BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19548_g3_i1 len=208 path=[936:0-77 1014:78-207]

Length=208
                                                                      Score     E

ref|XP_002862696.1|  predicted protein                                77.0    2e-16   
ref|XP_009790872.1|  PREDICTED: heterogeneous nuclear ribonucleop...  80.9    6e-16   
ref|XP_010327197.1|  PREDICTED: heterogeneous nuclear ribonucleop...  80.1    9e-16   
dbj|BAB08572.1|  RNA-binding protein-like                             79.7    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866102.1|  hypothetical protein ARALYDRAFT_495641           79.0    2e-15   
gb|AAM97088.1|  RNA-binding protein-like                              79.0    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568826.1|  RNA recognition motif-containing protein            79.0    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851195.1|  RNA recognition motif-containing protein            79.0    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009790873.1|  PREDICTED: heterogeneous nuclear ribonucleop...  78.6    3e-15   
ref|XP_009594583.1|  PREDICTED: heterogeneous nuclear ribonucleop...  78.6    3e-15   
ref|XP_004248330.1|  PREDICTED: heterogeneous nuclear ribonucleop...  78.6    4e-15   
ref|XP_006352533.1|  PREDICTED: heterogeneous nuclear ribonucleop...  78.2    4e-15   
ref|XP_010483006.1|  PREDICTED: heterogeneous nuclear ribonucleop...  78.2    5e-15   
ref|XP_010443192.1|  PREDICTED: heterogeneous nuclear ribonucleop...  78.2    5e-15   
ref|XP_006280461.1|  hypothetical protein CARUB_v10026394mg           77.8    5e-15   
ref|XP_006401444.1|  hypothetical protein EUTSA_v10013607mg           77.8    6e-15   
ref|XP_010449765.1|  PREDICTED: heterogeneous nuclear ribonucleop...  77.8    7e-15   
ref|XP_009606206.1|  PREDICTED: RNA-binding protein Musashi homol...  77.8    7e-15   
ref|XP_009765857.1|  PREDICTED: heterogeneous nuclear ribonucleop...  77.0    2e-14   
ref|XP_011007099.1|  PREDICTED: heterogeneous nuclear ribonucleop...  76.6    2e-14   
ref|XP_006344882.1|  PREDICTED: heterogeneous nuclear ribonucleop...  76.6    2e-14   
ref|XP_011007096.1|  PREDICTED: heterogeneous nuclear ribonucleop...  76.6    2e-14   
ref|XP_011007097.1|  PREDICTED: heterogeneous nuclear ribonucleop...  76.6    2e-14   
ref|XP_009594584.1|  PREDICTED: heterogeneous nuclear ribonucleop...  76.3    2e-14   
ref|XP_004251912.1|  PREDICTED: heterogeneous nuclear ribonucleop...  76.3    2e-14   
emb|CBI26733.3|  unnamed protein product                              74.7    2e-14   
ref|XP_002316761.1|  hypothetical protein POPTR_0011s09050g           75.9    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_006452507.1|  hypothetical protein CICLE_v10008158mg           75.9    3e-14   
ref|XP_006474951.1|  PREDICTED: heterogeneous nuclear ribonucleop...  75.9    3e-14   
ref|XP_010545265.1|  PREDICTED: heterogeneous nuclear ribonucleop...  75.5    3e-14   
ref|XP_010545264.1|  PREDICTED: heterogeneous nuclear ribonucleop...  75.5    4e-14   
emb|CDY36753.1|  BnaA03g11330D                                        75.5    4e-14   
ref|XP_011007622.1|  PREDICTED: heterogeneous nuclear ribonucleop...  75.5    4e-14   
ref|XP_002300356.2|  hypothetical protein POPTR_0001s37230g           75.5    4e-14   Populus trichocarpa [western balsam poplar]
ref|XP_011007620.1|  PREDICTED: heterogeneous nuclear ribonucleop...  75.5    4e-14   
ref|XP_011007619.1|  PREDICTED: heterogeneous nuclear ribonucleop...  75.5    5e-14   
ref|XP_009132374.1|  PREDICTED: heterogeneous nuclear ribonucleop...  75.1    5e-14   
emb|CDY11989.1|  BnaC03g14150D                                        75.1    5e-14   
gb|KDP39233.1|  hypothetical protein JCGZ_00990                       75.1    6e-14   
gb|KDO62196.1|  hypothetical protein CISIN_1g009920mg                 75.5    6e-14   
ref|XP_010689542.1|  PREDICTED: heterogeneous nuclear ribonucleop...  70.9    6e-14   
ref|XP_003551514.1|  PREDICTED: heterogeneous nuclear ribonucleop...  75.1    6e-14   
gb|KEH33977.1|  heterogeneous nuclear ribonucleoprotein 27C, puta...  75.1    7e-14   
ref|XP_003600251.1|  Heterogeneous nuclear ribonucleoprotein A1       75.1    7e-14   
ref|XP_010689539.1|  PREDICTED: heterogeneous nuclear ribonucleop...  71.2    7e-14   
ref|XP_002529044.1|  Heterogeneous nuclear ribonucleoprotein 27C,...  74.7    8e-14   Ricinus communis
gb|KHG28808.1|  RNA-binding Musashi                                   74.7    8e-14   
ref|XP_010539319.1|  PREDICTED: heterogeneous nuclear ribonucleop...  74.7    9e-14   
ref|XP_010539320.1|  PREDICTED: heterogeneous nuclear ribonucleop...  74.3    1e-13   
ref|XP_006575702.1|  PREDICTED: heterogeneous nuclear ribonucleop...  74.3    1e-13   
ref|XP_010060242.1|  PREDICTED: heterogeneous nuclear ribonucleop...  74.3    1e-13   
ref|XP_010060245.1|  PREDICTED: heterogeneous nuclear ribonucleop...  74.3    1e-13   
gb|KCW66864.1|  hypothetical protein EUGRSUZ_F00624                   74.3    1e-13   
emb|CAN75218.1|  hypothetical protein VITISV_003519                   74.3    1e-13   Vitis vinifera
ref|XP_007142373.1|  hypothetical protein PHAVU_008G274900g           74.3    1e-13   
ref|XP_002274589.1|  PREDICTED: heterogeneous nuclear ribonucleop...  74.3    1e-13   Vitis vinifera
ref|XP_010097281.1|  RNA-binding protein Musashi-2-like protein       73.9    2e-13   
ref|XP_007146589.1|  hypothetical protein PHAVU_006G053000g           73.9    2e-13   
ref|XP_007146588.1|  hypothetical protein PHAVU_006G053000g           73.9    2e-13   
ref|XP_010675870.1|  PREDICTED: heterogeneous nuclear ribonucleop...  73.6    2e-13   
emb|CBI28407.3|  unnamed protein product                              73.2    2e-13   
ref|XP_002272993.1|  PREDICTED: heterogeneous nuclear ribonucleop...  73.6    2e-13   Vitis vinifera
ref|XP_010270159.1|  PREDICTED: heterogeneous nuclear ribonucleop...  73.6    2e-13   
emb|CDY46690.1|  BnaA03g48180D                                        73.2    3e-13   
gb|KHN43809.1|  RNA-binding protein Musashi like Rbp6                 73.6    3e-13   
ref|XP_007142374.1|  hypothetical protein PHAVU_008G274900g           73.2    4e-13   
ref|XP_004294459.1|  PREDICTED: uncharacterized protein LOC101307182  72.8    4e-13   
ref|XP_006413156.1|  hypothetical protein EUTSA_v10025172mg           72.8    4e-13   
ref|XP_007020625.1|  RNA-binding family protein isoform 1             72.4    5e-13   
ref|XP_008449079.1|  PREDICTED: heterogeneous nuclear ribonucleop...  72.4    5e-13   
ref|XP_007020626.1|  RNA-binding family protein isoform 2             72.4    5e-13   
ref|XP_007020630.1|  RNA-binding family protein isoform 6             72.4    6e-13   
emb|CDX89316.1|  BnaA01g15770D                                        72.4    6e-13   
ref|XP_007212016.1|  hypothetical protein PRUPE_ppa004834mg           72.4    6e-13   
ref|XP_010270160.1|  PREDICTED: heterogeneous nuclear ribonucleop...  72.4    6e-13   
ref|XP_010908651.1|  PREDICTED: heterogeneous nuclear ribonucleop...  72.4    6e-13   
emb|CDP13750.1|  unnamed protein product                              72.4    7e-13   
ref|XP_010908650.1|  PREDICTED: heterogeneous nuclear ribonucleop...  72.0    7e-13   
ref|XP_007212015.1|  hypothetical protein PRUPE_ppa004834mg           72.0    7e-13   
ref|XP_010908648.1|  PREDICTED: heterogeneous nuclear ribonucleop...  72.4    7e-13   
ref|XP_008227101.1|  PREDICTED: heterogeneous nuclear ribonucleop...  72.0    7e-13   
ref|XP_009137608.1|  PREDICTED: heterogeneous nuclear ribonucleop...  72.0    7e-13   
ref|XP_004506674.1|  PREDICTED: heterogeneous nuclear ribonucleop...  72.0    7e-13   
ref|XP_004149577.1|  PREDICTED: uncharacterized protein LOC101220541  72.0    8e-13   
ref|XP_010252687.1|  PREDICTED: heterogeneous nuclear ribonucleop...  72.0    8e-13   
ref|XP_003544715.1|  PREDICTED: heterogeneous nuclear ribonucleop...  72.0    8e-13   
gb|KHG26657.1|  RNA-binding Musashi Rbp6                              72.0    8e-13   
gb|KHN23872.1|  RNA-binding protein Musashi like Rbp6                 72.0    8e-13   
ref|XP_003519614.1|  PREDICTED: heterogeneous nuclear ribonucleop...  72.0    9e-13   
ref|XP_006586118.1|  PREDICTED: heterogeneous nuclear ribonucleop...  72.0    9e-13   
emb|CDX92807.1|  BnaC07g40650D                                        71.6    9e-13   
emb|CDY46689.1|  BnaA03g48190D                                        71.6    1e-12   
ref|XP_009795233.1|  PREDICTED: heterogeneous nuclear ribonucleop...  71.6    1e-12   
ref|XP_009631808.1|  PREDICTED: heterogeneous nuclear ribonucleop...  71.6    1e-12   
gb|KHM99490.1|  RNA-binding protein Musashi like Rbp6                 71.6    1e-12   
ref|XP_002869600.1|  RNA recognition motif-containing protein         71.2    1e-12   
ref|XP_009606898.1|  PREDICTED: RNA-binding protein Musashi homol...  71.2    1e-12   
ref|XP_006283675.1|  hypothetical protein CARUB_v10004740mg           71.2    1e-12   
emb|CAB43861.1|  hnRNP-like protein                                   71.2    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283677.1|  hypothetical protein CARUB_v10004740mg           71.2    2e-12   
gb|AAF13099.1|AC009176_26  putative RNA-binding protein, 3' partial   66.6    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283676.1|  hypothetical protein CARUB_v10004740mg           71.2    2e-12   
ref|XP_010433462.1|  PREDICTED: heterogeneous nuclear ribonucleop...  71.2    2e-12   
ref|XP_009802735.1|  PREDICTED: RNA-binding protein Musashi homol...  70.9    2e-12   
ref|XP_010438716.1|  PREDICTED: heterogeneous nuclear ribonucleop...  70.9    2e-12   
ref|XP_010448232.1|  PREDICTED: heterogeneous nuclear ribonucleop...  70.9    2e-12   
ref|NP_567753.1|  RNA recognition motif-containing protein            70.9    2e-12   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19875.1|  AT4G26650                                            70.9    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031725.1|  RNA recognition motif-containing protein         70.9    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008798476.1|  PREDICTED: heterogeneous nuclear ribonucleop...  70.9    2e-12   
ref|XP_002963878.1|  hypothetical protein SELMODRAFT_4662             68.2    2e-12   
ref|XP_010536716.1|  PREDICTED: heterogeneous nuclear ribonucleop...  70.1    3e-12   
ref|XP_010536715.1|  PREDICTED: heterogeneous nuclear ribonucleop...  70.1    3e-12   
ref|XP_009364612.1|  PREDICTED: heterogeneous nuclear ribonucleop...  70.1    4e-12   
ref|XP_008379969.1|  PREDICTED: heterogeneous nuclear ribonucleop...  70.1    4e-12   
ref|XP_009380127.1|  PREDICTED: heterogeneous nuclear ribonucleop...  70.1    4e-12   
ref|XP_009364669.1|  PREDICTED: heterogeneous nuclear ribonucleop...  70.1    4e-12   
ref|XP_009364617.1|  PREDICTED: heterogeneous nuclear ribonucleop...  70.1    4e-12   
ref|XP_009361093.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.7    5e-12   
ref|XP_008342216.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.7    5e-12   
ref|XP_008776924.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.7    5e-12   
ref|XP_004243541.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.7    5e-12   
ref|XP_009390837.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.7    5e-12   
ref|XP_009365193.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.7    5e-12   
ref|XP_006363028.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.7    5e-12   
ref|XP_009397215.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.3    6e-12   
gb|ABF70162.1|  RNA-binding protein, putative                         69.3    6e-12   Musa acuminata [banana]
ref|XP_008776925.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.7    6e-12   
emb|CDX94301.1|  BnaC01g18830D                                        69.3    7e-12   
ref|XP_008379973.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.9    9e-12   
ref|XP_009404108.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.9    9e-12   
ref|XP_007215319.1|  hypothetical protein PRUPE_ppa005119mg           68.9    1e-11   
ref|XP_010112801.1|  DAZ-associated protein 1                         68.9    1e-11   
ref|XP_009397214.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.9    1e-11   
ref|XP_004251544.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.6    1e-11   
ref|XP_010273569.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.2    1e-11   
emb|CDY07975.1|  BnaC03g35480D                                        68.6    1e-11   
ref|XP_001766367.1|  predicted protein                                64.3    1e-11   
ref|XP_006836782.1|  hypothetical protein AMTR_s00088p00174110        68.6    1e-11   
ref|XP_008464191.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.6    1e-11   
ref|XP_010907705.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.6    1e-11   
ref|XP_008342172.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.6    2e-11   
ref|XP_006395215.1|  hypothetical protein EUTSA_v10004139mg           68.2    2e-11   
ref|XP_006352009.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.2    2e-11   
ref|XP_010486352.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.2    2e-11   
ref|XP_011097787.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.2    2e-11   
ref|XP_004140014.1|  PREDICTED: uncharacterized protein LOC101222391  68.2    2e-11   
ref|XP_010524610.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.2    2e-11   
ref|XP_002882552.1|  hypothetical protein ARALYDRAFT_478119           68.2    2e-11   
ref|XP_002301585.1|  heterogeneous nuclear ribonucleoprotein          68.2    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009142599.1|  PREDICTED: LOW QUALITY PROTEIN: heterogeneou...  67.8    2e-11   
ref|XP_010936617.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.2    2e-11   
ref|NP_566321.1|  RNA recognition motif-containing protein            68.2    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006447738.1|  hypothetical protein CICLE_v10015084mg           68.2    2e-11   
gb|AAF21191.1|AC013483_15  putative RNA-binding protein               68.2    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAK92717.1|  putative RNA-binding protein                          68.2    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850539.1|  RNA recognition motif-containing protein            68.2    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KDO58444.1|  hypothetical protein CISIN_1g012289mg                 67.8    2e-11   
ref|XP_010464424.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-11   
ref|XP_010458039.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-11   
ref|XP_010457881.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-11   
