BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19526_g1_i1 len=980 path=[1:0-434 @436@!:435-902 908:903-979]

Length=980
                                                                      Score     E

ref|XP_010262522.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     130   2e-31   
ref|XP_011089481.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    130   2e-31   
ref|XP_009622236.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    128   6e-31   
ref|XP_009799102.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    128   6e-31   
ref|XP_011035298.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    127   1e-30   
ref|XP_009622237.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    127   2e-30   
ref|XP_002299869.1|  hypothetical protein POPTR_0001s24810g             127   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_009799103.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    127   2e-30   
ref|XP_002533094.1|  conserved hypothetical protein                     127   2e-30   Ricinus communis
ref|XP_004241224.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     126   4e-30   
ref|XP_010106499.1|  hypothetical protein L484_025257                   125   2e-29   
emb|CDP09069.1|  unnamed protein product                                124   2e-29   
ref|XP_006350776.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    123   4e-29   
ref|XP_002313431.2|  hypothetical protein POPTR_0009s03750g             122   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_008457470.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     122   1e-28   
ref|XP_004145292.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    122   1e-28   
ref|XP_008359015.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     122   2e-28   
ref|XP_010920572.1|  PREDICTED: uncharacterized protein LOC105044391    122   2e-28   
gb|KDP42256.1|  hypothetical protein JCGZ_02986                         121   2e-28   
ref|XP_004505857.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    120   6e-28   
ref|XP_008222454.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     120   7e-28   
ref|XP_008357128.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    120   8e-28   
ref|XP_006424847.1|  hypothetical protein CICLE_v10028946mg             120   9e-28   
gb|EYU18985.1|  hypothetical protein MIMGU_mgv1a011644mg                119   1e-27   
ref|XP_009364384.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    119   1e-27   
ref|XP_004300428.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    119   1e-27   
ref|XP_006488341.1|  PREDICTED: uncharacterized protein LOC102622011    120   2e-27   
ref|XP_006846241.1|  hypothetical protein AMTR_s00012p00238290          119   2e-27   
ref|XP_008357135.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    118   3e-27   
gb|AAK82465.1|  AT5g59400/f2o15_60                                      115   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009364385.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    117   4e-27   
ref|XP_002864632.1|  hypothetical protein ARALYDRAFT_496067             118   5e-27   
ref|XP_002280802.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     117   5e-27   Vitis vinifera
gb|AAM63217.1|  unknown                                                 117   6e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008784597.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    117   7e-27   
ref|XP_008784596.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    117   7e-27   
ref|XP_006280714.1|  hypothetical protein CARUB_v10026679mg             118   7e-27   
ref|XP_011042717.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    117   8e-27   
ref|XP_011042716.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    117   8e-27   
ref|XP_009347346.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     116   1e-26   
gb|KHN30164.1|  PGR5-like protein 1B, chloroplastic                     115   1e-26   
gb|KCW85554.1|  hypothetical protein EUGRSUZ_B02353                     116   2e-26   
ref|XP_003542032.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    116   2e-26   
ref|XP_003597359.1|  PGR5-like protein                                  116   2e-26   
ref|NP_851220.1|  uncharacterized protein                               116   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010046398.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     115   3e-26   
ref|XP_004486996.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    115   3e-26   
ref|XP_009405840.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    115   3e-26   
ref|NP_568906.2|  uncharacterized protein                               115   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010535489.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    114   7e-26   
gb|KHN33377.1|  PGR5-like protein 1B, chloroplastic                     114   7e-26   
ref|XP_006591567.1|  PREDICTED: uncharacterized protein LOC100797976    112   7e-26   
ref|XP_003547017.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    114   8e-26   
ref|XP_010535487.1|  PREDICTED: uncharacterized protein LOC104810...    114   9e-26   
emb|CDX80272.1|  BnaC09g34700D                                          114   1e-25   
gb|KFK27469.1|  hypothetical protein AALP_AA8G387300                    113   2e-25   
ref|XP_009120449.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     113   2e-25   
ref|XP_007132061.1|  hypothetical protein PHAVU_011G063700g             113   2e-25   
emb|CDY33035.1|  BnaA10g12410D                                          113   3e-25   
gb|KHN21948.1|  hypothetical protein glysoja_008860                     111   3e-25   
ref|XP_010443696.1|  PREDICTED: uncharacterized protein LOC104726523    112   4e-25   
ref|XP_010483565.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     112   4e-25   
ref|XP_007150332.1|  hypothetical protein PHAVU_005G144700g             112   5e-25   
ref|XP_010454975.1|  PREDICTED: uncharacterized protein LOC104736651    112   5e-25   
emb|CAN64889.1|  hypothetical protein VITISV_021080                     117   5e-25   Vitis vinifera
ref|XP_010685740.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     112   5e-25   
ref|XP_009405841.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    112   5e-25   
gb|AGV54173.1|  PGR5-like protein                                       111   8e-25   
ref|XP_009384871.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    110   1e-24   
ref|XP_009384870.1|  PREDICTED: uncharacterized protein LOC103972...    110   1e-24   
ref|XP_009384869.1|  PREDICTED: uncharacterized protein LOC103972...    110   1e-24   
ref|XP_011035299.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    109   3e-24   
gb|EPS74279.1|  hypothetical protein M569_00477                         108   4e-24   
ref|XP_002439135.1|  hypothetical protein SORBIDRAFT_09g001180          105   6e-24   Sorghum bicolor [broomcorn]
ref|XP_007016391.1|  Uncharacterized protein isoform 1                  109   6e-24   
ref|XP_011035296.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    108   1e-23   
gb|AFW82870.1|  hypothetical protein ZEAMMB73_880282                    104   2e-23   
gb|KHF99383.1|  PGR5-like protein 1B, chloroplastic                     107   4e-23   
dbj|BAK04627.1|  predicted protein                                      106   5e-23   
ref|XP_003569096.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     106   5e-23   
ref|XP_004960527.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    106   6e-23   
ref|NP_001054443.2|  Os05g0110800                                       102   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008656557.1|  PREDICTED: LOW QUALITY PROTEIN: PGR5-like pr...    104   2e-22   
ref|XP_006654905.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    103   5e-22   
gb|AAK73156.1|AC079022_29  unknown protein                              102   7e-22   Oryza sativa [red rice]
ref|XP_007205750.1|  hypothetical protein PRUPE_ppa010233mg             102   1e-21   
ref|XP_008784599.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    102   1e-21   
ref|XP_004505856.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    102   2e-21   
dbj|BAA97476.1|  unnamed protein product                              95.5    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004960526.1|  PREDICTED: PGR5-like protein 1B, chloroplast...  93.2    3e-18   
ref|XP_004169097.1|  PREDICTED: uncharacterized protein LOC101227988  91.7    5e-18   
gb|EMT19592.1|  hypothetical protein F775_16194                       90.5    1e-17   
gb|EMS54420.1|  hypothetical protein TRIUR3_00721                     90.1    2e-17   
gb|KEH30175.1|  transmembrane protein, putative                       80.5    5e-15   
ref|XP_001772464.1|  predicted protein                                76.6    5e-13   
ref|XP_001763093.1|  predicted protein                                75.1    2e-12   
ref|XP_003057673.1|  predicted protein                                54.7    3e-05   
ref|XP_007016392.1|  Uncharacterized protein isoform 2                54.3    4e-05   
ref|XP_002501860.1|  hypothetical protein MICPUN_58040                54.7    4e-05   Micromonas commoda
ref|XP_007149519.1|  hypothetical protein PHAVU_005G077000g           48.9    5e-04   



>ref|XP_010262522.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Nelumbo nucifera]
Length=304

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 68/75 (91%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + GALQGLWKND VALKGACPNCGEEVFAFVR++QSN++PH+ +CHVCES +EFRTKV +
Sbjct  216  SVGALQGLWKNDLVALKGACPNCGEEVFAFVRADQSNRAPHKADCHVCESSLEFRTKVEQ  275

