BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19564_g2_i1 len=151 path=[729:0-110 1418:111-150]

Length=151
                                                                      Score     E

ref|XP_004165819.1|  PREDICTED: polygalacturonase At1g48100-like      55.5    4e-08   
gb|AAF17670.1|AC009398_19  F20B24.8                                   57.4    7e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAK63956.1|  At1g10640/F20B24_8                                    57.0    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563875.6|  pectin lyase-like protein                           57.4    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009774333.1|  PREDICTED: polygalacturonase At1g48100-like      56.6    1e-07   
ref|XP_009629756.1|  PREDICTED: polygalacturonase At1g48100-like      56.6    1e-07   
ref|XP_010248147.1|  PREDICTED: polygalacturonase At1g48100-like      54.3    1e-07   
ref|XP_002892586.1|  hypothetical protein ARALYDRAFT_471186           55.5    2e-07   
ref|XP_006356424.1|  PREDICTED: polygalacturonase At1g48100-like      55.5    3e-07   
ref|XP_004238649.1|  PREDICTED: polygalacturonase At1g48100-like      55.5    3e-07   
ref|XP_008446197.1|  PREDICTED: polygalacturonase At1g48100-like      55.5    3e-07   
ref|XP_004135250.1|  PREDICTED: polygalacturonase At1g48100-like      55.5    3e-07   
emb|CDP13178.1|  unnamed protein product                              55.1    4e-07   
emb|CAN65317.1|  hypothetical protein VITISV_006410                   54.7    4e-07   Vitis vinifera
ref|XP_002266600.1|  PREDICTED: polygalacturonase At1g48100           55.1    4e-07   Vitis vinifera
gb|ABD62086.1|  polygalacturonase precursor                           51.2    7e-07   Glycine max [soybeans]
ref|XP_010251222.1|  PREDICTED: polygalacturonase At1g48100           54.3    8e-07   
emb|CDY34877.1|  BnaA09g48030D                                        53.5    1e-06   
ref|XP_009118238.1|  PREDICTED: polygalacturonase At1g48100-like      53.1    2e-06   
emb|CDY54228.1|  BnaC08g49850D                                        53.1    2e-06   
gb|KDP26605.1|  hypothetical protein JCGZ_17763                       53.1    2e-06   
gb|EYU22502.1|  hypothetical protein MIMGU_mgv1a0051062mg             51.2    2e-06   
ref|XP_010547772.1|  PREDICTED: polygalacturonase At1g48100           52.8    2e-06   
gb|KFK43344.1|  hypothetical protein AALP_AA1G112800                  52.4    3e-06   
emb|CDY20612.1|  BnaC08g14460D                                        52.4    3e-06   
emb|CDY20962.1|  BnaA08g25630D                                        52.4    4e-06   
gb|ABK95839.1|  unknown                                               48.9    4e-06   Populus trichocarpa [western balsam poplar]
emb|CDY37962.1|  BnaC05g08120D                                        52.4    4e-06   
ref|XP_009148407.1|  PREDICTED: polygalacturonase At1g48100           52.4    4e-06   
ref|XP_010533949.1|  PREDICTED: polygalacturonase At1g48100-like      52.0    4e-06   
ref|XP_006602385.1|  PREDICTED: polygalacturonase At1g48100-like ...  52.0    4e-06   
ref|XP_003552026.1|  PREDICTED: polygalacturonase At1g48100-like ...  52.0    5e-06   
gb|KHN26888.1|  Polygalacturonase                                     52.0    5e-06   
gb|EPS67779.1|  polygalacturonase                                     52.0    5e-06   
ref|XP_003531999.2|  PREDICTED: polygalacturonase At1g48100 isofo...  52.0    6e-06   
ref|XP_006417442.1|  hypothetical protein EUTSA_v10007255mg           51.6    7e-06   
ref|XP_011086585.1|  PREDICTED: polygalacturonase At1g48100           51.2    9e-06   
ref|XP_010248489.1|  PREDICTED: polygalacturonase At1g48100           51.2    1e-05   
gb|AES96173.2|  polygalacturonase                                     51.2    1e-05   
ref|XP_006840721.1|  hypothetical protein AMTR_s00096p00105250        50.1    1e-05   
ref|XP_003613215.1|  Polygalacturonase                                51.2    1e-05   
ref|XP_004489829.1|  PREDICTED: polygalacturonase At1g48100-like      50.8    1e-05   
gb|AAK50769.1|AF361321_1  polygalacturonase                           50.4    1e-05   Pisum sativum [garden pea]
ref|XP_002525361.1|  polygalacturonase, putative                      50.8    1e-05   Ricinus communis
ref|XP_010100443.1|  Polygalacturonase                                50.8    1e-05   
ref|XP_006350314.1|  PREDICTED: polygalacturonase At1g48100-like      50.4    1e-05   
gb|KHG15884.1|  hypothetical protein F383_10630                       50.8    1e-05   
gb|KHG05280.1|  hypothetical protein F383_31181                       50.4    2e-05   
ref|XP_009144427.1|  PREDICTED: polygalacturonase At1g48100-like      50.4    2e-05   
ref|XP_011013806.1|  PREDICTED: polygalacturonase At1g48100-like      50.4    2e-05   