ref|XP_010464421.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-11   
ref|XP_008342177.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-11   
emb|CDP04502.1|  unnamed protein product                              67.8    2e-11   
gb|EMT31848.1|  RNA-binding Musashi-2-like protein                    67.8    3e-11   
ref|XP_010688996.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    3e-11   
tpg|DAA41246.1|  TPA: hypothetical protein ZEAMMB73_495774            64.7    3e-11   
ref|XP_009380131.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    3e-11   
gb|KHG02993.1|  DAZ-associated 1                                      67.8    3e-11   
ref|XP_007049271.1|  HnRNP isoform 1                                  67.8    3e-11   
gb|EYU33694.1|  hypothetical protein MIMGU_mgv1a005066mg              67.8    3e-11   
ref|XP_010557695.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.4    3e-11   
ref|XP_011039340.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    3e-11   
ref|XP_010264924.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.4    3e-11   
ref|XP_004293446.1|  PREDICTED: uncharacterized protein LOC101313871  67.4    3e-11   
ref|XP_009380128.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.4    3e-11   
ref|XP_007026293.1|  RNA-binding family protein isoform 3             67.4    3e-11   
gb|EMS61711.1|  RNA-binding protein Musashi-like protein 2            67.4    3e-11   
ref|NP_001068335.1|  Os11g0637700                                     67.4    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003577309.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.4    3e-11   
ref|XP_007142507.1|  hypothetical protein PHAVU_008G286500g           67.4    3e-11   
ref|XP_006663067.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.4    4e-11   
ref|XP_006407794.1|  hypothetical protein EUTSA_v10020586mg           67.4    4e-11   
ref|XP_006407795.1|  hypothetical protein EUTSA_v10020586mg           67.4    4e-11   
ref|XP_006595660.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.4    4e-11   
ref|XP_008229871.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.0    4e-11   
ref|XP_011003504.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.4    4e-11   
ref|XP_009147022.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.4    4e-11   
ref|XP_009147023.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.4    4e-11   
ref|XP_007215320.1|  hypothetical protein PRUPE_ppa005132mg           67.0    4e-11   
ref|XP_011095499.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.0    4e-11   
emb|CDX74030.1|  BnaA03g30170D                                        67.0    4e-11   
ref|XP_010909449.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.0    4e-11   
gb|ADK92872.1|  hnRNP                                                 67.0    4e-11   
ref|XP_009124131.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.0    5e-11   
gb|KHN46912.1|  DAZ-associated protein 1                              67.0    5e-11   
ref|XP_009124116.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.0    5e-11   
emb|CDY22136.1|  BnaC01g39650D                                        67.0    5e-11   
emb|CDY35966.1|  BnaA05g29840D                                        67.0    5e-11   
ref|XP_009134994.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.0    5e-11   
emb|CDY66272.1|  BnaC05g52200D                                        67.0    5e-11   
gb|EPS59033.1|  hypothetical protein M569_15778                       65.9    5e-11   
ref|XP_010057821.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    5e-11   
ref|XP_009365188.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.0    5e-11   
dbj|BAK01877.1|  predicted protein                                    66.6    6e-11   
gb|EAZ19017.1|  hypothetical protein OsJ_34549                        66.6    6e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010262417.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    6e-11   
ref|XP_006857074.1|  hypothetical protein AMTR_s00065p00083440        66.2    6e-11   
ref|XP_007026295.1|  RNA-binding family protein isoform 5             66.6    6e-11   
ref|XP_002320502.2|  hypothetical protein POPTR_0014s15970g           66.6    6e-11   Populus trichocarpa [western balsam poplar]
ref|XP_007026291.1|  RNA-binding family protein isoform 1             66.6    6e-11   
ref|XP_010035445.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    6e-11   
ref|XP_004979810.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    6e-11   
ref|XP_001757549.1|  predicted protein                                63.2    7e-11   
ref|XP_004293449.1|  PREDICTED: uncharacterized protein LOC101314729  66.6    7e-11   
ref|XP_001757547.1|  predicted protein                                62.8    8e-11   
gb|KDP29893.1|  hypothetical protein JCGZ_18462                       66.2    8e-11   
ref|XP_006373597.1|  hypothetical protein POPTR_0016s01150g           66.2    1e-10   
ref|XP_011040202.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    1e-10   
ref|XP_002532010.1|  Heterogeneous nuclear ribonucleoprotein 27C,...  65.9    1e-10   Ricinus communis
gb|KDP40375.1|  hypothetical protein JCGZ_02373                       65.9    1e-10   
ref|XP_006297510.1|  hypothetical protein CARUB_v10013535mg           65.9    1e-10   
gb|EYU18292.1|  hypothetical protein MIMGU_mgv1a0092212mg             61.6    1e-10   
ref|XP_010557774.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    1e-10   
ref|XP_002972014.1|  hypothetical protein SELMODRAFT_172407           63.2    1e-10   
ref|XP_003519672.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.5    2e-10   
ref|XP_002974297.1|  hypothetical protein SELMODRAFT_101375           63.2    2e-10   
gb|KHN43959.1|  DAZ-associated protein 1                              65.5    2e-10   
gb|KHG03345.1|  RNA-binding Musashi Rbp6                              65.5    2e-10   
gb|ABY56086.1|  putative heterogeneous nuclear ribonucleoprotein      61.6    2e-10   Cucumis melo [Oriental melon]
ref|XP_003617976.1|  Heterogeneous nuclear ribonucleoprotein A1, ...  65.5    2e-10   
ref|XP_006467314.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.5    2e-10   
gb|KHG03317.1|  RNA-binding Musashi                                   65.5    2e-10   
ref|XP_006449887.1|  hypothetical protein CICLE_v10015098mg           65.5    2e-10   
ref|XP_010532987.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.5    2e-10   
gb|KDO78485.1|  hypothetical protein CISIN_1g011518mg                 65.5    2e-10   
ref|XP_010920312.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.1    2e-10   
ref|NP_001060120.1|  Os07g0584500                                     65.1    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003594254.1|  RNA-binding protein, putative                    65.5    2e-10   
ref|XP_004491591.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.1    2e-10   
gb|ABY56098.1|  putative heterogeneous nuclear ribonucleoprotein      61.2    2e-10   Cucumis sativus [cucumbers]
gb|KEH28480.1|  RNA-binding (RRM/RBD/RNP motif) family protein        65.1    2e-10   
dbj|BAJ88758.1|  predicted protein                                    65.1    2e-10   
dbj|BAJ94498.1|  predicted protein                                    65.1    3e-10   
ref|XP_011041422.1|  PREDICTED: heterogeneous nuclear ribonucleop...  64.7    3e-10   
gb|KHG02324.1|  RNA-binding Musashi                                   64.7    3e-10   
ref|XP_009358003.1|  PREDICTED: heterogeneous nuclear ribonucleop...  64.7    3e-10   
ref|XP_008340642.1|  PREDICTED: heterogeneous nuclear ribonucleop...  64.7    3e-10   
ref|XP_007222942.1|  hypothetical protein PRUPE_ppa005309mg           64.7    3e-10   
gb|EYU27413.1|  hypothetical protein MIMGU_mgv1a005325mg              64.3    4e-10   
gb|KDP36443.1|  hypothetical protein JCGZ_09513                       64.3    4e-10   
ref|XP_008224160.1|  PREDICTED: heterogeneous nuclear ribonucleop...  64.3    4e-10   
ref|XP_008351334.1|  PREDICTED: heterogeneous nuclear ribonucleop...  64.3    4e-10   
gb|EAZ16390.1|  hypothetical protein OsJ_31855                        64.3    4e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008670520.1|  PREDICTED: heterogeneous nuclear ribonucleop...  64.3    4e-10   
ref|XP_003562808.1|  PREDICTED: heterogeneous nuclear ribonucleop...  64.3    5e-10   
ref|XP_002308799.1|  hypothetical protein POPTR_0006s01680g           64.3    5e-10   Populus trichocarpa [western balsam poplar]
ref|XP_009334212.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.9    5e-10   
emb|CDX84689.1|  BnaA03g15410D                                        63.9    5e-10   
ref|XP_006378320.1|  hypothetical protein POPTR_0010s07790g           63.9    5e-10   
ref|XP_004151998.1|  PREDICTED: DAZ-associated protein 1-like         63.9    5e-10   
emb|CDX79527.1|  BnaC03g18630D                                        63.5    5e-10   
ref|XP_009132928.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.5    5e-10   
gb|AES64505.2|  RNA-binding (RRM/RBD/RNP motif) family protein        63.9    5e-10   
ref|XP_008447387.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.9    5e-10   
gb|KHG00059.1|  RNA-binding Musashi                                   63.9    6e-10   
ref|XP_008785173.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.9    6e-10   
gb|ADE75708.1|  unknown                                               63.5    6e-10   
ref|XP_002528377.1|  Heterogeneous nuclear ribonucleoprotein 27C,...  63.9    6e-10   Ricinus communis
ref|XP_004296398.1|  PREDICTED: uncharacterized protein LOC101310107  63.9    6e-10   
ref|XP_009141312.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.2    6e-10   
gb|ABR16827.1|  unknown                                               63.5    6e-10   Picea sitchensis
ref|XP_010069110.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.5    6e-10   
ref|XP_010473857.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.0    6e-10   
ref|NP_001064824.1|  Os10g0470900                                     63.5    6e-10   Oryza sativa Japonica Group [Japonica rice]
gb|KGN61572.1|  hypothetical protein Csa_2G171930                     63.9    7e-10   
ref|XP_007224330.1|  hypothetical protein PRUPE_ppa020543mg           59.7    7e-10   
ref|XP_006657892.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.5    7e-10   
ref|XP_009625541.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.5    7e-10   
ref|XP_006857465.1|  hypothetical protein AMTR_s00067p00185510        63.5    7e-10   
gb|EEC82342.1|  hypothetical protein OsI_26646                        63.5    7e-10   
ref|XP_006352343.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.5    7e-10   
ref|XP_004250279.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.5    7e-10   
ref|XP_008802392.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.5    8e-10   
emb|CDO99280.1|  unnamed protein product                              63.5    8e-10   
ref|XP_007203553.1|  hypothetical protein PRUPE_ppb013006mg           60.5    8e-10   
emb|CBI37165.3|  unnamed protein product                              61.6    8e-10   
emb|CDY12068.1|  BnaC03g59840D                                        62.8    9e-10   
ref|XP_010934253.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.2    9e-10   
ref|XP_004958148.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.2    9e-10   
ref|XP_009109571.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.8    9e-10   
ref|XP_002285419.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.2    9e-10   
ref|XP_011091261.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.2    9e-10   
ref|XP_004486327.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.2    1e-09   
ref|XP_009420757.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.2    1e-09   
emb|CAN68016.1|  hypothetical protein VITISV_025150                   63.2    1e-09   
ref|XP_004486326.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.2    1e-09   
ref|XP_008463611.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.2    1e-09   
emb|CDX90262.1|  BnaA08g17220D                                        62.8    1e-09   
ref|XP_004139532.1|  PREDICTED: uncharacterized protein LOC101217028  63.2    1e-09   
ref|XP_010093086.1|  DAZ-associated protein 1                         62.8    1e-09   
ref|XP_006489648.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.8    1e-09   
gb|KHG15677.1|  DAZ-associated 1                                      63.2    1e-09   
gb|KGK37111.1|  hypothetical protein JL09_g3738                       63.2    1e-09   
ref|XP_011091262.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.8    1e-09   
ref|XP_010094687.1|  RNA-binding protein Musashi-2-like protein       63.2    1e-09   
gb|KDP26484.1|  hypothetical protein JCGZ_17642                       62.8    1e-09   
gb|KDO54113.1|  hypothetical protein CISIN_1g035855mg                 62.8    1e-09   
ref|XP_002528240.1|  Heterogeneous nuclear ribonucleoprotein 27C,...  62.8    1e-09   
ref|XP_006410483.1|  hypothetical protein EUTSA_v10016750mg           62.8    1e-09   
ref|XP_006420325.1|  hypothetical protein CICLE_v10004941mg           62.8    1e-09   
emb|CDY23739.1|  BnaC04g43830D                                        62.4    1e-09   
ref|XP_005845491.1|  hypothetical protein CHLNCDRAFT_36600            62.0    1e-09   
ref|XP_009625288.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.8    1e-09   
emb|CBI23698.3|  unnamed protein product                              62.4    1e-09   
emb|CDY37724.1|  BnaA04g19440D                                        62.0    2e-09   
ref|XP_002274734.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.4    2e-09   
ref|XP_002460931.1|  hypothetical protein SORBIDRAFT_02g037690        62.8    2e-09   
ref|XP_010670957.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.4    2e-09   
ref|XP_004147161.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.8    2e-09   
ref|XP_008460677.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.4    2e-09   
ref|XP_004173706.1|  PREDICTED: LOW QUALITY PROTEIN: heterogeneou...  62.4    2e-09   
ref|XP_009775500.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.4    2e-09   
ref|XP_006414743.1|  hypothetical protein EUTSA_v10025365mg           62.0    2e-09   
ref|XP_011004496.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.4    2e-09   
ref|XP_008813343.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.4    2e-09   
tpg|DAA63349.1|  TPA: hypothetical protein ZEAMMB73_769138            61.6    2e-09   
gb|EYU27681.1|  hypothetical protein MIMGU_mgv1a005511mg              62.4    2e-09   
ref|XP_009763753.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.0    2e-09   