Query  610  STSRPGQRWVYGRVY  654
            S SR G+RWVYGRVY
Sbjct  276  SISRHGRRWVYGRVY  290



>ref|XP_011089481.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X1 [Sesamum 
indicum]
 ref|XP_011089482.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X2 [Sesamum 
indicum]
Length=296

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + GALQGLWKND VALKG CPNCGEEVFAFVRS++S  SPHR ECHVCES +EFRTK+ +
Sbjct  210  SVGALQGLWKNDLVALKGVCPNCGEEVFAFVRSDRSIHSPHRVECHVCESSLEFRTKIEQ  269

Query  610  STSRPGQRWVYGRVY  654
            S SRPG+RWVYGR+Y
Sbjct  270  SISRPGRRWVYGRIY  284



>ref|XP_009622236.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=286

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + GALQGLWKND VALKGACPNCGEEVFAFV+S +SN+SPHR +CHVC S +EF+TKV +
Sbjct  203  SVGALQGLWKNDLVALKGACPNCGEEVFAFVKSEKSNRSPHRADCHVCGSKLEFQTKVEQ  262

Query  610  STSRPGQRWVYGRVY  654
            S SRPG+RWVYGRVY
Sbjct  263  SISRPGRRWVYGRVY  277



>ref|XP_009799102.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X1 [Nicotiana 
sylvestris]
Length=286

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + GALQGLWKND VALKGACPNCGEEVFAFV+S +SN+SPHR +CHVC S +EF+TKV +
Sbjct  203  SVGALQGLWKNDLVALKGACPNCGEEVFAFVKSEKSNRSPHRADCHVCGSKLEFQTKVEQ  262

Query  610  STSRPGQRWVYGRVY  654
            S SRPG+RWVYGRVY
Sbjct  263  SISRPGRRWVYGRVY  277



>ref|XP_011035298.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X2 [Populus 
euphratica]
Length=294

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 66/71 (93%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            LQGLW+ND VALKGACPNCGEEVFAFV+S+QSN SPHR +CHVCESL+EFRTKV ++TSR
Sbjct  214  LQGLWRNDLVALKGACPNCGEEVFAFVKSDQSNNSPHRADCHVCESLLEFRTKVEQTTSR  273

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  274  AGRQWVYGRIY  284



>ref|XP_009622237.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
Length=284

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKS  612
            + GALQGLWKND VALKGACPNCGEEVFAFV+S +SN+SPHR +CHVC S +EF+TK +S
Sbjct  203  SVGALQGLWKNDLVALKGACPNCGEEVFAFVKSEKSNRSPHRADCHVCGSKLEFQTK-QS  261

Query  613  TSRPGQRWVYGRVY  654
             SRPG+RWVYGRVY
Sbjct  262  ISRPGRRWVYGRVY  275



>ref|XP_002299869.1| hypothetical protein POPTR_0001s24810g [Populus trichocarpa]
 gb|EEE84674.1| hypothetical protein POPTR_0001s24810g [Populus trichocarpa]
Length=294

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 66/71 (93%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            LQGLW+ND VALKGACPNCGEEVFAFV+S+QSN SPHR +CHVCESL+EFRTKV ++TSR
Sbjct  214  LQGLWRNDLVALKGACPNCGEEVFAFVKSDQSNDSPHRADCHVCESLLEFRTKVEQTTSR  273

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  274  VGRQWVYGRIY  284



>ref|XP_009799103.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X2 [Nicotiana 
sylvestris]
Length=284

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKS  612
            + GALQGLWKND VALKGACPNCGEEVFAFV+S +SN+SPHR +CHVC S +EF+TK +S
Sbjct  203  SVGALQGLWKNDLVALKGACPNCGEEVFAFVKSEKSNRSPHRADCHVCGSKLEFQTK-QS  261

Query  613  TSRPGQRWVYGRVY  654
             SRPG+RWVYGRVY
Sbjct  262  ISRPGRRWVYGRVY  275



>ref|XP_002533094.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29286.1| conserved hypothetical protein [Ricinus communis]
Length=287

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 64/71 (90%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKST-SR  621
            LQGLW+ND VALKGACPNCGEEVFAFV+S+QSN SPHR +CHVCESL+EFRTKV+ T SR
Sbjct  207  LQGLWRNDLVALKGACPNCGEEVFAFVKSDQSNNSPHRADCHVCESLLEFRTKVERTDSR  266

Query  622  PGQRWVYGRVY  654
             G+ WVYGR+Y
Sbjct  267  LGRNWVYGRIY  277



>ref|XP_004241224.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Solanum lycopersicum]
Length=286

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + GALQGLWKND VALKGACPNCGEEVFAF+++ +SN SPHR +CHVC S +EF+TKV +
Sbjct  203  SVGALQGLWKNDLVALKGACPNCGEEVFAFLKAEKSNHSPHRADCHVCGSRLEFQTKVEQ  262

Query  610  STSRPGQRWVYGRVY  654
            S SRPG+RWVYGRVY
Sbjct  263  SISRPGRRWVYGRVY  277



>ref|XP_010106499.1| hypothetical protein L484_025257 [Morus notabilis]
 gb|EXC10675.1| hypothetical protein L484_025257 [Morus notabilis]
Length=299

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKSTSRP  624
            L+GLW+ND VALKGACPNCGEEVFAFV+S+QSN SPHR +CHVCESL+EFRTK + T  P
Sbjct  217  LKGLWRNDLVALKGACPNCGEEVFAFVKSDQSNDSPHRADCHVCESLLEFRTKAEKTISP  276

Query  625  -GQRWVYGRVY  654
             G+RW+YGR+Y
Sbjct  277  LGRRWIYGRIY  287



>emb|CDP09069.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + GALQG+WKND VALKG CPNCGEEVFAFVRS+QS  S HR+ECHVCES IEFRT+V +
Sbjct  207  SVGALQGIWKNDLVALKGVCPNCGEEVFAFVRSDQSKLSRHRSECHVCESFIEFRTRVEQ  266

Query  610  STSRPGQRWVYGRVY  654
            S SR  +RWVYGRVY
Sbjct  267  SISRADRRWVYGRVY  281



>ref|XP_006350776.1| PREDICTED: PGR5-like protein 1B, chloroplastic-like [Solanum 
tuberosum]
Length=286

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + GALQGLWKND VALKGACPNCGEEVFAF+++ +S  SPHR +CHVC S +EF+TKV +
Sbjct  203  SVGALQGLWKNDLVALKGACPNCGEEVFAFLKAEKSYHSPHRADCHVCGSRLEFQTKVEQ  262

Query  610  STSRPGQRWVYGRVY  654
            S SRPG+RWVYGRVY
Sbjct  263  SISRPGRRWVYGRVY  277



>ref|XP_002313431.2| hypothetical protein POPTR_0009s03750g [Populus trichocarpa]
 gb|EEE87386.2| hypothetical protein POPTR_0009s03750g [Populus trichocarpa]
Length=292

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 64/71 (90%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKST-SR  621
            LQGLW+ND VALKGACPNCGEEVFAFV+S+QSN S HR +CHVCESL+EFRT+V+ T SR
Sbjct  212  LQGLWRNDLVALKGACPNCGEEVFAFVKSDQSNNSTHRADCHVCESLLEFRTEVEQTISR  271

Query  622  PGQRWVYGRVY  654
             G+RWV+GR+Y
Sbjct  272  VGRRWVFGRIY  282



>ref|XP_008457470.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Cucumis melo]
Length=291

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + G LQGLW+ND VALKGACPNCGEEVFAFVRS+++N SPHR++CHVCE L+EFR K  K
Sbjct  205  SVGVLQGLWRNDLVALKGACPNCGEEVFAFVRSDRANGSPHRSDCHVCECLLEFRIKFEK  264

Query  610  STSRPGQRWVYGRVY  654
            S+++ G++WVYGR+Y
Sbjct  265  SSTKLGRQWVYGRIY  279



>ref|XP_004145292.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004153911.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004164870.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Cucumis 
sativus]
 gb|KGN65731.1| hypothetical protein Csa_1G523060 [Cucumis sativus]
Length=291