ref|XP_006392146.1|  hypothetical protein EUTSA_v10023404mg           50.4    2e-05   
ref|XP_008340054.1|  PREDICTED: polygalacturonase At1g48100-like      50.4    2e-05   
ref|XP_007227459.1|  hypothetical protein PRUPE_ppa004002mg           50.1    2e-05   
ref|XP_009394799.1|  PREDICTED: polygalacturonase At1g48100-like      50.1    2e-05   
ref|XP_007044684.1|  Pectin lyase-like superfamily protein            50.1    2e-05   
ref|XP_008221838.1|  PREDICTED: polygalacturonase At1g48100           50.1    2e-05   
dbj|BAJ96167.1|  predicted protein                                    49.7    3e-05   
ref|XP_004297473.1|  PREDICTED: polygalacturonase At1g48100-like      49.7    3e-05   
gb|EMT04942.1|  Polygalacturonase                                     49.7    3e-05   
gb|EYU28445.1|  hypothetical protein MIMGU_mgv1a004469mg              49.7    3e-05   
ref|XP_006307174.1|  hypothetical protein CARUB_v10008765mg           49.7    3e-05   
ref|XP_007153746.1|  hypothetical protein PHAVU_003G061600g           49.7    3e-05   
ref|XP_002311773.1|  hypothetical protein POPTR_0008s19350g           49.3    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_008800720.1|  PREDICTED: polygalacturonase At1g48100-like      49.3    4e-05   
ref|XP_010491600.1|  PREDICTED: polygalacturonase At1g48100-like      49.3    5e-05   
ref|XP_010458422.1|  PREDICTED: polygalacturonase At1g48100-like      48.9    5e-05   
ref|XP_010475939.1|  PREDICTED: polygalacturonase At1g48100-like      48.9    5e-05   
ref|XP_010924275.1|  PREDICTED: polygalacturonase At1g48100-like ...  48.5    5e-05   
ref|XP_010924274.1|  PREDICTED: polygalacturonase At1g48100-like ...  48.5    6e-05   
ref|NP_001056414.1|  Os05g0578600                                     48.1    6e-05   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG98413.1|  unnamed protein product                              47.8    6e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010925884.1|  PREDICTED: polygalacturonase At1g48100-like      48.5    8e-05   
ref|XP_002314612.2|  hypothetical protein POPTR_0010s05180g           48.5    8e-05   Populus trichocarpa [western balsam poplar]
gb|KEH20046.1|  polygalacturonase plant-like protein                  48.5    8e-05   
gb|ABK95830.1|  unknown                                               48.5    8e-05   Populus trichocarpa [western balsam poplar]
gb|AAT39158.1|  putative polygalacturonase                            48.1    9e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEE64806.1|  hypothetical protein OsJ_19662                        48.1    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79746.1|  hypothetical protein OsI_21117                        48.1    1e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_011034123.1|  PREDICTED: polygalacturonase At1g48100 isofo...  48.1    1e-04   
ref|XP_011034122.1|  PREDICTED: polygalacturonase At1g48100 isofo...  48.1    1e-04   
ref|XP_011071095.1|  PREDICTED: polygalacturonase At1g48100           47.8    1e-04   
ref|XP_008812598.1|  PREDICTED: polygalacturonase At1g48100-like      47.4    2e-04   
ref|XP_004509758.1|  PREDICTED: polygalacturonase At1g48100-like      47.4    2e-04   
ref|XP_002886607.1|  hypothetical protein ARALYDRAFT_893483           47.4    2e-04   
ref|NP_564758.2|  pectin lyase-like protein                           47.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAL31197.1|  At1g60590/F8A5_12                                     47.0    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008389668.1|  PREDICTED: polygalacturonase At1g48100           47.0    2e-04   
gb|ABV25004.1|  polygalacturonase 7                                   47.0    2e-04   
gb|ABV25001.1|  polygalacturonase 4                                   46.6    3e-04   
ref|XP_010510936.1|  PREDICTED: polygalacturonase At1g48100-like      46.2    4e-04   
gb|KFK40772.1|  hypothetical protein AALP_AA2G039100                  46.2    5e-04   
gb|ABV25002.1|  polygalacturonase 5                                   46.2    5e-04   
gb|ABV24998.1|  polygalacturonase 1                                   46.2    5e-04   
ref|XP_010417992.1|  PREDICTED: polygalacturonase At1g48100-like      46.2    5e-04   
gb|ABV25003.1|  polygalacturonase 6                                   45.8    5e-04   
gb|ABV24999.1|  polygalacturonase 2                                   45.8    6e-04   
ref|XP_009113198.1|  PREDICTED: polygalacturonase At1g48100           45.8    7e-04   
emb|CDY50367.1|  BnaA09g13160D                                        45.8    7e-04   
ref|XP_006302097.1|  hypothetical protein CARUB_v10020088mg           45.8    7e-04   
emb|CDY47212.1|  BnaC09g14610D                                        45.4    8e-04   