ref|XP_010532688.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.0    2e-09   
ref|XP_004247759.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.0    2e-09   
ref|XP_008346177.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.0    2e-09   
gb|KFM29136.1|  Nuclear polyadenylated RNA-binding protein 4          60.1    2e-09   
ref|XP_008372374.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.0    3e-09   
gb|ABK24693.1|  unknown                                               62.0    3e-09   
ref|XP_002879449.1|  hypothetical protein ARALYDRAFT_482284           61.6    3e-09   
ref|XP_009401201.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.0    3e-09   
ref|XP_006354447.1|  PREDICTED: heterogeneous nuclear ribonucleop...  62.0    3e-09   
ref|NP_001146396.1|  uncharacterized protein LOC100279976             62.0    3e-09   
tpg|DAA63348.1|  TPA: LOW QUALITY PROTEIN: hypothetical protein Z...  61.6    3e-09   
ref|XP_006443770.1|  hypothetical protein CICLE_v10020365mg           61.6    3e-09   
gb|ACN39853.1|  unknown                                               61.6    3e-09   
gb|KDO60385.1|  hypothetical protein CISIN_1g015040mg                 61.6    3e-09   
ref|XP_004982907.1|  PREDICTED: heterogeneous nuclear ribonucleop...  61.6    3e-09   
ref|XP_009336098.1|  PREDICTED: heterogeneous nuclear ribonucleop...  61.6    3e-09   
ref|NP_180899.1|  RNA recognition motif-containing protein            61.6    3e-09   
ref|XP_006661850.1|  PREDICTED: heterogeneous nuclear ribonucleop...  61.6    3e-09   
ref|XP_009369427.1|  PREDICTED: heterogeneous nuclear ribonucleop...  61.6    4e-09   
ref|XP_010413869.1|  PREDICTED: heterogeneous nuclear ribonucleop...  61.2    4e-09   
ref|XP_009788450.1|  PREDICTED: heterogeneous nuclear ribonucleop...  61.2    4e-09   
ref|XP_010469479.1|  PREDICTED: heterogeneous nuclear ribonucleop...  61.2    4e-09   
ref|XP_010686663.1|  PREDICTED: heterogeneous nuclear ribonucleop...  61.6    4e-09   
ref|XP_006294340.1|  hypothetical protein CARUB_v10023347mg           61.2    4e-09   
gb|KHG10024.1|  DAZ-associated 1                                      61.6    4e-09   
ref|XP_002459499.1|  hypothetical protein SORBIDRAFT_02g005620        61.2    4e-09   
emb|CDP03780.1|  unnamed protein product                              60.8    5e-09   
ref|XP_009627212.1|  PREDICTED: heterogeneous nuclear ribonucleop...  60.8    5e-09   
ref|XP_008235616.1|  PREDICTED: heterogeneous nuclear ribonucleop...  61.2    5e-09   
ref|XP_007199867.1|  hypothetical protein PRUPE_ppa005979mg           61.2    5e-09   
gb|KHG09558.1|  DAZ-associated protein 1                              61.2    5e-09   
ref|XP_008652160.1|  PREDICTED: heterogeneous nuclear ribonucleop...  61.2    5e-09   
ref|XP_010522464.1|  PREDICTED: heterogeneous nuclear ribonucleop...  60.8    5e-09   
ref|XP_010109739.1|  Uncharacterized RNA-binding protein              60.8    5e-09   
gb|KHG05056.1|  RNA-binding Musashi                                   61.2    6e-09   
ref|XP_010435156.1|  PREDICTED: heterogeneous nuclear ribonucleop...  60.8    6e-09   
tpg|DAA42481.1|  TPA: hypothetical protein ZEAMMB73_522608            60.8    6e-09   
gb|KFK31048.1|  hypothetical protein AALP_AA6G061600                  60.8    6e-09   
ref|XP_004234048.1|  PREDICTED: heterogeneous nuclear ribonucleop...  60.8    6e-09   
ref|XP_002461626.1|  hypothetical protein SORBIDRAFT_02g005670        60.8    6e-09   
ref|XP_006358414.1|  PREDICTED: heterogeneous nuclear ribonucleop...  60.5    7e-09   
gb|ABD64965.1|  hypothetical protein 25.t00002                        60.5    8e-09   
emb|CDX77783.1|  BnaC07g20370D                                        60.5    8e-09   
ref|NP_001168878.1|  uncharacterized protein LOC100382683             60.5    8e-09   
ref|XP_010530068.1|  PREDICTED: heterogeneous nuclear ribonucleop...  60.5    9e-09   
emb|CDY67299.1|  BnaCnng54370D                                        60.1    9e-09   
ref|XP_010450068.1|  PREDICTED: heterogeneous nuclear ribonucleop...  60.1    1e-08   
gb|KEH42685.1|  RNA-binding (RRM/RBD/RNP motif) family protein        60.5    1e-08   
ref|XP_004247503.1|  PREDICTED: heterogeneous nuclear ribonucleop...  60.1    1e-08   
ref|XP_009792734.1|  PREDICTED: heterogeneous nuclear ribonucleop...  60.1    1e-08   
ref|XP_009143861.1|  PREDICTED: heterogeneous nuclear ribonucleop...  60.1    1e-08   
gb|EMT18277.1|  RNA-binding Musashi-2-like protein                    60.1    1e-08   
ref|XP_010538458.1|  PREDICTED: heterogeneous nuclear ribonucleop...  59.7    1e-08   
ref|NP_001146692.1|  uncharacterized protein LOC100280293             60.1    1e-08   
dbj|BAK08137.1|  predicted protein                                    60.1    1e-08   
emb|CDY17173.1|  BnaA05g10150D                                        59.7    1e-08   
ref|XP_007896923.1|  PREDICTED: DAZ-associated protein 1              60.1    1e-08   
ref|XP_010494999.1|  PREDICTED: heterogeneous nuclear ribonucleop...  59.7    1e-08   
ref|XP_010509893.1|  PREDICTED: heterogeneous nuclear ribonucleop...  59.7    1e-08   
ref|XP_004289979.1|  PREDICTED: heterogeneous nuclear ribonucleop...  59.7    1e-08   
ref|XP_001703132.1|  hypothetical protein CHLREDRAFT_108674           56.2    1e-08   
ref|XP_002449904.1|  hypothetical protein SORBIDRAFT_05g025410        59.7    1e-08   
tpg|DAA59918.1|  TPA: hypothetical protein ZEAMMB73_017923            59.7    1e-08   
ref|XP_011029769.1|  PREDICTED: heterogeneous nuclear ribonucleop...  59.7    2e-08   
ref|XP_003249817.2|  PREDICTED: RNA-binding protein Musashi homol...  55.8    2e-08   
ref|XP_002870323.1|  hypothetical protein ARALYDRAFT_493480           59.3    2e-08   
ref|XP_002320621.2|  hypothetical protein POPTR_0014s18470g           59.3    2e-08   
gb|ACG34206.1|  RNA-binding protein                                   59.7    2e-08   
ref|NP_001136724.1|  uncharacterized protein LOC100216861             59.7    2e-08   
ref|XP_002046609.1|  GJ12977                                          57.8    2e-08   
emb|CAB10209.1|  ribonucleoprotein like protein                       59.3    2e-08   
ref|XP_006346780.1|  PREDICTED: heterogeneous nuclear ribonucleop...  59.3    2e-08   
ref|XP_002312594.2|  hypothetical protein POPTR_0008s17030g           59.3    2e-08   
gb|KFK22119.1|  hypothetical protein AALP_AAs39140U000900             59.3    2e-08   
emb|CDY17719.1|  BnaA06g35380D                                        59.3    2e-08   
ref|XP_001743838.1|  hypothetical protein                             56.6    2e-08   
gb|EPY72363.1|  hypothetical protein CB1_067070001                    55.8    2e-08   
ref|XP_009101401.1|  PREDICTED: heterogeneous nuclear ribonucleop...  58.9    2e-08   
gb|AAC41383.1|  RNA-binding protein AxRNBP                            56.6    3e-08   
ref|XP_004955730.1|  PREDICTED: heterogeneous nuclear ribonucleop...  59.3    3e-08   
dbj|BAB09088.1|  RNA-binding protein-like                             58.9    3e-08   
ref|XP_004495305.1|  PREDICTED: heterogeneous nuclear ribonucleop...  58.9    3e-08   
ref|XP_004955731.1|  PREDICTED: heterogeneous nuclear ribonucleop...  58.9    3e-08   
ref|XP_009405917.1|  PREDICTED: heterogeneous nuclear ribonucleop...  58.9    3e-08   
ref|NP_193166.2|  heterogeneous nuclear ribonucleoprotein 1           58.9    3e-08   
dbj|BAC27370.1|  unnamed protein product                              56.6    3e-08   
ref|XP_006666309.1|  RNA recognition protein, RNP-1                   58.9    3e-08   
ref|XP_006195343.1|  PREDICTED: cold-inducible RNA-binding protei...  55.5    3e-08   
emb|CDQ67899.1|  unnamed protein product                              55.8    3e-08   
ref|XP_003403287.1|  PREDICTED: RNA-binding protein Musashi homol...  56.2    3e-08   
gb|AAM63044.1|  RNA-binding protein-like                              58.5    3e-08   
ref|XP_011083052.1|  PREDICTED: heterogeneous nuclear ribonucleop...  58.5    3e-08   
ref|XP_010234806.1|  PREDICTED: heterogeneous nuclear ribonucleop...  58.5    4e-08   
ref|XP_002085238.1|  GD12423                                          58.2    4e-08   
ref|NP_568685.1|  RNA recognition motif-containing protein            58.5    4e-08   
ref|XP_009188588.1|  PREDICTED: RNA-binding protein Musashi homol...  55.8    4e-08   
ref|XP_004236665.1|  PREDICTED: heterogeneous nuclear ribonucleop...  58.5    4e-08   
ref|XP_009188589.1|  PREDICTED: RNA-binding protein Musashi homol...  55.8    4e-08   
ref|NP_001190485.1|  RNA recognition motif-containing protein         58.5    4e-08   
ref|NP_730245.2|  RNA-binding protein 6, isoform A                    58.2    4e-08   
ref|XP_001956784.1|  GF24401                                          58.2    4e-08   
ref|NP_001261979.1|  RNA-binding protein 6, isoform G                 58.2    4e-08   
ref|XP_001984346.1|  GH15068                                          58.2    4e-08   
ref|XP_002007249.1|  GI12835                                          58.2    4e-08   
emb|CDY41059.1|  BnaA09g18380D                                        58.5    4e-08   
ref|XP_002068946.1|  GK18043                                          58.2    4e-08   
ref|XP_010441434.1|  PREDICTED: heterogeneous nuclear ribonucleop...  58.5    4e-08   
ref|XP_006536536.1|  PREDICTED: RNA-binding protein Musashi homol...  56.2    4e-08   
ref|XP_006356068.1|  PREDICTED: heterogeneous nuclear ribonucleop...  58.5    4e-08   
ref|XP_010670958.1|  PREDICTED: heterogeneous nuclear ribonucleop...  58.2    4e-08   
ref|NP_001188270.1|  RNA-binding protein Musashi homolog 2 isoform 2  55.8    4e-08   
ref|XP_002135246.1|  GA23959                                          55.1    4e-08   
ref|XP_006414255.1|  hypothetical protein EUTSA_v10027322mg           58.2    5e-08   
ref|XP_007545999.1|  PREDICTED: RNA-binding protein Musashi homol...  55.8    5e-08   
ref|XP_009379302.1|  PREDICTED: heterogeneous nuclear ribonucleop...  55.5    5e-08   
gb|ABD64996.1|  RNA recognition motif. (a.k.a. RRM, RBD, or RNP d...  58.5    5e-08   
gb|ABD64922.1|  RNA recognition motif. (a.k.a. RRM, RBD, or RNP d...  58.2    5e-08   
ref|XP_008595147.1|  RNA recognition domain-containing protein        58.5    5e-08   
emb|CDQ85325.1|  unnamed protein product                              55.5    5e-08   
ref|XP_005471965.1|  PREDICTED: RNA-binding protein Musashi homol...  55.8    5e-08   
ref|XP_011057504.1|  PREDICTED: RNA-binding protein Musashi homol...  55.8    5e-08   
ref|XP_010768675.1|  PREDICTED: RNA-binding protein Musashi homol...  55.5    5e-08   
ref|NP_001097631.1|  RNA-binding protein 6, isoform B                 58.2    5e-08   
gb|EAW94507.1|  musashi homolog 2 (Drosophila), isoform CRA_b         55.8    6e-08   
ref|XP_002301858.2|  hypothetical protein POPTR_0002s26030g           58.2    6e-08   
ref|XP_007035222.1|  RNA-binding family protein isoform 1             58.2    6e-08   
gb|AAI52222.1|  Msi2b protein                                         55.8    6e-08   
ref|XP_006283695.1|  hypothetical protein CARUB_v10004759mg           58.2    6e-08   
emb|CDY25957.1|  BnaC09g20300D                                        58.2    6e-08   
gb|ACM08974.1|  DAZ-associated protein 1                              55.1    6e-08   
ref|XP_005471964.1|  PREDICTED: RNA-binding protein Musashi homol...  55.8    6e-08   
emb|CAG02993.1|  unnamed protein product                              55.5    6e-08   
ref|XP_006729905.1|  PREDICTED: RNA-binding protein Musashi homol...  55.8    6e-08   
ref|XP_009114263.1|  PREDICTED: heterogeneous nuclear ribonucleop...  57.8    6e-08   
gb|EYU33847.1|  hypothetical protein MIMGU_mgv1a008238mg              57.8    6e-08   
emb|CDY40554.1|  BnaC02g33380D                                        58.2    7e-08   
ref|XP_009188587.1|  PREDICTED: RNA-binding protein Musashi homol...  55.5    7e-08   
ref|XP_010481301.1|  PREDICTED: heterogeneous nuclear ribonucleop...  57.8    7e-08   
ref|XP_007801508.1|  hypothetical protein EPUS_04221                  58.2    7e-08   
ref|XP_008199696.1|  PREDICTED: RNA-binding protein Musashi homol...  57.4    8e-08   
ref|XP_008199697.1|  PREDICTED: RNA-binding protein Musashi homol...  57.4    8e-08   
ref|XP_006398459.1|  hypothetical protein EUTSA_v10000891mg           57.8    8e-08   
ref|XP_011024451.1|  PREDICTED: heterogeneous nuclear ribonucleop...  57.8    8e-08   
gb|EAW94509.1|  musashi homolog 2 (Drosophila), isoform CRA_d         55.5    8e-08   
ref|XP_008199695.1|  PREDICTED: RNA-binding protein Musashi homol...  57.4    8e-08   
ref|XP_006903158.1|  PREDICTED: putative RNA-binding protein 3        54.7    8e-08   
ref|XP_008199693.1|  PREDICTED: RNA-binding protein Musashi homol...  57.4    8e-08   
ref|XP_008199692.1|  PREDICTED: RNA-binding protein Musashi homol...  57.4    8e-08   
ref|XP_007144122.1|  hypothetical protein PHAVU_007G130600g           57.8    9e-08   
ref|XP_007035223.1|  RNA-binding family protein isoform 2             57.8    9e-08   
ref|XP_010771129.1|  PREDICTED: DAZ-associated protein 1 isoform X3   56.6    9e-08   
ref|XP_008199691.1|  PREDICTED: RNA-binding protein Musashi homol...  57.4    9e-08   
ref|XP_005987518.1|  PREDICTED: RNA-binding protein Musashi homol...  57.0    9e-08   
ref|XP_010771128.1|  PREDICTED: DAZ-associated protein 1 isoform X2   56.6    9e-08   
ref|XP_010771127.1|  PREDICTED: DAZ-associated protein 1 isoform X1   56.6    9e-08   
ref|XP_008331161.1|  PREDICTED: RNA-binding protein Musashi homol...  57.4    1e-07   
ref|XP_006298696.1|  hypothetical protein CARUB_v10014791mg           55.1    1e-07   
ref|XP_005155755.1|  PREDICTED: DAZ-associated protein 1 isoform X7   57.0    1e-07   
ref|XP_007887160.1|  PREDICTED: heterogeneous nuclear ribonucleop...  57.0    1e-07   
ref|XP_006280514.1|  hypothetical protein CARUB_v10026451mg           57.4    1e-07   
ref|XP_003536257.1|  PREDICTED: heterogeneous nuclear ribonucleop...  57.4    1e-07   
gb|AAI14332.1|  Dazap1 protein                                        57.0    1e-07   
gb|AAI53535.1|  Dazap1 protein                                        57.0    1e-07   
emb|CDQ83642.1|  unnamed protein product                              54.3    1e-07   
ref|XP_009304078.1|  PREDICTED: DAZ-associated protein 1 isoform X6   57.0    1e-07   
ref|XP_002837697.1|  hypothetical protein                             57.8    1e-07   
ref|XP_005531237.1|  PREDICTED: DAZ-associated protein 1              57.0    1e-07   
ref|XP_003051103.1|  hypothetical protein NECHADRAFT_41418            57.4    1e-07   
gb|EXK39131.1|  hypothetical protein FOMG_06555                       57.4    1e-07   
ref|NP_001166975.1|  DAZ-associated protein 1                         57.0    1e-07   
gb|EQL04000.1|  heterogeneous nuclear ribonucleoprotein HRP1          57.0    1e-07   



