RI++C+E GA+
Sbjct  68   THQEIEINLIITDYCMPGMTGYDLLKRVKESAAFRSIPVVIMSSENVPARISRCLEEGAE  127

Query  525  MFILKPLKQADVNELKSQLMHKRL  596
             F LKP+K ADV +LK  +M  +L
Sbjct  128  EFFLKPVKLADVTKLKPHMMKTKL  151



>ref|XP_009765982.1| PREDICTED: two-component response regulator ARR9-like isoform 
X1 [Nicotiana sylvestris]
Length=187

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 106/141 (75%), Gaps = 3/141 (2%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD---VQHNSPNT  350
            D   HVLAVDD  I+  +IE+LLK+SS +VT  ++G +ALEYLGL + +   V+ +  + 
Sbjct  8    DHQFHVLAVDDSIIDRKLIERLLKTSSYQVTVVDSGSKALEYLGLSSDENEGVEIDHSHV  67

Query  351  NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMF  530
                +NLIITDYSMPGM GY+LL+K+K S+  KD+PV++MSSEN+PSRIN+C+E GA+ F
Sbjct  68   REIGINLIITDYSMPGMTGYDLLRKIKGSSSLKDIPVIIMSSENVPSRINRCLEEGAEEF  127

Query  531  ILKPLKQADVNELKSQLMHKR  593
             LKP++Q+D+N +K  LM ++
Sbjct  128  FLKPVQQSDMNRIKPHLMREK  148



>ref|XP_006411396.1| hypothetical protein EUTSA_v10017200mg [Eutrema salsugineum]
 gb|ESQ52849.1| hypothetical protein EUTSA_v10017200mg [Eutrema salsugineum]
Length=228

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 103/140 (74%), Gaps = 8/140 (6%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN--TNVP-  359
             HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL   + +   PN  +  P 
Sbjct  9    FHVLAVDDSLFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRESNDESEDPNVLSTSPV  68

Query  360  -----KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAK  524
                 ++NLIITDY MPGM GY+LLK+VK+SA FK +PVV+MSSEN+P+RI++C+E GA+
Sbjct  69   THQEVEINLIITDYCMPGMTGYDLLKRVKESAAFKSIPVVIMSSENVPARISRCLEEGAE  128

Query  525  MFILKPLKQADVNELKSQLM  584
             F LKP+K ADV +LK  +M
Sbjct  129  EFFLKPVKLADVTKLKPHMM  148



>ref|NP_181663.1| response regulator 3 [Arabidopsis thaliana]
 sp|O80365.1|ARR8_ARATH RecName: Full=Two-component response regulator ARR8; AltName: 
Full=Response reactor 3 [Arabidopsis thaliana]
 dbj|BAA31145.1| responce reactor3 [Arabidopsis thaliana]
 gb|AAC78541.1| putative two-component response regulator 3 protein [Arabidopsis 
thaliana]
 gb|AAL69459.1| At2g41310/F13H10.14 [Arabidopsis thaliana]
 dbj|BAF00286.1| putative two-component response regulator 3 protein [Arabidopsis 
thaliana]
 gb|AEC09959.1| response regulator 3 [Arabidopsis thaliana]
Length=225

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 105/144 (73%), Gaps = 11/144 (8%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN--TNVPK  362
             HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL   D   N PN  +  P+
Sbjct  9    FHVLAVDDSLFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRVDD---NDPNALSTSPQ  65

Query  363  V------NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAK  524
            +      NLIITDY MPGM GY+LLKKVK+SA F+ +PVV+MSSEN+P+RI++C+E GA+
Sbjct  66   IHQEVEINLIITDYCMPGMTGYDLLKKVKESAAFRSIPVVIMSSENVPARISRCLEEGAE  125

Query  525  MFILKPLKQADVNELKSQLMHKRL  596
             F LKP+K AD+ +LK  +M  +L
Sbjct  126  EFFLKPVKLADLTKLKPHMMKTKL  149



>gb|ABG35777.1| SRR217 [Striga asiatica]
Length=220

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 106/147 (72%), Gaps = 7/147 (5%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG    +   HVLAVDD  I+  +IE+LLK+SS +VTT ++G +ALE+LG  + D   NS
Sbjct  1    MGMAAAEAQFHVLAVDDSLIDRKLIERLLKTSSYQVTTVDSGNKALEFLGW-SKDESGNS  59

Query  342  PNTNVPK------VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  503
               + PK      VNL+ITDY MPGM GYELLKKVK+S   +D+PVV+MSSEN+PSRIN+
Sbjct  60   NAFDSPKNHQVVEVNLVITDYCMPGMTGYELLKKVKESTFLRDIPVVIMSSENVPSRINR  119

Query  504  CMEVGAKMFILKPLKQADVNELKSQLM  584
            C+E GA+ F LKP++ +DVN+L+  +M
Sbjct  120  CLEEGAEEFFLKPVRLSDVNKLRPHMM  146



>gb|KHG14174.1| Two-component response regulator ARR6 -like protein [Gossypium 
arboreum]
Length=210

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 99/127 (78%), Gaps = 3/127 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IEKLLK SSCKVTT E+G RAL++LGL   D +  S   N  KVN
Sbjct  14   LHVLAVDDSHVDRKVIEKLLKISSCKVTTVESGARALQFLGL---DEEKGSLGFNGLKVN  70

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPGM GYELLKK+K S+ F+++PVV+MSSENI +RI+ C+E GA+ F++KP+K
Sbjct  71   LIMTDYSMPGMTGYELLKKIKRSSTFREIPVVIMSSENILTRIDSCLEEGAEEFLVKPVK  130

Query  549  QADVNEL  569
             +DV  +
Sbjct  131  LSDVKRV  137



>ref|NP_001238384.1| uncharacterized protein LOC100306152 [Glycine max]
 gb|ACU14193.1| unknown [Glycine max]
Length=201

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   +  KVN
Sbjct  21   LHVLAVDDSHVDRKVIERLLKISSCKVTVVESGSRALQYLGL---DGEKSSIGLDSVKVN  77

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPGM GYELLKK+K+S++F++VPVVVMSSENI +RI+ C+E GA+ F+LKP+K
Sbjct  78   LIMTDYSMPGMTGYELLKKIKESSVFREVPVVVMSSENILTRIDSCLEEGAEEFLLKPVK  137

Query  549  QADVNELKSQLMH  587
             +DV  +   +M 
Sbjct  138  LSDVKRVTDFIMR  150



>ref|XP_006304206.1| hypothetical protein CARUB_v10010295mg [Capsella rubella]
 gb|EOA37104.1| hypothetical protein CARUB_v10010295mg [Capsella rubella]
Length=210

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 109/147 (74%), Gaps = 4/147 (3%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL   D    + N    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL---DGDKGASNLKDLKVN  80

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GY+LLKK+K+S+ F++VPVV+MSSENI  RI +C++ GA+ F+LKP+K
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSAFREVPVVIMSSENILPRIEECLKEGAEDFLLKPVK  140

Query  549  QADVNELKSQLMHKRLSM**RPIRSFS  629
             ADV  +K QL+ +  S   + +RS S
Sbjct  141  LADVKRIK-QLIMRNESEECKTLRSLS  166



>ref|XP_010458393.1| PREDICTED: two-component response regulator ARR4-like [Camelina 
sativa]
Length=259

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 104/136 (76%), Gaps = 3/136 (2%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            E +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D    S   +  K
Sbjct  38   EEVHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DNDKASAQLDRLK  94