>ref|XP_004165819.1| PREDICTED: polygalacturonase At1g48100-like, partial [Cucumis 
sativus]
Length=195

 Score = 55.5 bits (132),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVPP+DCL++GK  SN++Q D+D C
Sbjct  162  QTFGELRTPTVPPIDCLQIGKPSSNQIQYDFDSC  195



>gb|AAF17670.1|AC009398_19 F20B24.8 [Arabidopsis thaliana]
Length=542

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT+PP+DCLK+GK P NKVQ D+D C
Sbjct  509  QTFGELNTPTLPPIDCLKIGKPPRNKVQSDHDVC  542



>gb|AAK63956.1| At1g10640/F20B24_8 [Arabidopsis thaliana]
 gb|AAN28898.1| At1g10640/F20B24_8 [Arabidopsis thaliana]
Length=380

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT+PP+DCLK+GK P NKVQ D+D C
Sbjct  347  QTFGELNTPTLPPIDCLKIGKPPRNKVQSDHDVC  380



>ref|NP_563875.6| pectin lyase-like protein [Arabidopsis thaliana]
 gb|AEE28612.1| pectin lyase-like protein [Arabidopsis thaliana]
Length=532

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT+PP+DCLK+GK P NKVQ D+D C
Sbjct  499  QTFGELNTPTLPPIDCLKIGKPPRNKVQSDHDVC  532



>ref|XP_009774333.1| PREDICTED: polygalacturonase At1g48100-like [Nicotiana sylvestris]
Length=505

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT+PP+DCL+VGK  SN++Q D+DQC
Sbjct  472  QTFGELYTPTLPPIDCLQVGKPSSNRIQGDHDQC  505



>ref|XP_009629756.1| PREDICTED: polygalacturonase At1g48100-like [Nicotiana tomentosiformis]
Length=509

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT+PP+DCL+VGK  SN++Q D+DQC
Sbjct  476  QTFGELYTPTLPPIDCLQVGKPSSNRIQGDHDQC  509



>ref|XP_010248147.1| PREDICTED: polygalacturonase At1g48100-like, partial [Nelumbo 
nucifera]
Length=200

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVP +DCL++GK  SN++Q DYD C
Sbjct  167  QTFGELSTPTVPQIDCLQIGKPSSNRIQSDYDSC  200



>ref|XP_002892586.1| hypothetical protein ARALYDRAFT_471186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68845.1| hypothetical protein ARALYDRAFT_471186 [Arabidopsis lyrata subsp. 
lyrata]
Length=381

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT+PP+DCL++GK P NKVQ D+D C
Sbjct  348  QTFGELNTPTLPPIDCLQIGKPPRNKVQSDHDVC  381



>ref|XP_006356424.1| PREDICTED: polygalacturonase At1g48100-like [Solanum tuberosum]
Length=511

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT PP++CL+VGK  SNK+Q D+DQC
Sbjct  478  QTFGELYTPTQPPIECLQVGKPTSNKIQADHDQC  511



>ref|XP_004238649.1| PREDICTED: polygalacturonase At1g48100-like [Solanum lycopersicum]
Length=508

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT PP++CL+VGK  SNK+Q D+DQC
Sbjct  475  QTFGELYTPTQPPIECLQVGKPTSNKIQADHDQC  508



>ref|XP_008446197.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis melo]
 gb|ADN33828.1| polygalacturonase [Cucumis melo subsp. melo]
Length=530

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVPP+DCL++GK  SN++Q D+D C
Sbjct  497  QTFGELRTPTVPPIDCLQIGKPSSNQIQYDFDSC  530



>ref|XP_004135250.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis sativus]
 gb|KGN51797.1| hypothetical protein Csa_5G601470 [Cucumis sativus]
Length=530

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVPP+DCL++GK  SN++Q D+D C
Sbjct  497  QTFGELRTPTVPPIDCLQIGKPSSNQIQYDFDSC  530



>emb|CDP13178.1| unnamed protein product [Coffea canephora]
Length=531

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL+SPT PP++CL++GK P N++Q D+D C
Sbjct  498  QTFGELYSPTEPPIECLQIGKPPGNRIQADHDSC  531



>emb|CAN65317.1| hypothetical protein VITISV_006410 [Vitis vinifera]
Length=388

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVPP+DCL++GK  SN++Q D+D C
Sbjct  355  QTFGELTTPTVPPIDCLQIGKPSSNRIQSDHDSC  388



>ref|XP_002266600.1| PREDICTED: polygalacturonase At1g48100 [Vitis vinifera]
 emb|CBI28553.3| unnamed protein product [Vitis vinifera]
Length=505

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVPP+DCL++GK  SN++Q D+D C
Sbjct  472  QTFGELTTPTVPPIDCLQIGKPSSNRIQSDHDSC  505



>gb|ABD62086.1| polygalacturonase precursor [Glycine max]
Length=79

 Score = 51.2 bits (121),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QT+GEL +PTVPP+DCL++GK  +N++Q D+D C
Sbjct  46   QTYGELKTPTVPPIDCLQIGKPTNNRIQTDHDLC  79



>ref|XP_010251222.1| PREDICTED: polygalacturonase At1g48100 [Nelumbo nucifera]
Length=528