>ref|XP_002862696.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38954.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=87

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ L+DYFS+YGDVVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDR  41



>ref|XP_009790872.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Nicotiana sylvestris]
Length=464

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  80   EMTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            EM E+DLGKLFIGGISWDTDE+ LK+YFSSYG+VVEAVIMRDR
Sbjct  5    EMMETDLGKLFIGGISWDTDEERLKEYFSSYGEVVEAVIMRDR  47



>ref|XP_010327197.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Solanum lycopersicum]
Length=485

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 37/43 (86%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  80   EMTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            EM ESDLGKLF+GGISWDTDE  LK+YFSSYG+VVEAVIMRDR
Sbjct  14   EMMESDLGKLFVGGISWDTDEDRLKEYFSSYGEVVEAVIMRDR  56



>dbj|BAB08572.1| RNA-binding protein-like [Arabidopsis thaliana]
Length=473

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ L+DYFS+YGDVVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDR  41



>ref|XP_002866102.1| hypothetical protein ARALYDRAFT_495641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42361.1| hypothetical protein ARALYDRAFT_495641 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ L+DYFS+YGDVVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDR  41



>gb|AAM97088.1| RNA-binding protein-like [Arabidopsis thaliana]
Length=448

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ L+DYFS+YGDVVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDR  41



>ref|NP_568826.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 ref|NP_974937.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AAK92731.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AAM20100.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AED96646.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AED96647.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=460

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ L+DYFS+YGDVVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDR  41



>ref|NP_851195.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 ref|NP_001190546.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AED96645.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AED96648.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=448

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ L+DYFS+YGDVVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDR  41



>ref|XP_009790873.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Nicotiana sylvestris]
Length=459

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  83   MTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            M E+DLGKLFIGGISWDTDE+ LK+YFSSYG+VVEAVIMRDR
Sbjct  1    MMETDLGKLFIGGISWDTDEERLKEYFSSYGEVVEAVIMRDR  42



>ref|XP_009594583.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X1 [Nicotiana tomentosiformis]
Length=481

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/43 (86%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  80   EMTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            EM ESDLGKLFIGGISWDTDE  LK+YF SYG+VVEAVIMRDR
Sbjct  4    EMMESDLGKLFIGGISWDTDEDRLKEYFGSYGEVVEAVIMRDR  46



>ref|XP_004248330.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Solanum lycopersicum]
Length=471

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  83   MTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            M ESDLGKLF+GGISWDTDE  LK+YFSSYG+VVEAVIMRDR
Sbjct  1    MMESDLGKLFVGGISWDTDEDRLKEYFSSYGEVVEAVIMRDR  42



>ref|XP_006352533.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
tuberosum]
Length=471

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  83   MTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            M ESDLGKLFIGGISWDTDE  LK+YFSSYG+VVEAVIMRDR
Sbjct  1    MMESDLGKLFIGGISWDTDEDRLKEYFSSYGEVVEAVIMRDR  42



>ref|XP_010483006.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
Length=456

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLF+GGISWDTDE+ L+DYFS+YGDVVEAVIMRDR
Sbjct  2    ESDLGKLFVGGISWDTDEERLRDYFSNYGDVVEAVIMRDR  41



>ref|XP_010443192.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
 ref|XP_010443193.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
Length=457

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLF+GGISWDTDE+ L+DYFS+YGDVVEAVIMRDR
Sbjct  2    ESDLGKLFVGGISWDTDEERLRDYFSNYGDVVEAVIMRDR  41



>ref|XP_006280461.1| hypothetical protein CARUB_v10026394mg [Capsella rubella]
 ref|XP_006280462.1| hypothetical protein CARUB_v10026394mg [Capsella rubella]
 gb|EOA13359.1| hypothetical protein CARUB_v10026394mg [Capsella rubella]
 gb|EOA13360.1| hypothetical protein CARUB_v10026394mg [Capsella rubella]
Length=448

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ L+DYFS+YGDVVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDR  41



>ref|XP_006401444.1| hypothetical protein EUTSA_v10013607mg [Eutrema salsugineum]
 gb|ESQ42897.1| hypothetical protein EUTSA_v10013607mg [Eutrema salsugineum]
Length=431

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ L+DYFS YGDVVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEEKLRDYFSKYGDVVEAVIMRDR  41



>ref|XP_010449765.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
 ref|XP_010449773.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
 ref|XP_010449781.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
 ref|XP_010449789.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
Length=452

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLF+GGISWDTDE+ L+DYFS+YGDVVEAVIMRDR
Sbjct  2    ESDLGKLFVGGISWDTDEERLRDYFSNYGDVVEAVIMRDR  41



>ref|XP_009606206.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606208.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Nicotiana 
tomentosiformis]
Length=459

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  83   MTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            M E+D+GKLFIGGISWDTDE+ LK+YFSSYG+VVEAVIMRDR
Sbjct  1    MMETDMGKLFIGGISWDTDEERLKEYFSSYGEVVEAVIMRDR  42



>ref|XP_009765857.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
 ref|XP_009765858.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
 ref|XP_009765859.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
 ref|XP_009765860.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
Length=477

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  83   MTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            M ESDLGKLFIGGISWDTDE  LK+YF SYG+VVEAVIMRDR
Sbjct  1    MMESDLGKLFIGGISWDTDEDRLKEYFGSYGEVVEAVIMRDR  42



>ref|XP_011007099.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X3 [Populus euphratica]
Length=481

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YFS+YG+VVEAVIMRDR
Sbjct  5    ESDLGKLFIGGISWDTDEERLKEYFSNYGEVVEAVIMRDR  44



>ref|XP_006344882.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
tuberosum]
Length=475

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  83   MTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            M E+DLGKLFIGGISWDTDE+ LK+YF+SYG+VVEAVIMRDR
Sbjct  1    MMETDLGKLFIGGISWDTDEERLKEYFTSYGEVVEAVIMRDR  42



>ref|XP_011007096.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Populus euphratica]
Length=485

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YFS+YG+VVEAVIMRDR
Sbjct  5    ESDLGKLFIGGISWDTDEERLKEYFSNYGEVVEAVIMRDR  44



>ref|XP_011007097.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Populus euphratica]
Length=482

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YFS+YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFSNYGEVVEAVIMRDR  41



>ref|XP_009594584.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009594585.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X2 [Nicotiana tomentosiformis]
Length=477

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  83   MTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            M ESDLGKLFIGGISWDTDE  LK+YF SYG+VVEAVIMRDR
Sbjct  1    MMESDLGKLFIGGISWDTDEDRLKEYFGSYGEVVEAVIMRDR  42



>ref|XP_004251912.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
lycopersicum]
Length=475

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  83   MTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            M E+DLGKLFIGGISWDTDE+ LK+YF+SYG+V+EAVIMRDR
Sbjct  1    MMETDLGKLFIGGISWDTDEERLKEYFTSYGEVIEAVIMRDR  42



>emb|CBI26733.3| unnamed protein product [Vitis vinifera]
Length=309

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE  LK+YF +YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEDRLKEYFRTYGEVVEAVIMRDR  41



>ref|XP_002316761.1| hypothetical protein POPTR_0011s09050g [Populus trichocarpa]
 ref|XP_006377630.1| hypothetical protein POPTR_0011s09050g [Populus trichocarpa]
 gb|EEE97373.1| hypothetical protein POPTR_0011s09050g [Populus trichocarpa]
 gb|ERP55427.1| hypothetical protein POPTR_0011s09050g [Populus trichocarpa]
Length=478

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YFS YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFSKYGEVVEAVIMRDR  41



>ref|XP_006452507.1| hypothetical protein CICLE_v10008158mg [Citrus clementina]
 ref|XP_006452508.1| hypothetical protein CICLE_v10008158mg [Citrus clementina]
 ref|XP_006452509.1| hypothetical protein CICLE_v10008158mg [Citrus clementina]
 ref|XP_006452510.1| hypothetical protein CICLE_v10008158mg [Citrus clementina]
 gb|ESR65747.1| hypothetical protein CICLE_v10008158mg [Citrus clementina]
 gb|ESR65748.1| hypothetical protein CICLE_v10008158mg [Citrus clementina]
 gb|ESR65749.1| hypothetical protein CICLE_v10008158mg [Citrus clementina]
 gb|ESR65750.1| hypothetical protein CICLE_v10008158mg [Citrus clementina]
Length=477

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YFS YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFSRYGEVVEAVIMRDR  41



>ref|XP_006474951.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006474952.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Citrus sinensis]
 ref|XP_006474953.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X3 [Citrus sinensis]
 gb|KDO62194.1| hypothetical protein CISIN_1g009920mg [Citrus sinensis]
 gb|KDO62195.1| hypothetical protein CISIN_1g009920mg [Citrus sinensis]
Length=477

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YFS YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFSRYGEVVEAVIMRDR  41



>ref|XP_010545265.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010545266.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Tarenaya hassleriana]
Length=444

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ L++YFS YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLREYFSKYGEVVEAVIMRDR  41



>ref|XP_010545264.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Tarenaya hassleriana]
Length=448

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ L++YFS YG+VVEAVIMRDR
Sbjct  6    ESDLGKLFIGGISWDTDEERLREYFSKYGEVVEAVIMRDR  45



>emb|CDY36753.1| BnaA03g11330D [Brassica napus]
Length=435

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ L++YF++YGDVVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLREYFTNYGDVVEAVIMRDR  41



>ref|XP_011007622.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X3 [Populus euphratica]
Length=481

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YFS+YG+VVEAVIMRDR
Sbjct  5    ESDLGKLFIGGISWDTDEERLKEYFSNYGEVVEAVIMRDR  44



>ref|XP_002300356.2| hypothetical protein POPTR_0001s37230g [Populus trichocarpa]
 gb|EEE85161.2| hypothetical protein POPTR_0001s37230g [Populus trichocarpa]
Length=484

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YFS YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFSKYGEVVEAVIMRDR  41



>ref|XP_011007620.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Populus euphratica]
 ref|XP_011007621.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Populus euphratica]
Length=482

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YFS+YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFSNYGEVVEAVIMRDR  41



>ref|XP_011007619.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Populus euphratica]
Length=485

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YFS+YG+VVEAVIMRDR
Sbjct  5    ESDLGKLFIGGISWDTDEERLKEYFSNYGEVVEAVIMRDR  44



>ref|XP_009132374.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Brassica 
rapa]
 ref|XP_009132375.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Brassica 
rapa]
Length=433

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ L++YF++YGDVVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLREYFTNYGDVVEAVIMRDR  41



>emb|CDY11989.1| BnaC03g14150D [Brassica napus]
Length=432

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ L++YF++YGDVVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLREYFTNYGDVVEAVIMRDR  41



>gb|KDP39233.1| hypothetical protein JCGZ_00990 [Jatropha curcas]
Length=479

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YFS YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFSKYGEVVEAVIMRDR  41



>gb|KDO62196.1| hypothetical protein CISIN_1g009920mg [Citrus sinensis]
 gb|KDO62197.1| hypothetical protein CISIN_1g009920mg [Citrus sinensis]
 gb|KDO62198.1| hypothetical protein CISIN_1g009920mg [Citrus sinensis]
Length=522

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YFS YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFSRYGEVVEAVIMRDR  41



>ref|XP_010689542.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=98

 Score = 70.9 bits (172),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE  LK++F  YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDESRLKEFFGQYGEVVEAVIMRDR  41



>ref|XP_003551514.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Glycine max]
Length=479

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LKDYF  YG+V+EAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKDYFGKYGEVIEAVIMRDR  41



>gb|KEH33977.1| heterogeneous nuclear ribonucleoprotein 27C, putative [Medicago 
truncatula]
Length=478

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YF++YG+V+EAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFATYGEVIEAVIMRDR  41



>ref|XP_003600251.1| Heterogeneous nuclear ribonucleoprotein A1 [Medicago truncatula]
 gb|AES70502.1| heterogeneous nuclear ribonucleoprotein 27C, putative [Medicago 
truncatula]
Length=481

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YF++YG+V+EAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFATYGEVIEAVIMRDR  41



>ref|XP_010689539.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010689540.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010689541.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=125

 Score = 71.2 bits (173),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE  LK++F  YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDESRLKEFFGQYGEVVEAVIMRDR  41



>ref|XP_002529044.1| Heterogeneous nuclear ribonucleoprotein 27C, putative [Ricinus 
communis]
 gb|EEF33355.1| Heterogeneous nuclear ribonucleoprotein 27C, putative [Ricinus 
communis]
Length=478