Query  363  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
            V+LIITDY MPGM GYELLKK+K+S+ F++VPVV+MSSEN+ +RI++C+E GA+ F+LKP
Sbjct  95   VDLIITDYCMPGMTGYELLKKIKESSNFREVPVVIMSSENVMTRIDRCLEEGAQDFLLKP  154

Query  543  LKQADVNELKSQLMHK  590
            +K ADV  L+S L  K
Sbjct  155  VKLADVKRLRSHLATK  170



>emb|CDX85860.1| BnaC06g22740D [Brassica napus]
Length=218

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD+ ++  +IE+LL+ S+CKVTT E+G RAL+YLGL   D  + S      KVN
Sbjct  44   LHVLAVDDNFVDRKVIERLLRISACKVTTVESGTRALQYLGL---DGDNGSSALKDLKVN  100

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM  GA+ F+LKP+K
Sbjct  101  LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCMTEGAEDFLLKPVK  160

Query  549  QADVNELKSQLMH  587
             ADV  L   +M 
Sbjct  161  LADVKRLTELIMR  173



>ref|XP_004249238.1| PREDICTED: two-component response regulator ARR9 [Solanum lycopersicum]
Length=227

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 105/147 (71%), Gaps = 3/147 (2%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG    +   HVLAVDD  I+  +IE LLK+S+C+VTT ++G +ALE+LGL   D     
Sbjct  1    MGMAAVESQFHVLAVDDSVIDRKLIEMLLKTSACQVTTVDSGSKALEFLGLQENDKNQTC  60

Query  342  ---PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  512
                N    ++NLIITDY MPGM GY+LLKK+K+SA  +++PVV+MSSEN+PSRI++C+E
Sbjct  61   VSLDNHQEAEINLIITDYCMPGMTGYDLLKKIKESASLRNIPVVIMSSENVPSRISRCLE  120

Query  513  VGAKMFILKPLKQADVNELKSQLMHKR  593
             GA+ F LKP++ +DVN+LK  +M  +
Sbjct  121  EGAEEFFLKPVRLSDVNKLKPHMMKTK  147



>ref|XP_010277318.1| PREDICTED: two-component response regulator ARR17-like [Nelumbo 
nucifera]
Length=162

 Score =   153 bits (386),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 105/139 (76%), Gaps = 5/139 (4%)
 Frame = +3

Query  165  GENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP  344
            G+  E E +HVLAVDD  I+  +IEKLLKSSS +VTT E+G RALE LGL     + NS 
Sbjct  19   GDTRESERLHVLAVDDSSIDRKLIEKLLKSSSYRVTTVESGKRALELLGL----GKENSF  74

Query  345  NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAK  524
                 KVN+IITDY MP M G++LLK+VK+S+  K++PVV++SSEN+P+RIN+C+E GA+
Sbjct  75   FKE-QKVNMIITDYCMPEMTGFDLLKRVKESSALKEIPVVILSSENVPTRINRCLEEGAE  133

Query  525  MFILKPLKQADVNELKSQL  581
             F+LKPL+Q+DV+ L + +
Sbjct  134  EFLLKPLRQSDVSRLHNHM  152



>ref|NP_172517.1| two-component response regulator ARR4 [Arabidopsis thaliana]
 sp|O82798.1|ARR4_ARATH RecName: Full=Two-component response regulator ARR4; AltName: 
Full=Response regulator 1 [Arabidopsis thaliana]
 gb|AAD39568.1|AC007067_8 T10O24.8 [Arabidopsis thaliana]
 dbj|BAA31143.1| responce regulator1 [Arabidopsis thaliana]
 gb|AAC26636.1| two-component response regulator homolog [Arabidopsis thaliana]
 dbj|BAA34726.1| response regulator 4 [Arabidopsis thaliana]
 gb|ABD19659.1| At1g10470 [Arabidopsis thaliana]
 dbj|BAE98474.1| putative response regulator 3 [Arabidopsis thaliana]
 gb|AEE28583.1| two-component response regulator ARR4 [Arabidopsis thaliana]
Length=259

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 103/131 (79%), Gaps = 3/131 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D +  S   +  KV+
Sbjct  34   VHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DNEKASAEFDRLKVD  90

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM GYELLKK+K+S+ F++VPVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  91   LIITDYCMPGMTGYELLKKIKESSNFREVPVVIMSSENVLTRIDRCLEEGAQDFLLKPVK  150

Query  549  QADVNELKSQL  581
             ADV  L+S L
Sbjct  151  LADVKRLRSHL  161



>ref|XP_003545839.1| PREDICTED: two-component response regulator ARR8-like [Glycine 
max]
 gb|KHN27335.1| Two-component response regulator ARR8 [Glycine soja]
Length=179

 Score =   153 bits (387),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 106/142 (75%), Gaps = 9/142 (6%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK--  362
             HVLAVDD  I+ ++IE+LLK+SS  VTT ++  +AL++LGL+  +++  + +T V    
Sbjct  9    FHVLAVDDSIIDRMLIERLLKTSSFHVTTVDSATKALKFLGLVEDELR--TFDTTVASEI  66

Query  363  -----VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKM  527
                 +NLIITDY MPGM GY+LL+K+K+S   K++PVV+MSSEN+PSRIN+C+E GA+ 
Sbjct  67   HQDVDINLIITDYCMPGMTGYDLLRKIKESKSLKNIPVVIMSSENVPSRINRCLEEGAEE  126

Query  528  FILKPLKQADVNELKSQLMHKR  593
            F LKP++QADVN+LK  LM  R
Sbjct  127  FFLKPVQQADVNKLKPHLMKSR  148



>ref|XP_002267404.1| PREDICTED: two-component response regulator ARR8 [Vitis vinifera]
Length=220

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 104/136 (76%), Gaps = 4/136 (3%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP---  359
             HVLAVDD  I+  +IEKLLK+SS +VT  ++G +ALE+LGL   + ++ SP +  P   
Sbjct  9    FHVLAVDDSIIDRKLIEKLLKTSSYQVTAVDSGSKALEFLGLQEAEQRNLSPPSLCPSQE  68

Query  360  -KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFIL  536
             +VNLIITDY MPGM GY+LL+K+K+S   KD+PVV+MSSENIPSRIN+C+E GA+ F L
Sbjct  69   MEVNLIITDYCMPGMTGYDLLRKIKESTSLKDIPVVIMSSENIPSRINRCLEEGAEDFFL  128

Query  537  KPLKQADVNELKSQLM  584
            KP++ +DVN+L+  L+
Sbjct  129  KPVQLSDVNKLRPHLL  144



>ref|XP_009606673.1| PREDICTED: two-component response regulator ARR9 isoform X1 [Nicotiana 
tomentosiformis]
Length=222

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 106/145 (73%), Gaps = 1/145 (1%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG    D   HVLAVDD  I+  +IE+L + SSC+VTT ++G +ALE+LGL   +    S
Sbjct  1    MGMAAADLQFHVLAVDDSLIDRKLIERLFRISSCQVTTVDSGSKALEFLGLQDQNQPCVS  60

Query  342  P-NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVG  518
            P N    +VNLIITDY MPGM GY+LLKK+K+S+  +++PVV+MSSEN+PSRI++C+E G
Sbjct  61   PSNQQEVEVNLIITDYCMPGMTGYDLLKKIKESSSLRNIPVVIMSSENVPSRISRCLEEG  120