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVP +DCL++GK  SN++Q DYD C
Sbjct  495  QTFGELSTPTVPQIDCLQIGKPSSNRIQSDYDSC  528



>emb|CDY34877.1| BnaA09g48030D [Brassica napus]
Length=489

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL+SPT+PP+DCL++GK   N+VQ D+D C
Sbjct  456  QTFGELNSPTLPPIDCLQIGKPARNRVQSDHDVC  489



>ref|XP_009118238.1| PREDICTED: polygalacturonase At1g48100-like [Brassica rapa]
Length=528

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL+SPT+PP+DCL++GK   N+VQ D+D C
Sbjct  495  QTFGELNSPTLPPIDCLQIGKPARNRVQSDHDVC  528



>emb|CDY54228.1| BnaC08g49850D [Brassica napus]
Length=528

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL+SPT+PP+DCL++GK   N+VQ D+D C
Sbjct  495  QTFGELNSPTLPPIDCLQIGKPARNRVQSDHDVC  528



>gb|KDP26605.1| hypothetical protein JCGZ_17763 [Jatropha curcas]
Length=517

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT PP+DCL++GK P+N+ Q D+D C
Sbjct  484  QTFGELNTPTTPPIDCLQIGKPPNNRPQSDHDAC  517



>gb|EYU22502.1| hypothetical protein MIMGU_mgv1a0051062mg, partial [Erythranthe 
guttata]
Length=223

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFG+L+SPT+PPV CL VGK  SNK+Q D D C
Sbjct  190  QTFGQLNSPTIPPVGCLMVGKPSSNKIQGDSDSC  223



>ref|XP_010547772.1| PREDICTED: polygalacturonase At1g48100 [Tarenaya hassleriana]
Length=526

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVPP+DCL++GK   N+VQ D+D C
Sbjct  493  QTFGELSTPTVPPIDCLQIGKPSRNRVQSDHDLC  526



>gb|KFK43344.1| hypothetical protein AALP_AA1G112800 [Arabis alpina]
Length=536

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT+PP+DCL++GK   N+VQ D+D C
Sbjct  503  QTFGELNTPTLPPIDCLQIGKPARNRVQSDHDVC  536



>emb|CDY20612.1| BnaC08g14460D [Brassica napus]
Length=531

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT+PP+DCL++GK   N+VQ D+D C
Sbjct  498  QTFGELNTPTLPPIDCLQIGKPARNRVQSDHDVC  531



>emb|CDY20962.1| BnaA08g25630D [Brassica napus]
Length=531

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT+PP+DCL++GK   N+VQ D+D C
Sbjct  498  QTFGELNTPTLPPIDCLQIGKPARNRVQSDHDVC  531



>gb|ABK95839.1| unknown [Populus trichocarpa]
Length=59

 Score = 48.9 bits (115),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PT+PP+ CL++GK   N+ Q DYD C
Sbjct  26   QTFGELKTPTMPPISCLQIGKPSGNRPQRDYDAC  59



>emb|CDY37962.1| BnaC05g08120D [Brassica napus]
Length=532

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT+PP+DCL++GK   N+VQ D+D C
Sbjct  499  QTFGELNTPTLPPIDCLQIGKPARNRVQSDHDVC  532



>ref|XP_009148407.1| PREDICTED: polygalacturonase At1g48100 [Brassica rapa]
 emb|CDX93397.1| BnaA06g06510D [Brassica napus]
Length=533

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT+PP+DCL++GK   N+VQ D+D C
Sbjct  500  QTFGELNTPTLPPIDCLQIGKPARNRVQSDHDVC  533



>ref|XP_010533949.1| PREDICTED: polygalacturonase At1g48100-like [Tarenaya hassleriana]
Length=541

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PTVPP+DCL++GK   N VQ D+D C
Sbjct  508  QTFGELNTPTVPPIDCLQIGKPSRNGVQSDHDLC  541



>ref|XP_006602385.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Glycine 
max]
Length=494

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QT+GEL +PTVPP+DCL++GK  +N++Q D+D C
Sbjct  461  QTYGELKTPTVPPIDCLQIGKPTNNRIQTDHDLC  494



>ref|XP_003552026.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Glycine 
max]
 gb|KHN23203.1| Polygalacturonase [Glycine soja]
Length=538

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QT+GEL +PTVPP+DCL++GK  +N++Q D+D C
Sbjct  505  QTYGELKTPTVPPIDCLQIGKPTNNRIQTDHDLC  538



>gb|KHN26888.1| Polygalacturonase [Glycine soja]
Length=538

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QT+GEL +PTVPP+DCL++GK  +N++Q D+D C
Sbjct  505  QTYGELKTPTVPPIDCLQIGKPTNNRIQTDHDLC  538



>gb|EPS67779.1| polygalacturonase, partial [Genlisea aurea]
Length=489

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFG+L+SPT+PPV+C+++GK  SNK+ VD D C
Sbjct  456  QTFGQLYSPTIPPVECVQIGKPSSNKIHVDDDSC  489