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + G LQGLW+ND VALKGACPNCGEEVFAFVRS+++N SPHR++CHVCE L+EFR K  K
Sbjct  205  SVGVLQGLWRNDLVALKGACPNCGEEVFAFVRSDRANGSPHRSDCHVCECLLEFRIKFEK  264

Query  610  STSRPGQRWVYGRVY  654
            S+++ G++WVYGR+Y
Sbjct  265  SSTKLGRQWVYGRIY  279



>ref|XP_008359015.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Malus domestica]
Length=288

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            L+GLW+ND VALKGACPNCG+EVFAFV+S+QSN SPHR  CHVCE L+EFRTKV KS S 
Sbjct  204  LKGLWRNDLVALKGACPNCGDEVFAFVKSDQSNNSPHRANCHVCECLLEFRTKVEKSVSP  263

Query  622  PGQRWVYGRVY  654
             G+RWVYGR+Y
Sbjct  264  LGRRWVYGRIY  274



>ref|XP_010920572.1| PREDICTED: uncharacterized protein LOC105044391 [Elaeis guineensis]
Length=335

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +1

Query  442  ALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTS  618
            ALQGLW+ND VALKG+CPNCGEEVFAFVR+ +S Q PH  ECHVCES +EFRTKV +S S
Sbjct  199  ALQGLWRNDLVALKGSCPNCGEEVFAFVRAGKSKQQPHCAECHVCESDLEFRTKVEQSIS  258

Query  619  RPGQRWVYGRVY  654
            RP +RWVYGRVY
Sbjct  259  RPDRRWVYGRVY  270



>gb|KDP42256.1| hypothetical protein JCGZ_02986 [Jatropha curcas]
Length=295

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKST-SR  621
            LQGLW+ D VALKGACPNCGEEVFAFV+SN+ N SPHR +CHVCESL+EFRTKV+ T SR
Sbjct  215  LQGLWRKDLVALKGACPNCGEEVFAFVKSNEPNNSPHRADCHVCESLLEFRTKVEQTASR  274

Query  622  PGQRWVYGRVY  654
             G++WV+GR+Y
Sbjct  275  LGRQWVHGRIY  285



>ref|XP_004505857.1| PREDICTED: PGR5-like protein 1B, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=283

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            LQGLW+ND VALKGACPNCGEEVFAFVR +++  SPHRT+CHVCESL+EFRT V +S SR
Sbjct  199  LQGLWRNDLVALKGACPNCGEEVFAFVRMDRNIDSPHRTDCHVCESLLEFRTNVEQSVSR  258

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  259  FGRQWVYGRIY  269



>ref|XP_008222454.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Prunus mume]
Length=286

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            L+GLW+ND VALKGACPNCGEEVFAFV+SNQSN SPHR  CHVCE L+EFRTK  KS S 
Sbjct  203  LEGLWRNDLVALKGACPNCGEEVFAFVKSNQSNNSPHRANCHVCECLLEFRTKFEKSISP  262

Query  622  PGQRWVYGRVY  654
             G+RWVYG +Y
Sbjct  263  LGRRWVYGSIY  273



>ref|XP_008357128.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X1 [Malus 
domestica]
Length=283

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            L+GLW+ND VALKG CPNCG+EVFAFV+S+QSN SPHR  CHVCE L+EFRTKV KS S 
Sbjct  199  LKGLWRNDLVALKGVCPNCGDEVFAFVQSDQSNNSPHRANCHVCECLLEFRTKVEKSVSP  258

Query  622  PGQRWVYGRVY  654
             G+RWVYGR+Y
Sbjct  259  LGRRWVYGRIY  269



>ref|XP_006424847.1| hypothetical protein CICLE_v10028946mg [Citrus clementina]
 gb|ESR38087.1| hypothetical protein CICLE_v10028946mg [Citrus clementina]
 gb|KDO72835.1| hypothetical protein CISIN_1g045112mg [Citrus sinensis]
Length=296

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 64/71 (90%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            LQGLW+ND VAL+GACPNCGEEVFAFV S+Q+  SPHR++CHVC SL+EFRTKV +S+SR
Sbjct  214  LQGLWRNDLVALRGACPNCGEEVFAFVNSDQTKNSPHRSDCHVCGSLLEFRTKVEQSSSR  273

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  274  LGRQWVYGRIY  284



>gb|EYU18985.1| hypothetical protein MIMGU_mgv1a011644mg [Erythranthe guttata]
Length=275

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + GALQGLWKND VALKG CPNCGEEVFAFVRS++S  S HR  CHVCES +EF+TKV +
Sbjct  189  SVGALQGLWKNDLVALKGVCPNCGEEVFAFVRSDRSTNSSHRVNCHVCESSLEFQTKVEE  248

Query  610  STSRPGQRWVYGRVY  654
            S S PG++WVYGR+Y
Sbjct  249  SGSIPGKQWVYGRIY  263



>ref|XP_009364384.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X1 [Pyrus 
x bretschneideri]
Length=283

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            L+GLW+ND VALKG CPNCG+EVFAFV S+QSN SPHR  CHVCE L+EFRTKV KS S 
Sbjct  199  LKGLWRNDLVALKGVCPNCGDEVFAFVESDQSNNSPHRANCHVCECLLEFRTKVEKSVSP  258

Query  622  PGQRWVYGRVY  654
             G+RWVYGR+Y
Sbjct  259  LGRRWVYGRIY  269



>ref|XP_004300428.1| PREDICTED: PGR5-like protein 1B, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=287

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            L+GLW+ND +ALKGACPNCGEEVFAFV+++QSN SPHR  CHVCE L+EFRTK  KS S 
Sbjct  203  LEGLWRNDLMALKGACPNCGEEVFAFVKTDQSNNSPHRANCHVCECLLEFRTKAEKSLSP  262

Query  622  PGQRWVYGRVY  654
             G+RWVYGR+Y
Sbjct  263  LGRRWVYGRIY  273



>ref|XP_006488341.1| PREDICTED: uncharacterized protein LOC102622011 [Citrus sinensis]
Length=344

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 64/72 (89%), Gaps = 1/72 (1%)
 Frame = +1

Query  442  ALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTS  618
             LQGLW+ND VAL+GACPNCGEEVFAFV S+Q+  SPHR++CHVC SL+EFRTKV +S+S
Sbjct  261  VLQGLWRNDLVALRGACPNCGEEVFAFVNSDQTKNSPHRSDCHVCGSLLEFRTKVEQSSS  320

Query  619  RPGQRWVYGRVY  654
            R G++WVYGR+Y
Sbjct  321  RLGRQWVYGRIY  332



>ref|XP_006846241.1| hypothetical protein AMTR_s00012p00238290 [Amborella trichopoda]
 gb|ERN07916.1| hypothetical protein AMTR_s00012p00238290 [Amborella trichopoda]
Length=296

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = +1

Query  442  ALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTS  618
            ALQGLWKND VALKG CPNCGEEVFAFVR+ +  + PHRT+CHVC+S +EFRTKV +S S
Sbjct  219  ALQGLWKNDLVALKGCCPNCGEEVFAFVRAAKPKEPPHRTDCHVCDSSLEFRTKVEESAS  278

Query  619  RPGQRWVYGRVY  654
            +P  RWVYGR+Y
Sbjct  279  KPRSRWVYGRIY  290



>ref|XP_008357135.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X2 [Malus 
domestica]
Length=281

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 1/70 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKSTSRP  624
            L+GLW+ND VALKG CPNCG+EVFAFV+S+QSN SPHR  CHVCE L+EFRTK KS S  
Sbjct  199  LKGLWRNDLVALKGVCPNCGDEVFAFVQSDQSNNSPHRANCHVCECLLEFRTK-KSVSPL  257

Query  625  GQRWVYGRVY  654
            G+RWVYGR+Y
Sbjct  258  GRRWVYGRIY  267



>gb|AAK82465.1| AT5g59400/f2o15_60 [Arabidopsis thaliana]
 gb|AAL05899.1| AT5g59400/f2o15_60 [Arabidopsis thaliana]
Length=157