Query  519  AKMFILKPLKQADVNELKSQLMHKR  593
            A+ F LKP++ +DVN+L+  +M  +
Sbjct  121  AEEFFLKPVRLSDVNKLRPHMMKTK  145



>ref|XP_009110302.1| PREDICTED: two-component response regulator ARR7 [Brassica rapa]
Length=207

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 109/145 (75%), Gaps = 13/145 (9%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP--K  362
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL       N+ ++++   K
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL-----DGNTGDSDLKDLK  78

Query  363  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
            VNLI+TDYSMPG+ GY+LLKK+K+S+ F+++PVV+MSSENI +RI QC++ GA+ F+LKP
Sbjct  79   VNLIVTDYSMPGLTGYDLLKKIKESSTFREIPVVIMSSENILTRIEQCLKEGAEDFLLKP  138

Query  543  LKQADVNELKSQLM------HKRLS  599
            +K ADV  +K  +M      H+ LS
Sbjct  139  VKLADVKRIKQLIMRNEAEDHRTLS  163



>ref|XP_002283787.2| PREDICTED: two-component response regulator ARR5-like [Vitis 
vinifera]
Length=258

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 102/132 (77%), Gaps = 3/132 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL++LGL   D + NS   +  KVN
Sbjct  65   LHVLAVDDSHVDRKVIERLLKISSCKVTAVESGTRALQFLGL---DGEENSVGFDGLKVN  121

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPGM GYELLKK+K+S  F+ +PVV+MSSENI +RI++C+E GA+ FI+KP+K
Sbjct  122  LIMTDYSMPGMTGYELLKKIKESKAFRKIPVVIMSSENILTRIDRCLEEGAEEFIVKPVK  181

Query  549  QADVNELKSQLM  584
             ADV  L+  +M
Sbjct  182  LADVRRLRDFIM  193



>ref|XP_010428484.1| PREDICTED: two-component response regulator ARR15-like [Camelina 
sativa]
 ref|XP_010428485.1| PREDICTED: two-component response regulator ARR15-like [Camelina 
sativa]
Length=201

 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 99/133 (74%), Gaps = 5/133 (4%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK S+CKVTT E+G RAL+YLGL  G     S      KVN
Sbjct  16   LHVLAVDDSFVDRKVIERLLKISACKVTTVESGTRALQYLGLDKG-----SSGLKDLKVN  70

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM  GA+ F+LKP+K
Sbjct  71   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCMIEGAEDFLLKPVK  130

Query  549  QADVNELKSQLMH  587
             ADV  +K  +M 
Sbjct  131  LADVKRIKELIMR  143



>gb|KHN37666.1| Two-component response regulator ARR8 [Glycine soja]
Length=179

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 106/142 (75%), Gaps = 9/142 (6%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK--  362
             HVLAVDD  I+ ++IE+LLK+SS  VTT ++  +AL++LGL+  +++  + +T V    
Sbjct  9    FHVLAVDDSIIDRMLIERLLKTSSFHVTTLDSATKALKFLGLVEDELR--TFDTTVASEI  66

Query  363  -----VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKM  527
                 VNLIITDY MPGM GY+LL+K+K+S   K++PVV+MSSEN+PSRIN+C+E GA+ 
Sbjct  67   HQDVDVNLIITDYCMPGMTGYDLLRKIKESKSLKNIPVVIMSSENVPSRINRCLEEGAEE  126

Query  528  FILKPLKQADVNELKSQLMHKR  593
            F LKP++QADVN+LK  LM  R
Sbjct  127  FFLKPVQQADVNKLKPHLMKSR  148



>ref|XP_004296015.1| PREDICTED: two-component response regulator ARR3-like [Fragaria 
vesca subsp. vesca]
Length=140

 Score =   152 bits (383),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 102/140 (73%), Gaps = 4/140 (3%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG N  D   HVLAVDD  ++  IIE+LL +SSCKVTTAEN   ALE LGL   D Q N 
Sbjct  1    MGLNS-DAKPHVLAVDDSILDRKIIERLLTNSSCKVTTAENAHGALELLGL--ADGQQNF  57

Query  342  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGA  521
             NT V  VN+IITDY MPGM GYELLKK+K+S   K++PV+V+SSENI +RI +C+E GA
Sbjct  58   SNT-VSDVNMIITDYCMPGMTGYELLKKLKESPTAKEIPVIVVSSENIQTRIEKCLEEGA  116

Query  522  KMFILKPLKQADVNELKSQL  581
            + F+LKPL+Q+DV  L+  L
Sbjct  117  EEFLLKPLRQSDVKRLRCNL  136



>emb|CDY06934.1| BnaA04g23810D [Brassica napus]
Length=222

 Score =   154 bits (389),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 108/144 (75%), Gaps = 9/144 (6%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN--TNVP-  359
             HVLAVDD  ++  +IE+LL+ SSC+VTT ++G +ALE+LGL   + + N PN  ++ P 
Sbjct  9    FHVLAVDDSLVDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRESN-ESNDPNAPSSSPV  67

Query  360  -----KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAK  524
                 ++NLIITDY MPGM GY+LLK+VK+SA F+ +PVV+MSSEN+P+RI++C+E GA+
Sbjct  68   THQEIEINLIITDYCMPGMTGYDLLKRVKESAAFRSIPVVIMSSENVPARISRCLEEGAE  127

Query  525  MFILKPLKQADVNELKSQLMHKRL  596
             F LKP+K AD+ +LK  +M  +L
Sbjct  128  EFFLKPVKLADLTKLKPHMMKTKL  151



>ref|NP_176202.1| response regulator 3 [Arabidopsis thaliana]
 sp|Q9ZWS9.1|ARR3_ARATH RecName: Full=Two-component response regulator ARR3 [Arabidopsis 
thaliana]
 gb|AAD39333.1|AC007258_22 response regulator 3 [Arabidopsis thaliana]
 dbj|BAA34725.1| response regulator 3 [Arabidopsis thaliana]
 gb|ABD60731.1| At1g59940 [Arabidopsis thaliana]
 dbj|BAF00859.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33642.1| response regulator 3 [Arabidopsis thaliana]
Length=231

 Score =   154 bits (390),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D    +   +  KV+
Sbjct  33   VHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DDDKAAVEFDRLKVD  89

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM GYELLKK+K+S  FK+VPVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  90   LIITDYCMPGMTGYELLKKIKESTSFKEVPVVIMSSENVMTRIDRCLEEGAEDFLLKPVK  149

Query  549  QADVNELKSQLMH  587
             ADV  L+S L  
Sbjct  150  LADVKRLRSYLTR  162



>ref|XP_009116409.1| PREDICTED: two-component response regulator ARR9 [Brassica rapa]
Length=236

 Score =   154 bits (390),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 110/147 (75%), Gaps = 2/147 (1%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG    +   HVLAVDD  ++  +IE+LL+ SSC+VTT ++G +ALE+LGL  G   +++
Sbjct  1    MGMAAAEWKFHVLAVDDSLVDRKLIERLLQKSSCQVTTVDSGYKALEFLGLRQGIESNDT  60

Query  342  PNTNVP--KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEV  515
               ++   +VNLIITDY MPGM GY+LLKK+K+S+  K++PVV+MSSEN+P+RI++C+E 
Sbjct  61   TALSLSPQEVNLIITDYCMPGMTGYDLLKKLKESSALKNIPVVIMSSENVPARISRCLEE  120