>ref|XP_003531999.2| PREDICTED: polygalacturonase At1g48100 isoform 1 [Glycine max]
Length=601

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QT+GEL +PTVPP+DCL++GK  +N++Q D+D C
Sbjct  568  QTYGELKTPTVPPIDCLQIGKPTNNRIQTDHDLC  601



>ref|XP_006417442.1| hypothetical protein EUTSA_v10007255mg [Eutrema salsugineum]
 gb|ESQ35795.1| hypothetical protein EUTSA_v10007255mg [Eutrema salsugineum]
Length=560

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQ-VDYDQC  103
            QTFGEL++PT+PP+DCL++GK P N+V   D+DQC
Sbjct  526  QTFGELNTPTLPPIDCLQIGKPPRNRVHDSDHDQC  560



>ref|XP_011086585.1| PREDICTED: polygalacturonase At1g48100 [Sesamum indicum]
Length=518

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFG+L++PT+PPV+CL++GK  SNK+Q D D C
Sbjct  485  QTFGQLYTPTIPPVECLQLGKPTSNKIQGDNDSC  518



>ref|XP_010248489.1| PREDICTED: polygalacturonase At1g48100 [Nelumbo nucifera]
Length=526

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVPP+ CL++GK  SN++Q D D C
Sbjct  493  QTFGELSTPTVPPIGCLQIGKPSSNRIQSDGDTC  526



>gb|AES96173.2| polygalacturonase [Medicago truncatula]
Length=534

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVPP+ CL++GK  +N++Q D+D C
Sbjct  501  QTFGELRTPTVPPIGCLQIGKPSNNRIQTDHDIC  534



>ref|XP_006840721.1| hypothetical protein AMTR_s00096p00105250 [Amborella trichopoda]
 gb|ERN02396.1| hypothetical protein AMTR_s00096p00105250 [Amborella trichopoda]
Length=271

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL SPTVPP+ CL++GK  ++++Q D+D C
Sbjct  238  QTFGELMSPTVPPIACLQIGKPANSRIQSDHDSC  271



>ref|XP_003613215.1| Polygalacturonase [Medicago truncatula]
Length=543

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVPP+ CL++GK  +N++Q D+D C
Sbjct  510  QTFGELRTPTVPPIGCLQIGKPSNNRIQTDHDIC  543



>ref|XP_004489829.1| PREDICTED: polygalacturonase At1g48100-like [Cicer arietinum]
Length=532

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVPP+ CL++GK  +N++Q D+D C
Sbjct  499  QTFGELRTPTVPPIGCLQIGKPSNNRIQTDHDIC  532



>gb|AAK50769.1|AF361321_1 polygalacturonase [Pisum sativum]
Length=355

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVPP+ CL++GK  +N++Q D+D C
Sbjct  322  QTFGELKTPTVPPIGCLQIGKPTNNRIQTDHDIC  355



>ref|XP_002525361.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF36999.1| polygalacturonase, putative [Ricinus communis]
Length=519

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT PP+DCL++GK  SN+ Q D+D C
Sbjct  486  QTFGELNTPTTPPIDCLQIGKPSSNRPQSDHDVC  519



>ref|XP_010100443.1| Polygalacturonase [Morus notabilis]
 gb|EXB82577.1| Polygalacturonase [Morus notabilis]
Length=530

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL SPTVPP+ C ++GK  SN +Q D+D C
Sbjct  497  QTFGELRSPTVPPIACFQIGKPSSNHLQSDHDSC  530



>ref|XP_006350314.1| PREDICTED: polygalacturonase At1g48100-like [Solanum tuberosum]
Length=476

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PTVPP+ CL+VGK  S+  Q +Y QC
Sbjct  443  QTFGELYTPTVPPIQCLQVGKPSSSTTQANYGQC  476



>gb|KHG15884.1| hypothetical protein F383_10630 [Gossypium arboreum]
Length=557

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            Q++GEL +PTVPP+ CL++GK P+N+VQ +YD C
Sbjct  524  QSYGELTTPTVPPIACLQIGKPPNNRVQSNYDVC  557



>gb|KHG05280.1| hypothetical protein F383_31181 [Gossypium arboreum]
Length=519

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVPP+ CL++GK  +N+VQ D+D C
Sbjct  486  QTFGELTTPTVPPISCLQIGKPTNNRVQSDHDVC  519



>ref|XP_009144427.1| PREDICTED: polygalacturonase At1g48100-like [Brassica rapa]
Length=531

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT+PP+DCL++GK   N VQ D+D C
Sbjct  498  QTFGELNTPTLPPIDCLQIGKPARNIVQSDHDVC  531



>ref|XP_011013806.1| PREDICTED: polygalacturonase At1g48100-like [Populus euphratica]
Length=516

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT+PP+ CL++GK  SN+ Q D+D C
Sbjct  483  QTFGELNTPTMPPISCLQIGKPSSNRPQTDHDTC  516



>ref|XP_006392146.1| hypothetical protein EUTSA_v10023404mg [Eutrema salsugineum]
 gb|ESQ29432.1| hypothetical protein EUTSA_v10023404mg [Eutrema salsugineum]
Length=538