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YFS YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFSKYGEVVEAVIMRDR  41



>gb|KHG28808.1| RNA-binding Musashi [Gossypium arboreum]
Length=513

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    DWVLIDATRTRCSSVSELRSA*FSR*EMTESDLGKLFIGGISWDTDEKSLKDYFSSYGDV  181
            D  + ++   +  SV  ++ +  +  +  ESDLGKLFIGGISWDTDE+ LK+YF  YG+V
Sbjct  10   DLTITNSVSDQILSVIHIKRSFLAADDKMESDLGKLFIGGISWDTDEERLKEYFRKYGEV  69

Query  182  VEAVIMRDR  208
            VEA+IMRDR
Sbjct  70   VEAMIMRDR  78



>ref|XP_010539319.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Tarenaya hassleriana]
Length=453

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLF+GGISWDTDE+ L+ YFS YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFVGGISWDTDEERLRGYFSKYGEVVEAVIMRDR  41



>ref|XP_010539320.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Tarenaya hassleriana]
Length=460

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLF+GGISWDTDE+ L+ YFS YG+VVEAVIMRDR
Sbjct  9    ESDLGKLFVGGISWDTDEERLRGYFSKYGEVVEAVIMRDR  48



>ref|XP_006575702.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Glycine max]
Length=481

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  80   EMTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+ ESDLGKLFIGGISWDTD++ LK+YF  YG+V+EAVIMRDR
Sbjct  3    ELMESDLGKLFIGGISWDTDDERLKEYFGKYGEVIEAVIMRDR  45



>ref|XP_010060242.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010060243.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010060244.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X1 [Eucalyptus grandis]
 gb|KCW66863.1| hypothetical protein EUGRSUZ_F00624 [Eucalyptus grandis]
Length=452

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YF SYG+VVEA+IMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFGSYGEVVEAMIMRDR  41



>ref|XP_010060245.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X2 [Eucalyptus grandis]
Length=449

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YF SYG+VVEA+IMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFGSYGEVVEAMIMRDR  41



>gb|KCW66864.1| hypothetical protein EUGRSUZ_F00624 [Eucalyptus grandis]
Length=454

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YF SYG+VVEA+IMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFGSYGEVVEAMIMRDR  41



>emb|CAN75218.1| hypothetical protein VITISV_003519 [Vitis vinifera]
Length=482

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE  LK+YF +YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEDRLKEYFRTYGEVVEAVIMRDR  41



>ref|XP_007142373.1| hypothetical protein PHAVU_008G274900g [Phaseolus vulgaris]
 gb|ESW14367.1| hypothetical protein PHAVU_008G274900g [Phaseolus vulgaris]
Length=490

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  80   EMTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E  ESDLGKLFIGGISWDTDE+ L++YF  YG+V+EAVIMRDR
Sbjct  10   EQMESDLGKLFIGGISWDTDEERLREYFGKYGEVIEAVIMRDR  52



>ref|XP_002274589.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Vitis vinifera]
Length=478

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE  LK+YF +YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEDRLKEYFRTYGEVVEAVIMRDR  41



>ref|XP_010097281.1| RNA-binding protein Musashi-2-like protein [Morus notabilis]
 gb|EXB67433.1| RNA-binding protein Musashi-2-like protein [Morus notabilis]
Length=487

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YF  YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDR  41



>ref|XP_007146589.1| hypothetical protein PHAVU_006G053000g [Phaseolus vulgaris]
 gb|ESW18583.1| hypothetical protein PHAVU_006G053000g [Phaseolus vulgaris]
Length=479

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YF  YG+V+EAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFGKYGEVIEAVIMRDR  41



>ref|XP_007146588.1| hypothetical protein PHAVU_006G053000g [Phaseolus vulgaris]
 gb|ESW18582.1| hypothetical protein PHAVU_006G053000g [Phaseolus vulgaris]
Length=481

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YF  YG+V+EAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFGKYGEVIEAVIMRDR  41



>ref|XP_010675870.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Beta vulgaris 
subsp. vulgaris]
Length=473

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE  LK+YF  YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDESRLKEYFGQYGEVVEAVIMRDR  41



>emb|CBI28407.3| unnamed protein product [Vitis vinifera]
Length=401

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SDLGKLFIGGISWDT+E  LKDYFS+YG+VVEAVIM+DR
Sbjct  2    QSDLGKLFIGGISWDTNEDRLKDYFSNYGEVVEAVIMKDR  41



>ref|XP_002272993.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Vitis vinifera]
 ref|XP_010657420.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Vitis vinifera]
Length=478

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SDLGKLFIGGISWDT+E  LKDYFS+YG+VVEAVIM+DR
Sbjct  2    QSDLGKLFIGGISWDTNEDRLKDYFSNYGEVVEAVIMKDR  41



>ref|XP_010270159.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Nelumbo nucifera]
Length=484

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  80   EMTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E  ESDLGKLFIGGISWDT+E  LK+YF SYG+VVEAVIM+DR
Sbjct  3    EKMESDLGKLFIGGISWDTNEDRLKEYFKSYGEVVEAVIMKDR  45



>emb|CDY46690.1| BnaA03g48180D [Brassica napus]
Length=428

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            SDLGKLFIGGISWDTDE+ L++YFS YGD+VE+VIMRDR
Sbjct  5    SDLGKLFIGGISWDTDEERLREYFSKYGDLVESVIMRDR  43



>gb|KHN43809.1| RNA-binding protein Musashi like Rbp6 [Glycine soja]
Length=502

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YF  YG+V+EAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFGKYGEVIEAVIMRDR  41



>ref|XP_007142374.1| hypothetical protein PHAVU_008G274900g [Phaseolus vulgaris]
 ref|XP_007142375.1| hypothetical protein PHAVU_008G274900g [Phaseolus vulgaris]
 gb|ESW14368.1| hypothetical protein PHAVU_008G274900g [Phaseolus vulgaris]
 gb|ESW14369.1| hypothetical protein PHAVU_008G274900g [Phaseolus vulgaris]
Length=479

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ L++YF  YG+V+EAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLREYFGKYGEVIEAVIMRDR  41



>ref|XP_004294459.1| PREDICTED: uncharacterized protein LOC101307182 [Fragaria vesca 
subsp. vesca]
Length=472

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E DLGK+FIGGISWDTDE+ LK+YF+ YG+VVEAVIMRDR
Sbjct  2    EPDLGKIFIGGISWDTDEEQLKEYFNKYGEVVEAVIMRDR  41



>ref|XP_006413156.1| hypothetical protein EUTSA_v10025172mg [Eutrema salsugineum]
 gb|ESQ54609.1| hypothetical protein EUTSA_v10025172mg [Eutrema salsugineum]
Length=453

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            SDLGKLFIGGISWDTDE+ L++YFS YGD+VEAVIMRDR
Sbjct  9    SDLGKLFIGGISWDTDEERLREYFSKYGDLVEAVIMRDR  47



>ref|XP_007020625.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 ref|XP_007020627.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 ref|XP_007020628.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY12150.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY12152.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY12153.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=474

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YF  YG+VVEA+IMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAMIMRDR  41



>ref|XP_008449079.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Cucumis 
melo]
 ref|XP_008449080.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Cucumis 
melo]
 ref|XP_008449082.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Cucumis 
melo]
 ref|XP_008449083.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Cucumis 
melo]
Length=480

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ L++YF  YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLREYFGQYGEVVEAVIMRDR  41



>ref|XP_007020626.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 ref|XP_007020629.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY12151.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY12154.1| RNA-binding family protein isoform 2 [Theobroma cacao]
Length=472

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YF  YG+VVEA+IMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAMIMRDR  41



>ref|XP_007020630.1| RNA-binding family protein isoform 6 [Theobroma cacao]
 gb|EOY12155.1| RNA-binding family protein isoform 6 [Theobroma cacao]
Length=481

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YF  YG+VVEA+IMRDR
Sbjct  9    ESDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAMIMRDR  48



>emb|CDX89316.1| BnaA01g15770D [Brassica napus]
Length=447

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            SDLGKLFIGGISWDTDE+ L++YFS++GD+VE+VIMRDR
Sbjct  31   SDLGKLFIGGISWDTDEERLREYFSNFGDLVESVIMRDR  69



>ref|XP_007212016.1| hypothetical protein PRUPE_ppa004834mg [Prunus persica]
 gb|EMJ13215.1| hypothetical protein PRUPE_ppa004834mg [Prunus persica]
Length=489

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E DLGKLFIGGISWDTDE+ LK+YF  YG+VVEAVIMRDR
Sbjct  2    EPDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDR  41



>ref|XP_010270160.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Nelumbo nucifera]
Length=480

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDT+E  LK+YF SYG+VVEAVIM+DR
Sbjct  2    ESDLGKLFIGGISWDTNEDRLKEYFKSYGEVVEAVIMKDR  41



>ref|XP_010908651.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X3 [Elaeis guineensis]
Length=478

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  83   MTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            M ESDLGKLFIGGISWDT+E  L++YF +YG+VVEAVIM+DR
Sbjct  1    MMESDLGKLFIGGISWDTNEDHLREYFKTYGEVVEAVIMKDR  42



>emb|CDP13750.1| unnamed protein product [Coffea canephora]
Length=475

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE  LK+YF ++G+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEDRLKEYFRAFGEVVEAVIMRDR  41



>ref|XP_010908650.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Elaeis guineensis]
Length=484

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  83   MTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            M ESDLGKLFIGGISWDT+E  L++YF +YG+VVEAVIM+DR
Sbjct  1    MMESDLGKLFIGGISWDTNEDHLREYFKTYGEVVEAVIMKDR  42



>ref|XP_007212015.1| hypothetical protein PRUPE_ppa004834mg [Prunus persica]
 gb|EMJ13214.1| hypothetical protein PRUPE_ppa004834mg [Prunus persica]
Length=476

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E DLGKLFIGGISWDTDE+ LK+YF  YG+VVEAVIMRDR
Sbjct  2    EPDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDR  41



>ref|XP_010908648.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010908649.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Elaeis guineensis]
Length=501

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  83   MTESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            M ESDLGKLFIGGISWDT+E  L++YF +YG+VVEAVIM+DR
Sbjct  1    MMESDLGKLFIGGISWDTNEDHLREYFKTYGEVVEAVIMKDR  42



>ref|XP_008227101.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Prunus 
mume]
 ref|XP_008227102.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Prunus 
mume]
Length=473

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E DLGKLFIGGISWDTDE+ LK+YF  YG+VVEAVIMRDR
Sbjct  2    EPDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDR  41



>ref|XP_009137608.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Brassica 
rapa]
Length=462

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            SDLGKLFIGGISWDTDE+ L++YFS YGD+VE+VIMRDR
Sbjct  9    SDLGKLFIGGISWDTDEERLREYFSKYGDLVESVIMRDR  47



>ref|XP_004506674.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Cicer 
arietinum]
Length=481

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YF  YG+V+EAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFVKYGEVIEAVIMRDR  41



>ref|XP_004149577.1| PREDICTED: uncharacterized protein LOC101220541 [Cucumis sativus]
 ref|XP_004165650.1| PREDICTED: uncharacterized protein LOC101224873 [Cucumis sativus]
 gb|KGN56055.1| hypothetical protein Csa_3G062570 [Cucumis sativus]
Length=480

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ L++YF  YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLREYFGHYGEVVEAVIMRDR  41



>ref|XP_010252687.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Nelumbo 
nucifera]
Length=477

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDT+E  LK+YF SYG+VVEAVIM+DR
Sbjct  2    ESDLGKLFIGGISWDTNEDRLKEYFKSYGEVVEAVIMKDR  41



>ref|XP_003544715.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Glycine max]
 ref|XP_006595704.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Glycine max]
Length=478

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTD++ LK+YF  YG+V+EAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDDERLKEYFGKYGEVIEAVIMRDR  41



>gb|KHG26657.1| RNA-binding Musashi Rbp6 [Gossypium arboreum]
Length=471

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YF  YG VVEA+IMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFGKYGAVVEAMIMRDR  41



>gb|KHN23872.1| RNA-binding protein Musashi like Rbp6 [Glycine soja]
Length=478

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTD++ LK+YF  YG+V+EAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDDERLKEYFGKYGEVIEAVIMRDR  41



>ref|XP_003519614.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Glycine max]
 gb|KHN43866.1| RNA-binding protein Musashi like Rbp6 [Glycine soja]
Length=477

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTD++ LK+YF  YG+V+EAVIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDDERLKEYFGKYGEVIEAVIMRDR  41



>ref|XP_006586118.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Glycine max]
Length=479

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YF  YG+V+E VIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFGKYGEVIETVIMRDR  41



>emb|CDX92807.1| BnaC07g40650D [Brassica napus]
Length=450

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            SDLGKLFIGGISWDTDE+ L++YFS YGD+VE+VIMRDR
Sbjct  5    SDLGKLFIGGISWDTDEERLREYFSKYGDLVESVIMRDR  43



>emb|CDY46689.1| BnaA03g48190D [Brassica napus]
Length=463

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            SDLGKLFIGGISWDTDE+ L++YFS YGD+VE+VIMRDR
Sbjct  5    SDLGKLFIGGISWDTDEERLREYFSKYGDLVESVIMRDR  43



>ref|XP_009795233.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
 ref|XP_009795234.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
Length=474

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SDLGKLFIGGISWDT+E+ LK+YFS+YG+V+EAVIM+DR
Sbjct  2    QSDLGKLFIGGISWDTNEERLKEYFSTYGEVLEAVIMKDR  41



>ref|XP_009631808.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009631809.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
tomentosiformis]
Length=474

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SDLGKLFIGGISWDT+E+ LK+YFS+YG+V+EAVIM+DR
Sbjct  2    QSDLGKLFIGGISWDTNEERLKEYFSTYGEVLEAVIMKDR  41



>gb|KHM99490.1| RNA-binding protein Musashi like Rbp6 [Glycine soja]
Length=512

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDTDE+ LK+YF  YG+V+E VIMRDR
Sbjct  2    ESDLGKLFIGGISWDTDEERLKEYFGKYGEVIETVIMRDR  41



>ref|XP_002869600.1| RNA recognition motif-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45859.1| RNA recognition motif-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=455

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  86   TESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            + SDLGKLFIGGISWDTDE+ L++YF  YGD+VEAVIMRDR
Sbjct  10   SASDLGKLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDR  50



>ref|XP_009606898.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606899.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606900.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Nicotiana 
tomentosiformis]
Length=454

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +S+LGKLF+GGISWDTDE+ LK+YFS+YG+V+EAVIM+DR
Sbjct  2    QSELGKLFVGGISWDTDEERLKEYFSTYGEVIEAVIMKDR  41