Query  516  GAKMFILKPLKQADVNELKSQLMHKRL  596
            GA+ F LKP++ AD+N+LK  +M  +L
Sbjct  121  GAEEFFLKPVRLADLNKLKPHMMKTKL  147



>ref|XP_010471585.1| PREDICTED: two-component response regulator ARR15-like [Camelina 
sativa]
 ref|XP_010471586.1| PREDICTED: two-component response regulator ARR15-like [Camelina 
sativa]
Length=200

 Score =   154 bits (388),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 99/133 (74%), Gaps = 5/133 (4%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK S+CKVTT E+G RAL+YLGL  G     S      KVN
Sbjct  16   LHVLAVDDSFVDRKVIERLLKISACKVTTVESGTRALQYLGLDKG-----SSGLKDLKVN  70

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM  GA+ F+LKP+K
Sbjct  71   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCMIEGAEDFLLKPVK  130

Query  549  QADVNELKSQLMH  587
             ADV  +K  +M 
Sbjct  131  LADVKRIKELIMR  143



>ref|XP_002866522.1| hypothetical protein ARALYDRAFT_496477 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42781.1| hypothetical protein ARALYDRAFT_496477 [Arabidopsis lyrata subsp. 
lyrata]
Length=186

 Score =   153 bits (386),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 101/137 (74%), Gaps = 3/137 (2%)
 Frame = +3

Query  174  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  353
            G  +++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL    V+  S    
Sbjct  20   GSPDLLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---GVEEKSVGFQ  76

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
              KVNLI+TDYSMPGM GYELLKK+K+S+ F+ VPVV+MSSENI  RI++C+E GA+ F+
Sbjct  77   DLKVNLIMTDYSMPGMTGYELLKKIKESSAFRQVPVVIMSSENILPRIDRCLEEGAEDFL  136

Query  534  LKPLKQADVNELKSQLM  584
            LKP+K +DV  L+  LM
Sbjct  137  LKPVKLSDVERLRDSLM  153



>emb|CDY23856.1| BnaC04g01810D [Brassica napus]
Length=215

 Score =   154 bits (388),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 105/138 (76%), Gaps = 3/138 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKV-  365
             HVLAVDD  ++  +IE+LL+ SSC+VTT ++G +ALE+LGL   + Q N+  T+  +V 
Sbjct  9    FHVLAVDDSHLDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRESNDQ-NALETHQQEVE  67

Query  366  -NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
             NLIITDY MPGM GY+LLKKVK+S  F+ +PVV+MSSEN+P+RI++C+E GA+ F LKP
Sbjct  68   INLIITDYCMPGMTGYDLLKKVKESVAFRSIPVVIMSSENVPARISRCLEEGAEEFFLKP  127

Query  543  LKQADVNELKSQLMHKRL  596
            +K ADV +LK  +M  +L
Sbjct  128  VKLADVTKLKPHMMKTKL  145



>ref|XP_006301719.1| hypothetical protein CARUB_v10022177mg [Capsella rubella]
 gb|EOA34617.1| hypothetical protein CARUB_v10022177mg [Capsella rubella]
Length=240

 Score =   154 bits (390),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 101/131 (77%), Gaps = 3/131 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D    S   +  KV+
Sbjct  34   VHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DDDKASVEFDRLKVD  90

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM GYELLKK+K+S  FK+VPVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  91   LIITDYCMPGMTGYELLKKIKESTSFKEVPVVIMSSENVLTRIDRCLEEGAEDFLLKPVK  150

Query  549  QADVNELKSQL  581
             ADV  L+S L
Sbjct  151  LADVKRLRSYL  161



>ref|XP_010475910.1| PREDICTED: two-component response regulator ARR4-like isoform 
X2 [Camelina sativa]
Length=258

 Score =   155 bits (392),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 103/134 (77%), Gaps = 3/134 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D    S   +  KV+
Sbjct  33   VHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DNDKASAQLDRLKVD  89

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM GYELLKK+K+S+ F++VPVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  90   LIITDYCMPGMTGYELLKKIKESSNFREVPVVIMSSENVLTRIDRCLEEGAQDFLLKPVK  149

Query  549  QADVNELKSQLMHK  590
             ADV  L+S L  K
Sbjct  150  LADVKRLRSHLATK  163



>ref|XP_010414625.1| PREDICTED: two-component response regulator ARR3 [Camelina sativa]
Length=232

 Score =   154 bits (390),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D    +   +  KV+
Sbjct  34   VHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DEDKAAVEFDRLKVD  90

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM GYELLKK+K+S  FK+VPVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  91   LIITDYCMPGMTGYELLKKIKESTSFKEVPVVIMSSENVLTRIDRCLEEGAEDFLLKPVK  150

Query  549  QADVNELKSQLMH  587
             ADV  L+S L  
Sbjct  151  LADVKRLRSYLTR  163



>ref|XP_006579380.1| PREDICTED: uncharacterized protein LOC100527518 isoform X1 [Glycine 
max]
Length=210

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 106/136 (78%), Gaps = 3/136 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            + VLAVDD  ++  +IE+LL+ SSCKVT  E+G RAL+YLGL  G   ++S   +  KVN
Sbjct  26   LQVLAVDDSLVDRKVIERLLRISSCKVTVVESGTRALQYLGLDGG---NSSLGFDSVKVN  82

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPGM GYELLKK+K+S++F+++PVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  83   LIMTDYSMPGMTGYELLKKIKESSVFREIPVVIMSSENVLTRIDRCLEEGAEDFLLKPVK  142

Query  549  QADVNELKSQLMHKRL  596
             +DV  LK  +M  ++
Sbjct  143  LSDVRRLKDFIMKGKV  158



>ref|XP_006291782.1| hypothetical protein CARUB_v10017962mg [Capsella rubella]
 gb|EOA24680.1| hypothetical protein CARUB_v10017962mg [Capsella rubella]
Length=234

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 111/153 (73%), Gaps = 10/153 (7%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL  G ++ N 
Sbjct  1    MGMAAESQ-FHVLAVDDSLFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLRQG-IESND  58

Query  342  PN--TNVP------KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  497
            PN  +  P      +VNLIITDY MPGM G++LLKKVK+S+  K++PVV+MSSEN+P+RI
Sbjct  59   PNALSTAPVNHQEVEVNLIITDYCMPGMTGFDLLKKVKESSALKNIPVVIMSSENVPARI  118

Query  498  NQCMEVGAKMFILKPLKQADVNELKSQLMHKRL  596
            ++C+E GA  F +KP++ AD+N+LK  +M  +L
Sbjct  119  SRCLEEGALEFFVKPVRLADLNKLKPHMMKTKL  151



>ref|XP_010475909.1| PREDICTED: two-component response regulator ARR4-like isoform 
X1 [Camelina sativa]
Length=272

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 103/134 (77%), Gaps = 3/134 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D    S   +  KV+
Sbjct  47   VHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DNDKASAQLDRLKVD  103

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM GYELLKK+K+S+ F++VPVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  104  LIITDYCMPGMTGYELLKKIKESSNFREVPVVIMSSENVLTRIDRCLEEGAQDFLLKPVK  163

Query  549  QADVNELKSQLMHK  590
             ADV  L+S L  K
Sbjct  164  LADVKRLRSHLATK  177



>gb|KFK34943.1| hypothetical protein AALP_AA5G214000 [Arabis alpina]
Length=242

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 109/149 (73%), Gaps = 5/149 (3%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAG---DVQ  332
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL      +  
Sbjct  1    MGMAAESQ-FHVLAVDDSSFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLRESIDPNAL  59