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            +TFGEL+SPTVPP+DCL++GK   N V  D+D C
Sbjct  503  KTFGELNSPTVPPIDCLQIGKPARNGVHTDHDIC  536



>ref|XP_008340054.1| PREDICTED: polygalacturonase At1g48100-like [Malus domestica]
Length=521

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVPP+ CL++GK  SNKV  D+D C
Sbjct  488  QTFGELRTPTVPPIGCLQLGKPSSNKVNSDHDVC  521



>ref|XP_007227459.1| hypothetical protein PRUPE_ppa004002mg [Prunus persica]
 gb|EMJ28658.1| hypothetical protein PRUPE_ppa004002mg [Prunus persica]
Length=536

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVPP+ CL++GK  SN+V  D+D C
Sbjct  503  QTFGELRTPTVPPIACLQIGKPSSNRVNSDHDVC  536



>ref|XP_009394799.1| PREDICTED: polygalacturonase At1g48100-like [Musa acuminata subsp. 
malaccensis]
Length=475

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            Q FGEL++PT+PP+ CL++GK  SN++  D+D C
Sbjct  442  QAFGELYAPTIPPITCLQIGKPASNRISTDHDLC  475



>ref|XP_007044684.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY00516.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=524

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            Q+FGEL +PTVPP+ CL++GK  +N+VQ D+D C
Sbjct  491  QSFGELTTPTVPPISCLQIGKPSNNRVQADHDVC  524



>ref|XP_008221838.1| PREDICTED: polygalacturonase At1g48100 [Prunus mume]
Length=533

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVPP+ CL++GK  SN+V  D+D C
Sbjct  500  QTFGELRTPTVPPIACLQIGKPSSNRVNSDHDVC  533



>dbj|BAJ96167.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=532

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            Q FGEL++PT+PP+ CL++GK   N+V  D+DQC
Sbjct  499  QAFGELYTPTIPPISCLQLGKPAGNRVLSDHDQC  532



>ref|XP_004297473.1| PREDICTED: polygalacturonase At1g48100-like [Fragaria vesca subsp. 
vesca]
Length=527

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PT+PP+ CL++GK  +NKV  D+D C
Sbjct  492  QTFGELRTPTLPPISCLQIGKPANNKVNSDHDAC  525



>gb|EMT04942.1| Polygalacturonase [Aegilops tauschii]
Length=421

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            Q FGEL++PT+PP+ CL++GK   N+V  D+DQC
Sbjct  388  QAFGELYTPTIPPISCLQLGKPAGNRVLSDHDQC  421



>gb|EYU28445.1| hypothetical protein MIMGU_mgv1a004469mg [Erythranthe guttata]
Length=525

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFG+L++PTVPPV CL++GK   NK+Q D D C
Sbjct  492  QTFGQLYTPTVPPVQCLQIGKPSRNKIQGDNDSC  525



>ref|XP_006307174.1| hypothetical protein CARUB_v10008765mg [Capsella rubella]
 gb|EOA40072.1| hypothetical protein CARUB_v10008765mg [Capsella rubella]
Length=549

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKV-QVDYDQC  103
            QTFGEL++PT+PP+DCL++GK P NKV + D+D C
Sbjct  515  QTFGELNTPTLPPIDCLQIGKPPRNKVHESDHDVC  549



>ref|XP_007153746.1| hypothetical protein PHAVU_003G061600g [Phaseolus vulgaris]
 gb|ESW25740.1| hypothetical protein PHAVU_003G061600g [Phaseolus vulgaris]
Length=534

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QT+GEL +PT+PP+ CL++GK  SN++Q D+D C
Sbjct  501  QTYGELKTPTLPPIGCLQIGKPTSNRIQTDHDLC  534



>ref|XP_002311773.1| hypothetical protein POPTR_0008s19350g [Populus trichocarpa]
 gb|EEE89140.1| hypothetical protein POPTR_0008s19350g [Populus trichocarpa]
Length=517

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PT+PP+ CL++GK   N+ Q DYD C
Sbjct  484  QTFGELKTPTMPPISCLQIGKPSGNRPQRDYDAC  517



>ref|XP_008800720.1| PREDICTED: polygalacturonase At1g48100-like [Phoenix dactylifera]
Length=483

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            Q +GEL++PTVPP+ CL+ GK  SN++Q D+D C
Sbjct  450  QAYGELYTPTVPPIVCLQAGKPTSNRIQFDHDSC  483



>ref|XP_010491600.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=534

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKV-QVDYDQC  103
            QTFGEL +PT+PP+DCL++GK P NKV + D+D C
Sbjct  500  QTFGELGAPTLPPIDCLQIGKPPRNKVHESDHDVC  534



>ref|XP_010458422.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=531

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKV-QVDYDQC  103
            QTFGEL +PT+PP+DCL++GK P NKV + D+D C
Sbjct  497  QTFGELGTPTLPPIDCLQIGKPPRNKVHESDHDVC  531



>ref|XP_010475939.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=537

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKV-QVDYDQC  103
            QTFGEL +PT+PP+DCL++GK P NKV + D+D C
Sbjct  503  QTFGELGTPTLPPIDCLQIGKPPRNKVHESDHDVC  537