>ref|XP_006283675.1| hypothetical protein CARUB_v10004740mg [Capsella rubella]
 gb|EOA16573.1| hypothetical protein CARUB_v10004740mg [Capsella rubella]
Length=455

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            SDLGKLFIGGISWDTDE+ L++YF  YGD+VEAVIMRDR
Sbjct  12   SDLGKLFIGGISWDTDEERLREYFGKYGDLVEAVIMRDR  50



>emb|CAB43861.1| hnRNP-like protein [Arabidopsis thaliana]
 emb|CAB79520.1| hnRNP-like protein [Arabidopsis thaliana]
Length=524

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  86   TESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            + SDLGKLFIGGISWDTDE+ L++YF  YGD+VEAVIMRDR
Sbjct  3    SASDLGKLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDR  43



>ref|XP_006283677.1| hypothetical protein CARUB_v10004740mg [Capsella rubella]
 gb|EOA16575.1| hypothetical protein CARUB_v10004740mg [Capsella rubella]
Length=467

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            SDLGKLFIGGISWDTDE+ L++YF  YGD+VEAVIMRDR
Sbjct  12   SDLGKLFIGGISWDTDEERLREYFGKYGDLVEAVIMRDR  50



>gb|AAF13099.1|AC009176_26 putative RNA-binding protein, 3' partial [Arabidopsis thaliana]
Length=74

 Score = 66.6 bits (161),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>ref|XP_006283676.1| hypothetical protein CARUB_v10004740mg [Capsella rubella]
 gb|EOA16574.1| hypothetical protein CARUB_v10004740mg [Capsella rubella]
Length=464

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            SDLGKLFIGGISWDTDE+ L++YF  YGD+VEAVIMRDR
Sbjct  9    SDLGKLFIGGISWDTDEERLREYFGKYGDLVEAVIMRDR  47



>ref|XP_010433462.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Camelina sativa]
 ref|XP_010433463.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Camelina sativa]
 ref|XP_010433464.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X3 [Camelina sativa]
Length=458

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            SDLGKLFIGGISWDTDE+ L++YF  YGD+VEAVIMRDR
Sbjct  12   SDLGKLFIGGISWDTDEERLREYFGKYGDLVEAVIMRDR  50



>ref|XP_009802735.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Nicotiana 
sylvestris]
 ref|XP_009802736.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Nicotiana 
sylvestris]
Length=453

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +S+LGKLF+GGISWDTDE+ LK+YFS+YG+V+EAVIM+DR
Sbjct  2    QSELGKLFVGGISWDTDEERLKEYFSTYGEVIEAVIMKDR  41



>ref|XP_010438716.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
 ref|XP_010438717.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
Length=458

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            SDLGKLFIGGISWDTDE+ L++YF  YGD+VEAVIMRDR
Sbjct  12   SDLGKLFIGGISWDTDEERLREYFGKYGDLVEAVIMRDR  50



>ref|XP_010448232.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
 ref|XP_010448233.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
 ref|XP_010448234.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Camelina 
sativa]
Length=459

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            SDLGKLFIGGISWDTDE+ L++YF  YGD+VEAVIMRDR
Sbjct  12   SDLGKLFIGGISWDTDEERLREYFGKYGDLVEAVIMRDR  50



>ref|NP_567753.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AAL31937.1|AF419605_1 AT4g26650/T15N24_100 [Arabidopsis thaliana]
 gb|AAM19861.1| AT4g26650/T15N24_100 [Arabidopsis thaliana]
 gb|AEE85232.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=455

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  86   TESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            + SDLGKLFIGGISWDTDE+ L++YF  YGD+VEAVIMRDR
Sbjct  10   SASDLGKLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDR  50



>dbj|BAH19875.1| AT4G26650 [Arabidopsis thaliana]
Length=452

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  86   TESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            + SDLGKLFIGGISWDTDE+ L++YF  YGD+VEAVIMRDR
Sbjct  7    SASDLGKLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDR  47



>ref|NP_001031725.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AEE85233.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=452

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  86   TESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            + SDLGKLFIGGISWDTDE+ L++YF  YGD+VEAVIMRDR
Sbjct  7    SASDLGKLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDR  47



>ref|XP_008798476.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Phoenix 
dactylifera]
 ref|XP_008798477.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Phoenix 
dactylifera]
Length=478

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDT+E  L++YF S+GDVVEAVIM+DR
Sbjct  2    ESDLGKLFIGGISWDTNEDRLREYFESFGDVVEAVIMKDR  41



>ref|XP_002963878.1| hypothetical protein SELMODRAFT_4662, partial [Selaginella moellendorffii]
 ref|XP_002988281.1| hypothetical protein SELMODRAFT_4658, partial [Selaginella moellendorffii]
 gb|EFJ10700.1| hypothetical protein SELMODRAFT_4658, partial [Selaginella moellendorffii]
 gb|EFJ35749.1| hypothetical protein SELMODRAFT_4662, partial [Selaginella moellendorffii]
Length=188

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+D GKLFIGGISW+T E+ LKDYF +YG+VVE VIMRDR
Sbjct  2    ETDQGKLFIGGISWETTEEKLKDYFQAYGEVVETVIMRDR  41



>ref|XP_010536716.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X2 [Tarenaya hassleriana]
Length=456

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGG+SWDT E+ L++YF  YG+VVEAVIMRDR
Sbjct  2    ESDLGKLFIGGVSWDTGEERLREYFGKYGEVVEAVIMRDR  41



>ref|XP_010536715.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X1 [Tarenaya hassleriana]
Length=460

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGG+SWDT E+ L++YF  YG+VVEAVIMRDR
Sbjct  6    ESDLGKLFIGGVSWDTGEERLREYFGKYGEVVEAVIMRDR  45



>ref|XP_009364612.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364613.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364614.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364615.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364616.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=480

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E D GKLFIGGISWDTDE+ LK+YF  YG+VVEAVIMRDR
Sbjct  2    EPDHGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDR  41



>ref|XP_008379969.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
Length=481

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+VVEAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEERLKEYFSSFGEVVEAVIMKDR  41



>ref|XP_009380127.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
Length=497

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SDLGKLFIGGISWDT+E  L++YFS+YG+VVEAVIM+DR
Sbjct  2    QSDLGKLFIGGISWDTNEDRLREYFSNYGEVVEAVIMKDR  41



>ref|XP_009364669.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
 ref|XP_009364670.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
 ref|XP_009364671.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
Length=476

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E D GKLFIGGISWDTDE+ LK+YF  YG+VVEAVIMRDR
Sbjct  2    EPDHGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDR  41



>ref|XP_009364617.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=476

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E D GKLFIGGISWDTDE+ LK+YF  YG+VVEAVIMRDR
Sbjct  2    EPDHGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDR  41



>ref|XP_009361093.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
Length=476

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E D GKLFIGGISWDTDE+ LK+YF  YG+VVEAVIMRDR
Sbjct  2    EPDHGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDR  41



>ref|XP_008342216.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
 ref|XP_008362304.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
Length=475

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E D GKLFIGGISWDTDE+ LK+YF  YG+VVEAVIMRDR
Sbjct  2    EPDHGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDR  41



>ref|XP_008776924.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Phoenix dactylifera]
Length=496

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDT+E  L++YF +YG+VVEAVIM+DR
Sbjct  2    ESDLGKLFIGGISWDTNEDRLREYFKTYGEVVEAVIMKDR  41



>ref|XP_004243541.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Solanum 
lycopersicum]
 ref|XP_010323871.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Solanum 
lycopersicum]
 ref|XP_010323872.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Solanum 
lycopersicum]
Length=472

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SDLGKLFIGGISWDT+E+ LK+YFS+YG+V+EAVIM+DR
Sbjct  2    QSDLGKLFIGGISWDTNEERLKEYFSTYGEVLEAVIMKDR  41



>ref|XP_009390837.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390838.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
Length=477

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
             SDLGKLF+GGISWDTDE+ L++YF +YG+VVEAVIM+DR
Sbjct  2    RSDLGKLFVGGISWDTDEERLREYFRNYGEVVEAVIMKDR  41



>ref|XP_009365193.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009365194.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+VVEAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEERLKEYFSSFGEVVEAVIMKDR  41



>ref|XP_006363028.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006363029.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006363030.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X3 [Solanum tuberosum]
Length=472

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SDLGKLFIGGISWDT+E+ LK+YFS+YG+V+EAVIM+DR
Sbjct  2    QSDLGKLFIGGISWDTNEERLKEYFSTYGEVLEAVIMKDR  41



>ref|XP_009397215.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=463

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E DLGKLFIGGISWDT+E SL+ YFS++G+VVEAVIM+DR
Sbjct  2    EVDLGKLFIGGISWDTNEDSLRKYFSAFGEVVEAVIMKDR  41



>gb|ABF70162.1| RNA-binding protein, putative [Musa acuminata]
Length=465

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E DLGKLFIGGISWDT+E SL+ YFS++G+VVEAVIM+DR
Sbjct  2    EVDLGKLFIGGISWDTNEDSLRKYFSAFGEVVEAVIMKDR  41



>ref|XP_008776925.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Phoenix dactylifera]
Length=489

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDT+E  L++YF +YG+VVEAVIM+DR
Sbjct  2    ESDLGKLFIGGISWDTNEDRLREYFKTYGEVVEAVIMKDR  41



>emb|CDX94301.1| BnaC01g18830D [Brassica napus]
Length=442

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            SDLGKLFIGGISWDTDE+ L +YFS +GD+VE+VIMRDR
Sbjct  5    SDLGKLFIGGISWDTDEERLGEYFSKFGDLVESVIMRDR  43



>ref|XP_008379973.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
Length=483

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G VVEAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEERLKEYFSSFGXVVEAVIMKDR  41



>ref|XP_009404108.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009404109.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
Length=477

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SDLGKLFIGGISWDT+E  L++YF +YG+VVEAVIM+DR
Sbjct  2    QSDLGKLFIGGISWDTNEDRLREYFRNYGEVVEAVIMKDR  41



>ref|XP_007215319.1| hypothetical protein PRUPE_ppa005119mg [Prunus persica]
 gb|EMJ16518.1| hypothetical protein PRUPE_ppa005119mg [Prunus persica]
Length=476

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+VVEAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEERLKEYFSSFGEVVEAVIMKDR  41



>ref|XP_010112801.1| DAZ-associated protein 1 [Morus notabilis]
 gb|EXC34916.1| DAZ-associated protein 1 [Morus notabilis]
Length=603

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT E+ LK+YFS+YG+VVEAVIM+DR
Sbjct  104  QSDNGKLFIGGISWDTSEERLKEYFSAYGEVVEAVIMKDR  143



>ref|XP_009397214.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=498

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E DLGKLFIGGISWDT+E SL+ YFS++G+VVEAVIM+DR
Sbjct  37   EVDLGKLFIGGISWDTNEDSLRKYFSAFGEVVEAVIMKDR  76



>ref|XP_004251544.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
lycopersicum]
 ref|XP_010313682.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
lycopersicum]
Length=475

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            + DLGKLF+GGISWDTD++ LK+YFS+YG+VVEAVIM+DR
Sbjct  2    QVDLGKLFVGGISWDTDDERLKEYFSTYGEVVEAVIMKDR  41



>ref|XP_010273569.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nelumbo 
nucifera]
Length=408

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLF+GGISW+T+E +LKD+F  YGDVVE+VIMRDR
Sbjct  2    DSDQGKLFVGGISWETNENTLKDHFKKYGDVVESVIMRDR  41



>emb|CDY07975.1| BnaC03g35480D [Brassica napus]
Length=471

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDTDE+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDSGKLFIGGISWDTDEERLKEYFSSFGEVIEAVILKDR  41



>ref|XP_001766367.1| predicted protein [Physcomitrella patens]
 gb|EDQ68695.1| predicted protein [Physcomitrella patens]
Length=73

 Score = 64.3 bits (155),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISW+T E+ L+DYF SYG+VVE VIM+DR
Sbjct  2    DSDQGKLFIGGISWETTEEKLRDYFKSYGEVVETVIMKDR  41



>ref|XP_006836782.1| hypothetical protein AMTR_s00088p00174110 [Amborella trichopoda]
 gb|ERM99635.1| hypothetical protein AMTR_s00088p00174110 [Amborella trichopoda]
Length=472

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESD+GKLFIGGISW+T+E  LK+YF +YG++VEAVIM+DR
Sbjct  2    ESDMGKLFIGGISWETNEDRLKEYFKTYGEIVEAVIMKDR  41



>ref|XP_008464191.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Cucumis 
melo]
Length=476

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ++D GKLF+GGISWDTDE  LK+YF++YGDVVEAVIM+DR
Sbjct  2    QTDSGKLFVGGISWDTDEDRLKEYFNAYGDVVEAVIMKDR  41



>ref|XP_010907705.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Elaeis guineensis]
Length=487

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+DLGKLFIGG+SWDTD+  L++YF +YG+VVEAVIM+DR
Sbjct  2    ETDLGKLFIGGVSWDTDDDHLREYFRTYGEVVEAVIMKDR  41



>ref|XP_008342172.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
 ref|XP_008342173.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
Length=484

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+VVEAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEERLKEYFSSFGEVVEAVIMKDR  41



>ref|XP_006395215.1| hypothetical protein EUTSA_v10004139mg [Eutrema salsugineum]
 ref|XP_006395216.1| hypothetical protein EUTSA_v10004139mg [Eutrema salsugineum]
 gb|ESQ32501.1| hypothetical protein EUTSA_v10004139mg [Eutrema salsugineum]
 gb|ESQ32502.1| hypothetical protein EUTSA_v10004139mg [Eutrema salsugineum]
Length=472

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVIM+DR
Sbjct  2    QSDNGKLFIGGISWDTNEELLKEYFSSFGEVIEAVIMKDR  41



>ref|XP_006352009.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
tuberosum]
Length=474

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            + DLGKLF+GGISWDTD++ LK+YFS+YG+VVEAVIM+DR
Sbjct  2    QVDLGKLFVGGISWDTDDERLKEYFSTYGEVVEAVIMKDR  41



>ref|XP_010486352.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Camelina sativa]
 ref|XP_010486353.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Camelina sativa]
 ref|XP_010486354.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X3 [Camelina sativa]
Length=496

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>ref|XP_011097787.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Sesamum 
indicum]
Length=475

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+D GKLFIGGISWDT+E+ LK+YF +YG+VVEAVIMRDR
Sbjct  2    ETDQGKLFIGGISWDTNEERLKEYFGAYGEVVEAVIMRDR  41



>ref|XP_004140014.1| PREDICTED: uncharacterized protein LOC101222391 [Cucumis sativus]
 ref|XP_004162378.1| PREDICTED: uncharacterized protein LOC101227668 [Cucumis sativus]
 gb|KGN46587.1| hypothetical protein Csa_6G110300 [Cucumis sativus]
Length=476