Query  333  HNSPNTNVP-KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  509
              SPN +   +VNLIITDY MPGM GY+LLKK+K+S+  K++PVV+MSSEN+P+RI++C+
Sbjct  60   STSPNNHQEVEVNLIITDYCMPGMTGYDLLKKIKESSALKNIPVVIMSSENVPARISRCL  119

Query  510  EVGAKMFILKPLKQADVNELKSQLMHKRL  596
            E GA+ F LKP++ AD+N+LK  +M  +L
Sbjct  120  EEGAEEFFLKPVRLADLNKLKPHMMKTKL  148



>emb|CDP09526.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 110/143 (77%), Gaps = 9/143 (6%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN-----TN  353
             HVLAVDD  I+  +IE+LLK+SS +VTT ++G +ALE+LGLL GD  H +PN     TN
Sbjct  10   FHVLAVDDSIIDRKLIERLLKTSSYRVTTVDSGSKALEFLGLL-GDEDHGNPNQPCICTN  68

Query  354  VPK---VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAK  524
              +   VNL+ITDY MPGM GY+LLK++K+S+  +++PVV+MSSEN+PSRI++C++ GA+
Sbjct  69   HSQEVAVNLVITDYCMPGMTGYDLLKRIKESSSLRNIPVVIMSSENVPSRISRCLQEGAE  128

Query  525  MFILKPLKQADVNELKSQLMHKR  593
             F LKP++ +D+N+LK+ +M  +
Sbjct  129  EFFLKPVRLSDLNKLKTHMMKSK  151



>ref|XP_002893028.1| hypothetical protein ARALYDRAFT_889335 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69287.1| hypothetical protein ARALYDRAFT_889335 [Arabidopsis lyrata subsp. 
lyrata]
Length=209

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 103/134 (77%), Gaps = 4/134 (3%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL  G     + N    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGLDGG---KGASNLKDLKVN  80

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GY+LLKK+K+S+ F++VPVV+MSSENI  RI +C++ GA+ F+LKP+K
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSAFREVPVVIMSSENILPRIEECLKEGAEEFLLKPVK  140

Query  549  QADVNELKSQLMHK  590
             ADV  +K QL+ K
Sbjct  141  LADVKRIK-QLILK  153



>gb|KFK43337.1| hypothetical protein AALP_AA1G111900 [Arabis alpina]
Length=246

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 103/131 (79%), Gaps = 3/131 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D +  S   +  KV+
Sbjct  31   VHVLAVDDSLVDRIVIERLLRVTSCKVTAVDSGWRALEFLGL---DNEKASAEFDRLKVD  87

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM GYELLKK+K+S+ F++VPVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  88   LIITDYCMPGMTGYELLKKIKESSNFREVPVVIMSSENVLTRIDRCLEEGAEDFLLKPVK  147

Query  549  QADVNELKSQL  581
             ADV  ++S L
Sbjct  148  LADVKRIRSHL  158



>ref|XP_002322145.2| hypothetical protein POPTR_0015s08130g [Populus trichocarpa]
 gb|EEF06272.2| hypothetical protein POPTR_0015s08130g [Populus trichocarpa]
Length=224

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 105/135 (78%), Gaps = 4/135 (3%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            E +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   N  K
Sbjct  27   EELHVLAVDDSFVDRKVIERLLKISSCKVTVVESGSRALQYLGL---DGEKSSVGFNDLK  83

Query  363  VNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILK  539
            +NLI+TDYSMPGM GYELLKK+K +S+ F+++PVV+MSSENI +RI++C+E GA+ +ILK
Sbjct  84   INLIMTDYSMPGMTGYELLKKIKQESSAFREIPVVIMSSENILARIDRCLEEGAEEYILK  143

Query  540  PLKQADVNELKSQLM  584
            P+K +DV  +K  +M
Sbjct  144  PVKLSDVKRIKDVIM  158



>ref|XP_006281027.1| hypothetical protein CARUB_v10027044mg [Capsella rubella]
 gb|EOA13925.1| hypothetical protein CARUB_v10027044mg [Capsella rubella]
Length=235

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = +3

Query  174  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  353
            G  +++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   DV+       
Sbjct  65   GSPDLLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DVEEKPLGFE  121

Query  354  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFI  533
              KVNLI+TDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI  RI++C+E GA+ F+
Sbjct  122  DLKVNLIMTDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILPRIDRCLEEGAEDFL  181

Query  534  LKPLKQADVNELKSQLM  584
            LKP+K +DV  L+  LM
Sbjct  182  LKPVKLSDVRRLRDSLM  198



>ref|XP_010554778.1| PREDICTED: two-component response regulator ARR9-like [Tarenaya 
hassleriana]
Length=233

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 108/153 (71%), Gaps = 8/153 (5%)
 Frame = +3

Query  156  MAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLL-AGDVQ  332
            M MG   E +  HVLAVDD   +  +IE+LL+ SS +VTT ++G +ALE+LGL   GD  
Sbjct  1    MVMGMAAESQ-FHVLAVDDSLFDRKLIERLLQKSSYQVTTVDSGTKALEFLGLREGGDNN  59

Query  333  HNSPNTNVPK------VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSR  494
                 ++ PK      VNLIITDY MPGM GY+LLKK+K+S+ FK+VPVV+MSSEN+PSR
Sbjct  60   DTKTPSSSPKNHQEVEVNLIITDYCMPGMTGYDLLKKIKESSAFKNVPVVIMSSENVPSR  119

Query  495  INQCMEVGAKMFILKPLKQADVNELKSQLMHKR  593
            I +C+E GA+ F LKP++ AD+N+LK  +M  +
Sbjct  120  ITRCLEEGAEEFFLKPVRLADLNKLKPHMMKAK  152



>ref|XP_004238726.2| PREDICTED: two-component response regulator ARR5 [Solanum lycopersicum]
Length=251

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 109/134 (81%), Gaps = 4/134 (3%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++ I+IE+LLK++SCKVTT ++G+RAL+YLGL   D + +S + +  KV+
Sbjct  32   VHVLAVDDSLVDRIVIERLLKNTSCKVTTVDSGMRALKYLGL---DEEESSVSIDGLKVD  88

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM GY+LLKK+K S+ F++VPVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  89   LIITDYCMPGMTGYDLLKKIKGSS-FREVPVVIMSSENVLARIDRCLEEGAEDFLLKPVK  147

Query  549  QADVNELKSQLMHK  590
             ADV  LKS + ++
Sbjct  148  LADVKRLKSYMFNE  161



>ref|XP_003541594.1| PREDICTED: two-component response regulator ARR8-like [Glycine 
max]
Length=179

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 110/153 (72%), Gaps = 12/153 (8%)
 Frame = +3

Query  156  MAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQH  335
            MAM    +    HVLAVDD  I+ ++IE+LLK+SS  VTT ++  +AL++LGL+  +++ 
Sbjct  1    MAMTVEAQ---FHVLAVDDSIIDRMLIERLLKTSSFHVTTLDSATKALKFLGLVEDELR-  56

Query  336  NSPNTNVPK-------VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSR  494
             + +T V         VNLIITDY MPG+ GY+LL+K+K+S   K++PVV+MSSEN+PSR
Sbjct  57   -TFDTTVASEIHQDVDVNLIITDYCMPGLTGYDLLRKIKESKSLKNIPVVIMSSENVPSR  115