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 61/74 (82%), Gaps = 3/74 (4%)
 Frame = +1

Query  442  ALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV---KS  612
             L+GLW+ND  ALKG CPNCGEEVFAFVRS+QSN+S H+ +CHVCE  +EFRTKV   KS
Sbjct  70   VLKGLWRNDLTALKGDCPNCGEEVFAFVRSDQSNRSAHKADCHVCECTLEFRTKVEVDKS  129

Query  613  TSRPGQRWVYGRVY  654
             SR G++WVYGR+Y
Sbjct  130  ASRLGRKWVYGRIY  143



>ref|XP_009364385.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X2 [Pyrus 
x bretschneideri]
Length=281

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 1/70 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKSTSRP  624
            L+GLW+ND VALKG CPNCG+EVFAFV S+QSN SPHR  CHVCE L+EFRTK KS S  
Sbjct  199  LKGLWRNDLVALKGVCPNCGDEVFAFVESDQSNNSPHRANCHVCECLLEFRTK-KSVSPL  257

Query  625  GQRWVYGRVY  654
            G+RWVYGR+Y
Sbjct  258  GRRWVYGRIY  267



>ref|XP_002864632.1| hypothetical protein ARALYDRAFT_496067 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40891.1| hypothetical protein ARALYDRAFT_496067 [Arabidopsis lyrata subsp. 
lyrata]
Length=299

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            L+GLW+ND  ALKG CPNCGEEVFAFVRS+QSN+S H+ +CHVCE  +EFRTKV KSTSR
Sbjct  215  LKGLWRNDLTALKGDCPNCGEEVFAFVRSDQSNRSAHKADCHVCECTLEFRTKVEKSTSR  274

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  275  LGRKWVYGRIY  285



>ref|XP_002280802.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Vitis vinifera]
 emb|CBI16116.3| unnamed protein product [Vitis vinifera]
Length=293

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKS  612
            + G LQGLW+ND VALKGACPNCGEEVFAFV+S Q N SPH  +CHVCES +EF TKV+ 
Sbjct  207  SVGVLQGLWRNDLVALKGACPNCGEEVFAFVKSGQPNSSPHSADCHVCESSLEFSTKVEQ  266

Query  613  TSRPGQRWVYGRVY  654
            ++  G+RWVYGR+Y
Sbjct  267  STL-GRRWVYGRIY  279



>gb|AAM63217.1| unknown [Arabidopsis thaliana]
Length=299

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +1

Query  442  ALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTS  618
            AL+GLW+ND  ALKG CPNCGEEVFAFVRS+QSN+S H+ +CHVCE  +EFRTKV KS S
Sbjct  214  ALKGLWRNDLTALKGDCPNCGEEVFAFVRSDQSNRSAHKADCHVCECTLEFRTKVEKSAS  273

Query  619  RPGQRWVYGRVY  654
            R G++WVYGR+Y
Sbjct  274  RLGRKWVYGRIY  285



>ref|XP_008784597.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X2 [Phoenix 
dactylifera]
 ref|XP_008784598.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=283

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = +1

Query  442  ALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTS  618
            ALQGLW+ND VALKG+CPNCGEEVFAFVR+ +S Q PHR ECHVCES + FRTKV +S S
Sbjct  199  ALQGLWRNDLVALKGSCPNCGEEVFAFVRAEKSKQQPHRAECHVCESALVFRTKVEQSIS  258

Query  619  RPGQRWVYGRVY  654
              G+ WVYGRVY
Sbjct  259  GSGRHWVYGRVY  270



>ref|XP_008784596.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=284

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = +1

Query  442  ALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTS  618
            ALQGLW+ND VALKG+CPNCGEEVFAFVR+ +S Q PHR ECHVCES + FRTKV +S S
Sbjct  199  ALQGLWRNDLVALKGSCPNCGEEVFAFVRAEKSKQQPHRAECHVCESALVFRTKVEQSIS  258

Query  619  RPGQRWVYGRVY  654
              G+ WVYGRVY
Sbjct  259  GSGRHWVYGRVY  270



>ref|XP_006280714.1| hypothetical protein CARUB_v10026679mg [Capsella rubella]
 gb|EOA13612.1| hypothetical protein CARUB_v10026679mg [Capsella rubella]
Length=354

 Score =   118 bits (296),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +1

Query  442  ALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTS  618
             LQGLW+ND  AL+G CPNCGEEVFAFVRS+QSN+S H+ +CHVCE  +EFRTKV KSTS
Sbjct  269  VLQGLWRNDLTALRGDCPNCGEEVFAFVRSDQSNRSAHKADCHVCECTLEFRTKVEKSTS  328

Query  619  RPGQRWVYGRVY  654
            R G++WVYGR+Y
Sbjct  329  RLGRKWVYGRIY  340



>ref|XP_011042717.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X2 [Populus 
euphratica]
Length=273

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +1

Query  430  ITAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVK  609
            +    LQGLW+ND VALKGACPNCGEEV+AFV+S Q N S HR +CHVCESL+EFRT V+
Sbjct  188  VNVKVLQGLWRNDLVALKGACPNCGEEVYAFVKSYQPNNSTHRADCHVCESLLEFRTNVE  247

Query  610  ST-SRPGQRWVYGRVY  654
             T SR G+RWV+GR+Y
Sbjct  248  QTISRVGRRWVFGRIY  263



>ref|XP_011042716.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X1 [Populus 
euphratica]
Length=292

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKST-SR  621
            LQGLW+ND VALKGACPNCGEEV+AFV+S Q N S HR +CHVCESL+EFRT V+ T SR
Sbjct  212  LQGLWRNDLVALKGACPNCGEEVYAFVKSYQPNNSTHRADCHVCESLLEFRTNVEQTISR  271

Query  622  PGQRWVYGRVY  654
             G+RWV+GR+Y
Sbjct  272  VGRRWVFGRIY  282



>ref|XP_009347346.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Pyrus x bretschneideri]
 ref|XP_009347353.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Pyrus x bretschneideri]
Length=287

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 62/71 (87%), Gaps = 2/71 (3%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            LQGLW+ND VALKGACPNCG+EVFAFV+S+QSN SPHR  CHVCE L+EFRTKV KS S 
Sbjct  204  LQGLWRNDLVALKGACPNCGDEVFAFVKSDQSN-SPHRANCHVCECLLEFRTKVEKSISP  262

Query  622  PGQRWVYGRVY  654
             G+RWV+GR+Y
Sbjct  263  LGRRWVHGRIY  273



>gb|KHN30164.1| PGR5-like protein 1B, chloroplastic [Glycine soja]
Length=259

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            LQGLW+ND  ALKG+CPNCGEEVFAFVR++++N SPHR +CHVCE L+EFRT+V +S  R
Sbjct  178  LQGLWRNDLAALKGSCPNCGEEVFAFVRTDKANNSPHRADCHVCECLLEFRTEVEQSALR  237

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  238  LGRQWVYGRIY  248



>gb|KCW85554.1| hypothetical protein EUGRSUZ_B02353, partial [Eucalyptus grandis]
Length=291

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + G LQGLW+ D  ALKGACPNCGEEVFAFV+SNQSN S HR +CHVCE  +EFRTK+ +
Sbjct  203  SVGVLQGLWRKDLAALKGACPNCGEEVFAFVKSNQSNSSAHRADCHVCECTLEFRTKIEQ  262

Query  610  STSRPGQRWVYGRVY  654
              S  G+RW+YGRVY
Sbjct  263  PASSLGRRWIYGRVY  277



>ref|XP_003542032.1| PREDICTED: PGR5-like protein 1B, chloroplastic-like [Glycine 
max]
Length=281

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            LQGLW+ND  ALKG+CPNCGEEVFAFVR++++N SPHR +CHVCE L+EFRT+V +S  R
Sbjct  200  LQGLWRNDLAALKGSCPNCGEEVFAFVRTDKANNSPHRADCHVCECLLEFRTEVEQSALR  259