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ++D GKLF+GGISWDTDE  LK+YF++YGDVVEAVIM+DR
Sbjct  2    QTDSGKLFVGGISWDTDEDRLKEYFNAYGDVVEAVIMKDR  41



>ref|XP_010524610.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Tarenaya 
hassleriana]
 ref|XP_010524611.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Tarenaya 
hassleriana]
Length=473

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVIM+DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVIMKDR  41



>ref|XP_002882552.1| hypothetical protein ARALYDRAFT_478119 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58811.1| hypothetical protein ARALYDRAFT_478119 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>ref|XP_002301585.1| heterogeneous nuclear ribonucleoprotein [Populus trichocarpa]
 gb|EEE80858.1| heterogeneous nuclear ribonucleoprotein [Populus trichocarpa]
Length=479

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LKDYF S+G+VVEAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEERLKDYFQSFGEVVEAVIMKDR  41



>ref|XP_009142599.1| PREDICTED: LOW QUALITY PROTEIN: heterogeneous nuclear ribonucleoprotein 
1 [Brassica rapa]
Length=431

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            S+LGKLFIGGISWDTDE+ L +YFS +GD+VE+VIMRDR
Sbjct  9    SNLGKLFIGGISWDTDEERLGEYFSKFGDLVESVIMRDR  47



>ref|XP_010936617.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Elaeis 
guineensis]
Length=478

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESDLGKLFIGGISWDT+E  L+ YF S+G+VVEAVIM+DR
Sbjct  2    ESDLGKLFIGGISWDTNEDRLRGYFESFGEVVEAVIMKDR  41



>ref|NP_566321.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AAL32012.1|AF436830_1 AT3g07810/F17A17_15 [Arabidopsis thaliana]
 gb|AAN12995.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AEE74606.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=494

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>ref|XP_006447738.1| hypothetical protein CICLE_v10015084mg [Citrus clementina]
 ref|XP_006469525.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Citrus sinensis]
 gb|ESR60978.1| hypothetical protein CICLE_v10015084mg [Citrus clementina]
Length=481

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFS+YG+VVEAVIM+DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSTYGEVVEAVIMKDR  41



>gb|AAF21191.1|AC013483_15 putative RNA-binding protein [Arabidopsis thaliana]
Length=492

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>gb|AAK92717.1| putative RNA-binding protein [Arabidopsis thaliana]
Length=494

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>ref|NP_850539.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AEE74607.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=495

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>gb|KDO58444.1| hypothetical protein CISIN_1g012289mg [Citrus sinensis]
Length=466

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFS+YG+VVEAVIM+DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSTYGEVVEAVIMKDR  41



>ref|XP_010464424.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Camelina sativa]
Length=495

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>ref|XP_010458039.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Camelina sativa]
Length=494

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>ref|XP_010457881.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Camelina sativa]
 ref|XP_010457959.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Camelina sativa]
Length=495

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>ref|XP_010464421.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Camelina sativa]
 ref|XP_010464423.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Camelina sativa]
Length=496

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>ref|XP_008342177.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
 ref|XP_008342178.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
Length=481

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+VVEAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEERLKEYFSSFGEVVEAVIMKDR  41



>emb|CDP04502.1| unnamed protein product [Coffea canephora]
Length=477

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E + GKLFIGGISWDTDEK L++YF ++GDVVEAVIM+DR
Sbjct  2    EMESGKLFIGGISWDTDEKRLREYFEAFGDVVEAVIMKDR  41



>gb|EMT31848.1| RNA-binding Musashi-2-like protein [Aegilops tauschii]
Length=463

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+D GKLFIGGISWDT+E  L++YF  YG+VVEAVIMRDR
Sbjct  2    EADAGKLFIGGISWDTNEDRLREYFEKYGEVVEAVIMRDR  41



>ref|XP_010688996.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Beta vulgaris 
subsp. vulgaris]
Length=476

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SDLGKLFIGGISW+T+E+ LK+YFS++G+V+EAVIM+DR
Sbjct  2    QSDLGKLFIGGISWETNEERLKEYFSTFGEVIEAVIMKDR  41



>tpg|DAA41246.1| TPA: hypothetical protein ZEAMMB73_495774 [Zea mays]
Length=132

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+D GKLF+GGISW+TDE  L++YF  +GDV EAVIMRDR
Sbjct  2    EADSGKLFVGGISWETDEDRLREYFGRFGDVTEAVIMRDR  41



>ref|XP_009380131.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=481

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SDLGKLFIGGISWDT+E  L++YF ++G+VVEAVIM+DR
Sbjct  2    QSDLGKLFIGGISWDTNEDRLREYFGNFGEVVEAVIMKDR  41



>gb|KHG02993.1| DAZ-associated 1 [Gossypium arboreum]
Length=494

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            S+ GKLFIGGISWDT+E+ LK+YF SYG+VVEAVIM+DR
Sbjct  2    SEYGKLFIGGISWDTNEQRLKEYFDSYGEVVEAVIMKDR  40



>ref|XP_007049271.1| HnRNP isoform 1 [Theobroma cacao]
 gb|EOX93428.1| HnRNP isoform 1 [Theobroma cacao]
Length=477

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            S+ GKLFIGGISWDT+E+ LK+YFSS+G+VVEAVIM+DR
Sbjct  2    SENGKLFIGGISWDTNEERLKEYFSSFGEVVEAVIMKDR  40



>gb|EYU33694.1| hypothetical protein MIMGU_mgv1a005066mg [Erythranthe guttata]
Length=498

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+D GKLFIGGISWDT+E  L++YF +YG+VVEAVIMRDR
Sbjct  2    ETDQGKLFIGGISWDTNEDRLREYFGAYGEVVEAVIMRDR  41



>ref|XP_010557695.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Tarenaya 
hassleriana]
Length=467

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFS++G+VVEAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEECLKEYFSNFGEVVEAVIMKDR  41



>ref|XP_011039340.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
 ref|XP_011039341.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
Length=479

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LKDYF S+G+VVEAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEERLKDYFQSFGEVVEAVIMKDR  41



>ref|XP_010264924.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nelumbo 
nucifera]
Length=467

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT E  LK+YFS YG+VV+ VIMRD+
Sbjct  2    DSDQGKLFIGGISWDTSEDKLKEYFSKYGEVVQTVIMRDK  41



>ref|XP_004293446.1| PREDICTED: uncharacterized protein LOC101313871 [Fragaria vesca 
subsp. vesca]
Length=473

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFS++G+VVEAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEERLKEYFSAFGEVVEAVIMKDR  41



>ref|XP_009380128.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009380130.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=490

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SDLGKLFIGGISWDT+E  L++YF ++G+VVEAVIM+DR
Sbjct  2    QSDLGKLFIGGISWDTNEDRLREYFGNFGEVVEAVIMKDR  41



>ref|XP_007026293.1| RNA-binding family protein isoform 3 [Theobroma cacao]
 gb|EOY28915.1| RNA-binding family protein isoform 3 [Theobroma cacao]
Length=497

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E +LGKLFIGGISWDT+E  L++YF ++GDVVEAVIMRDR
Sbjct  2    EMELGKLFIGGISWDTNEDRLREYFQAFGDVVEAVIMRDR  41



>gb|EMS61711.1| RNA-binding protein Musashi-like protein 2 [Triticum urartu]
Length=463

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+D GKLFIGGISWDT+E  L++YF  YG+VVEAVIMRDR
Sbjct  2    EADAGKLFIGGISWDTNEDRLREYFEKYGEVVEAVIMRDR  41



>ref|NP_001068335.1| Os11g0637700 [Oryza sativa Japonica Group]
 gb|ABA94921.2| RNA-binding protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28698.1| Os11g0637700 [Oryza sativa Japonica Group]
 dbj|BAG92021.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97349.1| unnamed protein product [Oryza sativa Japonica Group]
Length=467

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+D GKLFIGGISWDT+E  L++YF  YG+VVEAVIMRDR
Sbjct  2    EADAGKLFIGGISWDTNEDRLREYFDKYGEVVEAVIMRDR  41



>ref|XP_003577309.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Brachypodium 
distachyon]
 ref|XP_010237506.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Brachypodium 
distachyon]
Length=463

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+D GKLFIGGISWDT+E  L++YF  YG+VVEAVIMRDR
Sbjct  2    EADAGKLFIGGISWDTNEDRLREYFEKYGEVVEAVIMRDR  41



>ref|XP_007142507.1| hypothetical protein PHAVU_008G286500g [Phaseolus vulgaris]
 gb|ESW14501.1| hypothetical protein PHAVU_008G286500g [Phaseolus vulgaris]
Length=479

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ L++YFS+YG+VVEAVIM+DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLREYFSTYGEVVEAVIMKDR  41



>ref|XP_006663067.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Oryza 
brachyantha]
Length=462

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+D GKLFIGGISWDT+E  L++YF  YG+VVEAVIMRDR
Sbjct  2    EADAGKLFIGGISWDTNEDRLREYFDKYGEVVEAVIMRDR  41



>ref|XP_006407794.1| hypothetical protein EUTSA_v10020586mg [Eutrema salsugineum]
 gb|ESQ49247.1| hypothetical protein EUTSA_v10020586mg [Eutrema salsugineum]
Length=494

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>ref|XP_006407795.1| hypothetical protein EUTSA_v10020586mg [Eutrema salsugineum]
 gb|ESQ49248.1| hypothetical protein EUTSA_v10020586mg [Eutrema salsugineum]
Length=495

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>ref|XP_006595660.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Glycine 
max]
Length=479

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ L++YFS+YG+VVEAVIM+DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLREYFSTYGEVVEAVIMKDR  41



>ref|XP_008229871.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Prunus 
mume]
 ref|XP_008229872.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Prunus 
mume]
Length=476

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFS++G+VVEAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEERLKEYFSTFGEVVEAVIMKDR  41



>ref|XP_011003504.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
 ref|XP_011003505.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
 ref|XP_011003506.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
 ref|XP_011003507.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
Length=482

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDTDE+ LK YF S+G+VVEAVIM+DR
Sbjct  2    QSDNGKLFIGGISWDTDEERLKGYFQSFGEVVEAVIMKDR  41



>ref|XP_009147022.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Brassica rapa]
Length=500

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFS++G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSTFGEVIEAVILKDR  41



>ref|XP_009147023.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Brassica rapa]
Length=498

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFS++G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSTFGEVIEAVILKDR  41



>ref|XP_007215320.1| hypothetical protein PRUPE_ppa005132mg [Prunus persica]
 gb|EMJ16519.1| hypothetical protein PRUPE_ppa005132mg [Prunus persica]
Length=476

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFS++G+VVEAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEERLKEYFSTFGEVVEAVIMKDR  41



>ref|XP_011095499.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Sesamum 
indicum]
Length=476

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E D GKLFIGGISWDT+E  LK+YF +YG VVEAVIMRDR
Sbjct  2    EVDQGKLFIGGISWDTNEDRLKEYFGAYGKVVEAVIMRDR  41



>emb|CDX74030.1| BnaA03g30170D [Brassica napus]
Length=472

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDSGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>ref|XP_010909449.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Elaeis 
guineensis]
 ref|XP_010909450.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Elaeis 
guineensis]
 ref|XP_010909451.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Elaeis 
guineensis]
Length=476

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESD GKLFIGGISWDT+E  L++YF S+G+VVEAVIM+DR
Sbjct  2    ESDNGKLFIGGISWDTNEDRLREYFKSFGEVVEAVIMKDR  41



>gb|ADK92872.1| hnRNP [Hypericum perforatum]
Length=477

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLF+GGISWDT+E+ LK+YF S+GDVVEAVIM+DR
Sbjct  2    QSDNGKLFVGGISWDTNEERLKEYFGSFGDVVEAVIMKDR  41



>ref|XP_009124131.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Brassica rapa]
Length=485

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>gb|KHN46912.1| DAZ-associated protein 1 [Glycine soja]
Length=496

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ L++YFS+YG+VVEAVIM+DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLREYFSTYGEVVEAVIMKDR  41



>ref|XP_009124116.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Brassica rapa]
 ref|XP_009124125.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Brassica rapa]
Length=486

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>emb|CDY22136.1| BnaC01g39650D [Brassica napus]
Length=486

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>emb|CDY35966.1| BnaA05g29840D [Brassica napus]
Length=494

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFS++G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSTFGEVIEAVILKDR  41



>ref|XP_009134994.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Brassica 
rapa]
 ref|XP_009134995.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Brassica 
rapa]
Length=471

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFSS+G+V+EAVI++DR
Sbjct  2    QSDSGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR  41



>emb|CDY66272.1| BnaC05g52200D [Brassica napus]
Length=489

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFS++G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFSTFGEVIEAVILKDR  41



>gb|EPS59033.1| hypothetical protein M569_15778, partial [Genlisea aurea]
Length=335

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E + GKLFIGGISWDT+E  LK+YF +YG+V+EAVIMRDR
Sbjct  8    EMEQGKLFIGGISWDTNEDRLKEYFGAYGEVIEAVIMRDR  47



>ref|XP_010057821.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Eucalyptus 
grandis]
 gb|KCW75151.1| hypothetical protein EUGRSUZ_E03898 [Eucalyptus grandis]
Length=467

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E D GKLF+GGISWDT+E  L+DYF ++G+VVEAVIMRDR
Sbjct  2    EMDHGKLFVGGISWDTNEDRLRDYFQNFGEVVEAVIMRDR  41



>ref|XP_009365188.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
 ref|XP_009365189.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
Length=483

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YFS +G+VVEAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEERLKEYFSGFGEVVEAVIMKDR  41



>dbj|BAK01877.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+D GKLFIGGISWDT+E  L++YF  YG+VVEAVIMRDR
Sbjct  2    EADAGKLFIGGISWDTNEDRLREYFEKYGEVVEAVIMRDR  41



>gb|EAZ19017.1| hypothetical protein OsJ_34549 [Oryza sativa Japonica Group]
Length=481

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+D GKLFIGGISWDT+E  L++YF  YG+VVEAVIMRDR
Sbjct  2    EADAGKLFIGGISWDTNEDRLREYFDKYGEVVEAVIMRDR  41



>ref|XP_010262417.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Nelumbo 
nucifera]
Length=461

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLF+GGISWDT E+ LK+YF +YG+VV+ VIMRD+
Sbjct  2    DSDQGKLFVGGISWDTSEEKLKEYFGNYGEVVQTVIMRDK  41



>ref|XP_006857074.1| hypothetical protein AMTR_s00065p00083440 [Amborella trichopoda]
 gb|ERN18541.1| hypothetical protein AMTR_s00065p00083440 [Amborella trichopoda]
Length=385