Query  495  INQCMEVGAKMFILKPLKQADVNELKSQLMHKR  593
            IN+C+E GA+ F LKP++QADVN+LK  LM  R
Sbjct  116  INRCLEEGAEEFFLKPVQQADVNKLKPHLMKSR  148



>gb|AFK41993.1| unknown [Lotus japonicus]
Length=209

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 104/133 (78%), Gaps = 4/133 (3%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP-NTNVPKV  365
            +HVLAVDD  ++  +IE+LLK SSCKVT  ++G RAL+YLGL   D + NS    +  KV
Sbjct  20   LHVLAVDDSLVDRKVIERLLKISSCKVTVVDSGTRALQYLGL---DGEENSSIGFDGVKV  76

Query  366  NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPL  545
            NLI+TDYSMPGM GYELLKK+K+S+ F+++PVVVMSSENI +RI++C+E GA+ F+LKP+
Sbjct  77   NLIMTDYSMPGMTGYELLKKIKESSAFREIPVVVMSSENILTRIDRCLEEGAEDFLLKPV  136

Query  546  KQADVNELKSQLM  584
            K +DV  L+  +M
Sbjct  137  KLSDVRRLRDFIM  149



>ref|XP_006439725.1| hypothetical protein CICLE_v10022334mg [Citrus clementina]
 gb|ESR52965.1| hypothetical protein CICLE_v10022334mg [Citrus clementina]
Length=199

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 104/133 (78%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LL+ SSCKVT  E+G RAL+YLGL   D + ++   +  KVN
Sbjct  11   LHVLAVDDSYVDRKLIERLLQISSCKVTAVESGTRALQYLGL---DGEQSNVGFDALKVN  67

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY+MPGM GYELLKK+K+S++F++VPVV+MSSE++ ++I+ C+E GA+ +I+KP+K
Sbjct  68   LIITDYTMPGMTGYELLKKIKESSVFREVPVVIMSSEDVLTQIDSCLEEGAEEYIVKPVK  127

Query  549  QADVNELKSQLMH  587
             +DV  LK  +M 
Sbjct  128  LSDVKRLKDHIMR  140



>ref|XP_006854776.1| hypothetical protein AMTR_s00063p00116400 [Amborella trichopoda]
 gb|ERN16243.1| hypothetical protein AMTR_s00063p00116400 [Amborella trichopoda]
Length=196

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 107/147 (73%), Gaps = 6/147 (4%)
 Frame = +3

Query  156  MAMGENGEDEV-IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQ  332
            MA  E    E   HVLAVDD  I+  +IEKLLK+SS +VTT ++G +ALEYLGL   D Q
Sbjct  1    MARPETQFQETQFHVLAVDDSLIDRKLIEKLLKTSSYQVTTVDSGSKALEYLGL--QDNQ  58

Query  333  HNS---PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  503
             +    PN N  +VNLIITDY MPGM GY+LLKK+K+S+  K++PVV+MSSEN+PSRI +
Sbjct  59   QDPALCPNQNEVEVNLIITDYCMPGMTGYDLLKKIKESSYLKNIPVVIMSSENVPSRITR  118

Query  504  CMEVGAKMFILKPLKQADVNELKSQLM  584
            C+E GA+ F LKP++ +D+ +LK  LM
Sbjct  119  CLEEGAEEFFLKPVQLSDMIKLKPHLM  145



>ref|XP_006417463.1| hypothetical protein EUTSA_v10008575mg [Eutrema salsugineum]
 gb|ESQ35816.1| hypothetical protein EUTSA_v10008575mg [Eutrema salsugineum]
Length=250

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 103/131 (79%), Gaps = 3/131 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D +  S   +  KV+
Sbjct  30   VHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DNEKASAEFDRLKVD  86

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM GYELLKK+K+S+ F++VPVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  87   LIITDYCMPGMTGYELLKKIKESSSFREVPVVIMSSENVLTRIDRCLEEGAEDFLLKPVK  146

Query  549  QADVNELKSQL  581
             ADV  L++ L
Sbjct  147  LADVKRLRNYL  157



>emb|CBI15098.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 102/132 (77%), Gaps = 3/132 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL++LGL   D + NS   +  KVN
Sbjct  103  LHVLAVDDSHVDRKVIERLLKISSCKVTAVESGTRALQFLGL---DGEENSVGFDGLKVN  159

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPGM GYELLKK+K+S  F+ +PVV+MSSENI +RI++C+E GA+ FI+KP+K
Sbjct  160  LIMTDYSMPGMTGYELLKKIKESKAFRKIPVVIMSSENILTRIDRCLEEGAEEFIVKPVK  219

Query  549  QADVNELKSQLM  584
             ADV  L+  +M
Sbjct  220  LADVRRLRDFIM  231



>ref|XP_009151412.1| PREDICTED: two-component response regulator ARR6 [Brassica rapa]
 emb|CDY00336.1| BnaA06g22370D [Brassica napus]
 emb|CDX84366.1| BnaC03g51340D [Brassica napus]
Length=190

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            +++HVLAVDD  ++   IE+LLK SSCKVT  ++  RAL+YLGL   DV          K
Sbjct  23   DLLHVLAVDDSHVDRKFIERLLKVSSCKVTVVDSATRALQYLGL---DVNEKPIGCKDLK  79

Query  363  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
            VNLI+TDYSMPGM GYELLKK+K+S+ F+DVPVVVMSSENI  RI++C+E GA+ F+LKP
Sbjct  80   VNLIMTDYSMPGMTGYELLKKIKESSAFRDVPVVVMSSENILPRIDRCLEEGAEDFLLKP  139

Query  543  LKQADVNELKSQLM  584
            +K +DV  ++  L+
Sbjct  140  VKLSDVRRIRDSLI  153



>ref|XP_003527040.1| PREDICTED: two-component response regulator ARR6-like [Glycine 
max]
Length=204

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   +   VN
Sbjct  21   LHVLAVDDSHVDRKVIERLLKISSCKVTVVESGSRALQYLGL---DGEKSSIGFDSVDVN  77

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPGM GYELLKK+K+S++F++VPVVVMSSENI +RI+ C+E GA+ F+LKP+K
Sbjct  78   LIMTDYSMPGMTGYELLKKIKESSVFREVPVVVMSSENILTRIDSCLEEGAEEFLLKPVK  137

Query  549  QADVNELKSQLMH  587
             +DV  +   +M 
Sbjct  138  LSDVKRVTDFIMR  150



>ref|XP_006407515.1| hypothetical protein EUTSA_v10021491mg [Eutrema salsugineum]
 gb|ESQ48968.1| hypothetical protein EUTSA_v10021491mg [Eutrema salsugineum]
Length=218

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LLK S+CKVTT E+G RAL+YLGL   D    + +    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLKISACKVTTVESGTRALQYLGL---DGDKGASDLKDLKVN  80

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GY+LLKK+K+S+ F+++PVV+MSSENI  RI QC++ GA+ F+LKP+K
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSAFREIPVVIMSSENILPRIEQCIKEGAEEFLLKPVK  140

Query  549  QADVNELKSQLMH  587
             ADV  +K  +M 
Sbjct  141  LADVKRIKQLIMR  153



>ref|XP_010276614.1| PREDICTED: two-component response regulator ARR9-like isoform 
X1 [Nelumbo nucifera]
Length=208