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  260  LGRQWVYGRIY  270



>ref|XP_003597359.1| PGR5-like protein [Medicago truncatula]
 gb|AES67610.1| PGR5-like protein 1A, putative [Medicago truncatula]
Length=286

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            LQGLW+ND  ALKG+CPNCGEEVFAFVR++++N SPHR +CHVCE L+EFRT+V +STS 
Sbjct  205  LQGLWRNDLAALKGSCPNCGEEVFAFVRTDKANNSPHRAKCHVCECLLEFRTEVEQSTSI  264

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  265  FGRQWVYGRIY  275



>ref|NP_851220.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED97180.1| uncharacterized protein AT5G59400 [Arabidopsis thaliana]
Length=299

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            L+GLW+ND  ALKG CPNCGEEVFAFVRS+QSN+S H+ +CHVCE  +EFRTKV KS SR
Sbjct  215  LKGLWRNDLTALKGDCPNCGEEVFAFVRSDQSNRSAHKADCHVCECTLEFRTKVEKSASR  274

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  275  LGRKWVYGRIY  285



>ref|XP_010046398.1| PREDICTED: PGR5-like protein 1B, chloroplastic, partial [Eucalyptus 
grandis]
Length=302

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + G LQGLW+ D  ALKGACPNCGEEVFAFV+SNQSN S HR +CHVCE  +EFRTK+ +
Sbjct  214  SVGVLQGLWRKDLAALKGACPNCGEEVFAFVKSNQSNSSAHRADCHVCECTLEFRTKIEQ  273

Query  610  STSRPGQRWVYGRVY  654
              S  G+RW+YGRVY
Sbjct  274  PASSLGRRWIYGRVY  288



>ref|XP_004486996.1| PREDICTED: PGR5-like protein 1B, chloroplastic-like isoform X1 
[Cicer arietinum]
 ref|XP_004486997.1| PREDICTED: PGR5-like protein 1B, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=275

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            L+GLW+N   ALKG+CPNCGEEVFAFVR++++N SPHR +CHVCE L+EFRT+V +STSR
Sbjct  194  LEGLWRNGLAALKGSCPNCGEEVFAFVRTDKANNSPHRAQCHVCECLLEFRTEVEQSTSR  253

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  254  FGRQWVYGRIY  264



>ref|XP_009405840.1| PREDICTED: PGR5-like protein 1A, chloroplastic isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=285

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = +1

Query  442  ALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKST-S  618
            ALQGLW+ + VALKG+CPNCGEEVFAFV+S  S + PHR ECHVCE  +EFRTKV+ T S
Sbjct  211  ALQGLWRKELVALKGSCPNCGEEVFAFVKSKTSYRHPHRAECHVCECTLEFRTKVEETFS  270

Query  619  RPGQRWVYGRVY  654
             PG+RWVYGRVY
Sbjct  271  TPGRRWVYGRVY  282



>ref|NP_568906.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AED97181.1| uncharacterized protein AT5G59400 [Arabidopsis thaliana]
Length=301

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 61/73 (84%), Gaps = 3/73 (4%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV---KST  615
            L+GLW+ND  ALKG CPNCGEEVFAFVRS+QSN+S H+ +CHVCE  +EFRTKV   KS 
Sbjct  215  LKGLWRNDLTALKGDCPNCGEEVFAFVRSDQSNRSAHKADCHVCECTLEFRTKVEVDKSA  274

Query  616  SRPGQRWVYGRVY  654
            SR G++WVYGR+Y
Sbjct  275  SRLGRKWVYGRIY  287



>ref|XP_010535489.1| PREDICTED: PGR5-like protein 1A, chloroplastic isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010535490.1| PREDICTED: PGR5-like protein 1A, chloroplastic isoform X2 [Tarenaya 
hassleriana]
Length=294

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +1

Query  439  GALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKSTS  618
            G LQGLW+ND  AL+GACPNCGEEVFAFVRS+QSN + HR +CHVC   +EFRTKV+  +
Sbjct  208  GVLQGLWRNDLAALRGACPNCGEEVFAFVRSDQSNSNAHRADCHVCGCTLEFRTKVEKNA  267

Query  619  RP-GQRWVYGRVY  654
             P G++W+YGR+Y
Sbjct  268  SPLGRKWIYGRIY  280



>gb|KHN33377.1| PGR5-like protein 1B, chloroplastic [Glycine soja]
Length=271

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            LQGLW+ND  ALKG+CPNCGEEVFAFVR++++N S HR +CHVCE L+EFRTKV +S  R
Sbjct  190  LQGLWRNDLAALKGSCPNCGEEVFAFVRTDKANNSSHRADCHVCECLLEFRTKVEQSALR  249

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  250  LGRQWVYGRIY  260



>ref|XP_006591567.1| PREDICTED: uncharacterized protein LOC100797976 [Glycine max]
Length=181

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = +1

Query  436  AGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KS  612
            A  L GLW+ND  ALKGACPNCGEEVFAFVR +++ +SPHR +CHVCE ++EFRTKV +S
Sbjct  77   AKVLHGLWRNDLTALKGACPNCGEEVFAFVRMDRNIESPHRADCHVCECILEFRTKVEQS  136

Query  613  TSRPGQRWVYGRVY  654
             SR G++WVYG +Y
Sbjct  137  VSRFGRQWVYGHIY  150



>ref|XP_003547017.1| PREDICTED: PGR5-like protein 1B, chloroplastic-like [Glycine 
max]
Length=270

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            LQGLW+ND  ALKG+CPNCGEEVFAFVR++++N S HR +CHVCE L+EFRTKV +S  R
Sbjct  189  LQGLWRNDLAALKGSCPNCGEEVFAFVRTDKANNSSHRADCHVCECLLEFRTKVEQSALR  248

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  249  LGRQWVYGRIY  259



>ref|XP_010535487.1| PREDICTED: uncharacterized protein LOC104810774 isoform X1 [Tarenaya 
hassleriana]
Length=307

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +1

Query  439  GALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKSTS  618
            G LQGLW+ND  AL+GACPNCGEEVFAFVRS+QSN + HR +CHVC   +EFRTKV+  +
Sbjct  208  GVLQGLWRNDLAALRGACPNCGEEVFAFVRSDQSNSNAHRADCHVCGCTLEFRTKVEKNA  267

Query  619  RP-GQRWVYGRVY  654
             P G++W+YGR+Y
Sbjct  268  SPLGRKWIYGRIY  280



>emb|CDX80272.1| BnaC09g34700D [Brassica napus]
Length=302

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            L+GLW+ND  ALKG CPNCGEEVFAFVRS+QSN+S H+ ECHVCE  +EFRTKV KS S 
Sbjct  218  LKGLWRNDLTALKGDCPNCGEEVFAFVRSDQSNKSAHKAECHVCECTLEFRTKVEKSASL  277

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  278  LGRKWVYGRIY  288



>gb|KFK27469.1| hypothetical protein AALP_AA8G387300 [Arabis alpina]
Length=294

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            LQGLW ND  ALKG CPNCGEEVFAFVRS+QSN+S H+ +CHVCE  +EFRTKV KST  
Sbjct  210  LQGLWSNDLTALKGNCPNCGEEVFAFVRSDQSNRSAHKADCHVCECTLEFRTKVEKSTLL  269

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  270  LGRKWVYGRIY  280



>ref|XP_009120449.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Brassica rapa]
Length=302

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            L+GLW+ND  ALKG CPNCGEEVFAFVRS+QSN+S H+ +CHVCE  +EFRTKV KS S 
Sbjct  218  LKGLWRNDLTALKGDCPNCGEEVFAFVRSDQSNKSAHKADCHVCECTLEFRTKVEKSASL  277