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLF+GGISW+T+E+ LKD+F  YG+V++AVIMRDR
Sbjct  2    DSDQGKLFVGGISWETNEEILKDHFKQYGEVLDAVIMRDR  41



>ref|XP_007026295.1| RNA-binding family protein isoform 5 [Theobroma cacao]
 gb|EOY28917.1| RNA-binding family protein isoform 5 [Theobroma cacao]
Length=482

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E +LGKLFIGGISWDT+E  L++YF ++GDVVEAVIMRDR
Sbjct  2    EMELGKLFIGGISWDTNEDRLREYFQAFGDVVEAVIMRDR  41



>ref|XP_002320502.2| hypothetical protein POPTR_0014s15970g [Populus trichocarpa]
 gb|EEE98817.2| hypothetical protein POPTR_0014s15970g [Populus trichocarpa]
Length=479

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDTDE+ LK YF S+G+VVEAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTDEERLKGYFRSFGEVVEAVIMKDR  41



>ref|XP_007026291.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 ref|XP_007026292.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY28913.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY28914.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=476

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E +LGKLFIGGISWDT+E  L++YF ++GDVVEAVIMRDR
Sbjct  2    EMELGKLFIGGISWDTNEDRLREYFQAFGDVVEAVIMRDR  41



>ref|XP_010035445.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Eucalyptus 
grandis]
 ref|XP_010035446.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Eucalyptus 
grandis]
 gb|KCW46850.1| hypothetical protein EUGRSUZ_K00657 [Eucalyptus grandis]
 gb|KCW46851.1| hypothetical protein EUGRSUZ_K00657 [Eucalyptus grandis]
 gb|KCW46852.1| hypothetical protein EUGRSUZ_K00657 [Eucalyptus grandis]
Length=467

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YF +YG+VVEA+IM+DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFGAYGEVVEAIIMKDR  41



>ref|XP_004979810.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Setaria 
italica]
Length=461

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+D GKLFIGGISWDT+E  L++YF  YG+VVEAVIMRDR
Sbjct  2    EADAGKLFIGGISWDTNEDRLREYFDKYGEVVEAVIMRDR  41



>ref|XP_001757549.1| predicted protein [Physcomitrella patens]
 gb|EDQ77606.1| predicted protein [Physcomitrella patens]
Length=96

 Score = 63.2 bits (152),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISW+T E+ L+DYF SYG+V E VIM+DR
Sbjct  2    DSDQGKLFIGGISWETTEEKLRDYFKSYGEVAETVIMKDR  41



>ref|XP_004293449.1| PREDICTED: uncharacterized protein LOC101314729 [Fragaria vesca 
subsp. vesca]
Length=471

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E  LK+YFS++G+VVEAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEDRLKEYFSTFGEVVEAVIMKDR  41



>ref|XP_001757547.1| predicted protein [Physcomitrella patens]
 gb|EDQ77604.1| predicted protein [Physcomitrella patens]
Length=93

 Score = 62.8 bits (151),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISW+T E+ L+DYF SYG+V E VIM+DR
Sbjct  2    DSDQGKLFIGGISWETTEEKLRDYFKSYGEVAETVIMKDR  41



>gb|KDP29893.1| hypothetical protein JCGZ_18462 [Jatropha curcas]
Length=478

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YF S+G+VVEAVIM+DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFGSFGEVVEAVIMKDR  41



>ref|XP_006373597.1| hypothetical protein POPTR_0016s01150g [Populus trichocarpa]
 gb|ERP51394.1| hypothetical protein POPTR_0016s01150g [Populus trichocarpa]
Length=477

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E +LGKLFIGGISWDT+E  LK+YF ++GDV+EAVIM+DR
Sbjct  2    EMELGKLFIGGISWDTNEDRLKEYFRAFGDVLEAVIMKDR  41



>ref|XP_011040202.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
Length=477

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E +LGKLFIGGISWDT+E  LK+YF ++GDV+EAVIM+DR
Sbjct  2    EMELGKLFIGGISWDTNEDRLKEYFRAFGDVLEAVIMKDR  41



>ref|XP_002532010.1| Heterogeneous nuclear ribonucleoprotein 27C, putative [Ricinus 
communis]
 gb|EEF30383.1| Heterogeneous nuclear ribonucleoprotein 27C, putative [Ricinus 
communis]
Length=484

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YF S+G+VVEAVIM+DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFGSFGEVVEAVIMKDR  41



>gb|KDP40375.1| hypothetical protein JCGZ_02373 [Jatropha curcas]
Length=466

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISW+T E+ LKDYF+ YGDV++ V+MRD+
Sbjct  2    DSDQGKLFIGGISWETTEEKLKDYFTQYGDVLQTVVMRDK  41



>ref|XP_006297510.1| hypothetical protein CARUB_v10013535mg [Capsella rubella]
 gb|EOA30408.1| hypothetical protein CARUB_v10013535mg [Capsella rubella]
Length=495

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YF S+G+V+EAVI++DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLKEYFGSFGEVIEAVILKDR  41



>gb|EYU18292.1| hypothetical protein MIMGU_mgv1a0092212mg, partial [Erythranthe 
guttata]
Length=74

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISW+T+E+ LK++F  YGDV++AV+MRD+
Sbjct  2    DSDQGKLFIGGISWETNEERLKEHFHGYGDVLQAVVMRDK  41



>ref|XP_010557774.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Tarenaya 
hassleriana]
Length=475

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWD +E+ LK+YFSS+G+V+EAVIM+DR
Sbjct  2    QSDNGKLFIGGISWDANEERLKEYFSSFGEVIEAVIMKDR  41



>ref|XP_002972014.1| hypothetical protein SELMODRAFT_172407, partial [Selaginella 
moellendorffii]
 ref|XP_002972551.1| hypothetical protein SELMODRAFT_172861, partial [Selaginella 
moellendorffii]
 gb|EFJ26637.1| hypothetical protein SELMODRAFT_172861, partial [Selaginella 
moellendorffii]
 gb|EFJ26931.1| hypothetical protein SELMODRAFT_172407, partial [Selaginella 
moellendorffii]
Length=167

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GK+F+GG+SW+T ++ LK+YF SYGDVVEA+IM+DR
Sbjct  2    DSDQGKIFVGGVSWETTDEKLKEYFQSYGDVVEAMIMKDR  41



>ref|XP_003519672.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Glycine max]
 ref|XP_006575746.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Glycine max]
Length=475

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ L++YF +YG+VVEAVIM+DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLREYFCTYGEVVEAVIMKDR  41



>ref|XP_002974297.1| hypothetical protein SELMODRAFT_101375, partial [Selaginella 
moellendorffii]
 ref|XP_002985671.1| hypothetical protein SELMODRAFT_122630, partial [Selaginella 
moellendorffii]
 gb|EFJ13249.1| hypothetical protein SELMODRAFT_122630, partial [Selaginella 
moellendorffii]
 gb|EFJ24519.1| hypothetical protein SELMODRAFT_101375, partial [Selaginella 
moellendorffii]
Length=187

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            ESD GKLFIGGISW+T E+ L+DYF  YG++ E +IM+DR
Sbjct  2    ESDQGKLFIGGISWETTEEQLRDYFQRYGEIAETMIMKDR  41



>gb|KHN43959.1| DAZ-associated protein 1 [Glycine soja]
Length=479

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ L++YF +YG+VVEAVIM+DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLREYFCTYGEVVEAVIMKDR  41



>gb|KHG03345.1| RNA-binding Musashi Rbp6 [Gossypium arboreum]
Length=481

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            S+ GKLFIGGISWDT+E+ LK+YFSS+G+VVEAVIM+DR
Sbjct  2    SENGKLFIGGISWDTNEERLKEYFSSFGEVVEAVIMKDR  40



>gb|ABY56086.1| putative heterogeneous nuclear ribonucleoprotein [Cucumis melo]
Length=74

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISW+T E  LKDYFS+YG+V+  V+MRD+
Sbjct  2    DSDQGKLFIGGISWETSEDKLKDYFSNYGEVMHTVVMRDK  41



>ref|XP_003617976.1| Heterogeneous nuclear ribonucleoprotein A1, A2/B1-like protein 
[Medicago truncatula]
 gb|AET00935.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=479

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ L++YFS+YG+V EAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEERLREYFSTYGEVKEAVIMKDR  41



>ref|XP_006467314.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006467315.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Citrus sinensis]
 gb|KDO78482.1| hypothetical protein CISIN_1g011518mg [Citrus sinensis]
 gb|KDO78483.1| hypothetical protein CISIN_1g011518mg [Citrus sinensis]
 gb|KDO78484.1| hypothetical protein CISIN_1g011518mg [Citrus sinensis]
Length=475

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E +LGKLFIGGISWDT+E  L+DYF ++G+V+EAVIM+DR
Sbjct  2    EMELGKLFIGGISWDTNEDRLRDYFQAFGEVLEAVIMKDR  41



>gb|KHG03317.1| RNA-binding Musashi [Gossypium arboreum]
Length=484

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  92   SDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            S  GKLFIGGISWDT+E+ LK+YFS++G+VVEAVIM+DR
Sbjct  2    SGNGKLFIGGISWDTNEERLKEYFSTFGEVVEAVIMKDR  40



>ref|XP_006449887.1| hypothetical protein CICLE_v10015098mg [Citrus clementina]
 ref|XP_006449888.1| hypothetical protein CICLE_v10015098mg [Citrus clementina]
 gb|ESR63127.1| hypothetical protein CICLE_v10015098mg [Citrus clementina]
 gb|ESR63128.1| hypothetical protein CICLE_v10015098mg [Citrus clementina]
Length=475

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E +LGKLFIGGISWDT+E  L+DYF ++G+V+EAVIM+DR
Sbjct  2    EMELGKLFIGGISWDTNEDRLRDYFQAFGEVLEAVIMKDR  41



>ref|XP_010532987.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Tarenaya 
hassleriana]
Length=485

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ LK+YF+++G+VVEA+IM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEECLKEYFANFGEVVEALIMKDR  41



>gb|KDO78485.1| hypothetical protein CISIN_1g011518mg [Citrus sinensis]
Length=484

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E +LGKLFIGGISWDT+E  L+DYF ++G+V+EAVIM+DR
Sbjct  2    EMELGKLFIGGISWDTNEDRLRDYFQAFGEVLEAVIMKDR  41



>ref|XP_010920312.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Elaeis 
guineensis]
Length=463

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISW+T E+ +K+YFS+YG+V++ VIMRD+
Sbjct  2    DSDQGKLFIGGISWETTEEKMKEYFSNYGEVLQTVIMRDK  41



>ref|NP_001060120.1| Os07g0584500 [Oryza sativa Japonica Group]
 dbj|BAC55617.2| putative heterogeneous nuclear ribonucleoprotein A1 [Oryza sativa 
Japonica Group]
 dbj|BAF22034.1| Os07g0584500 [Oryza sativa Japonica Group]
 dbj|BAG90564.1| unnamed protein product [Oryza sativa Japonica Group]
Length=472

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+D GKLF+GGISW+TDE  L++YFS +G+V EAVIMRDR
Sbjct  2    EADSGKLFVGGISWETDEDRLREYFSRFGEVTEAVIMRDR  41



>ref|XP_003594254.1| RNA-binding protein, putative [Medicago truncatula]
Length=522

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E D GKLFIGGISWDT+E  L+ YF ++GDVVEAVIM+DR
Sbjct  41   EMDPGKLFIGGISWDTNEDRLRQYFQNFGDVVEAVIMKDR  80



>ref|XP_004491591.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Cicer 
arietinum]
Length=481

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ L++YFS+YG+V EAVIM+DR
Sbjct  2    QSDNGKLFIGGISWDTNEERLREYFSTYGEVKEAVIMKDR  41



>gb|ABY56098.1| putative heterogeneous nuclear ribonucleoprotein [Cucumis sativus]
Length=79

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISW+T E  LKDYFS+YG+V+  V+MRD+
Sbjct  2    DSDQGKLFIGGISWETSEDKLKDYFSNYGEVMHTVVMRDK  41



>gb|KEH28480.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=493

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISWDT+E+ L++YFS+YG+V EAVIM+DR
Sbjct  2    QSDSGKLFIGGISWDTNEERLREYFSTYGEVKEAVIMKDR  41



>dbj|BAJ88758.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=471

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+D GKLF+GGISW+TDE  L+DYF  +G+V EAVIMRDR
Sbjct  2    EADSGKLFVGGISWETDEDRLRDYFGRFGEVTEAVIMRDR  41



>dbj|BAJ94498.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=494

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E+D GKLF+GGISW+TDE  L+DYF  +G+V EAVIMRDR
Sbjct  25   EADSGKLFVGGISWETDEDRLRDYFGRFGEVTEAVIMRDR  64



>ref|XP_011041422.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
Length=456

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISW+T E+ L+DYF  YGDV++AV+M+D+
Sbjct  2    DSDQGKLFIGGISWETSEEKLRDYFGQYGDVLQAVVMKDK  41



>gb|KHG02324.1| RNA-binding Musashi [Gossypium arboreum]
Length=476

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E +LGKLFIGGISWDT+E  L++YF ++G+VVEAVIM+DR
Sbjct  2    EMELGKLFIGGISWDTNEDRLREYFQTFGEVVEAVIMKDR  41



>ref|XP_009358003.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
Length=467

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISW+T E  LK+YFS+YGDV++ V+MRD+
Sbjct  2    DSDQGKLFIGGISWETSEDKLKEYFSNYGDVLQTVVMRDK  41



>ref|XP_008340642.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Malus domestica]
Length=467

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISW+T E  LK+YFS+YGDV++ V+MRD+
Sbjct  2    DSDQGKLFIGGISWETSEDKLKEYFSNYGDVLQTVVMRDK  41



>ref|XP_007222942.1| hypothetical protein PRUPE_ppa005309mg [Prunus persica]
 gb|EMJ24141.1| hypothetical protein PRUPE_ppa005309mg [Prunus persica]
Length=467

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            +SD GKLFIGGISW+T E  LK+YFS+YGDV++ V+MRD+
Sbjct  2    DSDQGKLFIGGISWETSEDKLKEYFSNYGDVLQTVVMRDK  41



>gb|EYU27413.1| hypothetical protein MIMGU_mgv1a005325mg [Erythranthe guttata]
Length=488

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  89   ESDLGKLFIGGISWDTDEKSLKDYFSSYGDVVEAVIMRDR  208
            E D GKLFIGGISWDT+E  L+++F +YG VVEAVIMRDR
Sbjct  2    EMDQGKLFIGGISWDTNEDRLREHFGAYGQVVEAVIMRDR  41



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514307204152