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG   E +  HVLAVDD  I+  +IE+LLK+SS +VTT ++G +ALE+LGL   D    +
Sbjct  1    MGMAAEAQ-FHVLAVDDSLIDRKLIERLLKTSSYQVTTVDSGSKALEFLGLREDDQTDPN  59

Query  342  P-----NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  506
            P     N +  +VNLIITDY MPGM GY+LLKK+K+S+  KD+PVV+MSSEN+PSRI++C
Sbjct  60   PPSVSSNHHEMEVNLIITDYCMPGMTGYDLLKKIKESSSLKDIPVVIMSSENVPSRISRC  119

Query  507  MEVGAKMFILKPLKQADVNELKSQLMHKRL  596
            +E GA+ F LKP++ +DVN L+  L+  +L
Sbjct  120  LEEGAEEFFLKPVQLSDVNRLRPHLLKGKL  149



>gb|EMS50922.1| Two-component response regulator ARR8 [Triticum urartu]
Length=230

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 104/139 (75%), Gaps = 4/139 (3%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNV----  356
             HVLAVDD  ++  +IE+LLK+SS +VTT ++G +ALE+LGL   D   +S + +     
Sbjct  10   FHVLAVDDSVLDRKLIERLLKTSSFQVTTVDSGTKALEFLGLHGEDASISSVHADQLDVE  69

Query  357  PKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFIL  536
              VNLIITDY MPGM GY+LLKK+K+S+ F+D+PVV+MSSENIPSRIN+C+E GA  F L
Sbjct  70   VNVNLIITDYCMPGMTGYDLLKKIKESSSFRDIPVVIMSSENIPSRINRCLEEGANEFFL  129

Query  537  KPLKQADVNELKSQLMHKR  593
            KP++ +D+++LK  +M  R
Sbjct  130  KPVRLSDMSKLKPHIMKSR  148



>ref|XP_009118251.1| PREDICTED: two-component response regulator ARR4-like [Brassica 
rapa]
 ref|XP_009123061.1| PREDICTED: two-component response regulator ARR4-like [Brassica 
rapa]
Length=261

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 102/131 (78%), Gaps = 3/131 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D +  S   +  KV+
Sbjct  33   VHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DNEKASAELDRLKVD  89

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM GYELLKK+K+S+ F+ VPVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  90   LIITDYCMPGMTGYELLKKIKESSSFRQVPVVIMSSENVLTRIDRCLEEGAEDFLLKPVK  149

Query  549  QADVNELKSQL  581
             ADV  L+S L
Sbjct  150  LADVKRLRSYL  160



>gb|KFK36982.1| hypothetical protein AALP_AA4G197100 [Arabis alpina]
Length=231

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 104/145 (72%), Gaps = 9/145 (6%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD--------VQHNSP  344
             HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL   +            SP
Sbjct  9    FHVLAVDDSLFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRESNENNVDDPNATSTSP  68

Query  345  NTNVP-KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGA  521
             T+   ++NLIITDY MPGM GY+LLKKVK+SA F+ +PVV+MSSEN+P+RI++C+E GA
Sbjct  69   QTHQEVEINLIITDYCMPGMTGYDLLKKVKESAAFRSIPVVIMSSENVPARISRCLEEGA  128

Query  522  KMFILKPLKQADVNELKSQLMHKRL  596
            + F LKP+K AD+ +LK  +M  +L
Sbjct  129  EEFFLKPVKLADLTKLKPHMMKTKL  153



>ref|XP_010491281.1| PREDICTED: two-component response regulator ARR4-like [Camelina 
sativa]
Length=254

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 103/134 (77%), Gaps = 3/134 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D    S   +  KV+
Sbjct  35   VHVLAVDDSLVDRIVIERLLRINSCKVTAVDSGWRALEFLGL---DNDKASAQLDRLKVD  91

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM GYELLKK+K+S+ F++VPVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  92   LIITDYCMPGMTGYELLKKIKESSNFREVPVVIMSSENVLTRIDRCLEEGAQDFLLKPVK  151

Query  549  QADVNELKSQLMHK  590
             ADV  L+S L  K
Sbjct  152  LADVKRLRSHLATK  165



>emb|CDY45155.1| BnaA09g14370D [Brassica napus]
Length=228

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D   +S   +  KV+
Sbjct  33   VHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DDDKSSVEFDRLKVD  89

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM GYELLKK+K+S  F++VPVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  90   LIITDYCMPGMTGYELLKKIKESTSFREVPVVIMSSENVLTRIDRCLEEGAEDFLLKPVK  149

Query  549  QADVNELKSQLMH  587
             ADV  L++ L  
Sbjct  150  LADVKRLRTYLTR  162



>ref|XP_010670481.1| PREDICTED: two-component response regulator ARR9-like [Beta vulgaris 
subsp. vulgaris]
Length=159

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 102/141 (72%), Gaps = 3/141 (2%)
 Frame = +3

Query  180  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP---NT  350
            D   HVLAVDD  I+  +IE+LL +SS +VT  ++G +ALE LGL A +     P   N 
Sbjct  4    DTQFHVLAVDDSLIDRKLIERLLTTSSFQVTAVDSGTKALELLGLQANESSDYHPHDDNH  63

Query  351  NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMF  530
            +  +VN+IITDY MPGM GY+LL+K+K+S   KD+PVV+MSSENIP+RIN+C+E GA  F
Sbjct  64   HDSEVNMIITDYCMPGMTGYDLLRKIKESENLKDIPVVIMSSENIPARINRCLEEGADEF  123

Query  531  ILKPLKQADVNELKSQLMHKR  593
            +LKP++ +DV++LK  LM  R
Sbjct  124  LLKPVRLSDVDKLKPHLMRSR  144



>ref|XP_006351272.1| PREDICTED: two-component response regulator ARR9-like [Solanum 
tuberosum]
Length=226

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 103/138 (75%), Gaps = 6/138 (4%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP------NT  350
             HVLAVDD  I+  +IE+LLK+S+C+VTT ++G +ALE+LGL   D    +       N 
Sbjct  10   FHVLAVDDSVIDRKLIERLLKTSACQVTTVDSGSKALEFLGLQENDKNQTNQTCVSLDNH  69

Query  351  NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMF  530
               ++NLIITDY MPGM GY+LLKK+K+SA  +++PVV+MSSEN+PSRI++C+E GA+ F
Sbjct  70   QEAEINLIITDYCMPGMTGYDLLKKLKESASLRNIPVVIMSSENVPSRISRCLEEGAEEF  129

Query  531  ILKPLKQADVNELKSQLM  584
             LKP++ +DVN+L+  +M
Sbjct  130  FLKPVRLSDVNKLRPHMM  147



>ref|XP_009150827.1| PREDICTED: two-component response regulator ARR5 [Brassica rapa]
Length=241

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = +3

Query  183  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  362
            E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D  ++S      K
Sbjct  81   ELLHVLAVDDSIVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DGDNSSVGFQDLK  137

Query  363  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKP  542
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI  RI++C+E GA+ F+LKP
Sbjct  138  INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILPRIDRCLEEGAEDFLLKP  197

Query  543  LKQADVNELKSQLM  584
            +K ADV  L+  LM
Sbjct  198  VKLADVKRLRDSLM  211



>emb|CDY30913.1| BnaC09g14930D [Brassica napus]
Length=238

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D   +S   +  KV+
Sbjct  33   VHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DDDKSSVEFDRLKVD  89