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  278  LGRKWVYGRIY  288



>ref|XP_007132061.1| hypothetical protein PHAVU_011G063700g [Phaseolus vulgaris]
 ref|XP_007132062.1| hypothetical protein PHAVU_011G063700g [Phaseolus vulgaris]
 gb|ESW04055.1| hypothetical protein PHAVU_011G063700g [Phaseolus vulgaris]
 gb|ESW04056.1| hypothetical protein PHAVU_011G063700g [Phaseolus vulgaris]
Length=280

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            LQ LW+ND VALKGACPNCGEE+FAFVR +++ +SPHR +CHVCE L+EFRTKV +  SR
Sbjct  199  LQSLWRNDLVALKGACPNCGEELFAFVRMDRNIESPHRADCHVCECLLEFRTKVEQPVSR  258

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  259  FGRQWVYGRIY  269



>emb|CDY33035.1| BnaA10g12410D [Brassica napus]
Length=302

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            L+GLW+ND  ALKG CPNCGEEVFAFVRS+QSN+S H+ +CHVCE  +EFRTKV KS S 
Sbjct  218  LKGLWRNDLTALKGDCPNCGEEVFAFVRSDQSNKSAHKADCHVCECTLEFRTKVEKSASL  277

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  278  LGRKWVYGRIY  288



>gb|KHN21948.1| hypothetical protein glysoja_008860 [Glycine soja]
Length=236

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            L GLW+ND  ALKGACPNCGEEVFAFVR +++ +SPHR +CHVCE ++EFRTKV +S SR
Sbjct  129  LHGLWRNDLTALKGACPNCGEEVFAFVRMDRNIESPHRADCHVCECILEFRTKVEQSVSR  188

Query  622  PGQRWVYGRVY  654
             G++WVYG +Y
Sbjct  189  FGRQWVYGHIY  199



>ref|XP_010443696.1| PREDICTED: uncharacterized protein LOC104726523 [Camelina sativa]
Length=298

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKSTSRP  624
            L+GLW+ND  AL+G CPNCGEEVFAFVRS+QSN+S H+ +CHVCE  +EFRTKV+ ++ P
Sbjct  214  LKGLWRNDLTALRGDCPNCGEEVFAFVRSDQSNRSAHKADCHVCECTLEFRTKVEKSASP  273

Query  625  -GQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  274  LGRKWVYGRIY  284



>ref|XP_010483565.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Camelina sativa]
Length=298

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKSTSRP  624
            L+GLW+ND  AL+G CPNCGEEVFAFVRS+QSN+S H+ +CHVCE  +EFRTKV+ ++ P
Sbjct  214  LKGLWRNDLTALRGDCPNCGEEVFAFVRSDQSNRSAHKADCHVCECTLEFRTKVEKSASP  273

Query  625  -GQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  274  LGRKWVYGRIY  284



>ref|XP_007150332.1| hypothetical protein PHAVU_005G144700g [Phaseolus vulgaris]
 gb|ESW22326.1| hypothetical protein PHAVU_005G144700g [Phaseolus vulgaris]
Length=279

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            LQGLW+ D  ALKG+CPNCGEEVFAFVR+++ N SPHR +CHVCE L+EFRTK  +S  R
Sbjct  198  LQGLWRVDLAALKGSCPNCGEEVFAFVRTDKGNNSPHRADCHVCECLLEFRTKAEQSDLR  257

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  258  SGRQWVYGRIY  268



>ref|XP_010454975.1| PREDICTED: uncharacterized protein LOC104736651 [Camelina sativa]
Length=298

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKSTSRP  624
            L+GLW+ND  AL+G CPNCGEEVFAFVRS+QSN+S H+ +CHVCE  +EFRTKV+ ++ P
Sbjct  214  LKGLWRNDLTALRGDCPNCGEEVFAFVRSDQSNRSAHKADCHVCECTLEFRTKVEKSASP  273

Query  625  -GQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  274  LGRKWVYGRIY  284



>emb|CAN64889.1| hypothetical protein VITISV_021080 [Vitis vinifera]
Length=1059

 Score =   117 bits (292),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = +1

Query  433   TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKS  612
             + G LQGLW+ND VALKGACPNCGEEVFAFV+S Q N SPH  +CHVCES +EF TKV+ 
Sbjct  973   SVGVLQGLWRNDLVALKGACPNCGEEVFAFVKSGQPNSSPHSADCHVCESSLEFSTKVEQ  1032

Query  613   TSRPGQRWVYGRVY  654
             ++  G+RWVYGR+Y
Sbjct  1033  STL-GRRWVYGRIY  1045



>ref|XP_010685740.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=299

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            +A ALQGLW+ND VAL+GACP+CGEEVFAF+RS+QSN S HR +CHVCE  +EFRTK  +
Sbjct  215  SARALQGLWRNDLVALRGACPSCGEEVFAFLRSDQSNSSAHRADCHVCECRLEFRTKAEQ  274

Query  610  STSRPGQRWVYGRVY  654
            S S+  +RWV+GRVY
Sbjct  275  SLSKLKRRWVHGRVY  289



>ref|XP_009405841.1| PREDICTED: PGR5-like protein 1A, chloroplastic isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=283

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +1

Query  442  ALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKSTSR  621
            ALQGLW+ + VALKG+CPNCGEEVFAFV+S  S + PHR ECHVCE  +EFRTK ++ S 
Sbjct  211  ALQGLWRKELVALKGSCPNCGEEVFAFVKSKTSYRHPHRAECHVCECTLEFRTK-ETFST  269

Query  622  PGQRWVYGRVY  654
            PG+RWVYGRVY
Sbjct  270  PGRRWVYGRVY  280



>gb|AGV54173.1| PGR5-like protein [Phaseolus vulgaris]
Length=282

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            LQGLW+ D  ALKG+CPNCGEEVFAFVR+++ N SPHR +CHVCE L+EFRTK  +S  R
Sbjct  201  LQGLWRVDLAALKGSCPNCGEEVFAFVRTDKGNNSPHRADCHVCECLLEFRTKAEQSDLR  260

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  261  LGRQWVYGRIY  271



>ref|XP_009384871.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=251

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = +1

Query  427  FITAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV  606
            F +  ALQGLW+N+ VA+KG+CPNCGEEVF FVR+  S   PHR  CHVCE  +EF+TKV
Sbjct  170  FASIQALQGLWRNELVAMKGSCPNCGEEVFTFVRAENSTGHPHRAACHVCECSLEFQTKV  229

Query  607  -KSTSRPGQRWVYGRVY  654
             +S + PG+RWVYGRVY
Sbjct  230  EQSFTVPGKRWVYGRVY  246



>ref|XP_009384870.1| PREDICTED: uncharacterized protein LOC103972301 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=265

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = +1

Query  427  FITAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV  606
            F +  ALQGLW+N+ VA+KG+CPNCGEEVF FVR+  S   PHR  CHVCE  +EF+TKV
Sbjct  184  FASIQALQGLWRNELVAMKGSCPNCGEEVFTFVRAENSTGHPHRAACHVCECSLEFQTKV  243

Query  607  -KSTSRPGQRWVYGRVY  654
             +S + PG+RWVYGRVY
Sbjct  244  EQSFTVPGKRWVYGRVY  260



>ref|XP_009384869.1| PREDICTED: uncharacterized protein LOC103972301 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=286

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = +1

Query  427  FITAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV  606
            F +  ALQGLW+N+ VA+KG+CPNCGEEVF FVR+  S   PHR  CHVCE  +EF+TKV
Sbjct  205  FASIQALQGLWRNELVAMKGSCPNCGEEVFTFVRAENSTGHPHRAACHVCECSLEFQTKV  264

Query  607  -KSTSRPGQRWVYGRVY  654
             +S + PG+RWVYGRVY
Sbjct  265  EQSFTVPGKRWVYGRVY  281



>ref|XP_011035299.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X3 [Populus 
euphratica]
Length=272

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKS  612
            LQGLW+ND VALKGACPNCGEEVFAFV+S+QSN SPHR +CHVCESL+EFRTKV+S
Sbjct  214  LQGLWRNDLVALKGACPNCGEEVFAFVKSDQSNNSPHRADCHVCESLLEFRTKVES  269