>ref|XP_010924275.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Elaeis 
guineensis]
Length=380

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            Q +GEL++PTVPP+ CL+ GK  SN++Q D+D C
Sbjct  347  QAYGELYTPTVPPIVCLQTGKPTSNRIQSDHDSC  380



>ref|XP_010924274.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Elaeis 
guineensis]
Length=487

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            Q +GEL++PTVPP+ CL+ GK  SN++Q D+D C
Sbjct  454  QAYGELYTPTVPPIVCLQTGKPTSNRIQSDHDSC  487



>ref|NP_001056414.1| Os05g0578600 [Oryza sativa Japonica Group]
 dbj|BAF18328.1| Os05g0578600, partial [Oryza sativa Japonica Group]
Length=312

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            Q FGEL +PT+PP+ CL++GK   N V  DYD C
Sbjct  279  QAFGELSTPTIPPISCLQIGKPSGNNVMSDYDLC  312



>dbj|BAG98413.1| unnamed protein product [Oryza sativa Japonica Group]
Length=271

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            Q FGEL +PT+PP+ CL++GK   N V  DYD C
Sbjct  238  QAFGELSTPTIPPISCLQIGKPSGNNVMSDYDLC  271



>ref|XP_010925884.1| PREDICTED: polygalacturonase At1g48100-like [Elaeis guineensis]
Length=483

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            Q +GEL++PTVPP+ CL+ GK  SN++Q D+D C
Sbjct  450  QVYGELYTPTVPPIFCLQTGKPTSNRIQSDHDSC  483



>ref|XP_002314612.2| hypothetical protein POPTR_0010s05180g [Populus trichocarpa]
 gb|EEF00783.2| hypothetical protein POPTR_0010s05180g [Populus trichocarpa]
Length=516

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT PP+ CL++GK  SN+ Q D+D C
Sbjct  483  QTFGELNTPTKPPISCLQIGKPSSNRPQSDHDTC  516



>gb|KEH20046.1| polygalacturonase plant-like protein [Medicago truncatula]
Length=521

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            +T+GEL + TVPP+DCL++GK P+N++Q  +D C
Sbjct  488  ETYGELKTATVPPIDCLQIGKPPNNRIQTAHDLC  521



>gb|ABK95830.1| unknown [Populus trichocarpa]
Length=516

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PT PP+ CL++GK  SN+ Q D+D C
Sbjct  483  QTFGELNTPTKPPISCLQIGKPSSNRPQSDHDTC  516



>gb|AAT39158.1| putative polygalacturonase [Oryza sativa Japonica Group]
 gb|AAU10689.1| putative polygalacturonase [Oryza sativa Japonica Group]
Length=571

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            Q FGEL +PT+PP+ CL++GK   N V  DYD C
Sbjct  538  QAFGELSTPTIPPISCLQIGKPSGNNVMSDYDLC  571



>gb|EEE64806.1| hypothetical protein OsJ_19662 [Oryza sativa Japonica Group]
Length=534

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            Q FGEL +PT+PP+ CL++GK   N V  DYD C
Sbjct  501  QAFGELSTPTIPPISCLQIGKPSGNNVMSDYDLC  534



>gb|EEC79746.1| hypothetical protein OsI_21117 [Oryza sativa Indica Group]
Length=534

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            Q FGEL +PT+PP+ CL++GK   N V  DYD C
Sbjct  501  QAFGELSTPTIPPISCLQIGKPSGNNVMSDYDLC  534



>ref|XP_011034123.1| PREDICTED: polygalacturonase At1g48100 isoform X2 [Populus euphratica]
Length=517

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PT+PP+ CL++GK   N  Q DYD C
Sbjct  484  QTFGELKTPTMPPISCLQIGKPSGNHPQRDYDAC  517



>ref|XP_011034122.1| PREDICTED: polygalacturonase At1g48100 isoform X1 [Populus euphratica]
Length=546

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PT+PP+ CL++GK   N  Q DYD C
Sbjct  513  QTFGELKTPTMPPISCLQIGKPSGNHPQRDYDAC  546



>ref|XP_011071095.1| PREDICTED: polygalacturonase At1g48100 [Sesamum indicum]
Length=522

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFG+L+SP +PPV CL VGK  SNK+Q D D C
Sbjct  489  QTFGKLYSPMIPPVGCLIVGKPSSNKIQGDSDFC  522



>ref|XP_008812598.1| PREDICTED: polygalacturonase At1g48100-like [Phoenix dactylifera]
Length=480

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            + +GEL++PTVPP+ CL+ GK  SN++Q D+D C
Sbjct  447  KAYGELYTPTVPPIICLQTGKPTSNRIQSDHDSC  480



>ref|XP_004509758.1| PREDICTED: polygalacturonase At1g48100-like [Cicer arietinum]
Length=526

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            +T+GEL +PT+PP+ CL++GK P+N++Q  +D C
Sbjct  493  KTYGELKTPTLPPIGCLEIGKPPNNRIQTAHDLC  526