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM GYELLKK+K+S  F++VPVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  90   LIITDYCMPGMTGYELLKKIKESTSFREVPVVIMSSENVLTRIDRCLEEGAEDFLLKPVK  149

Query  549  QADVNELKSQLMH  587
             ADV  L++ L  
Sbjct  150  LADVKRLRTYLTR  162



>emb|CBI40158.3| unnamed protein product [Vitis vinifera]
Length=140

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 103/144 (72%), Gaps = 9/144 (6%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG   E +  HVLAVDD  ++   IEKLLK+SS +VT  ++  +ALE+LGL   + +   
Sbjct  1    MGMAAESQ-FHVLAVDDSLVDRKWIEKLLKTSSFQVTVVDSVSKALEFLGLQEAEQER--  57

Query  342  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGA  521
                  KVNLIITDYSMPGM GY+LL+K+K+S   KD+PVV+MSSENIPSRIN+C+E GA
Sbjct  58   ------KVNLIITDYSMPGMTGYDLLRKIKESTSLKDIPVVIMSSENIPSRINRCLEEGA  111

Query  522  KMFILKPLKQADVNELKSQLMHKR  593
            + F LKP++ +DVN+L+  L+  R
Sbjct  112  EDFFLKPVQLSDVNKLRPHLLGWR  135



>ref|XP_010272107.1| PREDICTED: two-component response regulator ARR5-like [Nelumbo 
nucifera]
Length=230

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 107/149 (72%), Gaps = 9/149 (6%)
 Frame = +3

Query  144  PSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAG  323
            PS SM      E E +HVLAVDD  ++  +IE+LLK SSCKVT  ++G RAL++LGL   
Sbjct  31   PSPSMV-----ESEGLHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQFLGLDG-  84

Query  324  DVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  503
                NS   +  KVN++ITDY MPGM GYELLKK+K+S+ F++VPVV+MSSEN+ +RI++
Sbjct  85   ---ENSVGLDGLKVNMVITDYCMPGMTGYELLKKIKESSTFREVPVVIMSSENVLARIDR  141

Query  504  CMEVGAKMFILKPLKQADVNELKSQLMHK  590
            C+E GA+ FI+KP+K +DV  LK  L  +
Sbjct  142  CLEEGAEEFIVKPVKLSDVKRLKHNLTRE  170



>ref|XP_006476689.1| PREDICTED: two-component response regulator ARR15-like [Citrus 
sinensis]
Length=199

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 104/133 (78%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LL+ SSCKVT  E+G RAL+YLGL   D + ++   +  KVN
Sbjct  11   LHVLAVDDSYVDRKLIERLLQISSCKVTAVESGTRALQYLGL---DGEQSNVGFDALKVN  67

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY+MPGM GYELLKK+K+S++F++VPVV+MSSE++ ++I+ C+E GA+ +I+KP+K
Sbjct  68   LIITDYTMPGMTGYELLKKIKESSVFREVPVVIMSSEDVLTQIDSCLEEGAEEYIVKPVK  127

Query  549  QADVNELKSQLMH  587
             +DV  LK  +M 
Sbjct  128  LSDVKRLKDHIMR  140



>emb|CDY07801.1| BnaC03g48210D [Brassica napus]
Length=265

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D +  S   +  KV+
Sbjct  33   VHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DNEKASAELDRLKVD  89

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LIITDY MPGM GYELLKK+K+S+ F+ VPVV+MSSEN+ +RI++C+E GA+ F+LKP+K
Sbjct  90   LIITDYCMPGMTGYELLKKIKESSSFRQVPVVIMSSENVLTRIDRCLEEGAEDFLLKPVK  149

Query  549  QADVNELKSQLMH  587
             ADV  L+S L  
Sbjct  150  LADVKRLRSYLTR  162



>dbj|BAJ88185.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=287

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 111/153 (73%), Gaps = 5/153 (3%)
 Frame = +3

Query  147  SSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD  326
            SS MA+    E    HVLAVDD  ++  +IE+LLK+SS +VTT ++G +AL++LGL A D
Sbjct  41   SSPMAVAAIAE-APFHVLAVDDSVLDRKLIERLLKTSSFQVTTVDSGTKALQFLGLHAED  99

Query  327  VQHNSPNTNV----PKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSR  494
               +S + +       VNLIITDY MPGM GY+LLKK+K+S+ F+D+PVV+MSSENIPSR
Sbjct  100  ASISSVHADQLDVEVNVNLIITDYCMPGMTGYDLLKKIKESSSFRDIPVVIMSSENIPSR  159

Query  495  INQCMEVGAKMFILKPLKQADVNELKSQLMHKR  593
            IN+C+E GA  F LKP++ +D+++LK  +M  R
Sbjct  160  INRCLEEGANEFFLKPVRLSDMSKLKPHIMKSR  192



>gb|AAK14395.1|AF339732_1 response regulator protein [Dianthus caryophyllus]
Length=264

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = +3

Query  192  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  371
            HVLAVDD  I+  +IE+LLK++SCKVT  ++G+RALE+LGL   D +  +   +  K++L
Sbjct  36   HVLAVDDSLIDRKVIERLLKTTSCKVTVVDSGMRALEFLGL---DAEQRTSVVDGLKIDL  92

Query  372  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLKQ  551
            IITDY MPGM GYELLKK+K+S+ FK+ PVV+MSSEN+ +RI++C+E GA+ FILKP+K 
Sbjct  93   IITDYCMPGMTGYELLKKIKESSTFKETPVVIMSSENVIARIDRCLEEGAEDFILKPVKL  152

Query  552  ADVNELKSQLMHK  590
            +DV  L+  + +K
Sbjct  153  SDVKRLRDYMTNK  165



>ref|XP_009776026.1| PREDICTED: two-component response regulator ARR9-like isoform 
X3 [Nicotiana sylvestris]
Length=227

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 107/149 (72%), Gaps = 7/149 (5%)
 Frame = +3

Query  162  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  341
            MG    D   HVLAVDD  I+  +IE+L + SSC+VTT ++G +ALE+LGL   ++  N 
Sbjct  1    MGMAAADLQFHVLAVDDCLIDRKLIERLFRISSCQVTTVDSGSKALEFLGL--QELDQNQ  58

Query  342  P-----NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  506
            P     N    +VNLIITDY MPGM GY+LLKK+K+S+  +++PVV+MSSEN+PSRI++C
Sbjct  59   PCVSPSNQQEVEVNLIITDYCMPGMTGYDLLKKIKESSSLRNIPVVIMSSENVPSRISRC  118

Query  507  MEVGAKMFILKPLKQADVNELKSQLMHKR  593
            +E GA+ F LKP++ +DVN+L+  +M  +
Sbjct  119  LEEGAEEFFLKPVRLSDVNKLRPHMMKTK  147



>emb|CDX68161.1| BnaA07g22010D [Brassica napus]
Length=197

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 97/127 (76%), Gaps = 3/127 (2%)
 Frame = +3

Query  189  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  368
            +HVLAVDD  ++  +IE+LL+ S+CKVTT E+G RAL+YLGL   D      +    KVN
Sbjct  16   LHVLAVDDSFVDRKVIERLLRISACKVTTVESGTRALQYLGLDGDDAPSALKDL---KVN  72

Query  369  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCMEVGAKMFILKPLK  548
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI+QCM  GA+ F+LKP+K
Sbjct  73   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIDQCMTEGAEDFLLKPVK  132

Query  549  QADVNEL  569
             ADV  L
Sbjct  133  LADVKRL  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1578431504286