>gb|EPS74279.1| hypothetical protein M569_00477, partial [Genlisea aurea]
Length=256

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTK-VK  609
            + GAL+GLW ND VALKG CP+CGEEV+AFV    S Q PHR ECHVC+S +EFRTK V+
Sbjct  178  SVGALRGLWVNDLVALKGICPHCGEEVYAFV---GSKQWPHRVECHVCKSSLEFRTKVVE  234

Query  610  STSRPGQRWVYGRVY  654
            S S PG+RWVYGRVY
Sbjct  235  SVSAPGKRWVYGRVY  249



>ref|XP_002439135.1| hypothetical protein SORBIDRAFT_09g001180 [Sorghum bicolor]
 gb|EES17565.1| hypothetical protein SORBIDRAFT_09g001180 [Sorghum bicolor]
Length=154

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + GAL+GL  N+ VALKG+CPNCGE+VFAFV++++S ++PHR ECHVCE  +E+RTK+ K
Sbjct  65   SVGALRGLLTNNLVALKGSCPNCGEQVFAFVKTDKSVRAPHRAECHVCECPLEYRTKIEK  124

Query  610  STSRPGQRWVYGRVY  654
            S S P + WVYGRVY
Sbjct  125  SLSGPRRSWVYGRVY  139



>ref|XP_007016391.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY34010.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=311

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            LQ LW+ D VALKGACPNCGEEVFAF++S++ + SPHR +CHVCE  +EFR K  +S SR
Sbjct  208  LQRLWRKDLVALKGACPNCGEEVFAFLKSDKFSDSPHRADCHVCECTLEFRAKAEQSVSR  267

Query  622  PGQRWVYGRVY  654
             G+RWVYGRVY
Sbjct  268  VGRRWVYGRVY  278



>ref|XP_011035296.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X1 [Populus 
euphratica]
Length=302

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVK  609
            LQGLW+ND VALKGACPNCGEEVFAFV+S+QSN SPHR +CHVCESL+EFRTKV+
Sbjct  214  LQGLWRNDLVALKGACPNCGEEVFAFVKSDQSNNSPHRADCHVCESLLEFRTKVE  268



>gb|AFW82870.1| hypothetical protein ZEAMMB73_880282 [Zea mays]
Length=161

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + GALQGL  N+ VALKG+CPNCGE+VFAFV+  ++ ++PHR ECHVC+  +E+RTK+ K
Sbjct  74   SVGALQGLLSNNLVALKGSCPNCGEQVFAFVKIEKTVRAPHRAECHVCQCPLEYRTKIEK  133

Query  610  STSRPGQRWVYGRVY  654
            S+S P + WVYGRVY
Sbjct  134  SSSGPRRSWVYGRVY  148



>gb|KHF99383.1| PGR5-like protein 1B, chloroplastic [Gossypium arboreum]
 gb|KHG11545.1| PGR5-like protein 1B, chloroplastic [Gossypium arboreum]
Length=289

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            L  LW+ND VALKGACPNCGEEVFAFV+S + N SPHR +CHVC+  +EFR K  +S SR
Sbjct  207  LLRLWRNDLVALKGACPNCGEEVFAFVKSEKFNGSPHRADCHVCDCTLEFRAKTEQSVSR  266

Query  622  PGQRWVYGRVY  654
             G++WVYGR+Y
Sbjct  267  LGRKWVYGRIY  277



>dbj|BAK04627.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=281

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + GALQGL  N+ VALKG+CPNCGE+VFAFV++++S ++PH+ ECHVCE  +E+RTKV +
Sbjct  192  SVGALQGLLTNNVVALKGSCPNCGEQVFAFVKTDKSIKAPHKAECHVCECPLEYRTKVER  251

Query  610  STSRPGQRWVYGRVY  654
            S S P + WVYGRVY
Sbjct  252  SLSGPRRSWVYGRVY  266



>ref|XP_003569096.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Brachypodium 
distachyon]
Length=276

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + GALQGL  N+ VALKG+CPNCGE+VFAFV++++S ++PH+ ECHVCE  +E+RTKV +
Sbjct  187  SVGALQGLLTNNLVALKGSCPNCGEQVFAFVKTDKSIKAPHKAECHVCECPLEYRTKVER  246

Query  610  STSRPGQRWVYGRVY  654
            S S P + WVYGRVY
Sbjct  247  SLSGPRRSWVYGRVY  261



>ref|XP_004960527.1| PREDICTED: PGR5-like protein 1B, chloroplastic-like isoform X2 
[Setaria italica]
Length=322

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + GAL+GL  N+ VALKG+CPNCGE+VFAFV++++S ++PHR ECHVCE  +E+RTK+ K
Sbjct  233  SVGALRGLLSNNLVALKGSCPNCGEQVFAFVKTDKSIRAPHRAECHVCECPLEYRTKIEK  292

Query  610  STSRPGQRWVYGRVY  654
            S S P + WVYGRVY
Sbjct  293  SLSGPRRTWVYGRVY  307



>ref|NP_001054443.2| Os05g0110800 [Oryza sativa Japonica Group]
 gb|AAU44203.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG90576.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF16357.2| Os05g0110800 [Oryza sativa Japonica Group]
Length=163

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + GALQGL  N+ VALKG+CPNCGE+VFAFV+++ S ++PHR ECHVC   +E+RTKV K
Sbjct  74   SVGALQGLLTNNLVALKGSCPNCGEQVFAFVKTDNSIKAPHRAECHVCSCPLEYRTKVEK  133

Query  610  STSRPGQRWVYGRVY  654
            S S   + WVYGRVY
Sbjct  134  SLSGTRRTWVYGRVY  148



>ref|XP_008656557.1| PREDICTED: LOW QUALITY PROTEIN: PGR5-like protein 1A, chloroplastic 
[Zea mays]
Length=277

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + GALQGL  N+ VALKG+CPNCGE+VFAFV+  ++ ++PHR ECHVC+  +E+RTK+ K
Sbjct  186  SVGALQGLLSNNLVALKGSCPNCGEQVFAFVKIEKTVRAPHRAECHVCQCPLEYRTKIEK  245

Query  610  STSRPGQRWVYGRVY  654
            S+S P + WVYGRVY
Sbjct  246  SSSGPRRSWVYGRVY  260



>ref|XP_006654905.1| PREDICTED: PGR5-like protein 1B, chloroplastic-like [Oryza brachyantha]
Length=273

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKS  612
            +AGALQGL  N+ VALKG+CPNCGE+VFAFV+++ S ++PHR ECHVC   +E+RTKV+ 
Sbjct  185  SAGALQGLLTNNLVALKGSCPNCGEQVFAFVKTDNSIKAPHRAECHVCGCPLEYRTKVEK  244

Query  613  TSRPGQRWVYGRVY  654
            +    + WVYGRVY
Sbjct  245  SLSGPRTWVYGRVY  258



>gb|AAK73156.1|AC079022_29 unknown protein [Oryza sativa]
 gb|EEC78386.1| hypothetical protein OsI_18164 [Oryza sativa Indica Group]
 gb|EEE62073.1| hypothetical protein OsJ_16857 [Oryza sativa Japonica Group]
Length=272

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-K  609
            + GALQGL  N+ VALKG+CPNCGE+VFAFV+++ S ++PHR ECHVC   +E+RTKV K
Sbjct  183  SVGALQGLLTNNLVALKGSCPNCGEQVFAFVKTDNSIKAPHRAECHVCSCPLEYRTKVEK  242

Query  610  STSRPGQRWVYGRVY  654
            S S   + WVYGRVY
Sbjct  243  SLSGTRRTWVYGRVY  257



>ref|XP_007205750.1| hypothetical protein PRUPE_ppa010233mg [Prunus persica]
 gb|EMJ06949.1| hypothetical protein PRUPE_ppa010233mg [Prunus persica]
Length=258

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKST  615
            L+GLW+ND VALKGACPNCGEEVFAFV+SNQSN SPHR  CHVCE L+EFRTKV+ T
Sbjct  203  LEGLWRNDLVALKGACPNCGEEVFAFVKSNQSN-SPHRANCHVCECLLEFRTKVEVT  258