>ref|XP_002886607.1| hypothetical protein ARALYDRAFT_893483 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62866.1| hypothetical protein ARALYDRAFT_893483 [Arabidopsis lyrata subsp. 
lyrata]
Length=538

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            +TFGEL+S TVPP+DCL++GK   N V  D+D C
Sbjct  504  KTFGELNSATVPPIDCLQIGKPARNGVHSDHDIC  537



>ref|NP_564758.2| pectin lyase-like protein [Arabidopsis thaliana]
 gb|AAB71972.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE33700.1| pectin lyase-like protein [Arabidopsis thaliana]
Length=540

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            +TFGEL+S TVPP+DCL++GK   N V  D+D C
Sbjct  506  KTFGELNSATVPPIDCLQIGKPARNGVHSDHDIC  539



>gb|AAL31197.1| At1g60590/F8A5_12 [Arabidopsis thaliana]
 gb|AAN18178.1| At1g60590/F8A5_12 [Arabidopsis thaliana]
Length=474

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            +TFGEL+S TVPP+DCL++GK   N V  D+D C
Sbjct  440  KTFGELNSATVPPIDCLQIGKPARNGVHSDHDIC  473



>ref|XP_008389668.1| PREDICTED: polygalacturonase At1g48100 [Malus domestica]
Length=528

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL +PTVPP+ CL++GK   N++  ++D C
Sbjct  495  QTFGELRTPTVPPIGCLRLGKPSGNQINSNHDAC  528



>gb|ABV25004.1| polygalacturonase 7 [Oncidium hybrid cultivar]
Length=393

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PTVPP+ C++ GK  SN++  D+D C
Sbjct  360  QTFGELYTPTVPPILCMQNGKPTSNRILSDHDIC  393



>gb|ABV25001.1| polygalacturonase 4 [Oncidium hybrid cultivar]
Length=483

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PTVPP+ CL+ GK  SN++  D+D C
Sbjct  450  QTFGELYTPTVPPILCLQNGKPTSNRILSDHDIC  483



>ref|XP_010510936.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=534

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            +TFGEL S TVPP+DCL++GK   N V  D+D C
Sbjct  500  KTFGELTSATVPPIDCLQIGKPARNGVHSDHDIC  533



>gb|KFK40772.1| hypothetical protein AALP_AA2G039100 [Arabis alpina]
Length=520

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            +TFGE++S TVPP+DCL++GK   N V  D+D C
Sbjct  486  KTFGEINSVTVPPIDCLQIGKPARNGVHTDHDIC  519



>gb|ABV25002.1| polygalacturonase 5 [Oncidium hybrid cultivar]
Length=484

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PTVPP+ C++ GK  SN++  D+D C
Sbjct  451  QTFGELYTPTVPPILCMQNGKPTSNRILSDHDIC  484



>gb|ABV24998.1| polygalacturonase 1 [Oncidium hybrid cultivar]
Length=482

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PTVPP+ C++ GK  SN++  D+D C
Sbjct  449  QTFGELYTPTVPPILCMQNGKPTSNRILSDHDIC  482



>ref|XP_010417992.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=540

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            +TFGEL S TVPP+DCL++GK   N V  D+D C
Sbjct  506  KTFGELTSTTVPPIDCLQIGKPARNGVHSDHDIC  539



>gb|ABV25003.1| polygalacturonase 6 [Oncidium hybrid cultivar]
Length=483

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PTVPP+ C++ GK  SN++  D+D C
Sbjct  450  QTFGELYTPTVPPILCMQNGKPTSNRILSDHDIC  483



>gb|ABV24999.1| polygalacturonase 2 [Oncidium hybrid cultivar]
Length=483

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            QTFGEL++PTVPP+ C++ GK  SN++  D+D C
Sbjct  450  QTFGELYTPTVPPILCMQNGKPTSNRILSDHDIC  483



>ref|XP_009113198.1| PREDICTED: polygalacturonase At1g48100 [Brassica rapa]
Length=536

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            + FG L+SPTVPP+DCL++GK   N V  D+D C
Sbjct  502  KAFGLLNSPTVPPIDCLQIGKPARNGVHTDHDVC  535



>emb|CDY50367.1| BnaA09g13160D [Brassica napus]
Length=536

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            + FG L+SPTVPP+DCL++GK   N V  D+D C
Sbjct  502  KAFGLLNSPTVPPIDCLQIGKPARNGVHTDHDIC  535



>ref|XP_006302097.1| hypothetical protein CARUB_v10020088mg, partial [Capsella rubella]
 gb|EOA34995.1| hypothetical protein CARUB_v10020088mg, partial [Capsella rubella]
Length=550

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            +TFGEL S TVPP+DCL++GK   N V  D+D C
Sbjct  516  KTFGELISTTVPPIDCLQIGKPARNGVHSDHDIC  549



>emb|CDY47212.1| BnaC09g14610D [Brassica napus]
Length=536

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    QTFGELHSPTVPPVDCLKVGKLPSNKVQVDYDQC  103
            + FG L+SPTVPP+DCL++GK   N V  D+D C
Sbjct  502  KAFGLLNSPTVPPIDCLQIGKPARNGVHTDHDIC  535



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524054700018