>ref|XP_008784599.1| PREDICTED: PGR5-like protein 1B, chloroplastic isoform X3 [Phoenix 
dactylifera]
Length=260

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  442  ALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVK  609
            ALQGLW+ND VALKG+CPNCGEEVFAFVR+ +S Q PHR ECHVCES + FRTKV+
Sbjct  199  ALQGLWRNDLVALKGSCPNCGEEVFAFVRAEKSKQQPHRAECHVCESALVFRTKVE  254



>ref|XP_004505856.1| PREDICTED: PGR5-like protein 1B, chloroplastic-like isoform X1 
[Cicer arietinum]
Length=329

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 63/118 (53%), Gaps = 47/118 (40%)
 Frame = +1

Query  442  ALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-----  606
             LQGLW+ND VALKGACPNCGEEVFAFVR +++  SPHRT+CHVCESL+EFRT V     
Sbjct  198  VLQGLWRNDLVALKGACPNCGEEVFAFVRMDRNIDSPHRTDCHVCESLLEFRTNVEFILM  257

Query  607  ------------------------------------------KSTSRPGQRWVYGRVY  654
                                                      +S SR G++WVYGR+Y
Sbjct  258  MCKPENICFSHIFLLLPKQNKTLFPPKHDPALCMTCCVINFQQSVSRFGRQWVYGRIY  315



>dbj|BAA97476.1| unnamed protein product [Arabidopsis thaliana]
Length=282

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVK  609
            L+GLW+ND  ALKG CPNCGEEVFAFVRS+QSN+S H+ +CHVCE  +EFRTKV+
Sbjct  215  LKGLWRNDLTALKGDCPNCGEEVFAFVRSDQSNRSAHKADCHVCECTLEFRTKVE  269



>ref|XP_004960526.1| PREDICTED: PGR5-like protein 1B, chloroplastic-like isoform X1 
[Setaria italica]
Length=340

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKS  612
            + GAL+GL  N+ VALKG+CPNCGE+VFAFV++++S ++PHR ECHVCE  +E+RTK++ 
Sbjct  233  SVGALRGLLSNNLVALKGSCPNCGEQVFAFVKTDKSIRAPHRAECHVCECPLEYRTKIEV  292

Query  613  TSRP  624
              RP
Sbjct  293  CQRP  296



>ref|XP_004169097.1| PREDICTED: uncharacterized protein LOC101227988 [Cucumis sativus]
Length=300

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEF  594
            + G LQGLW++D  A+KGACPNCG+EVFAFVRSN+ N SPHR +CHVCE L+EF
Sbjct  162  SVGVLQGLWRDDLDAVKGACPNCGKEVFAFVRSNRVNGSPHRQDCHVCECLLEF  215



>gb|EMT19592.1| hypothetical protein F775_16194 [Aegilops tauschii]
Length=270

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVK  609
            + GALQGL  N+ VALKG+CPNCGE+VFAFV++++S ++PH+ ECHVCE  +E+RTKV+
Sbjct  136  SVGALQGLLTNNVVALKGSCPNCGEQVFAFVKTDKSIKAPHKAECHVCECPLEYRTKVE  194



>gb|EMS54420.1| hypothetical protein TRIUR3_00721 [Triticum urartu]
Length=302

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVK  609
            + GALQGL  N+ VALKG+CPNCGE+VFAFV++++S ++PH+ ECHVCE  +E+RTKV+
Sbjct  179  SVGALQGLLTNNVVALKGSCPNCGEQVFAFVKTDKSIKAPHKAECHVCECPLEYRTKVE  237



>gb|KEH30175.1| transmembrane protein, putative [Medicago truncatula]
Length=141

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  427  FITAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECH-VCESLIEFRTK  603
            F +   LQGLW+ND V+LKGACPNCGEEVFAFVR +++  SPH+     VCE L+EFRT 
Sbjct  36   FSSVKVLQGLWRNDLVSLKGACPNCGEEVFAFVRIDRNIDSPHKQIVMCVCECLLEFRTN  95

Query  604  VK  609
            ++
Sbjct  96   ME  97



>ref|XP_001772464.1| predicted protein [Physcomitrella patens]
 gb|EDQ62746.1| predicted protein [Physcomitrella patens]
Length=240

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +1

Query  433  TAGALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSN-QSPHRTECHVCESLIEFRTKVK  609
             A  LQ L + D +ALKG CPNCG EV+ FVR N S+ +  H +ECHVC+  + F+  + 
Sbjct  151  AAKQLQALGQGDVMALKGCCPNCGAEVYTFVRPNYSSLEIRHESECHVCDRQLMFQATLH  210

Query  610  ST-SRPGQRWVYGRVY  654
             + S PGQ W +GRVY
Sbjct  211  PSWSGPGQPWAHGRVY  226



>ref|XP_001763093.1| predicted protein [Physcomitrella patens]
 gb|EDQ71970.1| predicted protein, partial [Physcomitrella patens]
Length=227

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSP-HRTECHVCESLIEFRTKV-KSTS  618
            LQ L + D VALKG CPNCGEEV+ FV+ + S+    H +ECH+CE  + F+  +  S S
Sbjct  154  LQALGRGDLVALKGCCPNCGEEVYTFVKPDHSSSKVRHESECHICERQLVFQATLHPSKS  213

Query  619  RPGQRWVYGRVY  654
              GQ W +GRVY
Sbjct  214  GLGQPWAHGRVY  225



>ref|XP_003057673.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57624.1| predicted protein [Micromonas pusilla CCMP1545]
Length=270

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +1

Query  439  GALQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPH-RTECHVCESLIEFRTKVKST  615
            G L  L   +T+A+ G CPNC E V+AF+ +N + ++   +++CHVC   + F   V+S+
Sbjct  166  GKLASLRDGNTIAMSGDCPNCAERVYAFLPANSAAKTVKLKSDCHVCGRGLTFAADVQSS  225

Query  616  -SRPGQRWVYGRVY  654
               P  +   GR+Y
Sbjct  226  KDAPYGKVASGRIY  239



>ref|XP_007016392.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY34011.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=257

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 33/70 (47%), Gaps = 32/70 (46%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKSTSRP  624
            LQ LW+ D VALKGACPNCGEE                                +S SR 
Sbjct  208  LQRLWRKDLVALKGACPNCGEE--------------------------------QSVSRV  235

Query  625  GQRWVYGRVY  654
            G+RWVYGRVY
Sbjct  236  GRRWVYGRVY  245



>ref|XP_002501860.1| hypothetical protein MICPUN_58040 [Micromonas sp. RCC299]
 gb|ACO63118.1| hypothetical protein MICPUN_58040 [Micromonas sp. RCC299]
Length=346

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +1

Query  445  LQGLWKNDTVALKGACPNCGEEVFAFVRSNQSNQSPHRTECHVCESLIEFRTKV-KSTSR  621
            L  L   +TVA+KG CP+C EEV+AF+  N++       ECHVCE  + FR +V KS + 
Sbjct  240  LGRLRDGNTVAVKGECPSCAEEVYAFLPGNRAVARVE-CECHVCERRLAFRVEVAKSENA  298

Query  622  PGQRWVYGRVY  654
              +R   GR+Y
Sbjct  299  KWRRVATGRIY  309



>ref|XP_007149519.1| hypothetical protein PHAVU_005G077000g [Phaseolus vulgaris]
 gb|ESW21513.1| hypothetical protein PHAVU_005G077000g [Phaseolus vulgaris]
Length=121

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +1

Query  508  EVFAFVRSNQSNQSPHRTECHVCESLIEFRTKVKSTSRPGQRWVY  642
            +V AFVR+++ N SPHR +CHVC+ L+ F TK + +   G  W Y
Sbjct  18   KVLAFVRTDKGNNSPHRADCHVCKCLLGFHTKAEQSDLMG-LWAY  61



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2145275583018